BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13135_g1_i2 len=2110 path=[1:0-578 @580@!:579-1053 1055:1054-2109]

Length=2110
                                                                      Score     E

ref|XP_011095920.1|  PREDICTED: microtubule-associated protein 70...    565   0.0      
ref|XP_011095917.1|  PREDICTED: microtubule-associated protein 70...    565   0.0      
ref|XP_006352452.1|  PREDICTED: microtubule-associated protein 70...    558   0.0      
ref|XP_004250289.1|  PREDICTED: microtubule-associated protein 70...    553   0.0      
ref|XP_009591783.1|  PREDICTED: microtubule-associated protein 70...    550   0.0      
ref|XP_010312762.1|  PREDICTED: microtubule-associated protein 70...    550   0.0      
ref|XP_009591784.1|  PREDICTED: microtubule-associated protein 70...    546   0.0      
ref|XP_007026344.1|  Microtubule-associated proteins 70-5 isoform 1     543   0.0      
ref|XP_009796359.1|  PREDICTED: microtubule-associated protein 70...    538   1e-180   
ref|XP_009795884.1|  PREDICTED: microtubule-associated protein 70...    536   3e-180   
ref|XP_009613310.1|  PREDICTED: microtubule-associated protein 70...    533   5e-179   
ref|XP_002267938.1|  PREDICTED: microtubule-associated protein 70-5     527   1e-175   Vitis vinifera
ref|XP_009334569.1|  PREDICTED: microtubule-associated protein 70...    525   4e-175   
ref|XP_009333931.1|  PREDICTED: microtubule-associated protein 70...    524   1e-174   
emb|CBI25752.3|  unnamed protein product                                521   3e-174   
ref|XP_011004522.1|  PREDICTED: microtubule-associated protein 70-5     521   9e-174   
gb|EYU27662.1|  hypothetical protein MIMGU_mgv1a021959mg                520   7e-173   
ref|XP_002307909.1|  hypothetical protein POPTR_0006s01900g             517   9e-173   Populus trichocarpa [western balsam poplar]
ref|XP_008370982.1|  PREDICTED: microtubule-associated protein 70-5     515   3e-171   
ref|XP_004236657.1|  PREDICTED: microtubule-associated protein 70...    505   1e-168   
gb|KHG05064.1|  Microtubule-associated protein 70-5                     508   3e-168   
ref|XP_010057808.1|  PREDICTED: microtubule-associated protein 70...    502   5e-166   
ref|XP_002323125.2|  hypothetical protein POPTR_0016s00870g             500   2e-165   Populus trichocarpa [western balsam poplar]
ref|XP_010057809.1|  PREDICTED: microtubule-associated protein 70...    500   3e-165   
ref|XP_006467285.1|  PREDICTED: microtubule-associated protein 70...    499   6e-165   
ref|XP_006449918.1|  hypothetical protein CICLE_v10014697mg             499   1e-164   
gb|KHG14722.1|  Microtubule-associated 70-5 -like protein               494   2e-163   
ref|XP_006467284.1|  PREDICTED: microtubule-associated protein 70...    493   2e-162   
ref|XP_006449917.1|  hypothetical protein CICLE_v10014697mg             493   3e-162   
ref|XP_011040173.1|  PREDICTED: microtubule-associated protein 70...    486   6e-160   
ref|XP_010270218.1|  PREDICTED: microtubule-associated protein 70...    485   2e-159   
ref|XP_004295329.1|  PREDICTED: microtubule-associated protein 70...    480   4e-158   
gb|KDP32904.1|  hypothetical protein JCGZ_13685                         479   8e-158   
ref|XP_007147624.1|  hypothetical protein PHAVU_006G140300g             480   1e-157   
ref|XP_008224620.1|  PREDICTED: microtubule-associated protein 70-5     476   4e-156   
gb|KGN49039.1|  hypothetical protein Csa_6G511060                       476   4e-156   
ref|XP_002522887.1|  Myosin heavy chain, clone, putative                471   8e-155   Ricinus communis
ref|XP_007212811.1|  hypothetical protein PRUPE_ppa002850mg             474   1e-154   
ref|XP_006597612.1|  PREDICTED: microtubule-associated protein 70-5     470   9e-154   
ref|XP_004134988.1|  PREDICTED: microtubule-associated protein 70...    465   1e-152   
ref|XP_004168631.1|  PREDICTED: microtubule-associated protein 70...    465   1e-152   
ref|XP_006586778.1|  PREDICTED: microtubule-associated protein 70...    466   3e-152   
emb|CAN63131.1|  hypothetical protein VITISV_001458                     466   1e-151   Vitis vinifera
ref|XP_010686630.1|  PREDICTED: microtubule-associated protein 70-5     459   6e-150   
ref|XP_006584097.1|  PREDICTED: microtubule-associated protein 70...    459   2e-149   
ref|XP_006584096.1|  PREDICTED: microtubule-associated protein 70...    459   4e-149   
ref|XP_004486342.1|  PREDICTED: microtubule-associated protein 70...    454   1e-147   
ref|XP_004507603.1|  PREDICTED: microtubule-associated protein 70...    450   6e-146   
ref|XP_007154039.1|  hypothetical protein PHAVU_003G086000g             449   1e-145   
ref|XP_006600289.1|  PREDICTED: microtubule-associated protein 70...    446   1e-144   
gb|KHN03540.1|  Microtubule-associated protein 70-5                     446   3e-144   
gb|KEH36973.1|  myosin II heavy chain family protein                    442   3e-143   
ref|XP_010087647.1|  hypothetical protein L484_010598                   439   3e-142   
ref|XP_006283554.1|  hypothetical protein CARUB_v10004607mg             436   3e-141   
ref|XP_002868078.1|  atmap70-5                                          431   2e-139   
ref|XP_003610594.1|  hypothetical protein MTR_4g133890                  431   9e-139   
gb|KEH32682.1|  myosin II heavy chain family protein                    431   3e-138   
ref|XP_010440039.1|  PREDICTED: microtubule-associated protein 70-5     427   7e-138   
ref|XP_006856278.1|  hypothetical protein AMTR_s00047p00081310          429   1e-137   
gb|KFK32193.1|  hypothetical protein AALP_AA6G209500                    426   2e-137   
ref|NP_193455.2|  microtubule-associated protein 70-5                   426   3e-137   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010434704.1|  PREDICTED: microtubule-associated protein 70...    423   2e-136   
ref|XP_009144675.1|  PREDICTED: microtubule-associated protein 70...    424   2e-136   
ref|XP_010449651.1|  PREDICTED: microtubule-associated protein 70...    421   1e-135   
ref|XP_010538455.1|  PREDICTED: microtubule-associated protein 70-5     421   2e-135   
ref|XP_006414258.1|  hypothetical protein EUTSA_v10024950mg             419   7e-135   
emb|CDY35590.1|  BnaC01g21120D                                          416   2e-133   
gb|KHN40802.1|  Microtubule-associated protein 70-5                     412   9e-132   
ref|XP_006350273.1|  PREDICTED: microtubule-associated protein 70...    405   9e-131   
emb|CDY42967.1|  BnaA01g17870D                                          407   2e-130   
ref|XP_008441104.1|  PREDICTED: microtubule-associated protein 70...    406   5e-130   
emb|CAB78725.1|  putative protein                                       404   4e-129   Arabidopsis thaliana [mouse-ear cress]
emb|CAB10503.1|  myosin II heavy chain like protein                     405   7e-129   Arabidopsis thaliana [mouse-ear cress]
emb|CDX90483.1|  BnaA03g42980D                                          400   1e-127   
ref|XP_009136832.1|  PREDICTED: microtubule-associated protein 70...    397   2e-126   
gb|ACU18231.1|  unknown                                                 385   6e-124   Glycine max [soybeans]
ref|XP_006415832.1|  hypothetical protein EUTSA_v10007068mg             391   1e-122   
ref|XP_002890697.1|  At1g68060/T23K23_9                                 390   4e-122   
gb|ABD65109.1|  Myosin II heavy chain-like domain containing protein    384   2e-121   Brassica oleracea
ref|XP_007026345.1|  Microtubule-associated proteins 70-5 isoform 2     382   2e-121   
ref|NP_173873.5|  microtubule-associated protein 70-2                   388   2e-121   Arabidopsis thaliana [mouse-ear cress]
emb|CDY09638.1|  BnaC07g34230D                                          384   3e-121   
ref|XP_009411128.1|  PREDICTED: microtubule-associated protein 70-5     384   9e-121   
ref|XP_006584098.1|  PREDICTED: microtubule-associated protein 70...    381   8e-120   
ref|XP_006306974.1|  hypothetical protein CARUB_v10008549mg             384   9e-120   
ref|XP_008452405.1|  PREDICTED: microtubule-associated protein 70-1     382   4e-119   
gb|KFK44516.1|  hypothetical protein AALP_AA1G266900                    381   1e-118   
gb|KGN49724.1|  hypothetical protein Csa_5G083860                       380   2e-118   
ref|XP_004170227.1|  PREDICTED: microtubule-associated protein 70...    380   2e-118   
ref|XP_004170226.1|  PREDICTED: microtubule-associated protein 70...    380   2e-118   
ref|XP_004142301.1|  PREDICTED: LOW QUALITY PROTEIN: microtubule-...    380   2e-118   
emb|CDY36126.1|  BnaA08g19220D                                          379   6e-118   
ref|XP_006391189.1|  hypothetical protein EUTSA_v10018271mg             379   8e-118   
ref|XP_010499143.1|  PREDICTED: microtubule-associated protein 70...    379   9e-118   
emb|CDY04200.1|  BnaC06g26150D                                          378   1e-117   
emb|CDY01879.1|  BnaC06g29190D                                          378   2e-117   
ref|XP_010477983.1|  PREDICTED: microtubule-associated protein 70-2     378   2e-117   
ref|NP_001067398.1|  Os12g0640900                                       375   3e-117   Oryza sativa Japonica Group [Japonica rice]
gb|ABD65132.1|  Myosin II heavy chain-like domain containing protein    373   3e-117   Brassica oleracea
ref|XP_002525998.1|  Myosin heavy chain, clone, putative                377   3e-117   Ricinus communis
ref|XP_010319385.1|  PREDICTED: microtubule-associated protein 70-2     376   4e-117   
ref|XP_010932544.1|  PREDICTED: microtubule-associated protein 70...    375   7e-117   
ref|XP_006355060.1|  PREDICTED: microtubule-associated protein 70...    375   1e-116   
ref|XP_010932545.1|  PREDICTED: microtubule-associated protein 70...    375   1e-116   
ref|XP_010932543.1|  PREDICTED: microtubule-associated protein 70...    375   1e-116   
ref|XP_010460414.1|  PREDICTED: microtubule-associated protein 70-2     376   2e-116   
ref|XP_009105356.1|  PREDICTED: microtubule-associated protein 70-1     375   2e-116   
ref|XP_002875092.1|  atmap70-3                                          375   2e-116   
dbj|BAK06943.1|  predicted protein                                      373   3e-116   
ref|XP_010932540.1|  PREDICTED: microtubule-associated protein 70...    375   3e-116   
emb|CAJ31079.1|  70 kDa microtubule associated protein Type 2           373   5e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010531687.1|  PREDICTED: microtubule-associated protein 70...    374   5e-116   
emb|CDY27573.1|  BnaA09g28340D                                          374   7e-116   
emb|CDY07403.1|  BnaA07g24820D                                          373   7e-116   
ref|XP_006664255.1|  PREDICTED: microtubule-associated protein 70...    372   8e-116   
ref|XP_009768285.1|  PREDICTED: microtubule-associated protein 70...    373   8e-116   
ref|XP_009105067.1|  PREDICTED: microtubule-associated protein 70...    373   9e-116   
ref|NP_001170596.1|  hypothetical protein                               373   9e-116   Zea mays [maize]
ref|XP_009776285.1|  PREDICTED: microtubule-associated protein 70...    373   1e-115   
ref|XP_010513903.1|  PREDICTED: microtubule-associated protein 70...    373   1e-115   
gb|KHG19724.1|  Uncharacterized protein F383_26314                      372   2e-115   
gb|ACO87662.1|  myosin heavy chain                                      371   2e-115   Brachypodium sylvaticum
gb|EEC69752.1|  hypothetical protein OsI_39288                          369   2e-115   Oryza sativa Indica Group [Indian rice]
ref|XP_004963351.1|  PREDICTED: microtubule-associated protein 70...    375   3e-115   
ref|XP_009610620.1|  PREDICTED: microtubule-associated protein 70...    372   3e-115   
ref|XP_006292757.1|  hypothetical protein CARUB_v10019005mg             372   3e-115   
ref|XP_009113829.1|  PREDICTED: LOW QUALITY PROTEIN: microtubule-...    372   5e-115   
ref|XP_003575438.1|  PREDICTED: microtubule-associated protein 70-1     370   5e-115   
emb|CDX84971.1|  BnaC05g20840D                                          371   6e-115   
ref|XP_002438163.1|  hypothetical protein SORBIDRAFT_10g009020          370   8e-115   Sorghum bicolor [broomcorn]
emb|CDY51769.1|  BnaC05g49520D                                          370   1e-114   
ref|XP_009390353.1|  PREDICTED: microtubule-associated protein 70...    370   1e-114   
ref|XP_009109859.1|  PREDICTED: microtubule-associated protein 70...    370   1e-114   
ref|XP_009109861.1|  PREDICTED: microtubule-associated protein 70...    369   2e-114   
ref|NP_001159233.1|  hypothetical protein                               369   2e-114   Zea mays [maize]
ref|XP_010424947.1|  PREDICTED: microtubule-associated protein 70...    370   2e-114   
ref|XP_006301058.1|  hypothetical protein CARUB_v10021451mg             369   2e-114   
ref|XP_010926101.1|  PREDICTED: microtubule-associated protein 70...    370   2e-114   
ref|XP_008781372.1|  PREDICTED: microtubule-associated protein 70...    369   2e-114   
ref|XP_010513904.1|  PREDICTED: microtubule-associated protein 70...    369   3e-114   
ref|NP_001189497.1|  microtubule-associated protein 70-3                369   3e-114   
gb|KDO60764.1|  hypothetical protein CISIN_1g007087mg                   369   4e-114   
ref|XP_010916224.1|  PREDICTED: microtubule-associated protein 70...    369   4e-114   
ref|XP_010916222.1|  PREDICTED: microtubule-associated protein 70...    369   4e-114   
gb|KDP38119.1|  hypothetical protein JCGZ_04762                         369   4e-114   
ref|XP_002284904.1|  PREDICTED: microtubule-associated protein 70-2     369   5e-114   Vitis vinifera
ref|XP_006469252.1|  PREDICTED: microtubule-associated protein 70...    369   5e-114   
ref|XP_006828475.1|  hypothetical protein AMTR_s00060p00151140          369   6e-114   
ref|XP_011024158.1|  PREDICTED: microtubule-associated protein 70...    368   7e-114   
ref|XP_010043962.1|  PREDICTED: microtubule-associated protein 70-2     369   7e-114   
ref|XP_010916223.1|  PREDICTED: microtubule-associated protein 70...    368   9e-114   
emb|CDP16283.1|  unnamed protein product                                368   9e-114   
ref|XP_011027239.1|  PREDICTED: microtubule-associated protein 70...    368   1e-113   
ref|XP_003570689.1|  PREDICTED: microtubule-associated protein 70-2     367   1e-113   
gb|EMT08820.1|  hypothetical protein F775_15881                         365   2e-113   
ref|XP_010424948.1|  PREDICTED: microtubule-associated protein 70...    367   2e-113   
ref|XP_006395855.1|  hypothetical protein EUTSA_v10003816mg             367   3e-113   
ref|XP_006343174.1|  PREDICTED: microtubule-associated protein 70...    366   4e-113   
ref|XP_010273713.1|  PREDICTED: microtubule-associated protein 70...    367   4e-113   
ref|XP_006343175.1|  PREDICTED: microtubule-associated protein 70...    366   4e-113   
ref|XP_009404137.1|  PREDICTED: microtubule-associated protein 70-1     366   4e-113   
ref|XP_002311531.1|  hypothetical protein POPTR_0008s13450g             366   5e-113   Populus trichocarpa [western balsam poplar]
ref|XP_010673027.1|  PREDICTED: microtubule-associated protein 70...    365   5e-113   
ref|NP_178284.1|  microtubule-associated protein 70-3                   366   6e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009380076.1|  PREDICTED: microtubule-associated protein 70...    366   6e-113   
ref|XP_010243834.1|  PREDICTED: microtubule-associated protein 70...    365   6e-113   
ref|XP_006416965.1|  hypothetical protein EUTSA_v10007120mg             365   6e-113   
ref|XP_003553384.1|  PREDICTED: microtubule-associated protein 70...    364   7e-113   
ref|XP_008381751.1|  PREDICTED: microtubule-associated protein 70...    365   1e-112   
ref|XP_008812973.1|  PREDICTED: microtubule-associated protein 70...    365   1e-112   
ref|XP_010521011.1|  PREDICTED: microtubule-associated protein 70-2     365   1e-112   
ref|XP_007162092.1|  hypothetical protein PHAVU_001G123200g             364   1e-112   
ref|XP_010088195.1|  hypothetical protein L484_005541                   365   2e-112   
gb|AAG03117.1|AC004133_11  F5A9.19                                      365   2e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006448158.1|  hypothetical protein CICLE_v10014625mg             364   2e-112   
ref|XP_010055945.1|  PREDICTED: microtubule-associated protein 70...    363   4e-112   
ref|XP_004239261.1|  PREDICTED: microtubule-associated protein 70-1     363   4e-112   
gb|KHN21612.1|  Microtubule-associated protein 70-2                     363   6e-112   
ref|XP_008389171.1|  PREDICTED: microtubule-associated protein 70...    363   6e-112   
ref|XP_010227783.1|  PREDICTED: microtubule-associated protein 70-3     363   6e-112   
ref|XP_004510505.1|  PREDICTED: microtubule-associated protein 70...    363   7e-112   
gb|KHG10997.1|  Microtubule-associated 70-4 -like protein               363   8e-112   
gb|EPS64520.1|  hypothetical protein M569_10261                         363   8e-112   
ref|XP_003532520.1|  PREDICTED: microtubule-associated protein 70...    362   1e-111   
ref|XP_003525226.1|  PREDICTED: microtubule-associated protein 70...    362   1e-111   
ref|XP_010502169.1|  PREDICTED: microtubule-associated protein 70...    362   1e-111   
emb|CDX81676.1|  BnaC08g39250D                                          361   2e-111   
ref|NP_176973.1|  microtubule-associated protein 70-1                   362   2e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006303938.1|  hypothetical protein CARUB_v10008632mg             361   2e-111   
ref|XP_006647855.1|  PREDICTED: microtubule-associated protein 70...    361   2e-111   
ref|XP_002307974.2|  hypothetical protein POPTR_0006s03740g             362   2e-111   Populus trichocarpa [western balsam poplar]
emb|CDY45293.1|  BnaA06g09630D                                          361   3e-111   
ref|XP_004965147.1|  PREDICTED: microtubule-associated protein 70...    361   3e-111   
ref|XP_007204220.1|  hypothetical protein PRUPE_ppa003030mg             361   4e-111   
emb|CDY40783.1|  BnaAnng06460D                                          360   5e-111   
ref|XP_002887159.1|  atmap70-1                                          360   6e-111   
ref|XP_009148871.1|  PREDICTED: microtubule-associated protein 70-4     360   6e-111   
gb|EYU30134.1|  hypothetical protein MIMGU_mgv1a002946mg                360   7e-111   
ref|XP_010553646.1|  PREDICTED: microtubule-associated protein 70...    360   8e-111   
ref|XP_009101312.1|  PREDICTED: microtubule-associated protein 70...    360   1e-110   
ref|XP_009101310.1|  PREDICTED: microtubule-associated protein 70...    360   1e-110   
ref|XP_008240691.1|  PREDICTED: microtubule-associated protein 70...    359   2e-110   
ref|XP_004965146.1|  PREDICTED: microtubule-associated protein 70...    359   2e-110   
ref|XP_009117870.1|  PREDICTED: microtubule-associated protein 70...    358   2e-110   
ref|XP_004228735.1|  PREDICTED: microtubule-associated protein 70...    359   2e-110   
ref|XP_009149575.1|  PREDICTED: microtubule-associated protein 70...    358   2e-110   
ref|XP_010476557.1|  PREDICTED: microtubule-associated protein 70...    358   2e-110   
ref|XP_006364039.1|  PREDICTED: microtubule-associated protein 70...    359   3e-110   
ref|XP_010093577.1|  Microtubule-associated protein 70-2                366   4e-110   
emb|CDY33736.1|  BnaA09g45420D                                          358   4e-110   
ref|XP_009603020.1|  PREDICTED: microtubule-associated protein 70...    358   5e-110   
ref|NP_001057297.1|  Os06g0251700                                       358   6e-110   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010695899.1|  PREDICTED: microtubule-associated protein 70...    358   6e-110   
gb|EEE57764.1|  hypothetical protein OsJ_08300                          357   6e-110   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010496581.1|  PREDICTED: microtubule-associated protein 70...    357   8e-110   
ref|NP_001048050.1|  Os02g0736100                                       357   8e-110   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007028366.1|  Microtubule-associated proteins 70-2 isoform 1     357   1e-109   
ref|XP_010459001.1|  PREDICTED: microtubule-associated protein 70-4     357   1e-109   
ref|XP_009382991.1|  PREDICTED: microtubule-associated protein 70-1     357   1e-109   
gb|EMT16813.1|  hypothetical protein F775_18335                         354   2e-109   
ref|XP_004953846.1|  PREDICTED: microtubule-associated protein 70...    355   2e-109   
ref|XP_009777395.1|  PREDICTED: microtubule-associated protein 70...    356   3e-109   
ref|XP_007160432.1|  hypothetical protein PHAVU_002G321500g             356   3e-109   
gb|EEE65458.1|  hypothetical protein OsJ_20834                          355   4e-109   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008455712.1|  PREDICTED: microtubule-associated protein 70...    355   4e-109   
gb|KHN15454.1|  Microtubule-associated protein 70-2                     354   4e-109   
ref|XP_009417688.1|  PREDICTED: microtubule-associated protein 70...    356   5e-109   
ref|XP_004297434.1|  PREDICTED: microtubule-associated protein 70...    355   7e-109   
ref|XP_004144334.1|  PREDICTED: microtubule-associated protein 70...    354   9e-109   
ref|XP_003520494.1|  PREDICTED: microtubule-associated protein 70...    353   2e-108   
ref|XP_003627322.1|  microtubule associated protein Type 2              353   3e-108   
emb|CDY17639.1|  BnaA06g34580D                                          353   3e-108   
ref|XP_011075430.1|  PREDICTED: microtubule-associated protein 70...    353   3e-108   
emb|CDY36256.1|  BnaC07g21100D                                          353   4e-108   
ref|XP_009348833.1|  PREDICTED: microtubule-associated protein 70...    352   5e-108   
ref|XP_006574818.1|  PREDICTED: microtubule-associated protein 70...    352   1e-107   
ref|XP_010271765.1|  PREDICTED: microtubule-associated protein 70...    351   1e-107   
gb|KHN23795.1|  Microtubule-associated protein 70-2                     350   2e-107   
ref|XP_002323245.1|  hypothetical protein POPTR_0016s03570g             350   3e-107   Populus trichocarpa [western balsam poplar]
ref|NP_563959.1|  microtubule-associated protein 70-4                   350   3e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892833.1|  atmap70-4                                          350   3e-107   
ref|XP_006583719.1|  PREDICTED: microtubule-associated protein 70...    350   4e-107   
gb|AET05426.2|  microtubule-associated protein 70-1                     350   5e-107   
gb|KFK43754.1|  hypothetical protein AALP_AA1G168500                    350   6e-107   
ref|XP_004503349.1|  PREDICTED: microtubule-associated protein 70...    349   9e-107   
ref|XP_006343173.1|  PREDICTED: microtubule-associated protein 70...    350   1e-106   
ref|XP_008367624.1|  PREDICTED: LOW QUALITY PROTEIN: microtubule-...    347   1e-106   
ref|XP_011000423.1|  PREDICTED: microtubule-associated protein 70...    348   1e-106   
gb|EMS51736.1|  hypothetical protein TRIUR3_31011                       348   2e-106   
ref|XP_004503348.1|  PREDICTED: microtubule-associated protein 70...    348   3e-106   
ref|XP_010270219.1|  PREDICTED: microtubule-associated protein 70...    344   3e-106   
ref|XP_010554403.1|  PREDICTED: microtubule-associated protein 70...    348   4e-106   
ref|XP_006355767.1|  PREDICTED: microtubule-associated protein 70...    347   5e-106   
ref|XP_006832841.1|  hypothetical protein AMTR_s00095p00043050          347   6e-106   
ref|XP_009103049.1|  PREDICTED: microtubule-associated protein 70...    347   9e-106   
ref|XP_002271629.1|  PREDICTED: microtubule-associated protein 70-2     346   1e-105   Vitis vinifera
ref|XP_008775595.1|  PREDICTED: microtubule-associated protein 70...    346   2e-105   
ref|XP_008643807.1|  PREDICTED: LOC100285189 isoform X1                 345   3e-105   
ref|XP_002454321.1|  hypothetical protein SORBIDRAFT_04g028640          343   1e-104   Sorghum bicolor [broomcorn]
ref|XP_008785643.1|  PREDICTED: microtubule-associated protein 70...    345   1e-104   
gb|EMT03977.1|  hypothetical protein F775_09563                         348   2e-104   
emb|CDY03865.1|  BnaC07g10900D                                          343   3e-104   
ref|NP_001151555.1|  LOC100285189                                       342   4e-104   Zea mays [maize]
ref|XP_003630950.1|  microtubule associated protein Type 2              342   7e-104   
ref|XP_010936411.1|  PREDICTED: microtubule-associated protein 70...    341   1e-103   
ref|XP_010939241.1|  PREDICTED: microtubule-associated protein 70...    342   2e-103   
gb|ACL53445.1|  unknown                                                 339   4e-103   Zea mays [maize]
ref|XP_008790325.1|  PREDICTED: microtubule-associated protein 70...    339   7e-103   
ref|XP_004157994.1|  PREDICTED: microtubule-associated protein 70...    336   5e-102   
gb|KHN08880.1|  Microtubule-associated protein 70-1                     334   2e-101   
ref|XP_010914823.1|  PREDICTED: microtubule-associated protein 70...    327   1e-98    
ref|XP_009599321.1|  PREDICTED: microtubule-associated protein 70...    325   2e-98    
ref|XP_001758096.1|  predicted protein                                  325   2e-98    
gb|EMS60299.1|  hypothetical protein TRIUR3_07011                       331   6e-98    
ref|XP_007028367.1|  Microtubule-associated proteins 70-2 isoform 2     323   1e-97    
ref|XP_001771313.1|  predicted protein                                  325   2e-97    
gb|KDO60765.1|  hypothetical protein CISIN_1g007087mg                   321   1e-96    
ref|XP_002980874.1|  hypothetical protein SELMODRAFT_113465             320   3e-96    
gb|AAO72686.1|  putative myosin heavy chain                             315   1e-95    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002961395.1|  hypothetical protein SELMODRAFT_77018              318   3e-95    
ref|XP_011021765.1|  PREDICTED: microtubule-associated protein 70...    317   1e-94    
ref|XP_010554399.1|  PREDICTED: microtubule-associated protein 70...    313   5e-94    
ref|XP_010554402.1|  PREDICTED: microtubule-associated protein 70...    312   6e-94    
gb|KHG20171.1|  Microtubule-associated 70-4 -like protein               316   6e-94    
ref|XP_010554401.1|  PREDICTED: microtubule-associated protein 70...    312   7e-94    
ref|XP_010554396.1|  PREDICTED: microtubule-associated protein 70...    312   1e-93    
ref|XP_010271362.1|  PREDICTED: microtubule-associated protein 70...    316   1e-93    
ref|XP_010554397.1|  PREDICTED: microtubule-associated protein 70...    311   1e-93    
ref|XP_010554398.1|  PREDICTED: microtubule-associated protein 70...    311   1e-93    
ref|XP_011070564.1|  PREDICTED: microtubule-associated protein 70-2     315   1e-93    
ref|XP_010551223.1|  PREDICTED: microtubule-associated protein 70-2     313   6e-93    
gb|KHG17924.1|  Uncharacterized protein F383_01609                      313   9e-93    
ref|XP_006840410.1|  hypothetical protein AMTR_s00045p00152960          312   2e-92    
ref|XP_008221360.1|  PREDICTED: microtubule-associated protein 70...    310   3e-92    
ref|XP_001777884.1|  predicted protein                                  310   4e-92    
ref|NP_001184996.1|  microtubule-associated protein 70-4                310   5e-92    
ref|XP_007222004.1|  hypothetical protein PRUPE_ppa002899mg             310   6e-92    
tpg|DAA44092.1|  TPA: ATMAP70-2                                         307   6e-92    
ref|XP_006655970.1|  PREDICTED: microtubule-associated protein 70...    310   7e-92    
ref|XP_006655969.1|  PREDICTED: microtubule-associated protein 70...    310   7e-92    
ref|NP_001151609.1|  ATMAP70-2                                          306   2e-91    
ref|NP_001049378.1|  Os03g0215700                                       305   5e-91    
ref|XP_010271766.1|  PREDICTED: microtubule-associated protein 70...    305   5e-91    
ref|XP_006649637.1|  PREDICTED: microtubule-associated protein 70...    304   6e-91    
gb|KEH40631.1|  microtubule-associated protein 70-1                     307   6e-91    
gb|EEC74762.1|  hypothetical protein OsI_10528                          303   2e-90    
ref|XP_003558494.1|  PREDICTED: microtubule-associated protein 70...    303   3e-90    
ref|XP_002522178.1|  conserved hypothetical protein                     302   4e-90    
ref|XP_010939242.1|  PREDICTED: microtubule-associated protein 70...    304   9e-90    
ref|XP_004985186.1|  PREDICTED: microtubule-associated protein 70...    300   3e-89    
dbj|BAK04836.1|  predicted protein                                      300   4e-89    
ref|XP_004498246.1|  PREDICTED: microtubule-associated protein 70...    301   2e-88    
ref|XP_008341650.1|  PREDICTED: microtubule-associated protein 70...    300   2e-88    
emb|CAN80140.1|  hypothetical protein VITISV_038977                     299   3e-87    
ref|XP_002468275.1|  hypothetical protein SORBIDRAFT_01g042820          293   1e-86    
emb|CDP04519.1|  unnamed protein product                                287   4e-86    
ref|XP_009383720.1|  PREDICTED: microtubule-associated protein 70...    291   6e-85    
ref|XP_008775179.1|  PREDICTED: microtubule-associated protein 70...    283   7e-83    
gb|KGN54710.1|  hypothetical protein Csa_4G431900                       272   9e-81    
gb|EMT11914.1|  hypothetical protein F775_14888                         279   1e-80    
gb|EMS61205.1|  hypothetical protein TRIUR3_10457                       279   4e-80    
emb|CDP09571.1|  unnamed protein product                                268   8e-79    
emb|CDP04518.1|  unnamed protein product                                261   2e-78    
gb|KHN30360.1|  Microtubule-associated protein 70-2                     273   4e-78    
gb|EMT03038.1|  hypothetical protein F775_20637                         258   9e-74    
gb|EYU18624.1|  hypothetical protein MIMGU_mgv1a0077761mg               251   3e-72    
ref|XP_008675942.1|  PREDICTED: LOW QUALITY PROTEIN: microtubule-...    244   2e-69    
gb|KHG05065.1|  Microtubule-associated protein 70-4                     237   3e-69    
gb|EPS68244.1|  hypothetical protein M569_06527                         235   5e-67    
tpg|DAA54806.1|  TPA: hypothetical protein ZEAMMB73_048261              228   7e-64    
tpg|DAA54805.1|  TPA: hypothetical protein ZEAMMB73_048261              228   1e-63    
ref|XP_006448157.1|  hypothetical protein CICLE_v10014625mg             229   1e-62    
gb|EPS60605.1|  hypothetical protein M569_14198                         216   2e-60    
ref|XP_002890335.1|  hypothetical protein ARALYDRAFT_472169             210   2e-55    
gb|AAL11578.1|AF424584_1  At1g14840/F10B6_9                             205   2e-55    
ref|XP_001782825.1|  predicted protein                                  196   2e-53    
gb|KHM98977.1|  Microtubule-associated protein 70-2                     190   2e-49    
ref|XP_008664436.1|  PREDICTED: microtubule-associated protein 70...    160   2e-41    
gb|AFK46003.1|  unknown                                                 146   1e-34    
ref|XP_007134754.1|  hypothetical protein PHAVU_010G073000g             105   1e-21    
ref|XP_009131080.1|  PREDICTED: microtubule-associated protein 70...  98.2    1e-20    
ref|XP_007148872.1|  hypothetical protein PHAVU_005G021300g           89.0    1e-16    
gb|KDP29253.1|  hypothetical protein JCGZ_16642                       86.3    4e-15    
emb|CDP09572.1|  unnamed protein product                              85.5    8e-15    
emb|CDY24415.1|  BnaCnng04820D                                        83.2    4e-14    
gb|KGN54709.1|  hypothetical protein Csa_4G431890                     75.5    1e-11    
ref|XP_001755413.1|  predicted protein                                77.4    2e-11    
ref|XP_002315855.1|  hypothetical protein POPTR_0010s11640g           76.6    3e-11    
ref|XP_007045277.1|  Microtubule-associated proteins 70-2 isoform 3   75.5    6e-11    
ref|XP_007045275.1|  Microtubule-associated proteins 70-2 isoform 1   75.5    8e-11    
ref|XP_007045279.1|  Microtubule-associated proteins 70-2 isoform 5   75.1    8e-11    
ref|XP_007045276.1|  Microtubule-associated proteins 70-2 isoform 2   75.1    9e-11    
ref|XP_007153235.1|  hypothetical protein PHAVU_003G018100g           70.9    2e-09    
ref|XP_010265412.1|  PREDICTED: uncharacterized protein LOC104603...  65.5    5e-08    
ref|XP_010265411.1|  PREDICTED: uncharacterized protein LOC104603...  65.1    5e-08    
ref|XP_010265410.1|  PREDICTED: uncharacterized protein LOC104603...  65.1    6e-08    
ref|XP_001755305.1|  predicted protein                                60.8    3e-07    
ref|XP_003630952.1|  Pentatricopeptide repeat-containing protein      58.2    3e-05    
ref|XP_010232962.1|  PREDICTED: replication protein A 70 kDa DNA-...  55.5    7e-05    
emb|CDX84402.1|  BnaC03g50980D                                        49.7    5e-04    
emb|CDX95377.1|  BnaC04g27810D                                        49.7    5e-04    



>ref|XP_011095920.1| PREDICTED: microtubule-associated protein 70-5 isoform X2 [Sesamum 
indicum]
Length=565

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/564 (69%), Positives = 441/564 (78%), Gaps = 44/564 (8%)
 Frame = -3

Query  2015  GYEEVGVAELCLL-HTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEE  1839
             G EE+   ++ L+ H DP +LEL  LQNQLKEKERELG AQSE + LRATE LKDKALEE
Sbjct  3     GIEELVGEDISLVSHPDPVVLELNRLQNQLKEKERELGKAQSEIRALRATEVLKDKALEE  62

Query  1838  LGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSI  1659
             LG+EVKRLE KL+ SEN +EQKNL+ KKL +EKKEAL AQYAAEA LRRVYA QK+DDS+
Sbjct  63    LGSEVKRLEGKLRSSENHIEQKNLDIKKLTDEKKEALAAQYAAEATLRRVYANQKDDDSV  122

Query  1658  PIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEE  1479
             PIE VIAPLEAE+KM+KNEIAALQEDKRA+ER  KSKEAALLEAERIL+SALER LIVEE
Sbjct  123   PIELVIAPLEAELKMHKNEIAALQEDKRALERLTKSKEAALLEAERILRSALERALIVEE  182

Query  1478  VQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDY  1299
             VQNQNFELRRQIEICQEENKILDKTNRQKVLEVE+LSQTI ELEEAILAGGAAANTIRDY
Sbjct  183   VQNQNFELRRQIEICQEENKILDKTNRQKVLEVEKLSQTIKELEEAILAGGAAANTIRDY  242

Query  1298  rrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEM  1119
             RRQISE+ EE+RTLERELARVKVSANR+AT+VANEWKDE DKVMPVKQWLEERR+LQAEM
Sbjct  243   RRQISELNEEKRTLERELARVKVSANRIATVVANEWKDEKDKVMPVKQWLEERRMLQAEM  302

Query  1118  QRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHL  939
             Q+LKDKLAISER AKAEAQ+K+KLKLRLKTLE+GLK   + +VN    +G  K EK+N+ 
Sbjct  303   QKLKDKLAISERAAKAEAQVKEKLKLRLKTLEEGLKHVHSLSVNT---NGSPKNEKSNNF  359

Query  938   FGILSS----KKRSASQPRAS--------MVNTTseqesssensgEYNDQKKRHHG----  807
             FGILSS    KKRS SQPR S        M++      ++ E     N +KK   G    
Sbjct  360   FGILSSNTRMKKRSTSQPRPSTITRSSMQMMDEKQISSATEEIKLINNLKKKNSSGESLL  419

Query  806   ---LWYSRNKI---DEKENAGMKENS---DKL-----TDSGNFSKND--------EDMVS  693
                LW SRNK+    EKENA M +N+   DK+         N  K D        EDMVS
Sbjct  420   KKSLWASRNKVIDNSEKENAEMNKNAMVDDKMGKIKGITGSNEEKKDLELVINDCEDMVS  479

Query  692   GFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIR  513
             GFLYDRLQKEVI++RK  D+K++ LN+KDEEIKML KKIETLT+A+EVES+K KREAAIR
Sbjct  480   GFLYDRLQKEVISLRKFCDLKDSTLNSKDEEIKMLMKKIETLTRAMEVESKKMKREAAIR  539

Query  512   EKDSSTIKYKYDGNIRQTNSSLKS  441
             EKDS+    K D  IR TNSS +S
Sbjct  540   EKDSAL--TKVDEKIRSTNSSKRS  561



>ref|XP_011095917.1| PREDICTED: microtubule-associated protein 70-5 isoform X1 [Sesamum 
indicum]
 ref|XP_011095919.1| PREDICTED: microtubule-associated protein 70-5 isoform X1 [Sesamum 
indicum]
Length=585

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/565 (69%), Positives = 442/565 (78%), Gaps = 44/565 (8%)
 Frame = -3

Query  2015  GYEEVGVAELCLL-HTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEE  1839
             G EE+   ++ L+ H DP +LEL  LQNQLKEKERELG AQSE + LRATE LKDKALEE
Sbjct  3     GIEELVGEDISLVSHPDPVVLELNRLQNQLKEKERELGKAQSEIRALRATEVLKDKALEE  62

Query  1838  LGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSI  1659
             LG+EVKRLE KL+ SEN +EQKNL+ KKL +EKKEAL AQYAAEA LRRVYA QK+DDS+
Sbjct  63    LGSEVKRLEGKLRSSENHIEQKNLDIKKLTDEKKEALAAQYAAEATLRRVYANQKDDDSV  122

Query  1658  PIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEE  1479
             PIE VIAPLEAE+KM+KNEIAALQEDKRA+ER  KSKEAALLEAERIL+SALER LIVEE
Sbjct  123   PIELVIAPLEAELKMHKNEIAALQEDKRALERLTKSKEAALLEAERILRSALERALIVEE  182

Query  1478  VQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDY  1299
             VQNQNFELRRQIEICQEENKILDKTNRQKVLEVE+LSQTI ELEEAILAGGAAANTIRDY
Sbjct  183   VQNQNFELRRQIEICQEENKILDKTNRQKVLEVEKLSQTIKELEEAILAGGAAANTIRDY  242

Query  1298  rrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEM  1119
             RRQISE+ EE+RTLERELARVKVSANR+AT+VANEWKDE DKVMPVKQWLEERR+LQAEM
Sbjct  243   RRQISELNEEKRTLERELARVKVSANRIATVVANEWKDEKDKVMPVKQWLEERRMLQAEM  302

Query  1118  QRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHL  939
             Q+LKDKLAISER AKAEAQ+K+KLKLRLKTLE+GLK   + +VN    +G  K EK+N+ 
Sbjct  303   QKLKDKLAISERAAKAEAQVKEKLKLRLKTLEEGLKHVHSLSVNT---NGSPKNEKSNNF  359

Query  938   FGILSS----KKRSASQPRAS--------MVNTTseqesssensgEYNDQKKRHHG----  807
             FGILSS    KKRS SQPR S        M++      ++ E     N +KK   G    
Sbjct  360   FGILSSNTRMKKRSTSQPRPSTITRSSMQMMDEKQISSATEEIKLINNLKKKNSSGESLL  419

Query  806   ---LWYSRNKI---DEKENAGMKENS---DKL-----TDSGNFSKND--------EDMVS  693
                LW SRNK+    EKENA M +N+   DK+         N  K D        EDMVS
Sbjct  420   KKSLWASRNKVIDNSEKENAEMNKNAMVDDKMGKIKGITGSNEEKKDLELVINDCEDMVS  479

Query  692   GFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIR  513
             GFLYDRLQKEVI++RK  D+K++ LN+KDEEIKML KKIETLT+A+EVES+K KREAAIR
Sbjct  480   GFLYDRLQKEVISLRKFCDLKDSTLNSKDEEIKMLMKKIETLTRAMEVESKKMKREAAIR  539

Query  512   EKDSSTIKYKYDGNIRQTNSSLKSS  438
             EKDS+    K D  IR TNSS +S+
Sbjct  540   EKDSAL--TKVDEKIRSTNSSKRSA  562



>ref|XP_006352452.1| PREDICTED: microtubule-associated protein 70-5-like [Solanum 
tuberosum]
Length=558

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/560 (68%), Positives = 435/560 (78%), Gaps = 37/560 (7%)
 Frame = -3

Query  2015  GYEEVGVAELCL-LHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEE  1839
             G+ E G     +  HTD  I EL SL NQLKEK+RELG AQSE K L+AT+ LKDKALEE
Sbjct  3     GFNEFGDEHYFVGHHTDAVIFELNSLHNQLKEKDRELGAAQSEIKALKATDTLKDKALEE  62

Query  1838  LGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSI  1659
             LG+ V+RLEEK+KISENL+EQKNL+   L NEKKEAL AQYAAE+ LRRVYA+QK+ DS 
Sbjct  63    LGSNVQRLEEKMKISENLLEQKNLDINNLSNEKKEALAAQYAAESTLRRVYADQKDHDSP  122

Query  1658  PIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEE  1479
             PIES+IAPLEAEIKMYKNEIAALQED RA+ER NKSKEAALLEAERILKSALER LIVEE
Sbjct  123   PIESIIAPLEAEIKMYKNEIAALQEDTRALERQNKSKEAALLEAERILKSALERALIVEE  182

Query  1478  VQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDY  1299
             VQN NFELRRQIEICQEE+KILDKTNRQK+LEVERL+QTI ELEEAILAGGAAAN IRD 
Sbjct  183   VQNHNFELRRQIEICQEEHKILDKTNRQKILEVERLTQTIKELEEAILAGGAAANKIRDC  242

Query  1298  rrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEM  1119
             +RQISE+QEE+RTLERELAR+K+SANRVAT+VANEWKDENDKVMPVKQWLEER++LQAEM
Sbjct  243   QRQISELQEEKRTLERELARLKISANRVATVVANEWKDENDKVMPVKQWLEERKLLQAEM  302

Query  1118  QRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHL  939
             QRL++KL ISERTAKAEAQ+KDKLKLRL+TLE+GLKQ  + +V P   +G  KP+K NHL
Sbjct  303   QRLRNKLVISERTAKAEAQIKDKLKLRLRTLEEGLKQVTSVSVIP---NGSPKPQKTNHL  359

Query  938   FGILSS----KKRSASQPRASMVNTTseqesssensgEYNDQKKRHH----GLWYSRNKI  783
             F +LSS    K+RS SQPRAS +N    +    + S ++N +          LW SRNK+
Sbjct  360   FSLLSSNAGLKRRSTSQPRASTIN-KRSENRRDDASKQFNKEGSGDSLVKKSLWASRNKV  418

Query  782   DEKENAGMKENSD------KLTD----------------SGNFSKNDEDMVSGFLYDRLQ  669
              EKENA +KENS+      ++TD                +G+   ND DMVSG LYD LQ
Sbjct  419   AEKENAEIKENSNGHIYSKEMTDKQNIKNRVGDHEDNKNTGSNESNDNDMVSGLLYDMLQ  478

Query  668   KEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIK  489
             KEV+ +RK  + KE+ LN KDEEIKML KKIETL KAIEVESRK KRE+AIREKDS +  
Sbjct  479   KEVLCLRKFCETKESALNAKDEEIKMLMKKIETLIKAIEVESRKMKRESAIREKDSVS-S  537

Query  488   YKYDGNIRQTNSSLKSSIKV  429
              K D N R  N SL  SI+V
Sbjct  538   TKTDDNARSRN-SLTRSIRV  556



>ref|XP_004250289.1| PREDICTED: microtubule-associated protein 70-5-like isoform X2 
[Solanum lycopersicum]
Length=560

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/549 (68%), Positives = 431/549 (79%), Gaps = 42/549 (8%)
 Frame = -3

Query  1976  HTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKLKI  1797
             H+D  I EL SLQNQLKEK+RELG AQSE K L+AT+ LKDKALEELG++V++LEEK+KI
Sbjct  18    HSDVVIFELNSLQNQLKEKDRELGAAQSEIKALKATDTLKDKALEELGSKVQKLEEKMKI  77

Query  1796  SENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEIK  1617
             SENL+EQKNL+ K L NEKKEAL AQYAAE+ LRRVYA+QK+DDS PIES+IAPLEA+IK
Sbjct  78    SENLLEQKNLDIKNLSNEKKEALAAQYAAESTLRRVYADQKDDDSPPIESIIAPLEADIK  137

Query  1616  MYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIEI  1437
             MYKNEIAALQED RA+ER NKSKEAALLEAERILKSALER LIVEEVQN NFELRRQIEI
Sbjct  138   MYKNEIAALQEDIRALERQNKSKEAALLEAERILKSALERALIVEEVQNHNFELRRQIEI  197

Query  1436  CQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeerrtl  1257
             CQEE KILDKTNRQK+LEVERL+QTI ELEE ILAGGAAAN IRD +RQISE+QEE+RTL
Sbjct  198   CQEEYKILDKTNRQKILEVERLTQTIKELEETILAGGAAANKIRDCQRQISELQEEKRTL  257

Query  1256  erelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTA  1077
             ERELAR+K+SANRVAT+VANEWKDENDKVMPVKQWLEER++LQAEMQRL++KL  SERTA
Sbjct  258   ERELARLKISANRVATVVANEWKDENDKVMPVKQWLEERKLLQAEMQRLRNKLVKSERTA  317

Query  1076  KAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILSS----KKRS  909
             KAEAQ+KDKLKLRL+TLE+GLKQ+ +  V P   +G  KP+K NHLF ILSS    KKRS
Sbjct  318   KAEAQIKDKLKLRLRTLEEGLKQSTSVFVTP---NGSPKPQKTNHLFSILSSNAGLKKRS  374

Query  908   ASQPRASMVNTTseqesssensgEYNDQKKRHHG-------LWYSRNKIDEKENAGMKEN  750
              SQPRAS +N +    S +     +    K+  G       LW  RNK  EKENA +KEN
Sbjct  375   TSQPRASTINRS----SENRRDDAWKQFNKKGSGDSLVKKSLWAYRNKDAEKENAEIKEN  430

Query  749   SD------KLTD----------------SGNFSKNDEDMVSGFLYDRLQKEVINMRKCFD  636
             S+      ++TD                +G+   ND DMVSG LYD LQKEV+ +RK  +
Sbjct  431   SNGHIYSKEMTDTQKIKNRVGDHEDNKNTGSNESNDNDMVSGLLYDMLQKEVLCLRKFCE  490

Query  635   MKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQTN  456
              KE+ LN KDEEIKML KKI+TL KAIEVESRK KRE+AIRE+DS +   K D N+R  N
Sbjct  491   TKESALNAKDEEIKMLMKKIDTLNKAIEVESRKMKRESAIRERDSVS-SIKTDDNVRSRN  549

Query  455   SSLKSSIKV  429
              SL SS++V
Sbjct  550   -SLTSSVRV  557



>ref|XP_009591783.1| PREDICTED: microtubule-associated protein 70-5-like isoform X1 
[Nicotiana tomentosiformis]
Length=567

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/571 (67%), Positives = 439/571 (77%), Gaps = 49/571 (9%)
 Frame = -3

Query  2018  AGYEEVGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEE  1839
             AG++EVG  E   L  DP I EL SL NQLKEK+RELG AQSE K L+ T+ LKD ALEE
Sbjct  2     AGFDEVGGGEEHFL--DPVIFELNSLHNQLKEKKRELGAAQSEIKALKTTDVLKDMALEE  59

Query  1838  LGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSI  1659
             LG++V+RLEEKLKI+ENL+EQKNL+ K L NEKKEAL AQYAAEA LRRVYA+QK+DDS 
Sbjct  60    LGSKVQRLEEKLKINENLLEQKNLDIKNLSNEKKEALAAQYAAEATLRRVYADQKDDDSP  119

Query  1658  PIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEE  1479
             PIES++APLEAEIKMYK EIAALQED RA+ERH KSKEAAL+EAERILKSALER LIVEE
Sbjct  120   PIESIVAPLEAEIKMYKYEIAALQEDIRALERHTKSKEAALIEAERILKSALERALIVEE  179

Query  1478  VQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDY  1299
             VQNQNFELRRQIEICQEE+KILDK+NRQK+LEVE+L+QTI ELEEAILAGGAAAN IRD 
Sbjct  180   VQNQNFELRRQIEICQEEHKILDKSNRQKILEVEKLTQTIKELEEAILAGGAAANKIRDC  239

Query  1298  rrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEM  1119
             +RQISE+QEE+RTLERELAR+K+SANRVA++VANEWKDENDKVMPVKQWLEERR+LQAEM
Sbjct  240   QRQISELQEEKRTLERELARLKISANRVASVVANEWKDENDKVMPVKQWLEERRLLQAEM  299

Query  1118  QRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHL  939
             QRL+DKL ISERTAKAEAQ+KDKLKLRLKTLE GLK T + +  P   +G  K  K +HL
Sbjct  300   QRLRDKLTISERTAKAEAQIKDKLKLRLKTLEDGLKPTASVSAIP---NGSLKTRKTDHL  356

Query  938   FGILSS----KKRSASQPRASMVNTTseqesssensgEYNDQKKRHH-----------GL  804
             F ILSS    KKRS SQPRAS +N TSEQ+S  +     + + ++ +            L
Sbjct  357   FSILSSNAGLKKRSTSQPRASTINKTSEQQSLEKIKYYASIETRKFNKEAFGDSFLKKSL  416

Query  803   WYSRNKI---DEKENAGMKEN------SDKLT-----------------DSGNFSKNDED  702
             W SRNK+    EKEN  ++EN      S ++T                 +SG+   ND D
Sbjct  417   WASRNKVVNSAEKENGELRENFNGHIYSKEMTETQKIKNRAGEEIENNKNSGSSESNDND  476

Query  701   MVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREA  522
             MVSGFLYDRLQKEV+ +RK  + KE+ LN KDEEIK+L KKIETL KAIEVE RK KREA
Sbjct  477   MVSGFLYDRLQKEVLCLRKFCETKESALNAKDEEIKILMKKIETLNKAIEVECRKMKREA  536

Query  521   AIREKDSSTIKYKYDGNIRQTNSSLKSSIKV  429
             AIREKDS  +  K D N R  N SL SSI V
Sbjct  537   AIREKDS--VSTKPDDNTRSRN-SLTSSIGV  564



>ref|XP_010312762.1| PREDICTED: microtubule-associated protein 70-5-like isoform X1 
[Solanum lycopersicum]
Length=570

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/544 (68%), Positives = 427/544 (78%), Gaps = 41/544 (8%)
 Frame = -3

Query  1976  HTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKLKI  1797
             H+D  I EL SLQNQLKEK+RELG AQSE K L+AT+ LKDKALEELG++V++LEEK+KI
Sbjct  18    HSDVVIFELNSLQNQLKEKDRELGAAQSEIKALKATDTLKDKALEELGSKVQKLEEKMKI  77

Query  1796  SENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEIK  1617
             SENL+EQKNL+ K L NEKKEAL AQYAAE+ LRRVYA+QK+DDS PIES+IAPLEA+IK
Sbjct  78    SENLLEQKNLDIKNLSNEKKEALAAQYAAESTLRRVYADQKDDDSPPIESIIAPLEADIK  137

Query  1616  MYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIEI  1437
             MYKNEIAALQED RA+ER NKSKEAALLEAERILKSALER LIVEEVQN NFELRRQIEI
Sbjct  138   MYKNEIAALQEDIRALERQNKSKEAALLEAERILKSALERALIVEEVQNHNFELRRQIEI  197

Query  1436  CQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeerrtl  1257
             CQEE KILDKTNRQK+LEVERL+QTI ELEE ILAGGAAAN IRD +RQISE+QEE+RTL
Sbjct  198   CQEEYKILDKTNRQKILEVERLTQTIKELEETILAGGAAANKIRDCQRQISELQEEKRTL  257

Query  1256  erelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTA  1077
             ERELAR+K+SANRVAT+VANEWKDENDKVMPVKQWLEER++LQAEMQRL++KL  SERTA
Sbjct  258   ERELARLKISANRVATVVANEWKDENDKVMPVKQWLEERKLLQAEMQRLRNKLVKSERTA  317

Query  1076  KAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILSS----KKRS  909
             KAEAQ+KDKLKLRL+TLE+GLKQ+ +  V P   +G  KP+K NHLF ILSS    KKRS
Sbjct  318   KAEAQIKDKLKLRLRTLEEGLKQSTSVFVTP---NGSPKPQKTNHLFSILSSNAGLKKRS  374

Query  908   ASQPRASMVNTTseqesssensgEYNDQKKRHHG-------LWYSRNKIDEKENAGMKEN  750
              SQPRAS +N +    S +     +    K+  G       LW  RNK  EKENA +KEN
Sbjct  375   TSQPRASTINRS----SENRRDDAWKQFNKKGSGDSLVKKSLWAYRNKDAEKENAEIKEN  430

Query  749   SD------KLTD----------------SGNFSKNDEDMVSGFLYDRLQKEVINMRKCFD  636
             S+      ++TD                +G+   ND DMVSG LYD LQKEV+ +RK  +
Sbjct  431   SNGHIYSKEMTDTQKIKNRVGDHEDNKNTGSNESNDNDMVSGLLYDMLQKEVLCLRKFCE  490

Query  635   MKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQTN  456
              KE+ LN KDEEIKML KKI+TL KAIEVESRK KRE+AIRE+DS +   K D N+RQ  
Sbjct  491   TKESALNAKDEEIKMLMKKIDTLNKAIEVESRKMKRESAIRERDSVS-SIKTDDNLRQGQ  549

Query  455   SSLK  444
             + LK
Sbjct  550   NILK  553



>ref|XP_009591784.1| PREDICTED: microtubule-associated protein 70-5-like isoform X2 
[Nicotiana tomentosiformis]
Length=561

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/563 (67%), Positives = 434/563 (77%), Gaps = 48/563 (9%)
 Frame = -3

Query  2018  AGYEEVGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEE  1839
             AG++EVG  E   L  DP I EL SL NQLKEK+RELG AQSE K L+ T+ LKD ALEE
Sbjct  2     AGFDEVGGGEEHFL--DPVIFELNSLHNQLKEKKRELGAAQSEIKALKTTDVLKDMALEE  59

Query  1838  LGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSI  1659
             LG++V+RLEEKLKI+ENL+EQKNL+ K L NEKKEAL AQYAAEA LRRVYA+QK+DDS 
Sbjct  60    LGSKVQRLEEKLKINENLLEQKNLDIKNLSNEKKEALAAQYAAEATLRRVYADQKDDDSP  119

Query  1658  PIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEE  1479
             PIES++APLEAEIKMYK EIAALQED RA+ERH KSKEAAL+EAERILKSALER LIVEE
Sbjct  120   PIESIVAPLEAEIKMYKYEIAALQEDIRALERHTKSKEAALIEAERILKSALERALIVEE  179

Query  1478  VQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDY  1299
             VQNQNFELRRQIEICQEE+KILDK+NRQK+LEVE+L+QTI ELEEAILAGGAAAN IRD 
Sbjct  180   VQNQNFELRRQIEICQEEHKILDKSNRQKILEVEKLTQTIKELEEAILAGGAAANKIRDC  239

Query  1298  rrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEM  1119
             +RQISE+QEE+RTLERELAR+K+SANRVA++VANEWKDENDKVMPVKQWLEERR+LQAEM
Sbjct  240   QRQISELQEEKRTLERELARLKISANRVASVVANEWKDENDKVMPVKQWLEERRLLQAEM  299

Query  1118  QRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHL  939
             QRL+DKL ISERTAKAEAQ+KDKLKLRLKTLE GLK T + +  P   +G  K  K +HL
Sbjct  300   QRLRDKLTISERTAKAEAQIKDKLKLRLKTLEDGLKPTASVSAIP---NGSLKTRKTDHL  356

Query  938   FGILSS----KKRSASQPRASMVNTTseqesssensgEYNDQKKRHH-----------GL  804
             F ILSS    KKRS SQPRAS +N TSEQ+S  +     + + ++ +            L
Sbjct  357   FSILSSNAGLKKRSTSQPRASTINKTSEQQSLEKIKYYASIETRKFNKEAFGDSFLKKSL  416

Query  803   WYSRNKI---DEKENAGMKEN------SDKLT-----------------DSGNFSKNDED  702
             W SRNK+    EKEN  ++EN      S ++T                 +SG+   ND D
Sbjct  417   WASRNKVVNSAEKENGELRENFNGHIYSKEMTETQKIKNRAGEEIENNKNSGSSESNDND  476

Query  701   MVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREA  522
             MVSGFLYDRLQKEV+ +RK  + KE+ LN KDEEIK+L KKIETL KAIEVE RK KREA
Sbjct  477   MVSGFLYDRLQKEVLCLRKFCETKESALNAKDEEIKILMKKIETLNKAIEVECRKMKREA  536

Query  521   AIREKDSSTIKYKYDGNIRQTNS  453
             AIREKDS  +  K D N R  NS
Sbjct  537   AIREKDS--VSTKPDDNTRSRNS  557



>ref|XP_007026344.1| Microtubule-associated proteins 70-5 isoform 1 [Theobroma cacao]
 gb|EOY28966.1| Microtubule-associated proteins 70-5 isoform 1 [Theobroma cacao]
Length=580

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/571 (63%), Positives = 427/571 (75%), Gaps = 49/571 (9%)
 Frame = -3

Query  2015  GYEEV-GVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEE  1839
             G++E+ G  EL L H DP +LELT LQNQLKEK+RELG AQ+E K LRATE LKDKA+EE
Sbjct  3     GHDELLGGEELSLAHPDPVVLELTRLQNQLKEKDRELGAAQAEIKALRATETLKDKAIEE  62

Query  1838  LGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDS-  1662
             L  EV +L+EK +++ENL++ KNLE KKL NEKKEAL AQ+AAEA LRRV+A QK+DD  
Sbjct  63    LQGEVHKLDEKHRVTENLLQHKNLEIKKLTNEKKEALAAQFAAEATLRRVHANQKDDDDD  122

Query  1661  IPIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVE  1482
             +PIESVIAP EAEIKMYKNE+A LQEDKRA+ER  KSKE+ALLEAERIL+SALER LIVE
Sbjct  123   VPIESVIAPFEAEIKMYKNEVALLQEDKRALERLTKSKESALLEAERILRSALERALIVE  182

Query  1481  EVQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRD  1302
             EVQNQNFELRRQIEICQEENKIL+KTNRQKVLEVE+LSQTI ELEEAILAGGAAAN+IRD
Sbjct  183   EVQNQNFELRRQIEICQEENKILEKTNRQKVLEVEKLSQTIQELEEAILAGGAAANSIRD  242

Query  1301  YrrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAE  1122
             Y+R+ISE+ EE+RTL+RELARVKVSANRVAT+VANEWKDENDKVMPVKQWLE+RR+LQAE
Sbjct  243   YQRRISELHEEKRTLDRELARVKVSANRVATVVANEWKDENDKVMPVKQWLEDRRLLQAE  302

Query  1121  MQRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANH  942
             MQRLKDKLA+SERTAKAEAQLK+K KLRLK LE GLK   + + NP    G  KPEK+++
Sbjct  303   MQRLKDKLAVSERTAKAEAQLKEKFKLRLKILEDGLKHVSSFSGNPNASCGSPKPEKSSN  362

Query  941   LFGILSS----KKRSASQPRASMVNTTseqesssensgEYND----------QKKRHHG-  807
             + G L+S    +KRS SQPR S ++ TS  +  S  +   N           +KK   G 
Sbjct  363   ILGFLTSSGGLRKRSTSQPRGSTISRTSILQRPSVETETANANNGLRQVSNLKKKGASGE  422

Query  806   ------LWYSRNKI---DEKENAGMKENSD-----------------------KLTDSGN  723
                   LW SR K+    EKEN  MK N+D                       +  + GN
Sbjct  423   NMLRKNLWTSRCKVADSSEKENTAMKVNTDINISKDGDTTGSAGIKNKECCNEETENRGN  482

Query  722   FSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVES  543
                N ED VSGFLYDRLQKEVIN+RKC + K++ LN+KDEEIKML KK+E  +KA+EVES
Sbjct  483   ADCNVEDTVSGFLYDRLQKEVINLRKCCEAKDSSLNSKDEEIKMLMKKVEAFSKAMEVES  542

Query  542   RKTKREAAIREKDSSTIKYKYDGNIRQTNSS  450
             ++ KREA  +EK++ + K      +R  NSS
Sbjct  543   KRLKREAVAKEKENGSAKMDDSKKLRNINSS  573



>ref|XP_009796359.1| PREDICTED: microtubule-associated protein 70-5-like [Nicotiana 
sylvestris]
Length=547

 Score =   538 bits (1386),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 368/546 (67%), Positives = 428/546 (78%), Gaps = 45/546 (8%)
 Frame = -3

Query  2018  AGYEEVGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEE  1839
             AG++EVG  E   L  DP I EL SL NQLKEK+RELG AQSE K L+AT+ LKDKALEE
Sbjct  2     AGFDEVGGGEEYFL--DPLIFELNSLHNQLKEKKRELGAAQSEIKALKATDVLKDKALEE  59

Query  1838  LGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSI  1659
             LG+EV+RLEEKLKI+ENL+EQKNL+ K L NEKKEAL AQYAAEA LRRVYA+QK+DDS 
Sbjct  60    LGSEVQRLEEKLKINENLLEQKNLDIKNLTNEKKEALAAQYAAEATLRRVYADQKDDDSP  119

Query  1658  PIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEE  1479
             PIES++APLEAEIKMYK EIAALQE+ RA+ERH KSKEAALLEAERILKSALER L+VEE
Sbjct  120   PIESIVAPLEAEIKMYKYEIAALQENIRALERHTKSKEAALLEAERILKSALERALLVEE  179

Query  1478  VQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDY  1299
             +QNQNFELRRQIEICQEE+KILDK+NRQK+LEVE+L+QTI ELEEAILAGGAAAN IRD 
Sbjct  180   IQNQNFELRRQIEICQEEHKILDKSNRQKILEVEKLTQTIKELEEAILAGGAAANKIRDC  239

Query  1298  rrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEM  1119
             +RQISE+QEE+RTLERELAR+K+SAN+VA++VANEWKDEN KVMPVKQWLEER++LQAEM
Sbjct  240   QRQISELQEEKRTLERELARLKISANKVASVVANEWKDENHKVMPVKQWLEERKLLQAEM  299

Query  1118  QRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHL  939
             QRL+DKL ISERTAKAEAQ+KDKLKLRLKTLE+ LK T + +V   V +G  K +K NHL
Sbjct  300   QRLRDKLTISERTAKAEAQIKDKLKLRLKTLEESLKPTASVSV---VTNGSPKTQKTNHL  356

Query  938   FGILSS----KKRSASQPRASMVNTTseqesssensgEYNDQKKRHH-----------GL  804
             F ILSS    KKRS SQPRAS +N TSEQ+S  +     + + ++ +            +
Sbjct  357   FSILSSNAGLKKRSTSQPRASTINKTSEQQSLEKRRYYASIETRKLNKEASGDSFLKKSI  416

Query  803   WYSRNKI---DEKENAGMKENSDKLT----------------------DSGNFSKNDEDM  699
             W SRNK+    EKENA +KENS+                         +SG+   ND DM
Sbjct  417   WASRNKVVDSAEKENAEIKENSNGHIYSKQMPETQKIKNRAGDIEENRNSGSSESNDNDM  476

Query  698   VSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAA  519
             VSGFLYDRLQKEV+ +RK  + KE+ LN KDEEIK+L KKIETL KAIEVE RK KREAA
Sbjct  477   VSGFLYDRLQKEVLCLRKFCETKESALNAKDEEIKILMKKIETLNKAIEVECRKMKREAA  536

Query  518   IREKDS  501
             IRE+ S
Sbjct  537   IRERFS  542



>ref|XP_009795884.1| PREDICTED: microtubule-associated protein 70-5-like [Nicotiana 
sylvestris]
Length=529

 Score =   536 bits (1382),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 362/522 (69%), Positives = 424/522 (81%), Gaps = 26/522 (5%)
 Frame = -3

Query  2018  AGYEEVGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEE  1839
             +G  E+G+ E  L H DP ILE+ +LQNQLKEK+RELG AQSE K L+ATE LKDKALEE
Sbjct  2     SGIYELGIEEFFLAHPDPVILEINNLQNQLKEKDRELGAAQSEIKALKATEVLKDKALEE  61

Query  1838  LGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSI  1659
             LGNE +RLE KLKI+E L+EQKNL+ K+L NEKKEAL AQYAAEA LRRVYA+QK+DD+ 
Sbjct  62    LGNEFQRLEGKLKINEMLLEQKNLDIKRLANEKKEALAAQYAAEATLRRVYADQKDDDAP  121

Query  1658  PIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEE  1479
             P+ES+IAPLEAEIKMYKNEIAALQEDKR+++RH KSKEAALLEAE ILKSALER LIVEE
Sbjct  122   PLESIIAPLEAEIKMYKNEIAALQEDKRSLDRHTKSKEAALLEAEMILKSALERALIVEE  181

Query  1478  VQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDY  1299
             +QNQNFELRRQIEI QEE KILDKTNRQK+LEVE+LSQTI+ELEEAILAGGAAAN +RDY
Sbjct  182   IQNQNFELRRQIEIFQEETKILDKTNRQKILEVEKLSQTIIELEEAILAGGAAANRLRDY  241

Query  1298  rrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEM  1119
             +RQISE+QEE+RTLERELARVKVSANRVAT+VANEWKDENDKVMPVKQWLEERR+LQAEM
Sbjct  242   KRQISELQEEKRTLERELARVKVSANRVATVVANEWKDENDKVMPVKQWLEERRLLQAEM  301

Query  1118  QRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHL  939
             QRLKDKL ISERTAKAEAQLKDKLKLRLKTLE+GLKQ  N +VNP    G +K +K  H 
Sbjct  302   QRLKDKLTISERTAKAEAQLKDKLKLRLKTLEEGLKQAFNVSVNPNRNHGSTKIQKTKHF  361

Query  938   FGILSS----KKRSASQPRASMVNTTseqesssensgEYNDQKKRHHG-----LWYSRNK  786
             FG+LS+    KKRS SQPR S ++  ++QE++ + S + + + K+  G     LW SR+K
Sbjct  362   FGVLSNNTGVKKRSTSQPRVSTISRITKQENTDQRSDDTSGEMKQVIGLKKKSLWDSRDK  421

Query  785   IDE---KENAGMKE----NSDKLTDSGN----------FSKNDEDMVSGFLYDRLQKEVI  657
               E   KENA M      ++ K+ + G+             +++D+VSGFLYDRLQKEVI
Sbjct  422   NVESVGKENAEMNSKEITHTQKIKNPGDDEEENKTSRSMESDNDDIVSGFLYDRLQKEVI  481

Query  656   NMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTK  531
              +RK  + K + LNTKDEEIKMLTKKIETL+KAIEVE+RK K
Sbjct  482   CLRKFCETKVSALNTKDEEIKMLTKKIETLSKAIEVEARKRK  523



>ref|XP_009613310.1| PREDICTED: microtubule-associated protein 70-5-like [Nicotiana 
tomentosiformis]
Length=529

 Score =   533 bits (1374),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 361/522 (69%), Positives = 422/522 (81%), Gaps = 26/522 (5%)
 Frame = -3

Query  2018  AGYEEVGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEE  1839
             +G  E+G+ E  L H DP ILEL +LQNQLKEK+REL  +QSE K L+ATE LKDKA+EE
Sbjct  2     SGIYELGIEEFFLAHPDPVILELNNLQNQLKEKDRELVASQSEIKALKATEVLKDKAVEE  61

Query  1838  LGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSI  1659
             LGNE +RLE KLKISE L++QKNL+ K+L NEKKEAL AQYAAEA LRRVYA+QK+DDS 
Sbjct  62    LGNEFQRLEGKLKISETLLDQKNLDIKRLANEKKEALAAQYAAEATLRRVYADQKDDDSP  121

Query  1658  PIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEE  1479
             P+ES+IAPLEAEIKMYKNEIAALQEDKRA++RH KSKE ALLEAE ILKSALER LIVEE
Sbjct  122   PLESIIAPLEAEIKMYKNEIAALQEDKRALDRHTKSKEEALLEAEMILKSALERALIVEE  181

Query  1478  VQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDY  1299
             +QNQNFELRRQIEI QEE KILDKTNRQK+LEVE+LSQTI+ELEEAILAGGAAAN +RDY
Sbjct  182   IQNQNFELRRQIEIFQEETKILDKTNRQKILEVEKLSQTIIELEEAILAGGAAANRLRDY  241

Query  1298  rrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEM  1119
             +RQISE QEE+RTLERELARVKVSANRVAT+VANEWKDENDKVMPVKQWLEERR+LQAEM
Sbjct  242   KRQISEFQEEKRTLERELARVKVSANRVATVVANEWKDENDKVMPVKQWLEERRLLQAEM  301

Query  1118  QRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHL  939
             QRLKDKL IS+RTAKAEAQLKDKLKLRLKTLE+GLKQ  N +VNP    G +K +K  H 
Sbjct  302   QRLKDKLTISKRTAKAEAQLKDKLKLRLKTLEEGLKQALNVSVNPNRNHGSTKIQKTKHF  361

Query  938   FGILSS----KKRSASQPRASMVNTTseqesssensgEYNDQKK-----RHHGLWYSRNK  786
             FG+LSS    KKRS SQPR S ++  ++QE++ + S + + + K     +   LW SR+K
Sbjct  362   FGVLSSNTGIKKRSTSQPRVSTISRNTKQENTDQRSDDASGEMKQVISLKKKTLWDSRDK  421

Query  785   -IDE--KENAGMKE----NSDKLTDSGN----------FSKNDEDMVSGFLYDRLQKEVI  657
              +D   KENA M      ++ K+ + G+             +++D+VSGFLYDRLQKEVI
Sbjct  422   NVDNVGKENAEMNSKEITHAQKIKNPGDDKEENKTGRSMESDNDDIVSGFLYDRLQKEVI  481

Query  656   NMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTK  531
              +RK  + KE+ LNTKDEEIKMLTKKIETL+KAIEVE+RK K
Sbjct  482   CLRKFCETKESALNTKDEEIKMLTKKIETLSKAIEVEARKRK  523



>ref|XP_002267938.1| PREDICTED: microtubule-associated protein 70-5 [Vitis vinifera]
Length=584

 Score =   527 bits (1357),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 355/565 (63%), Positives = 419/565 (74%), Gaps = 48/565 (8%)
 Frame = -3

Query  2000  GVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVK  1821
             G  EL L H+DP +LE   LQNQLKEK+RELGVA SE K LRAT  LKDKALE+  NEV 
Sbjct  11    GGDELSLAHSDPIVLEFNRLQNQLKEKDRELGVASSEIKALRATIVLKDKALEQFRNEVN  70

Query  1820  RLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVI  1641
             +L+E+L + ENL++QK+LE KKL +EKK+AL AQ+AAEAALRRV+A QK+DD++PIE VI
Sbjct  71    KLDERLGVIENLLKQKDLEIKKLTSEKKDALAAQFAAEAALRRVHANQKDDDTVPIEDVI  130

Query  1640  APLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNF  1461
             APLEA+IKMYK EI  LQED +A+ERH KSKE+ALLEAERIL+SALER LIVEEVQNQNF
Sbjct  131   APLEADIKMYKIEIGRLQEDNKALERHIKSKESALLEAERILRSALERALIVEEVQNQNF  190

Query  1460  ELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqise  1281
             EL+RQIEICQEENKILDKTNRQKVLEVE+LSQTI ELEEAILAGG AAN IRDYRRQISE
Sbjct  191   ELKRQIEICQEENKILDKTNRQKVLEVEKLSQTIQELEEAILAGGVAANAIRDYRRQISE  250

Query  1280  iqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDK  1101
             + EE+RTLERELARVKVSANRVAT+VANEWKDENDKVMP+KQWLEERR+LQAE QRL+DK
Sbjct  251   LNEEKRTLERELARVKVSANRVATVVANEWKDENDKVMPIKQWLEERRLLQAETQRLRDK  310

Query  1100  LAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILSS  921
             LAISERTAKAEAQLKDKLKLRLKTLE+GLKQ  + + NP +     KPEK+NH+ G LS 
Sbjct  311   LAISERTAKAEAQLKDKLKLRLKTLEEGLKQVSSFSENPYLSCRSPKPEKSNHILGFLSG  370

Query  920   ----KKRSASQPRASMVNTTs---------eqesssensgEYNDQKKRH--------HGL  804
                 K+RS SQPR S +  TS             ++      N  KK++          L
Sbjct  371   NGGLKRRSTSQPRGSCIGKTSPLMPPNVENGAADAAGELKGVNSLKKKYASGENMLRKSL  430

Query  803   WYSRNKIDE---KENAGMKENSDKLTDS------------------------GNFSKNDE  705
             W SR+K+ +   KEN  MK N+D   D                         G+   + E
Sbjct  431   WASRSKVADIGGKENTEMKSNTDMHIDKFNNDTAVSADAKIKGGAKEETQNVGSAGFDSE  490

Query  704   DMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKRE  525
             DMVS FLYDRLQ+EVIN+RK  ++K N L  KD+EIKML +K++ L+KAIEVES+K KRE
Sbjct  491   DMVSAFLYDRLQREVINLRKSCEVKNNTLTAKDDEIKMLMRKVDALSKAIEVESKKIKRE  550

Query  524   AAIREKDSSTIKYKYDGNIRQTNSS  450
             AA REK++ + K   +  IR T+SS
Sbjct  551   AAAREKEAISTKADENKKIRNTDSS  575



>ref|XP_009334569.1| PREDICTED: microtubule-associated protein 70-5 isoform X2 [Pyrus 
x bretschneideri]
Length=580

 Score =   525 bits (1352),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 351/581 (60%), Positives = 436/581 (75%), Gaps = 51/581 (9%)
 Frame = -3

Query  2018  AGYEE----VGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDK  1851
             AGY+E    VG  EL L+H DP +LEL  + N LKEK RELG+A  E K LRATE  KDK
Sbjct  2     AGYDEEQLGVGGDELSLVHPDPVVLELNRMHNLLKEKSRELGIAHGEIKALRATEVQKDK  61

Query  1850  ALEELGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKE  1671
             A EEL NEV++L+EK +++E+L++ KNLE KKLI+EK++AL AQYAAE+ LRRV+A +++
Sbjct  62    AAEELRNEVQKLDEKHRVTESLLQHKNLEIKKLIDEKRDALAAQYAAESTLRRVHANRRD  121

Query  1670  DDSIPIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVL  1491
             D+S+P+ES IAPLEAEIKMYKN+IAALQEDK+A+ER  K+KE+ALLEAERIL+SALER L
Sbjct  122   DESLPLESFIAPLEAEIKMYKNQIAALQEDKKALERLTKTKESALLEAERILQSALERAL  181

Query  1490  IVEEVQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANT  1311
             IVEEVQNQNFELRRQIEICQEEN+IL+KTNRQKVLEVE+LSQTI ELEEA+LAGGAAAN 
Sbjct  182   IVEEVQNQNFELRRQIEICQEENRILEKTNRQKVLEVEKLSQTIQELEEAVLAGGAAANA  241

Query  1310  IRDYrrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRIL  1131
             IRDY+RQ  E+ EE+RTLERELAR+KVSANRVAT++ANEWKD+NDKVMPVKQWLEERR++
Sbjct  242   IRDYQRQAEELHEEKRTLERELARIKVSANRVATVIANEWKDDNDKVMPVKQWLEERRLM  301

Query  1130  QAEMQRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEK  951
             Q EMQRL+DKLAIS+RTAKAEAQLK+K+KLRLKTLE+GLK   + + NP +  G  KPEK
Sbjct  302   QGEMQRLRDKLAISDRTAKAEAQLKEKMKLRLKTLEEGLKHVSSFSCNPNLFCGSPKPEK  361

Query  950   ANHLFGILS----SKKRSASQPRASMVNTTseqesssensgEYNDQK-----KRHHG---  807
             +++  G L+    S KRS SQPR S V+ +S Q     ++      K     ++ +G   
Sbjct  362   SSNFLGFLTSNGGSAKRSTSQPRGSTVSRSSPQRQPHSDNETAGGLKRATSFRKKYGSGE  421

Query  806   ------LWYSRNKI---DEKENAGMKENSD---------------KLTDSGN------FS  717
                   LW SR+K+    EKEN  MKEN++               K  D GN       S
Sbjct  422   NMLKKSLWASRSKVVDSGEKENTEMKENTNTDTENNNDKTAAADIKAADGGNEDSHNKIS  481

Query  716   KN--DEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVES  543
              N   EDMVSGFLYDRLQKEV+N+RK  + KE+D+N KDEEIKML KK++ LTKA++VE 
Sbjct  482   TNPESEDMVSGFLYDRLQKEVLNLRKHCEAKESDMNAKDEEIKMLMKKVDALTKAMDVEF  541

Query  542   RKTKREAAIREKDSSTIKYKYDGNIRQTNSSLKSSIKVAKT  420
             +K KREA  R+K+++  KY  D N +  N++  SS +VAK 
Sbjct  542   KKMKREAVARDKETAAAKY-MDENKKSRNTN--SSKRVAKA  579



>ref|XP_009333931.1| PREDICTED: microtubule-associated protein 70-5 isoform X1 [Pyrus 
x bretschneideri]
Length=585

 Score =   524 bits (1349),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 350/573 (61%), Positives = 431/573 (75%), Gaps = 51/573 (9%)
 Frame = -3

Query  2018  AGYEE----VGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDK  1851
             AGY+E    VG  EL L+H DP +LEL  + N LKEK RELG+A  E K LRATE  KDK
Sbjct  2     AGYDEEQLGVGGDELSLVHPDPVVLELNRMHNLLKEKSRELGIAHGEIKALRATEVQKDK  61

Query  1850  ALEELGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKE  1671
             A EEL NEV++L+EK +++E+L++ KNLE KKLI+EK++AL AQYAAE+ LRRV+A +++
Sbjct  62    AAEELRNEVQKLDEKHRVTESLLQHKNLEIKKLIDEKRDALAAQYAAESTLRRVHANRRD  121

Query  1670  DDSIPIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVL  1491
             D+S+P+ES IAPLEAEIKMYKN+IAALQEDK+A+ER  K+KE+ALLEAERIL+SALER L
Sbjct  122   DESLPLESFIAPLEAEIKMYKNQIAALQEDKKALERLTKTKESALLEAERILQSALERAL  181

Query  1490  IVEEVQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANT  1311
             IVEEVQNQNFELRRQIEICQEEN+IL+KTNRQKVLEVE+LSQTI ELEEA+LAGGAAAN 
Sbjct  182   IVEEVQNQNFELRRQIEICQEENRILEKTNRQKVLEVEKLSQTIQELEEAVLAGGAAANA  241

Query  1310  IRDYrrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRIL  1131
             IRDY+RQ  E+ EE+RTLERELAR+KVSANRVAT++ANEWKD+NDKVMPVKQWLEERR++
Sbjct  242   IRDYQRQAEELHEEKRTLERELARIKVSANRVATVIANEWKDDNDKVMPVKQWLEERRLM  301

Query  1130  QAEMQRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEK  951
             Q EMQRL+DKLAIS+RTAKAEAQLK+K+KLRLKTLE+GLK   + + NP +  G  KPEK
Sbjct  302   QGEMQRLRDKLAISDRTAKAEAQLKEKMKLRLKTLEEGLKHVSSFSCNPNLFCGSPKPEK  361

Query  950   ANHLFGILS----SKKRSASQPRASMVNTTseqesssensgEYNDQK-----KRHHG---  807
             +++  G L+    S KRS SQPR S V+ +S Q     ++      K     ++ +G   
Sbjct  362   SSNFLGFLTSNGGSAKRSTSQPRGSTVSRSSPQRQPHSDNETAGGLKRATSFRKKYGSGE  421

Query  806   ------LWYSRNKI---DEKENAGMKENSD---------------KLTDSGN------FS  717
                   LW SR+K+    EKEN  MKEN++               K  D GN       S
Sbjct  422   NMLKKSLWASRSKVVDSGEKENTEMKENTNTDTENNNDKTAAADIKAADGGNEDSHNKIS  481

Query  716   KN--DEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVES  543
              N   EDMVSGFLYDRLQKEV+N+RK  + KE+D+N KDEEIKML KK++ LTKA++VE 
Sbjct  482   TNPESEDMVSGFLYDRLQKEVLNLRKHCEAKESDMNAKDEEIKMLMKKVDALTKAMDVEF  541

Query  542   RKTKREAAIREKDSSTIKYKYDGN--IRQTNSS  450
             +K KREA  R+K+++  KY  D N   R TNSS
Sbjct  542   KKMKREAVARDKETAAAKY-MDENKKSRNTNSS  573



>emb|CBI25752.3| unnamed protein product [Vitis vinifera]
Length=535

 Score =   521 bits (1343),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 345/521 (66%), Positives = 408/521 (78%), Gaps = 9/521 (2%)
 Frame = -3

Query  2000  GVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVK  1821
             G  EL L H+DP +LE   LQNQLKEK+RELGVA SE K LRAT  LKDKALE+  NEV 
Sbjct  11    GGDELSLAHSDPIVLEFNRLQNQLKEKDRELGVASSEIKALRATIVLKDKALEQFRNEVN  70

Query  1820  RLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVI  1641
             +L+E+L + ENL++QK+LE KKL +EKK+AL AQ+AAEAALRRV+A QK+DD++PIE VI
Sbjct  71    KLDERLGVIENLLKQKDLEIKKLTSEKKDALAAQFAAEAALRRVHANQKDDDTVPIEDVI  130

Query  1640  APLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNF  1461
             APLEA+IKMYK EI  LQED +A+ERH KSKE+ALLEAERIL+SALER LIVEEVQNQNF
Sbjct  131   APLEADIKMYKIEIGRLQEDNKALERHIKSKESALLEAERILRSALERALIVEEVQNQNF  190

Query  1460  ELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqise  1281
             EL+RQIEICQEENKILDKTNRQKVLEVE+LSQTI ELEEAILAGG AAN IRDYRRQISE
Sbjct  191   ELKRQIEICQEENKILDKTNRQKVLEVEKLSQTIQELEEAILAGGVAANAIRDYRRQISE  250

Query  1280  iqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDK  1101
             + EE+RTLERELARVKVSANRVAT+VANEWKDENDKVMP+KQWLEERR+LQAE QRL+DK
Sbjct  251   LNEEKRTLERELARVKVSANRVATVVANEWKDENDKVMPIKQWLEERRLLQAETQRLRDK  310

Query  1100  LAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILSS  921
             LAISERTAKAEAQLKDKLKLRLKTLE+GLKQ  + + NP +     KPEK+NH+ G LS 
Sbjct  311   LAISERTAKAEAQLKDKLKLRLKTLEEGLKQVSSFSENPYLSCRSPKPEKSNHILGFLSG  370

Query  920   ----KKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKENAGMKE  753
                 K+RS SQPR S +  TS     +  +G  +       G     N + +K  +G   
Sbjct  371   NGGLKRRSTSQPRGSCIGKTSPLMPPNVENGAAD-----AAGELKGVNSLKKKYASGENM  425

Query  752   NSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIE  573
                K  + G+   + EDMVS FLYDRLQ+EVIN+RK  ++K N L  KD+EIKML +K++
Sbjct  426   LRKKTQNVGSAGFDSEDMVSAFLYDRLQREVINLRKSCEVKNNTLTAKDDEIKMLMRKVD  485

Query  572   TLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQTNSS  450
              L+KAIEVES+K KREAA REK++ + K   +  IR T+SS
Sbjct  486   ALSKAIEVESKKIKREAAAREKEAISTKADENKKIRNTDSS  526



>ref|XP_011004522.1| PREDICTED: microtubule-associated protein 70-5 [Populus euphratica]
Length=576

 Score =   521 bits (1343),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 353/554 (64%), Positives = 411/554 (74%), Gaps = 49/554 (9%)
 Frame = -3

Query  2003  VGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEV  1824
             VG  +L L + DP +LEL  LQN LKEK RELG AQ E K LRATE LKDKA+EE  N V
Sbjct  14    VGSEDLSLSYPDPIVLELNRLQNLLKEKGRELGAAQGEIKALRATEALKDKAIEEFRNGV  73

Query  1823  KRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESV  1644
              +LEEKL + ENLVE KNLE KK+ +EKK+AL AQYAAEA LRRV+A QK+DDS PIESV
Sbjct  74    GKLEEKLGVMENLVESKNLEIKKITDEKKDALAAQYAAEATLRRVHANQKDDDSPPIESV  133

Query  1643  IAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQN  1464
             IAPLEAEIKMYKNEIAALQEDK+AMER  KSKE+ALLEAE IL+SALER LIVEEVQNQN
Sbjct  134   IAPLEAEIKMYKNEIAALQEDKKAMERLTKSKESALLEAEGILRSALERALIVEEVQNQN  193

Query  1463  FELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqis  1284
             +EL+RQIEICQEEN+IL+KTNRQKVLEVE+LSQTI ELEEAILA GAAANTIRDYRRQIS
Sbjct  194   YELKRQIEICQEENRILEKTNRQKVLEVEKLSQTIHELEEAILAAGAAANTIRDYRRQIS  253

Query  1283  eiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKD  1104
             E+ EE+R LERELAR +VSANRVAT+VANEWKDENDKVMPVKQWLEERR+LQAEMQRLKD
Sbjct  254   ELNEEKRILERELARARVSANRVATVVANEWKDENDKVMPVKQWLEERRLLQAEMQRLKD  313

Query  1103  KLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILS  924
             KLAISERTA AEAQLK+KLKLRLKTLE+GL+   + +VNP    G  KP K +++ G L+
Sbjct  314   KLAISERTANAEAQLKEKLKLRLKTLEEGLQHVQSFSVNPNASCGSPKPGKTSNILGFLT  373

Query  923   S----KKRSASQPRASMVNTTseqesssensgEYN--------DQKKR---------HHG  807
             S    +KRSASQPR S ++ +S  +  +      N        D  K+           G
Sbjct  374   SNGGIRKRSASQPRGSTISISSPFQQPNIEIENANAAGIQNRADSFKKKSGSGENPLRKG  433

Query  806   LWYSRNKI---DEKENAGMKENSDKLTD-------------------------SGNFSKN  711
             +W SR+K+     KENA +K N+D   D                          G    +
Sbjct  434   MWVSRSKVVDSGGKENAEVKTNTDSYIDKHKNNDTTSSAETKNKVVGNEDLQNKGGTISS  493

Query  710   DEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTK  531
              ED+VSGFLYDRLQKEVIN+RK  + KE+ LN KD+EI+ML KK++ LTK+IEVESRK K
Sbjct  494   SEDVVSGFLYDRLQKEVINLRKYCETKESSLNAKDQEIQMLMKKVDALTKSIEVESRKVK  553

Query  530   REAAIREKDSSTIK  489
             REAA REK++ + K
Sbjct  554   REAAAREKEAVSAK  567



>gb|EYU27662.1| hypothetical protein MIMGU_mgv1a021959mg [Erythranthe guttata]
Length=588

 Score =   520 bits (1338),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 351/531 (66%), Positives = 418/531 (79%), Gaps = 38/531 (7%)
 Frame = -3

Query  1982  LLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKL  1803
             L H+DPF+LEL  LQNQLKE EREL  AQ+E + LRATE LKDKA+EELG+EV+RLEEKL
Sbjct  11    LSHSDPFVLELNRLQNQLKEGERELLKAQTEIRALRATEVLKDKAVEELGSEVERLEEKL  70

Query  1802  KISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAE  1623
             + SE  +EQKNL+ KKL +EKKEAL AQYAAE  LRRVYA+QK+DD +PIE +IAPLEAE
Sbjct  71    RCSETYLEQKNLDIKKLTDEKKEALAAQYAAELTLRRVYADQKDDDYVPIELIIAPLEAE  130

Query  1622  IKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQI  1443
             ++M KNE+AALQEDKRA+ER  KSKE+ALLEAERIL SALER LIVEEVQNQNFELRRQI
Sbjct  131   LRMRKNEVAALQEDKRALERLTKSKESALLEAERILTSALERALIVEEVQNQNFELRRQI  190

Query  1442  EICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeerr  1263
             EICQEENKIL+KTNRQKVLE+E+LSQTI++LEEAILAGGA ANTIRDY+RQISE+ EE+R
Sbjct  191   EICQEENKILEKTNRQKVLEIEKLSQTIIDLEEAILAGGATANTIRDYKRQISELNEEKR  250

Query  1262  tlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISER  1083
             TLERELAR+KVSANR+AT+VANEWKD+ DKVMPVKQWLEERR+LQAEMQ+LKDKLAISER
Sbjct  251   TLERELARIKVSANRIATVVANEWKDDKDKVMPVKQWLEERRVLQAEMQKLKDKLAISER  310

Query  1082  TAKAEAQlkdklklrlktLEQGLKQTGNN-NVNPKVLSGFSKPEKANHLFGILSS----K  918
              AKAEAQ+K+KLKLRLKT+E+GLK    +  VN    +G  K EK+++ FGILSS     
Sbjct  311   AAKAEAQVKEKLKLRLKTVEEGLKNAPTSFYVNT---NGSPKNEKSSNFFGILSSNTRMA  367

Query  917   KRSASQPRASMVNTTseqesssensgEYNDQKKRHHG-------LWYSRNKIDE---KEN  768
             KRS SQPRASM  T   Q S  +       +KK   G       LW SRNK+ +   KEN
Sbjct  368   KRSTSQPRASMQMTDGNQISEMKPIDCL--KKKNSSGESLLKKSLWASRNKVVDSSGKEN  425

Query  767   AGMKENS---------DKLTDSGNFSK---------NDEDMVSGFLYDRLQKEVINMRKC  642
             A   +N          +++ ++G   +           EDMVSGFLYDRLQKEVI++RK 
Sbjct  426   AETNKNDTVKIEARGVEEVRETGYIKEMKGLEIGDTETEDMVSGFLYDRLQKEVIHLRKS  485

Query  641   FDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIK  489
              D+KE+ LN+K +EIKML KKI+TLT+A+EVES+K KREAAIR+KDS+ +K
Sbjct  486   CDLKESTLNSKHDEIKMLMKKIDTLTRAVEVESKKMKREAAIRDKDSTVVK  536



>ref|XP_002307909.1| hypothetical protein POPTR_0006s01900g [Populus trichocarpa]
 gb|EEE91432.1| hypothetical protein POPTR_0006s01900g [Populus trichocarpa]
Length=516

 Score =   517 bits (1331),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 342/514 (67%), Positives = 399/514 (78%), Gaps = 29/514 (6%)
 Frame = -3

Query  2003  VGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEV  1824
             VG  +L L H DP +LEL  LQN LKEK RELG AQ E K LRATE LKDKA+EE  N V
Sbjct  14    VGSEDLSLSHPDPIVLELNRLQNLLKEKGRELGAAQGEIKALRATEALKDKAIEEFRNGV  73

Query  1823  KRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESV  1644
              +LEEKL + ENLVE KNLE +K+ NEKK+AL AQYAAEA LRRV+A QK+DDS PIESV
Sbjct  74    GKLEEKLGVMENLVESKNLEIRKITNEKKDALAAQYAAEATLRRVHANQKDDDSPPIESV  133

Query  1643  IAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQN  1464
             IAPLEAEIKMYKNEIA LQEDK+AMER  KSKE+ALLEAE IL+SALER LIVEEVQNQN
Sbjct  134   IAPLEAEIKMYKNEIAVLQEDKKAMERLTKSKESALLEAEGILRSALERALIVEEVQNQN  193

Query  1463  FELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqis  1284
             +EL+RQIEICQEEN+IL+KTNRQKVLEVE+LSQTI ELEEAILA GAAANTIRDYRRQIS
Sbjct  194   YELKRQIEICQEENRILEKTNRQKVLEVEKLSQTIHELEEAILAAGAAANTIRDYRRQIS  253

Query  1283  eiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKD  1104
             E+ EE+R LERELAR +VSANRVAT+VANEWKDENDKVMPVKQWLEERR+LQAEMQRLKD
Sbjct  254   ELNEEKRILERELARARVSANRVATVVANEWKDENDKVMPVKQWLEERRMLQAEMQRLKD  313

Query  1103  KLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILS  924
             KLAISERTA AEAQLK+KLKLRLKTLE+GL+   + +VNP    G  KP K +++ G L+
Sbjct  314   KLAISERTANAEAQLKEKLKLRLKTLEEGLQHVSSFSVNPNASCGSPKPGKTSNILGFLT  373

Query  923   S----KKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKENAGMK  756
             S    +KRSASQPR S ++ +S  +  +  +   N                     AG++
Sbjct  374   SNGGIRKRSASQPRGSTISRSSPFQQPNIETENANA--------------------AGIQ  413

Query  755   ENSD-----KLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKM  591
               +D      L + G    + ED+VSGFLYDRLQKEVIN+RK  + KE++LN KD+EI+M
Sbjct  414   NRADCFKKKNLQNEGGTISSSEDVVSGFLYDRLQKEVINLRKYCETKESNLNAKDQEIQM  473

Query  590   LTKKIETLTKAIEVESRKTKREAAIREKDSSTIK  489
             L KK++ LTK+IEVESRK KREAA REK++ + K
Sbjct  474   LMKKVDALTKSIEVESRKVKREAAAREKEAVSAK  507



>ref|XP_008370982.1| PREDICTED: microtubule-associated protein 70-5 [Malus domestica]
Length=588

 Score =   515 bits (1327),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 345/575 (60%), Positives = 425/575 (74%), Gaps = 52/575 (9%)
 Frame = -3

Query  2018  AGYEE-------VGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQL  1860
             AGY+E       VG  EL L+H DP +LEL  + N LKEK RELG+AQ E K LRATE  
Sbjct  2     AGYDEEQLGVGGVGGDELSLVHPDPVVLELNRMHNLLKEKSRELGIAQGEIKALRATEVQ  61

Query  1859  KDKALEELGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAE  1680
             KDKA+EEL NEV++L+EK +++E+L++ KNLE KKLI+EK++AL AQYAAE+ALRRV+A 
Sbjct  62    KDKAVEELRNEVQKLDEKHRVTESLLQHKNLEIKKLIDEKRDALAAQYAAESALRRVHAN  121

Query  1679  QKEDDSIPIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALE  1500
             +++D+S+P+ES IAPLEAEIKMYKN+IAALQEDK+A ER  K+KE+ALLEAERIL+SALE
Sbjct  122   RRDDESLPLESFIAPLEAEIKMYKNQIAALQEDKKAXERLTKTKESALLEAERILQSALE  181

Query  1499  RVLIVEEVQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaa  1320
             R LIVEEVQNQ FELRRQIEICQEEN+IL+KTNRQKVLEVE+LSQTI ELEEA+LAGGAA
Sbjct  182   RALIVEEVQNQXFELRRQIEICQEENRILEKTNRQKVLEVEKLSQTIQELEEAVLAGGAA  241

Query  1319  ANTIRDYrrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEER  1140
              N IRDY RQ+ E+ EE+RTLERELAR KVSANRVAT++ANEWKD+NDKVMPVKQWLEER
Sbjct  242   XNAIRDYZRQMEELHEEKRTLERELARXKVSANRVATVIANEWKDDNDKVMPVKQWLEER  301

Query  1139  RILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSK  960
             R++QAEMQRL+DKLAIS+RTAK EAQLK+K+KLRLK LE+GLK   + +  P +  G  K
Sbjct  302   RLMQAEMQRLRDKLAISDRTAKXEAQLKEKMKLRLKXLEEGLKHVSSFSCTPNLFCGSPK  361

Query  959   PEKANHLFGILS----SKKRSASQPRASMVNTTseqesssensgEYNDQK-----KRHHG  807
             PEK+++  G L+    S  RS SQPR S V+ +S Q+    ++      K     ++ +G
Sbjct  362   PEKSSNFLGFLTSNGGSAXRSTSQPRGSTVSRSSPQQQPHSDNETAGGLKRANSFRKKYG  421

Query  806   ---------LWYSRNKI---DEKENAGMKENS--------DKLT------------DSGN  723
                      LW SR+K+    EKEN  MKEN+        DK              DS N
Sbjct  422   SGENMLKKSLWASRSKVVDSGEKENTEMKENTNTDAENNNDKTAAADIKAAYGGNEDSHN  481

Query  722   FSKND---EDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIE  552
                 D   EDMVSGFLYDRLQKEV+N+RK  + KE+D+N KDEEIKML KK++ LTKA++
Sbjct  482   KISTDPESEDMVSGFLYDRLQKEVLNLRKHCEAKESDMNAKDEEIKMLMKKVDALTKAMD  541

Query  551   VESRKTKREAAIREKDSSTIKYKYDG-NIRQTNSS  450
             VE +K KREA  R+K+++  KY  D    R  NSS
Sbjct  542   VEFKKMKREAXARDKETAAAKYMDDNKKSRNINSS  576



>ref|XP_004236657.1| PREDICTED: microtubule-associated protein 70-5-like [Solanum 
lycopersicum]
Length=487

 Score =   505 bits (1301),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 345/522 (66%), Positives = 400/522 (77%), Gaps = 68/522 (13%)
 Frame = -3

Query  2018  AGYEEVGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEE  1839
             +G+ EV   EL  +H DP ILEL +LQNQLKEK+RELG A SE K L+A+E LKDKALEE
Sbjct  2     SGFYEVCGEELFHVHPDPVILELNNLQNQLKEKDRELGAAVSEIKALKASEVLKDKALEE  61

Query  1838  LGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSI  1659
             LGNE +RLE KLKI E++VEQKNL+ K+L+NEKKEAL AQ+AAEA LRRVYA+QK+DD+ 
Sbjct  62    LGNEFQRLEGKLKIGEDVVEQKNLDIKRLVNEKKEALAAQHAAEATLRRVYADQKDDDAP  121

Query  1658  PIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEE  1479
             P+ES+IAPLEAEIKMYKNEIAALQED R++ERH +SKEAALLEAERILKSALER LIVEE
Sbjct  122   PLESIIAPLEAEIKMYKNEIAALQEDTRSLERHTRSKEAALLEAERILKSALERALIVEE  181

Query  1478  VQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDY  1299
             +QNQNFELRRQIEI QEENKILDKTNRQK+LEVE+LSQTI+ELEEAILAGGAAANT+RDY
Sbjct  182   IQNQNFELRRQIEIFQEENKILDKTNRQKILEVEKLSQTIIELEEAILAGGAAANTLRDY  241

Query  1298  rrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEM  1119
             +R+ISE+QEE+RTLEREL+RVKVSANRVAT+VANEWKDENDKVMPVKQWLEERR+LQAEM
Sbjct  242   KRRISELQEEKRTLERELSRVKVSANRVATVVANEWKDENDKVMPVKQWLEERRLLQAEM  301

Query  1118  QRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHL  939
             QRL+DKL+ISERTAKAEAQLKDKLKLRLKTLE+GLKQ  N N       G +KP+K  H 
Sbjct  302   QRLRDKLSISERTAKAEAQLKDKLKLRLKTLEEGLKQAFNPN-------GSTKPQKTKHY  354

Query  938   FGILSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKID----EKE  771
              G              S+V  +                      LW S+NKI      KE
Sbjct  355   LG-------------NSLVKKS----------------------LWTSQNKIIGSTVGKE  379

Query  770   NAGMKENS----------------------DKLTDSGNFSKNDEDMVSGFLYDRLQKEVI  657
             NA  KENS                      D++  +G     ++D+VSGFLYD+LQKEVI
Sbjct  380   NAETKENSIMDINSKETIDAHKIKNGGGDQDEIKTNGCSQSVNDDIVSGFLYDKLQKEVI  439

Query  656   NMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTK  531
              +RK  + KE+ LNTKDEEIK+LTKKIETL+KAIEVE+RK K
Sbjct  440   CLRKFCETKESALNTKDEEIKILTKKIETLSKAIEVEARKRK  481



>gb|KHG05064.1| Microtubule-associated protein 70-5 [Gossypium arboreum]
Length=595

 Score =   508 bits (1308),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 344/555 (62%), Positives = 420/555 (76%), Gaps = 45/555 (8%)
 Frame = -3

Query  2018  AGYEEV--GVAELCLL---HTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKD  1854
             AG+  V  G  +L L    H DPF+LELT LQN+LKEK+R+LG AQ+E K LRATE LKD
Sbjct  4     AGHSHVFGGEEQLPLAIADHPDPFVLELTRLQNRLKEKDRKLGAAQAEIKALRATEALKD  63

Query  1853  KALEELGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQK  1674
             K +EELG EV+ L+EK +++ENL++QKNLE KKL +EKK+A+ AQ+AAEA LRRVYA QK
Sbjct  64    KVIEELGEEVQTLDEKHRVAENLLQQKNLEMKKLADEKKDAVAAQFAAEATLRRVYASQK  123

Query  1673  EDDSIPIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERV  1494
             +D+ + +ES+IAPL+AEIKMYKNEIA L +DK+A+ER  KSKE AL+EAERIL+SALER 
Sbjct  124   DDEDVSMESIIAPLKAEIKMYKNEIAVLHQDKKALERLTKSKELALIEAERILRSALERA  183

Query  1493  LIVEEVQNQNFELRRQIEICQ------EENKILDKTNRQKVLEVERLSQTileleeaila  1332
             LIVEEVQNQN ELRRQIEICQ      EENKIL+KTNRQKVLE+E+LSQTI ELEEAIL 
Sbjct  184   LIVEEVQNQNLELRRQIEICQASLALTEENKILEKTNRQKVLEIEKLSQTIKELEEAILV  243

Query  1331  ggaaANTIRDYrrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQW  1152
             GGAAAN+IRD RRQIS+++EE+RTLERELARVKV ANRVAT+VANEWKDENDKVMPVKQW
Sbjct  244   GGAAANSIRDCRRQISQLREEKRTLERELARVKVLANRVATVVANEWKDENDKVMPVKQW  303

Query  1151  LEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLS  972
             LE+RR+LQAEMQRLKDKL++S RTAKAEAQLKDK KLRLK LE GLK   + ++NP    
Sbjct  304   LEDRRLLQAEMQRLKDKLSMSVRTAKAEAQLKDKFKLRLKILEDGLKHISSISINPNASY  363

Query  971   GFSKPEKANHLFGILSS----KKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGL  804
             G  KPEK++++ G L+S    KKRS SQPRAS ++T+S  +     SGE   +KK    L
Sbjct  364   GSPKPEKSSNILGFLTSTGGLKKRSTSQPRASTISTSSSLQRPRATSGENMVRKK----L  419

Query  803   WYSRNKI---DEKENAGMKENSD-----------------------KLTDSGNFSKNDED  702
             W SR K+   +EKENA MK N D                       +  + G    N ED
Sbjct  420   WASRCKVADSNEKENAEMKVNGDSSVRKDGDTKDSAEIKSNGGSNEQTGNRGIADSNAED  479

Query  701   MVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREA  522
             MVSGFLYDRLQKEVIN+RK  + K++ LNTKDEEIKML KK+E  ++A+EVE+++ KRE+
Sbjct  480   MVSGFLYDRLQKEVINLRKLCEAKDSSLNTKDEEIKMLMKKVEAFSRAMEVEAKRVKRES  539

Query  521   AIREKDSSTIKYKYD  477
               +EK++ + K   D
Sbjct  540   LAKEKENGSAKMGDD  554



>ref|XP_010057808.1| PREDICTED: microtubule-associated protein 70-5 isoform X1 [Eucalyptus 
grandis]
 gb|KCW75131.1| hypothetical protein EUGRSUZ_E03882 [Eucalyptus grandis]
Length=578

 Score =   502 bits (1292),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 346/574 (60%), Positives = 432/574 (75%), Gaps = 51/574 (9%)
 Frame = -3

Query  2009  EEVGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGN  1830
             E+ G  EL L H+DP +LEL  LQN LKE++REL  AQSE K L+A+E LKDKA+EEL N
Sbjct  5     EQFGGQELSLSHSDPVVLELNRLQNLLKERDRELANAQSEIKSLKASEILKDKAIEELKN  64

Query  1829  EVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIE  1650
              V++LE KL I+EN ++ KNLE KKL +EKK+AL AQYAAEA LRRV+A QK++D  P+E
Sbjct  65    IVQKLEGKLAITENFLQHKNLEIKKLASEKKDALAAQYAAEATLRRVHASQKDNDLPPVE  124

Query  1649  SVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQN  1470
             SVIAPLEAEIKM+KNEIAALQEDK+A+ER  KSKE ALLEAE+IL+SALER LIVE+VQN
Sbjct  125   SVIAPLEAEIKMHKNEIAALQEDKKALERLTKSKEFALLEAEKILRSALERALIVEQVQN  184

Query  1469  QNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrq  1290
             QN+EL+RQIEICQEENKIL+KTNRQKVLEVE+LSQTI ELEEAILAGGAAAN+IRDY+RQ
Sbjct  185   QNYELKRQIEICQEENKILEKTNRQKVLEVEKLSQTIQELEEAILAGGAAANSIRDYQRQ  244

Query  1289  iseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRL  1110
             ISEI+EE+RTLERELAR KVSANRVAT+VANEWKD+ND+VMP+KQWLEERRILQAEMQRL
Sbjct  245   ISEIKEEKRTLERELARAKVSANRVATVVANEWKDDNDRVMPIKQWLEERRILQAEMQRL  304

Query  1109  KDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGI  930
             +DKLA+SER AKAEAQ+K+K KLRLKTLE+GL++  N +VN  +L    K EK++ +F  
Sbjct  305   RDKLAVSERAAKAEAQMKEKFKLRLKTLEEGLRRGTNVSVNGNLLCASPKTEKSSKIFSF  364

Query  929   LSS----KKRSASQPRASM--------VNTTseqesssensgEYNDQKKRH--------H  810
             L+S    KKRS+SQPRA+          N   E E+ +      N  +K+          
Sbjct  365   LTSNGGLKKRSSSQPRATTNRSSPLRQPNMQDEAENVAREFNSMNSLRKKFASEEYLLKK  424

Query  809   GLWYSRNKIDE---KENAGMKENSDK----------------LTDS---------GNFSK  714
             G+W SRNK+ +   KENA  K  SD+                +TDS         G+   
Sbjct  425   GMWVSRNKVIDSTGKENAEKKTYSDESIDKSADEKKTASGECITDSNGDAELASKGSAKL  484

Query  713   NDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKT  534
             +DED+VSGFLYD+LQKEVI +R+  + K++ LN K++EI+ML KK++TLTKAIEVES+K 
Sbjct  485   DDEDLVSGFLYDKLQKEVIGLRRFSEAKDSILNAKEQEIQMLMKKVDTLTKAIEVESKKV  544

Query  533   KREAAIREKDSSTIK---YKYDGNIRQTNSSLKS  441
             KRE A REK+++ ++    K   N++ TN ++K+
Sbjct  545   KRETASREKEAAQMRVDELKNIKNLKSTNRAIKA  578



>ref|XP_002323125.2| hypothetical protein POPTR_0016s00870g [Populus trichocarpa]
 gb|EEF04886.2| hypothetical protein POPTR_0016s00870g [Populus trichocarpa]
Length=573

 Score =   500 bits (1288),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 339/539 (63%), Positives = 397/539 (74%), Gaps = 49/539 (9%)
 Frame = -3

Query  2003  VGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEV  1824
             +G  +L L H  P +LEL  LQN LKE+ERELG AQ E K LRATE LKDKA+EEL NEV
Sbjct  11    LGREDLSLSHPGPIVLELNRLQNLLKERERELGSAQGEIKALRATEALKDKAIEELRNEV  70

Query  1823  KRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESV  1644
              +L++KL ++ENLVE KNLE KKL NEKK+AL AQYAAEA LRRV+A QK DDS PIESV
Sbjct  71    GKLDQKLGVTENLVEHKNLEIKKLTNEKKDALAAQYAAEAILRRVHANQKGDDSPPIESV  130

Query  1643  IAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQN  1464
             IAPLEAEIKMYKNEIA+LQEDK+AMER  KSKE+ALLEAERIL+SALER LIVEEVQNQN
Sbjct  131   IAPLEAEIKMYKNEIASLQEDKKAMERLTKSKESALLEAERILRSALERALIVEEVQNQN  190

Query  1463  FELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqis  1284
             +EL+RQIEICQEEN+IL+KTNRQKVLEVE+LSQTI ELEEAILA GAAANTIRDYRRQIS
Sbjct  191   YELKRQIEICQEENRILEKTNRQKVLEVEKLSQTICELEEAILAAGAAANTIRDYRRQIS  250

Query  1283  eiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKD  1104
             E++EE+R LERELAR +VSANRVAT+VANEWKDENDKVMPVKQWLEERR+LQAEMQRLK+
Sbjct  251   ELKEEKRMLERELARARVSANRVATVVANEWKDENDKVMPVKQWLEERRLLQAEMQRLKE  310

Query  1103  KLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILS  924
             KLAISERTA AEAQLK+K+KLRLKTLE+GLK T + + NP    G  KP   N + G L 
Sbjct  311   KLAISERTANAEAQLKEKMKLRLKTLEEGLKHTSSFSANPNASCGSPKPGNTNKILGFLK  370

Query  923   S----KKRSASQPRASMVNTTseqesssensgEYN--------DQKKRHH---------G  807
             S    ++RS SQPR S +N  S  +  +  +   N        D  K+ +         G
Sbjct  371   SNAGMRRRSTSQPRGSSINRNSPLQQPNIETENANASGKLNGADSFKKKYGSGENMLTKG  430

Query  806   LWYSRNK---IDEKENAGMKENSDKLTD-------------------------SGNFSKN  711
             +W SRNK   I  KEN  +K  +D   D                          G+ + +
Sbjct  431   IWVSRNKVIDISGKENEEVKTKADSCIDKHGIDGTTNSEETKNKVSGNEDLPNKGSANSD  490

Query  710   DEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKT  534
              +D+VSGFLYDRLQK VIN++K  + KE  LN KD+EI+ML KK+  LTK+IEVES+K 
Sbjct  491   SQDIVSGFLYDRLQKAVINLQKSCETKERSLNAKDQEIQMLMKKVNALTKSIEVESKKV  549



>ref|XP_010057809.1| PREDICTED: microtubule-associated protein 70-5 isoform X2 [Eucalyptus 
grandis]
 gb|KCW75132.1| hypothetical protein EUGRSUZ_E03882 [Eucalyptus grandis]
Length=574

 Score =   500 bits (1287),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 346/570 (61%), Positives = 429/570 (75%), Gaps = 51/570 (9%)
 Frame = -3

Query  2009  EEVGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGN  1830
             E+ G  EL L H+DP +LEL  LQN LKE++REL  AQSE K L+A+E LKDKA+EEL N
Sbjct  5     EQFGGQELSLSHSDPVVLELNRLQNLLKERDRELANAQSEIKSLKASEILKDKAIEELKN  64

Query  1829  EVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIE  1650
              V++LE KL I+EN ++ KNLE KKL +EKK+AL AQYAAEA LRRV+A QK++D  P+E
Sbjct  65    IVQKLEGKLAITENFLQHKNLEIKKLASEKKDALAAQYAAEATLRRVHASQKDNDLPPVE  124

Query  1649  SVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQN  1470
             SVIAPLEAEIKM+KNEIAALQEDK+A+ER  KSKE ALLEAE+IL+SALER LIVE+VQN
Sbjct  125   SVIAPLEAEIKMHKNEIAALQEDKKALERLTKSKEFALLEAEKILRSALERALIVEQVQN  184

Query  1469  QNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrq  1290
             QN+EL+RQIEICQEENKIL+KTNRQKVLEVE+LSQTI ELEEAILAGGAAAN+IRDY+RQ
Sbjct  185   QNYELKRQIEICQEENKILEKTNRQKVLEVEKLSQTIQELEEAILAGGAAANSIRDYQRQ  244

Query  1289  iseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRL  1110
             ISEI+EE+RTLERELAR KVSANRVAT+VANEWKD+ND+VMP+KQWLEERRILQAEMQRL
Sbjct  245   ISEIKEEKRTLERELARAKVSANRVATVVANEWKDDNDRVMPIKQWLEERRILQAEMQRL  304

Query  1109  KDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGI  930
             +DKLA+SER AKAEAQ+K+K KLRLKTLE+GL++  N +VN  +L    K EK++ +F  
Sbjct  305   RDKLAVSERAAKAEAQMKEKFKLRLKTLEEGLRRGTNVSVNGNLLCASPKTEKSSKIFSF  364

Query  929   LSS----KKRSASQPRASM--------VNTTseqesssensgEYNDQKKRH--------H  810
             L+S    KKRS+SQPRA+          N   E E+ +      N  +K+          
Sbjct  365   LTSNGGLKKRSSSQPRATTNRSSPLRQPNMQDEAENVAREFNSMNSLRKKFASEEYLLKK  424

Query  809   GLWYSRNKIDE---KENAGMKENSDK----------------LTDS---------GNFSK  714
             G+W SRNK+ +   KENA  K  SD+                +TDS         G+   
Sbjct  425   GMWVSRNKVIDSTGKENAEKKTYSDESIDKSADEKKTASGECITDSNGDAELASKGSAKL  484

Query  713   NDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKT  534
             +DED+VSGFLYD+LQKEVI +R+  + K++ LN K++EI+ML KK++TLTKAIEVES+K 
Sbjct  485   DDEDLVSGFLYDKLQKEVIGLRRFSEAKDSILNAKEQEIQMLMKKVDTLTKAIEVESKKV  544

Query  533   KREAAIREKDSSTIK---YKYDGNIRQTNS  453
             KRE A REK+++ ++    K   N++ TNS
Sbjct  545   KRETASREKEAAQMRVDELKNIKNLKSTNS  574



>ref|XP_006467285.1| PREDICTED: microtubule-associated protein 70-5-like isoform X2 
[Citrus sinensis]
 gb|KDO78529.1| hypothetical protein CISIN_1g007760mg [Citrus sinensis]
Length=589

 Score =   499 bits (1285),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 346/580 (60%), Positives = 423/580 (73%), Gaps = 58/580 (10%)
 Frame = -3

Query  2015  GYEEV---GVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKAL  1845
             G++E+   GV EL L H DP +LEL  LQNQLKEK+REL  AQ E K LRATE LKDKA+
Sbjct  3     GFDELKLGGVEELSLAHPDPVVLELNRLQNQLKEKDRELADAQGEIKALRATEVLKDKAI  62

Query  1844  EELGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDD  1665
             EEL NE  +++ KL++++N++E +NLE KK+  EKK+AL AQYAAEA LRRV+A  K+DD
Sbjct  63    EELRNEFGKIDGKLRVTQNVLEHRNLEIKKVTGEKKDALAAQYAAEATLRRVHANLKDDD  122

Query  1664  SIPIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIV  1485
             S+PIESV+APLEA+IK YK EIAALQEDK+A++RH K+KE ALLEAE+IL+SALER LIV
Sbjct  123   SVPIESVLAPLEADIKTYKKEIAALQEDKKALQRHTKAKEMALLEAEKILRSALERALIV  182

Query  1484  EEVQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIR  1305
             EEVQN NFEL+RQIEICQEEN+IL+KTNRQKVLEVE+LS TI ELEEA+LAGG+AAN IR
Sbjct  183   EEVQNLNFELKRQIEICQEENRILEKTNRQKVLEVEKLSGTIKELEEAVLAGGSAANAIR  242

Query  1304  DYrrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQA  1125
             DY+RQI+E+ EE+RTLERELARVKVSANRVAT+VANEWKDENDKVMPV+QWLEERR+LQA
Sbjct  243   DYQRQITELNEEKRTLERELARVKVSANRVATVVANEWKDENDKVMPVRQWLEERRLLQA  302

Query  1124  EMQRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEK-A  948
             EMQRLKDKLAISERTAKAEAQLK+KLKLRLKTLE+GLK   + + +P    G  K EK +
Sbjct  303   EMQRLKDKLAISERTAKAEAQLKEKLKLRLKTLEEGLKHVSSFSGSPNTFCGSPKTEKSS  362

Query  947   NHLFGILSS----KKRSASQPRASMV------------NTTseqesssensgEYNDQKKR  816
             N + G L++    +KRS SQPRAS +            N T     +       + +KK 
Sbjct  363   NIILGFLTANGGLRKRSTSQPRASTISRNSLLHQPNSENATVNGNFTGGLKRADSFRKKC  422

Query  815   HHG-------LWYSRNKIDE----KENAGMKENSD------KLTDS--------------  729
               G       +W S+NK+ +    KEN  +KEN D      K+ D+              
Sbjct  423   AAGENVLRKSIWPSKNKVVDSSCGKENTQVKENKDNNIDEFKIGDTNVSVEVKNKVGGYE  482

Query  728   -------GNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIET  570
                    GN +   ED+VSGFLYDRLQKEVI +RK  + K++ LN KDEEIKML +K++ 
Sbjct  483   HEVSQNKGNPNPVKEDVVSGFLYDRLQKEVILLRKFCESKDSCLNAKDEEIKMLIRKVDA  542

Query  569   LTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQTNSS  450
             LTKAIE ES+K KREAA REK++ + K      IR T+SS
Sbjct  543   LTKAIEAESKKIKREAAAREKEAISAKLDDTRKIRSTSSS  582



>ref|XP_006449918.1| hypothetical protein CICLE_v10014697mg [Citrus clementina]
 gb|ESR63158.1| hypothetical protein CICLE_v10014697mg [Citrus clementina]
Length=589

 Score =   499 bits (1284),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 346/580 (60%), Positives = 424/580 (73%), Gaps = 58/580 (10%)
 Frame = -3

Query  2015  GYEEV---GVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKAL  1845
             G++E+   GV EL L H DP +LEL  LQNQLKEK+REL  AQ E K LRATE LKDKA+
Sbjct  3     GFDELKLGGVEELSLAHPDPVVLELNRLQNQLKEKDRELADAQGEIKALRATEVLKDKAI  62

Query  1844  EELGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDD  1665
             EEL NEV +++ KL++++N++E +NLE KK+  EKK+AL AQYAAEA LRRV+A  K+DD
Sbjct  63    EELRNEVGKIDGKLRVTQNVLEHRNLEIKKVTGEKKDALAAQYAAEATLRRVHANLKDDD  122

Query  1664  SIPIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIV  1485
             S+PIESV+APLEA+IK YK EIAALQEDK+A++RH K+KE ALLEAE+IL+SALER LIV
Sbjct  123   SVPIESVLAPLEADIKTYKKEIAALQEDKKALQRHTKAKEMALLEAEKILRSALERALIV  182

Query  1484  EEVQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIR  1305
             EEVQN NFEL+R+IEICQEEN+IL+KTNRQKVLEVE+LS TI ELEEA+LAGG+AAN IR
Sbjct  183   EEVQNLNFELKRKIEICQEENRILEKTNRQKVLEVEKLSGTIKELEEAVLAGGSAANAIR  242

Query  1304  DYrrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQA  1125
             DY+RQI+E+ EE+RTLERELARVKVSANRVAT+VANEWKDENDKVMPV+QWLEERR+LQA
Sbjct  243   DYQRQITELNEEKRTLERELARVKVSANRVATVVANEWKDENDKVMPVRQWLEERRLLQA  302

Query  1124  EMQRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEK-A  948
             EMQRLKDKLAISERTAKAEAQLK+KLKLRLKTLE+GLK   + + +P    G  K EK +
Sbjct  303   EMQRLKDKLAISERTAKAEAQLKEKLKLRLKTLEEGLKHVSSFSGSPNTFCGSPKTEKSS  362

Query  947   NHLFGILSS----KKRSASQPRASMV------------NTTseqesssensgEYNDQKKR  816
             N + G L++    +KRS SQPRAS +            N T    S+       + +KK 
Sbjct  363   NIILGFLTANGGLRKRSTSQPRASTISRNSLLQQPNSENATVNGNSTGGLKRADSFRKKC  422

Query  815   HHG-------LWYSRNKIDE----KENAGMKENSD------KLTDS--------------  729
               G       +W S+NK+ +    KEN  +KEN D      K+ D+              
Sbjct  423   AAGENVLRKSIWPSKNKVVDSSCGKENNQVKENKDNNIDEFKIGDTNVSVEVKNKVGGYE  482

Query  728   -------GNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIET  570
                    GN     ED+VSGFLYDRLQKEV+ +RK  + K++ LN KDEEIKML +K++ 
Sbjct  483   HEISQNKGNPIPGKEDVVSGFLYDRLQKEVVLLRKFCESKDSCLNAKDEEIKMLMRKVDA  542

Query  569   LTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQTNSS  450
             LTKAIE ES+K KREAA REK++ + K      IR T+SS
Sbjct  543   LTKAIEAESKKIKREAAAREKEAISAKLDDTRKIRSTSSS  582



>gb|KHG14722.1| Microtubule-associated 70-5 -like protein [Gossypium arboreum]
Length=561

 Score =   494 bits (1272),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 336/543 (62%), Positives = 410/543 (76%), Gaps = 36/543 (7%)
 Frame = -3

Query  1979  LHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKLK  1800
             LH +P +LELT LQNQLKE++RELG AQ+E K LRATE LKDKA+ EL  EV++L+EK +
Sbjct  18    LHPNPVVLELTRLQNQLKERDRELGAAQAEIKALRATEALKDKAIHELQGEVQKLDEKHR  77

Query  1799  ISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEI  1620
             ++EN+++ KNLE KKL NEKK+A+ AQ+AAEA LRRV+A QK+DD + IESVIAPLEAEI
Sbjct  78    VTENILQHKNLEIKKLTNEKKDAMAAQFAAEATLRRVHANQKDDDDVSIESVIAPLEAEI  137

Query  1619  KMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIE  1440
             KMYKNEIA L EDKRA+ER  KSKE+ALLEAE+IL+SALER LIVEEVQNQNFELRRQIE
Sbjct  138   KMYKNEIAMLHEDKRALERLTKSKESALLEAEKILRSALERALIVEEVQNQNFELRRQIE  197

Query  1439  ICQ---------EENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqi  1287
             ICQ         EE+KIL+KTNRQKVLEVE+LSQTI ELEEAILAGGAAAN+IRDY+RQI
Sbjct  198   ICQASLRLLLQSEEHKILEKTNRQKVLEVEKLSQTIQELEEAILAGGAAANSIRDYQRQI  257

Query  1286  seiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLK  1107
             S++ EE+RTLERELARVKVSANRVAT+VANEWKDENDKVMPVKQWLE+RR+LQAEMQRLK
Sbjct  258   SQLNEEKRTLERELARVKVSANRVATVVANEWKDENDKVMPVKQWLEDRRLLQAEMQRLK  317

Query  1106  DKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGIL  927
             DKLA+SERTAKAEAQLK+K KLRLK LE GLK     +VN     G  KP+K++++ G+L
Sbjct  318   DKLAVSERTAKAEAQLKEKFKLRLKILEDGLKHVSTLSVNASY--GSPKPDKSSNILGLL  375

Query  926   SS----KKRSASQPRASMVNTTseqesssensgE--------------YNDQKKRHHGLW  801
             +     +KRS SQPRAS ++ T  Q  S E                   +++      LW
Sbjct  376   TGSSGPRKRSTSQPRASTISATLLQRPSVETETANTRIRQGSILRRRPVSEENMVRKNLW  435

Query  800   YSRNKI---DEKENAGMKENSDKLTDSGNFSK---NDEDMVSGFLYDRLQKEVINMRKCF  639
              SR K+    EKENA  K N      +   ++   N EDMVSGFLYDRLQKEVIN+RK  
Sbjct  436   ASRCKVADSSEKENAENKVNEQTEKKNNEENENRGNAEDMVSGFLYDRLQKEVINLRKFC  495

Query  638   DMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAA-IREKDSSTIKYKYDGNIRQ  462
             + K + LN KDEEIKML KK+E  ++A+E+ES++ K+EA  ++EK + + K +    ++ 
Sbjct  496   EAKNSSLNAKDEEIKMLMKKVEAFSRAMEMESKRVKKEAQLVKEKKNGSPKMEDTKKVKN  555

Query  461   TNS  453
              NS
Sbjct  556   NNS  558



>ref|XP_006467284.1| PREDICTED: microtubule-associated protein 70-5-like isoform X1 
[Citrus sinensis]
 gb|KDO78528.1| hypothetical protein CISIN_1g007760mg [Citrus sinensis]
Length=590

 Score =   493 bits (1270),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 341/568 (60%), Positives = 417/568 (73%), Gaps = 58/568 (10%)
 Frame = -3

Query  2015  GYEEV---GVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKAL  1845
             G++E+   GV EL L H DP +LEL  LQNQLKEK+REL  AQ E K LRATE LKDKA+
Sbjct  3     GFDELKLGGVEELSLAHPDPVVLELNRLQNQLKEKDRELADAQGEIKALRATEVLKDKAI  62

Query  1844  EELGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDD  1665
             EEL NE  +++ KL++++N++E +NLE KK+  EKK+AL AQYAAEA LRRV+A  K+DD
Sbjct  63    EELRNEFGKIDGKLRVTQNVLEHRNLEIKKVTGEKKDALAAQYAAEATLRRVHANLKDDD  122

Query  1664  SIPIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIV  1485
             S+PIESV+APLEA+IK YK EIAALQEDK+A++RH K+KE ALLEAE+IL+SALER LIV
Sbjct  123   SVPIESVLAPLEADIKTYKKEIAALQEDKKALQRHTKAKEMALLEAEKILRSALERALIV  182

Query  1484  EEVQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIR  1305
             EEVQN NFEL+RQIEICQEEN+IL+KTNRQKVLEVE+LS TI ELEEA+LAGG+AAN IR
Sbjct  183   EEVQNLNFELKRQIEICQEENRILEKTNRQKVLEVEKLSGTIKELEEAVLAGGSAANAIR  242

Query  1304  DYrrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQA  1125
             DY+RQI+E+ EE+RTLERELARVKVSANRVAT+VANEWKDENDKVMPV+QWLEERR+LQA
Sbjct  243   DYQRQITELNEEKRTLERELARVKVSANRVATVVANEWKDENDKVMPVRQWLEERRLLQA  302

Query  1124  EMQRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEK-A  948
             EMQRLKDKLAISERTAKAEAQLK+KLKLRLKTLE+GLK   + + +P    G  K EK +
Sbjct  303   EMQRLKDKLAISERTAKAEAQLKEKLKLRLKTLEEGLKHVSSFSGSPNTFCGSPKTEKSS  362

Query  947   NHLFGILSS----KKRSASQPRASMV------------NTTseqesssensgEYNDQKKR  816
             N + G L++    +KRS SQPRAS +            N T     +       + +KK 
Sbjct  363   NIILGFLTANGGLRKRSTSQPRASTISRNSLLHQPNSENATVNGNFTGGLKRADSFRKKC  422

Query  815   HHG-------LWYSRNKIDE----KENAGMKENSD------KLTDS--------------  729
               G       +W S+NK+ +    KEN  +KEN D      K+ D+              
Sbjct  423   AAGENVLRKSIWPSKNKVVDSSCGKENTQVKENKDNNIDEFKIGDTNVSVEVKNKVGGYE  482

Query  728   -------GNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIET  570
                    GN +   ED+VSGFLYDRLQKEVI +RK  + K++ LN KDEEIKML +K++ 
Sbjct  483   HEVSQNKGNPNPVKEDVVSGFLYDRLQKEVILLRKFCESKDSCLNAKDEEIKMLIRKVDA  542

Query  569   LTKAIEVESRKTKREAAIREKDSSTIKY  486
             LTKAIE ES+K KREAA REK++ + K 
Sbjct  543   LTKAIEAESKKIKREAAAREKEAISAKL  570



>ref|XP_006449917.1| hypothetical protein CICLE_v10014697mg [Citrus clementina]
 gb|ESR63157.1| hypothetical protein CICLE_v10014697mg [Citrus clementina]
Length=590

 Score =   493 bits (1268),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 341/568 (60%), Positives = 418/568 (74%), Gaps = 58/568 (10%)
 Frame = -3

Query  2015  GYEEV---GVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKAL  1845
             G++E+   GV EL L H DP +LEL  LQNQLKEK+REL  AQ E K LRATE LKDKA+
Sbjct  3     GFDELKLGGVEELSLAHPDPVVLELNRLQNQLKEKDRELADAQGEIKALRATEVLKDKAI  62

Query  1844  EELGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDD  1665
             EEL NEV +++ KL++++N++E +NLE KK+  EKK+AL AQYAAEA LRRV+A  K+DD
Sbjct  63    EELRNEVGKIDGKLRVTQNVLEHRNLEIKKVTGEKKDALAAQYAAEATLRRVHANLKDDD  122

Query  1664  SIPIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIV  1485
             S+PIESV+APLEA+IK YK EIAALQEDK+A++RH K+KE ALLEAE+IL+SALER LIV
Sbjct  123   SVPIESVLAPLEADIKTYKKEIAALQEDKKALQRHTKAKEMALLEAEKILRSALERALIV  182

Query  1484  EEVQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIR  1305
             EEVQN NFEL+R+IEICQEEN+IL+KTNRQKVLEVE+LS TI ELEEA+LAGG+AAN IR
Sbjct  183   EEVQNLNFELKRKIEICQEENRILEKTNRQKVLEVEKLSGTIKELEEAVLAGGSAANAIR  242

Query  1304  DYrrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQA  1125
             DY+RQI+E+ EE+RTLERELARVKVSANRVAT+VANEWKDENDKVMPV+QWLEERR+LQA
Sbjct  243   DYQRQITELNEEKRTLERELARVKVSANRVATVVANEWKDENDKVMPVRQWLEERRLLQA  302

Query  1124  EMQRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEK-A  948
             EMQRLKDKLAISERTAKAEAQLK+KLKLRLKTLE+GLK   + + +P    G  K EK +
Sbjct  303   EMQRLKDKLAISERTAKAEAQLKEKLKLRLKTLEEGLKHVSSFSGSPNTFCGSPKTEKSS  362

Query  947   NHLFGILSS----KKRSASQPRASMV------------NTTseqesssensgEYNDQKKR  816
             N + G L++    +KRS SQPRAS +            N T    S+       + +KK 
Sbjct  363   NIILGFLTANGGLRKRSTSQPRASTISRNSLLQQPNSENATVNGNSTGGLKRADSFRKKC  422

Query  815   HHG-------LWYSRNKIDE----KENAGMKENSD------KLTDS--------------  729
               G       +W S+NK+ +    KEN  +KEN D      K+ D+              
Sbjct  423   AAGENVLRKSIWPSKNKVVDSSCGKENNQVKENKDNNIDEFKIGDTNVSVEVKNKVGGYE  482

Query  728   -------GNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIET  570
                    GN     ED+VSGFLYDRLQKEV+ +RK  + K++ LN KDEEIKML +K++ 
Sbjct  483   HEISQNKGNPIPGKEDVVSGFLYDRLQKEVVLLRKFCESKDSCLNAKDEEIKMLMRKVDA  542

Query  569   LTKAIEVESRKTKREAAIREKDSSTIKY  486
             LTKAIE ES+K KREAA REK++ + K 
Sbjct  543   LTKAIEAESKKIKREAAAREKEAISAKL  570



>ref|XP_011040173.1| PREDICTED: microtubule-associated protein 70-5-like [Populus 
euphratica]
 ref|XP_011040174.1| PREDICTED: microtubule-associated protein 70-5-like [Populus 
euphratica]
Length=573

 Score =   486 bits (1251),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 333/539 (62%), Positives = 391/539 (73%), Gaps = 49/539 (9%)
 Frame = -3

Query  2003  VGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEV  1824
             +G  EL L H DP +LE   LQN LK++ERELG AQ E K LRATE LKDKA+EEL NEV
Sbjct  11    LGKEELSLSHPDPIVLEHNRLQNLLKDRERELGFAQGEIKALRATEALKDKAIEELRNEV  70

Query  1823  KRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESV  1644
              +L++KL  +ENLVE KNLE KKL +EKK+AL A YAAEA LRRV+A QK+DDS PIESV
Sbjct  71    GKLDQKLVFTENLVEHKNLEIKKLTSEKKDALAAHYAAEAILRRVHANQKDDDSPPIESV  130

Query  1643  IAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQN  1464
             IAPLEA+IKMYKNEIA+LQ DK+AMER  KSKEAALLEAERIL+SALER L+VEEVQNQN
Sbjct  131   IAPLEADIKMYKNEIASLQVDKKAMERLTKSKEAALLEAERILQSALERALMVEEVQNQN  190

Query  1463  FELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqis  1284
             +EL+RQIEICQEEN+IL+KTNRQKV+EVE+LSQTI ELEEAILA GAAANTIRDYRRQIS
Sbjct  191   YELKRQIEICQEENRILEKTNRQKVIEVEKLSQTICELEEAILAAGAAANTIRDYRRQIS  250

Query  1283  eiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKD  1104
             E +EE+R LERELAR +VSANRVAT+VANEWKDENDKVMPVKQWLEERR+LQAEMQRLK+
Sbjct  251   EPKEEKRMLERELARARVSANRVATVVANEWKDENDKVMPVKQWLEERRLLQAEMQRLKE  310

Query  1103  KLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILS  924
             KLAISERTA AEAQLK+KLKLRLKTLE+GLK T + + NP    G  KP   N + G L 
Sbjct  311   KLAISERTANAEAQLKEKLKLRLKTLEEGLKYTSSFSANPNASCGSPKPGSTNKILGFLK  370

Query  923   S----KKRSASQPRASMVNTTseqesssensgEYN--------DQKKRHH---------G  807
             S    ++RS SQPR S ++     +     +   N        D  K+ +         G
Sbjct  371   SNAGMRRRSTSQPRGSNISRNFPLQQPDIETENANASGKLNGADSFKKKYGSGENMVAKG  430

Query  806   LWYSRNK---IDEKENAGMKENSDKLTD-------------------------SGNFSKN  711
             +W SRNK   I  KEN  +K   D   D                          G+ + +
Sbjct  431   IWVSRNKVIDISGKENEEVKAKDDSCIDKHGIDGTTNSEETKNKVGGNEDLPNKGSANSD  490

Query  710   DEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKT  534
              +D+VSGFLYDRLQK VIN++K  + KE  LN KD+EI+ML KK+  LTK+IEVES+K 
Sbjct  491   SQDVVSGFLYDRLQKAVINLQKSCETKERSLNAKDQEIQMLMKKVNALTKSIEVESKKV  549



>ref|XP_010270218.1| PREDICTED: microtubule-associated protein 70-5 isoform X1 [Nelumbo 
nucifera]
Length=580

 Score =   485 bits (1248),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 336/576 (58%), Positives = 414/576 (72%), Gaps = 59/576 (10%)
 Frame = -3

Query  2015  GYEEVGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEEL  1836
             G EE+   EL L  +DP  +EL  LQ+QLKEKE+ELGV+  E K LR TE LKDKA+EEL
Sbjct  3     GLEELTGKELFLALSDPVAIELNRLQDQLKEKEQELGVSHGEIKALRVTEALKDKAIEEL  62

Query  1835  GNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIP  1656
              +++K+L+EK + +ENL+E KNLE KKL NEKKEAL AQ+AAEA LRRVY  QKE++  P
Sbjct  63    NDKLKKLDEKFRAAENLIESKNLEIKKLTNEKKEALAAQFAAEATLRRVYVNQKEENFFP  122

Query  1655  IESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEV  1476
             +E+VIAPLEA+IKMYKNEIAALQED +A+ER  KSKE+ALLEAERIL+SALER LIVEE+
Sbjct  123   LEAVIAPLEADIKMYKNEIAALQEDNKALERITKSKESALLEAERILRSALERALIVEEI  182

Query  1475  QNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYr  1296
             QN+NFEL+RQIEICQEENK L+KTNRQKV+EVE+LSQTI ELEE+ILAGG AAN IRDY+
Sbjct  183   QNENFELKRQIEICQEENKTLEKTNRQKVVEVEKLSQTIQELEESILAGGVAANVIRDYQ  242

Query  1295  rqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQ  1116
             RQISE+ EE+RTLERELAR+KVSANRVA +VANEWKD+NDKVMP+KQWLEERR  QAE+Q
Sbjct  243   RQISELNEEKRTLERELARIKVSANRVAAVVANEWKDDNDKVMPIKQWLEERRFFQAEIQ  302

Query  1115  RLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLF  936
             RLKDKL +SERTAKAEA LKD+L++RLKTLE+GLKQ  N ++N     G  K EK N++ 
Sbjct  303   RLKDKLTLSERTAKAEAHLKDRLRMRLKTLEEGLKQVPNLSINLNAPCGSRKTEKPNYIL  362

Query  935   GILSS----KKRSASQPRASMV-NTTseqesssensgEYND-----------------QK  822
             G LS+    +++S SQP +S+  N  S  E  +   G  ND                 +K
Sbjct  363   GFLSNNAGLRRKSTSQPMSSVASNKASLIEQPNLEIGTANDAEQLRRANSLKLIYDSGEK  422

Query  821   KRHHGLWYSRNKI---DEKENAGMKENSD-----------------------------KL  738
             K    LW SR K+   D+K+ A MKENS+                             ++
Sbjct  423   KWITSLWASRLKMLDNDDKKTAEMKENSNVNVVKCFHDESAVPEEIRTDGNKIDSEISQI  482

Query  737   TDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKA  558
              D+G      EDMVSGFLYDRLQ+EVIN+RK  + K+  +N KDEEIKML KK++TL +A
Sbjct  483   ADAGG-----EDMVSGFLYDRLQREVINLRKYCEEKDATVNAKDEEIKMLMKKVDTLARA  537

Query  557   IEVESRKTKREAAIREKDSSTIKYKYDGNIRQTNSS  450
             +E+ES+K KREAA RE++ S         IR +N S
Sbjct  538   MEIESKKMKREAAARERELSAKMESNKQKIRSSNFS  573



>ref|XP_004295329.1| PREDICTED: microtubule-associated protein 70-5-like [Fragaria 
vesca subsp. vesca]
Length=541

 Score =   480 bits (1235),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 327/535 (61%), Positives = 410/535 (77%), Gaps = 17/535 (3%)
 Frame = -3

Query  2030  IKMAAGYEEVGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDK  1851
             +++A G    G  +  L+  DP +LEL  + N LKEK RELG+AQ E K LRATE LKDK
Sbjct  9     LQLAGG----GAEDQSLVTADPVVLELNRMHNVLKEKNRELGIAQGEIKALRATEVLKDK  64

Query  1850  ALEELGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKE  1671
             A EEL NEV++L+EK ++++ L+EQKNLE KKL +EKK+AL AQYAAEA LRRV+  +K+
Sbjct  65    AAEELRNEVEKLDEKHRLTQTLLEQKNLEIKKLTDEKKDALAAQYAAEATLRRVHTSRKD  124

Query  1670  DDSIPIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVL  1491
             DD   +ES+IAPLEAEIKM KNEIAALQEDK+A+ER  KSKE ALLEAERIL+SALER L
Sbjct  125   DDLPSLESIIAPLEAEIKMCKNEIAALQEDKKALERLTKSKELALLEAERILRSALERAL  184

Query  1490  IVEEVQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANT  1311
             IVEEVQNQNFELRRQIEICQEEN+IL++TNRQKVLEVE+LSQTI ELEEAILAGGAAAN 
Sbjct  185   IVEEVQNQNFELRRQIEICQEENRILERTNRQKVLEVEKLSQTIQELEEAILAGGAAANA  244

Query  1310  IRDYrrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRIL  1131
             IRDY+RQI E+ +E++TLERELARVKVSANRVAT+VANEWKDENDKVMPVKQWLE+RR++
Sbjct  245   IRDYKRQIDELHDEKKTLERELARVKVSANRVATVVANEWKDENDKVMPVKQWLEDRRLM  304

Query  1130  QAEMQRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEK  951
             QAEMQR+++KLAIS+RTAKAEAQLK+KLKLRLKTLE+GLK   + +VNP       K EK
Sbjct  305   QAEMQRMREKLAISDRTAKAEAQLKEKLKLRLKTLEEGLKHVSSFSVNPNSFCRSPKTEK  364

Query  950   ANHLFGILSSK----KRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKI  783
             +++  G L+S     KRS SQPRAS + ++  Q+       E  + K          NK 
Sbjct  365   SSNFLGFLTSPGGLGKRSTSQPRASSLRSSPLQQPIDSGEKENTEGKTN-----TDNNKN  419

Query  782   DEKENAG---MKENSDKLTDSG-NFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLN  615
             D+K  +     K+ +D+ + S  + +   ED+VSGFLYDRLQKEVIN+R+  ++KE D+ 
Sbjct  420   DDKTVSADIKTKDGADEDSPSKISINCESEDVVSGFLYDRLQKEVINLRRHCEVKETDMT  479

Query  614   TKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQTNSS  450
              K++EIK+L KK++ LTKA+EVES++ KREA  R+K+++  K   +   R  NSS
Sbjct  480   AKEQEIKLLMKKVDALTKAMEVESKRMKREAIARDKEAAAAKVDDNKKNRTINSS  534



>gb|KDP32904.1| hypothetical protein JCGZ_13685 [Jatropha curcas]
Length=539

 Score =   479 bits (1233),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 325/527 (62%), Positives = 402/527 (76%), Gaps = 41/527 (8%)
 Frame = -3

Query  1925  EKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKLKISENLVEQKNLETKKLIN  1746
             EK+RELG AQ+E K LR TE  K+KA+EEL +EV +L+EK+ + EN++E KNLE KKL N
Sbjct  10    EKDRELGAAQAEIKALRTTEVSKNKAIEELTSEVNKLDEKIIVMENIMEHKNLEIKKLTN  69

Query  1745  EKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEIKMYKNEIAALQEDKRAME  1566
             EKK+AL AQYAAEA LRRVYA QK++DS+PIES +APLEAEIKMYKNEIAALQEDK+AME
Sbjct  70    EKKDALAAQYAAEATLRRVYANQKDNDSLPIESFLAPLEAEIKMYKNEIAALQEDKKAME  129

Query  1565  RHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIEICQEENKILDKTNRQKVL  1386
             R  KSKE+ALLEAERIL+SALER LIVEEVQNQN+EL+RQIEIC EEN+IL+KTNRQKVL
Sbjct  130   RLTKSKESALLEAERILQSALERALIVEEVQNQNYELKRQIEICHEENRILEKTNRQKVL  189

Query  1385  EVERLSQTileleeailaggaaANTIRDYrrqiseiqeerrtlerelaRVKVSANRVATI  1206
             EVE+LSQTI ELEEAILAGGAAANTIRDY+RQISE+ EE+R LERELAR KV+ANRVAT+
Sbjct  190   EVEKLSQTIHELEEAILAGGAAANTIRDYKRQISELNEEKRMLERELARAKVNANRVATV  249

Query  1205  VANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktL  1026
             VANEWKDE+DKVMPV+Q+LEERR+ QAEMQRL+DK+A+ ERTAKAEAQLKDK KLRLKTL
Sbjct  250   VANEWKDESDKVMPVQQYLEERRLFQAEMQRLRDKIAVLERTAKAEAQLKDKFKLRLKTL  309

Query  1025  EQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILSS----KKRSASQPRASMVNTTseqes  858
             E+GLK   + +VN   + G  KP K++++ G L+S    +KRS+SQPRAS ++ T+  + 
Sbjct  310   EEGLKHVSSFSVNSDAIPGSPKPAKSSNILGFLTSTGGLRKRSSSQPRASSISRTTPLQQ  369

Query  857   ssensgEYN-----------------DQKKRHHGLWYSRNKI---DEKENAGMKENSD--  744
              +  + + N                  + K  + LW SR+KI     KENA +K N+D  
Sbjct  370   PNIENDKANAATELKIADSFKKKYRSGENKLRNSLWASRSKIINGSGKENAELKANTDAN  429

Query  743   ------------KLTDSGN---FSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTK  609
                         K   SGN    +   ED++SGFLYDRLQKEV+N+RK  + K++DLN K
Sbjct  430   IEKHKNDHMIEMKNKGSGNEELHNSESEDVISGFLYDRLQKEVLNLRKSCETKDSDLNAK  489

Query  608   DEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNI  468
             D+EI++L KK+E LTKAIEVES+K +RE A REK++ + K  +   I
Sbjct  490   DQEIQLLIKKVEALTKAIEVESKKARRELAAREKEALSAKVDHTKKI  536



>ref|XP_007147624.1| hypothetical protein PHAVU_006G140300g [Phaseolus vulgaris]
 gb|ESW19618.1| hypothetical protein PHAVU_006G140300g [Phaseolus vulgaris]
Length=571

 Score =   480 bits (1236),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 333/569 (59%), Positives = 415/569 (73%), Gaps = 49/569 (9%)
 Frame = -3

Query  2024  MAAGYEEVGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKAL  1845
             M A  E     EL L+  DP  L++  LQNQL EK +EL   QSE K LRATE  KDKA+
Sbjct  1     MVASEEVYSGEELPLVQPDPVGLQIDRLQNQLTEKAKELATCQSEIKALRATEAKKDKAI  60

Query  1844  EELGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDD  1665
             EEL NEV +L+E+L ++++ ++ K LE KKL  EK++AL AQYAAEA LRR++A+QKEDD
Sbjct  61    EELRNEVSKLDERLGLTQDHLKHKKLEIKKLTEEKRDALAAQYAAEATLRRLHADQKEDD  120

Query  1664  SIPIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIV  1485
              +P+ESVI PLEAEIKMY+NEIAALQEDK+A+ER  KSKEAALLEAE+IL++ALERVLIV
Sbjct  121   FVPLESVITPLEAEIKMYRNEIAALQEDKKALERLTKSKEAALLEAEKILRTALERVLIV  180

Query  1484  EEVQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIR  1305
             EEVQN+NF+L+RQIEICQEENKIL+KT+RQK+LEVE+LSQTI ELEE IL+ G  AN +R
Sbjct  181   EEVQNENFDLKRQIEICQEENKILEKTHRQKILEVEKLSQTIYELEEVILSSGVNANAVR  240

Query  1304  DYrrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQA  1125
             DY+RQISE+QEE+RTLERELARVKVSANRVAT+VANEWKDENDKVMPVKQWLEERRI+QA
Sbjct  241   DYQRQISELQEEKRTLERELARVKVSANRVATVVANEWKDENDKVMPVKQWLEERRIMQA  300

Query  1124  EMQRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKAN  945
             EMQRLK+KLAISERTAKAE+QLKDKLKLRLKTLE+GLK   N++      SG  K +K+N
Sbjct  301   EMQRLKEKLAISERTAKAESQLKDKLKLRLKTLEEGLKHFSNSSN-----SGSEKAQKSN  355

Query  944   HLFGILSS---KKRSASQPRASMVN----------------TTseqesssensgEYNDQK  822
              L  + ++   + RS SQPR S                   T +    S       + + 
Sbjct  356   ILSFLTTNGGLRNRSTSQPRGSTAGSSLFPKTNVKNNIESVTANLIPGSILRKKCSSAEN  415

Query  821   KRHHGLWYSRNKI----------------------DEKENAGMKENSDKLTDSGNFSKND  708
                 G+W SRNK+                      DE+E A +K   +   DS + S ND
Sbjct  416   MLKKGIWASRNKVVDSDEKENKMQVNTGINSNKRSDEREAAQIKTTVEDDEDSKSNSCND  475

Query  707   ---EDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRK  537
                 D+VSGFLYD+LQKEVIN+RK  ++KE+ L+TK+EEIKMLTKK++ LTKA+E+E +K
Sbjct  476   LGSNDVVSGFLYDKLQKEVINLRKSCEIKESSLHTKEEEIKMLTKKVDALTKAMEIEWKK  535

Query  536   TKREAAIREKDSSTIKYKYDGNIRQTNSS  450
              KREAA R+K++++IK   +  IR++NSS
Sbjct  536   MKREAAARDKEAASIKSDDNRKIRRSNSS  564



>ref|XP_008224620.1| PREDICTED: microtubule-associated protein 70-5 [Prunus mume]
Length=579

 Score =   476 bits (1226),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 329/541 (61%), Positives = 407/541 (75%), Gaps = 48/541 (9%)
 Frame = -3

Query  2015  GYEEVGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEEL  1836
             G   +G  +L L+H DP +LEL  + N L EK RELG+AQ E K LRA E LKDKA+EEL
Sbjct  9     GVGRIGGEDLSLVHPDPVVLELNRMHNLLTEKSRELGIAQGEIKALRACEVLKDKAVEEL  68

Query  1835  GNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIP  1656
              NEV++L+EK +++E+L+E KNLE KKL ++K++AL AQYAAEA LRRV+A +K+D+S  
Sbjct  69    INEVQKLDEKHRVTESLLEHKNLEIKKLTDDKRDALAAQYAAEATLRRVHANRKDDESPS  128

Query  1655  IESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEV  1476
             IESV+APLEAEIKM+KNEIAALQED +A++R  KSKE+ALLEAERIL+SALER LIVEEV
Sbjct  129   IESVVAPLEAEIKMHKNEIAALQEDNKALQRLTKSKESALLEAERILRSALERALIVEEV  188

Query  1475  QNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYr  1296
             QN NFEL+RQIEICQEEN+IL+KTNRQKVLEVE+LSQTI ELEEAILAGGAAAN IRDYR
Sbjct  189   QNHNFELKRQIEICQEENRILEKTNRQKVLEVEKLSQTIQELEEAILAGGAAANAIRDYR  248

Query  1295  rqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQ  1116
             RQI E+ EE+R+LERELARVKVSANRVAT++ANEWK+ENDKVMPVKQWLEERR++QA+MQ
Sbjct  249   RQIEELHEEKRSLERELARVKVSANRVATVIANEWKEENDKVMPVKQWLEERRLMQADMQ  308

Query  1115  RLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLF  936
             RL++KLAIS+RTAKAEAQLK+KLKLRLKTLE+GLK    ++ NP  L    K EK+++  
Sbjct  309   RLREKLAISDRTAKAEAQLKEKLKLRLKTLEEGLKHV--SSFNPH-LCVSPKAEKSSNFL  365

Query  935   GILSSK----KRSASQPRASMV---------NTTseqesssensgEYNDQKKRHH-----  810
             G L S     KRS SQPRAS +         N+ +E  +++      N  +K++      
Sbjct  366   GFLKSNGGLGKRSTSQPRASTIARSSPVQQPNSDNEAGNAAGQLKRSNSLRKKYGSGELM  425

Query  809   ---GLWYSRNK---IDEKENAGMKENSD-------------KLTDSGN--------FSKN  711
                 LW SR+K   I EKEN  MK N+D             +    GN         S +
Sbjct  426   LKKSLWASRSKVVDIGEKENTEMKANNDTNKNDDRMVAAEIEAQAGGNEDSPNKISTSCD  485

Query  710   DEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTK  531
             +EDMVSGFLYDRLQKEV+N+R+  + KE D+N KD+EIKML KK++ L+KA+EVES+K K
Sbjct  486   NEDMVSGFLYDRLQKEVLNLRRHCEAKEGDMNAKDQEIKMLMKKVDALSKAMEVESKKMK  545

Query  530   R  528
             R
Sbjct  546   R  546



>gb|KGN49039.1| hypothetical protein Csa_6G511060 [Cucumis sativus]
Length=573

 Score =   476 bits (1225),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 324/539 (60%), Positives = 404/539 (75%), Gaps = 40/539 (7%)
 Frame = -3

Query  2024  MAAGYEE-VGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKA  1848
             M   YEE VG  E C++H DP +LEL  L N L EK RELG A+ E K L+ATE  KDKA
Sbjct  1     MVNYYEEHVGREEACVVHPDPVVLELNRLHNLLSEKNRELGTARCEIKALKATEAQKDKA  60

Query  1847  LEELGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKED  1668
             LEEL +EV +L++KL+ +ENL+E KNLE KKL  EKK+A+ AQYAAEA LRRVYA QK+D
Sbjct  61    LEELKSEVDKLDDKLRATENLLEHKNLEIKKLTTEKKDAVAAQYAAEATLRRVYANQKDD  120

Query  1667  DSIPIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLI  1488
             DS+ + SV+APLEAEIK+YKNE+A LQEDK+A+ER  KSKEAALLEAE+IL+SALER LI
Sbjct  121   DSLTLASVVAPLEAEIKIYKNEVALLQEDKKALERLTKSKEAALLEAEKILRSALERALI  180

Query  1487  VEEVQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTI  1308
             VEEVQN NFEL+RQIEICQEEN+IL+KTNRQKV+EVERL QTI +LEEAILAGGA AN +
Sbjct  181   VEEVQNHNFELKRQIEICQEENRILEKTNRQKVIEVERLGQTIEDLEEAILAGGATANMV  240

Query  1307  RDYrrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQ  1128
             RDY+RQI E+ EE+RTLERELAR KVSA+RVAT+VANEWKDENDKVMPVKQWLEER++LQ
Sbjct  241   RDYKRQIEELHEEKRTLERELARAKVSAHRVATVVANEWKDENDKVMPVKQWLEERKLLQ  300

Query  1127  AEMQRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKA  948
             AE+QR+K+KLAISERTAKAEAQLK+K KLRLKTLE+GLKQ   +++N   + G  K E++
Sbjct  301   AELQRVKEKLAISERTAKAEAQLKEKFKLRLKTLEEGLKQIQISSLNSNAICGSPKAERS  360

Query  947   NHLFGILSS--KKRSASQPRAS--------MVNTTseqesssensgEYNDQKKRH-----  813
             N++ G L+S  +KRS S  R S        +V T   +++++      N  KK++     
Sbjct  361   NNILGFLTSNGRKRSTSLSRPSTITKNSNILVQTADYEKATAPELSRSNSLKKKYASARE  420

Query  812   ----HGLWYS-RNK---IDEKENAGMKENSD----KLTDSGNFSKN------------DE  705
                   +W + R++   IDEKE   M+ N +     +TDS   +              +E
Sbjct  421   NVIKKSMWATGRSRVVDIDEKEGNEMRGNKENRNATITDSKETNDGEELDNKEPINLENE  480

Query  704   DMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKR  528
             D VSGFLYD++QKEVIN+RK  ++K+ +LN KDEEIKML KK++ LTKA+EVES+K KR
Sbjct  481   DTVSGFLYDKIQKEVINLRKLCEVKDGNLNAKDEEIKMLMKKVDALTKAMEVESKKMKR  539



>ref|XP_002522887.1| Myosin heavy chain, clone, putative [Ricinus communis]
 gb|EEF39487.1| Myosin heavy chain, clone, putative [Ricinus communis]
Length=531

 Score =   471 bits (1213),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 327/538 (61%), Positives = 402/538 (75%), Gaps = 27/538 (5%)
 Frame = -3

Query  2024  MAAGYEE------VGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQ  1863
             M  GYEE      VG  EL L   +P +LEL  L N LKEK+R+LG AQ+E K LR TE 
Sbjct  1     MVMGYEEQLLGGGVGEEELSLSQLNPLVLELNRLNNLLKEKDRDLGAAQAEIKALRTTEV  60

Query  1862  LKDKALEELGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYA  1683
              KDKA+E+L N V +L+EKL ++EN VE KNLE KKLIN+KK+AL AQYAAEA LRRV+A
Sbjct  61    SKDKAIEQLKNAVNKLDEKLTVTENFVEHKNLEIKKLINDKKDALAAQYAAEATLRRVHA  120

Query  1682  EQKEDDSIPIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSAL  1503
              QK+DDS+PIE +IAPLEA+IK+YKNEI ALQEDK+A+ER  KSKE+ALLEAERIL+SAL
Sbjct  121   NQKDDDSLPIECLIAPLEADIKLYKNEIVALQEDKKALERLTKSKESALLEAERILRSAL  180

Query  1502  ERVLIVEEVQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailagga  1323
             ER LIVEEVQNQN+EL+RQIEICQEEN+IL+KTNRQKV+EVE+LSQTI ELE+ ILAGGA
Sbjct  181   ERALIVEEVQNQNYELKRQIEICQEENRILEKTNRQKVMEVEKLSQTIEELEQTILAGGA  240

Query  1322  aANTIRDYrrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEE  1143
             AAN+IRDY+RQISE+ EE+R LERELAR KVSANRVAT+VANEWKDEN++VMPVKQWLEE
Sbjct  241   AANSIRDYKRQISELNEEKRMLERELARAKVSANRVATVVANEWKDENERVMPVKQWLEE  300

Query  1142  RRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFS  963
             RRI+QAEMQRLKDKLAISERTAKAEA LKDK K+RLKTLE+GLKQ  +  VN     G  
Sbjct  301   RRIMQAEMQRLKDKLAISERTAKAEALLKDKFKIRLKTLEEGLKQVSSFTVNSNAFCGSP  360

Query  962   KPEKANHLFGILSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKI  783
             KP K +++ G L+S      + R  + +++ ++ +  + + + N  K ++  L  S    
Sbjct  361   KPAKTSNILGFLTS--NGGLKKRTKVTDSSGKENTEVKANTDLNLDKLKNEDLIIS----  414

Query  782   DEKENAGMKENSDKLTDSGNFSKND-------EDMVSGFLYDRLQKEVINMRKCFDMKEN  624
                      E  +K T + N  KN        ED+VSGFLYDRLQKEV+N+RK  + ++ 
Sbjct  415   --------AEIKNKATGNDNLLKNKESASPEFEDVVSGFLYDRLQKEVLNLRKSCEARDI  466

Query  623   DLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQTNSS  450
              L+ KD+EI+ML KK++ LTKAIEVES+K KREAA +EK+  + K      I   NSS
Sbjct  467   SLSAKDQEIQMLAKKVDALTKAIEVESKKVKREAAPKEKEPVSTKVDNPKRIGSMNSS  524



>ref|XP_007212811.1| hypothetical protein PRUPE_ppa002850mg [Prunus persica]
 gb|EMJ14010.1| hypothetical protein PRUPE_ppa002850mg [Prunus persica]
Length=628

 Score =   474 bits (1220),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 328/541 (61%), Positives = 407/541 (75%), Gaps = 48/541 (9%)
 Frame = -3

Query  2015  GYEEVGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEEL  1836
             G   VG  +L L+H DP +LEL  + N L EK RELG+AQ E K LRA E LKDKA+EEL
Sbjct  9     GVGRVGGEDLSLVHPDPVVLELNRMHNLLTEKSRELGIAQGEIKALRACEVLKDKAVEEL  68

Query  1835  GNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIP  1656
              NEV++L+EK +++E+L+E KNLE KKL ++K++AL AQYAAEA +RRV+A +K+D+S  
Sbjct  69    INEVQKLDEKHRVTESLLEHKNLEIKKLTDDKRDALAAQYAAEATVRRVHANRKDDESPS  128

Query  1655  IESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEV  1476
             IESV+APLEAEIKM+KNEIAALQED +A++R  KSKE+ALLEAERIL+SALER LIVEEV
Sbjct  129   IESVVAPLEAEIKMHKNEIAALQEDNKALQRLTKSKESALLEAERILRSALERALIVEEV  188

Query  1475  QNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYr  1296
             QN N EL+RQIEICQEEN+IL+KTNRQKVLEVE+LSQTI ELEEAILAGGAAAN IRDY+
Sbjct  189   QNHNVELKRQIEICQEENRILEKTNRQKVLEVEKLSQTIQELEEAILAGGAAANAIRDYK  248

Query  1295  rqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQ  1116
             RQI E+ EE+R+LERELARVKVSANRVAT++ANEWKDENDKVMPVKQWLEERR++QA+MQ
Sbjct  249   RQIEELHEEKRSLERELARVKVSANRVATVIANEWKDENDKVMPVKQWLEERRLMQADMQ  308

Query  1115  RLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLF  936
             RL++KLAIS+RTAKAEAQLK+KLKLRLKTLE+GLK    ++ NP  L    K EK+++  
Sbjct  309   RLREKLAISDRTAKAEAQLKEKLKLRLKTLEEGLKHV--SSFNPH-LCVSPKAEKSSNFL  365

Query  935   GILSSK----KRSASQPRASMV---------NTTseqesssensgEYNDQKKRHH-----  810
             G L S     KRS SQPRAS +         N+ +E  +++      N  +K++      
Sbjct  366   GFLKSNGGLGKRSTSQPRASTIARSSPVQQPNSDNEAGNAAGQLKRSNSLRKKYGSGELM  425

Query  809   ---GLWYSRNK---IDEKENAGMKENSD-------------KLTDSGN--------FSKN  711
                 LW SR+K   I EKEN  MK N+D             +    GN         S +
Sbjct  426   LKKSLWASRSKVVDIGEKENTEMKANNDTNKNDDRMVATEIEAQAGGNEDSPNKISTSCD  485

Query  710   DEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTK  531
             +EDMVSGFLYDRLQKEV+N+R+  + KE+D+N KD+EIKML KK++ L+KA+EVES+K K
Sbjct  486   NEDMVSGFLYDRLQKEVLNLRRHCEAKESDMNAKDQEIKMLMKKVDALSKAMEVESKKMK  545

Query  530   R  528
             R
Sbjct  546   R  546



>ref|XP_006597612.1| PREDICTED: microtubule-associated protein 70-5 [Glycine max]
 gb|KHN34218.1| Microtubule-associated protein 70-5 [Glycine soja]
Length=571

 Score =   470 bits (1209),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 345/569 (61%), Positives = 425/569 (75%), Gaps = 46/569 (8%)
 Frame = -3

Query  2024  MAAGYEEVGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKAL  1845
             M A  +  G  E+ L+  DP  L++  LQNQL EK +EL   QSE K LRATE  KDKA+
Sbjct  1     MVASEDIYGGEEVSLVQPDPVGLQIDRLQNQLTEKVKELATCQSEIKALRATEAKKDKAI  60

Query  1844  EELGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDD  1665
             EEL NEV +L++KL+++E+ ++ K LE KKL  EKK+AL AQYAAEA LRR++A+QKEDD
Sbjct  61    EELRNEVGKLDDKLRLTEDHLKHKKLEIKKLTEEKKDALAAQYAAEATLRRLHADQKEDD  120

Query  1664  SIPIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIV  1485
              +P+ESVI PLEAEIKMY+NEIA+LQEDK+A+ER  KSKEAALLEAE+IL+SALERVLIV
Sbjct  121   FVPLESVITPLEAEIKMYRNEIASLQEDKKALERLTKSKEAALLEAEKILRSALERVLIV  180

Query  1484  EEVQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIR  1305
             EEVQN+NF+L+RQIEICQEENKIL+KT+RQK+LEVE+LSQTI ELEE IL+ G  AN +R
Sbjct  181   EEVQNENFDLKRQIEICQEENKILEKTHRQKILEVEKLSQTIHELEEVILSSGVNANAVR  240

Query  1304  DYrrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQA  1125
             DY+RQISE+QEE+RTLERELARVKVSANRVAT+VANEWKDENDKVMPVKQWLEERRI+QA
Sbjct  241   DYQRQISELQEEKRTLERELARVKVSANRVATVVANEWKDENDKVMPVKQWLEERRIMQA  300

Query  1124  EMQRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKAN  945
             EMQRLKDKLAISERTAKAE+QLKDKLK+RLKTLE+GLK   NN V+    SG +K EK  
Sbjct  301   EMQRLKDKLAISERTAKAESQLKDKLKMRLKTLEEGLKHFSNNPVSSN--SGSAKSEKYK  358

Query  944   HLFGILSS---KKRSASQPRASM--------VNTTseqesssensgEYNDQKKRH-----  813
              L  + ++   + R  SQPR S          N  S  ES +E+    +  KK++     
Sbjct  359   ILSFLTTNGGLRNRCTSQPRGSTNGSSLFQKSNAKSNTESVTESLIPGSIMKKKYGTAEN  418

Query  812   ---HGLWYSRNKI---DEKE-----NAGM--------------KENSDKLTDSGNFSKND  708
                 G+W SR+K+   DEKE     NAGM              K + D   DS + S ND
Sbjct  419   VLKKGIWASRHKVADSDEKENEMQVNAGMNLNKCNDKKEAAEIKTSVDVDDDSKSNSCND  478

Query  707   ---EDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRK  537
                 D+VSGFLYDRLQKEVIN+RK  ++KE++L TKDEEIKMLTKK++ LTKA+E+E +K
Sbjct  479   LGSNDVVSGFLYDRLQKEVINLRKSCEIKESNLYTKDEEIKMLTKKVDALTKAMEIEWKK  538

Query  536   TKREAAIREKDSSTIKYKYDGNIRQTNSS  450
              KREAA REK++++ K   +  +R++NSS
Sbjct  539   MKREAAAREKEAASTKSDDNRKLRRSNSS  567



>ref|XP_004134988.1| PREDICTED: microtubule-associated protein 70-5-like [Cucumis 
sativus]
Length=515

 Score =   465 bits (1196),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 314/516 (61%), Positives = 384/516 (74%), Gaps = 52/516 (10%)
 Frame = -3

Query  2024  MAAGYEE-VGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKA  1848
             M   YEE VG  E C++H DP +LEL  L N L EK RELG A+ E K L+ATE  KDKA
Sbjct  1     MVNYYEEHVGREEACVVHPDPVVLELNRLHNLLSEKNRELGTARCEIKALKATEAQKDKA  60

Query  1847  LEELGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKED  1668
             LEEL +EV +L++KL+ +ENL+E KNLE KKL  EKK+A+ AQYAAEA LRRVYA QK+D
Sbjct  61    LEELKSEVDKLDDKLRATENLLEHKNLEIKKLTTEKKDAVAAQYAAEATLRRVYANQKDD  120

Query  1667  DSIPIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLI  1488
             DS+ + SV+APLEAEIK+YKNE+A LQEDK+A+ER  KSKEAALLEAE+IL+SALER LI
Sbjct  121   DSLTLASVVAPLEAEIKIYKNEVALLQEDKKALERLTKSKEAALLEAEKILRSALERALI  180

Query  1487  VEEVQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTI  1308
             VEEVQN NFEL+RQIEICQEEN+IL+KTNRQKV+EVERL QTI +LEEAILAGGA AN +
Sbjct  181   VEEVQNHNFELKRQIEICQEENRILEKTNRQKVIEVERLGQTIEDLEEAILAGGATANMV  240

Query  1307  RDYrrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQ  1128
             RDY+RQI E+ EE+RTLERELAR KVSA+RVAT+VANEWKDENDKVMPVKQWLEER++LQ
Sbjct  241   RDYKRQIEELHEEKRTLERELARAKVSAHRVATVVANEWKDENDKVMPVKQWLEERKLLQ  300

Query  1127  AEMQRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKA  948
             AE+QR+K+KLAISERTAKAEAQLK+K KLRLKTLE+GLKQ   +++N   + G  K E++
Sbjct  301   AELQRVKEKLAISERTAKAEAQLKEKFKLRLKTLEEGLKQIQISSLNSNAICGSPKAERS  360

Query  947   NHLFGILSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKEN  768
             N++ G L+S  R     R+ +V+                               IDEKE 
Sbjct  361   NNILGFLTSNGRK----RSRVVD-------------------------------IDEKEG  385

Query  767   AGMKENSD----KLTDSGNFSKN------------DEDMVSGFLYDRLQKEVINMRKCFD  636
               M+ N +     +TDS   +              +ED VSGFLYD++QKEVIN+RK  +
Sbjct  386   NEMRGNKENRNATITDSKETNDGEELDNKEPINLENEDTVSGFLYDKIQKEVINLRKLCE  445

Query  635   MKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKR  528
             +K+ +LN KDEEIKML KK++ LTKA+EVES+K KR
Sbjct  446   VKDGNLNAKDEEIKMLMKKVDALTKAMEVESKKMKR  481



>ref|XP_004168631.1| PREDICTED: microtubule-associated protein 70-5-like [Cucumis 
sativus]
Length=515

 Score =   465 bits (1196),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 314/516 (61%), Positives = 384/516 (74%), Gaps = 52/516 (10%)
 Frame = -3

Query  2024  MAAGYEE-VGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKA  1848
             M   YEE VG  E C++H DP +LEL  L N L EK RELG A+ E K L+ATE  KDKA
Sbjct  1     MVNYYEEHVGREEACVVHPDPLVLELNRLHNLLSEKNRELGTARCEIKALKATEAQKDKA  60

Query  1847  LEELGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKED  1668
             LEEL +EV +L++KL+ +ENL+E KNLE KKL  EKK+A+ AQYAAEA LRRVYA QK+D
Sbjct  61    LEELKSEVDKLDDKLRATENLLEHKNLEIKKLTTEKKDAVAAQYAAEATLRRVYANQKDD  120

Query  1667  DSIPIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLI  1488
             DS+ + SV+APLEAEIK+YKNE+A LQEDK+A+ER  KSKEAALLEAE+IL+SALER LI
Sbjct  121   DSLTLASVVAPLEAEIKIYKNEVALLQEDKKALERLTKSKEAALLEAEKILRSALERALI  180

Query  1487  VEEVQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTI  1308
             VEEVQN NFEL+RQIEICQEEN+IL+KTNRQKV+EVERL QTI +LEEAILAGGA AN +
Sbjct  181   VEEVQNHNFELKRQIEICQEENRILEKTNRQKVIEVERLGQTIEDLEEAILAGGATANMV  240

Query  1307  RDYrrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQ  1128
             RDY+RQI E+ EE+RTLERELAR KVSA+RVAT+VANEWKDENDKVMPVKQWLEER++LQ
Sbjct  241   RDYKRQIEELHEEKRTLERELARAKVSAHRVATVVANEWKDENDKVMPVKQWLEERKLLQ  300

Query  1127  AEMQRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKA  948
             AE+QR+K+KLAISERTAKAEAQLK+K KLRLKTLE+GLKQ   +++N   + G  K E++
Sbjct  301   AELQRVKEKLAISERTAKAEAQLKEKFKLRLKTLEEGLKQIHISSLNGNAICGSPKAERS  360

Query  947   NHLFGILSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKEN  768
             N++ G L+S  R     R+ +V+                               IDEKE 
Sbjct  361   NNILGFLTSNGRK----RSRVVD-------------------------------IDEKEG  385

Query  767   AGMKENSD----KLTDSGNFSKN------------DEDMVSGFLYDRLQKEVINMRKCFD  636
               M+ N +     +TDS   +              +ED VSGFLYD++QKEVIN+RK  +
Sbjct  386   NEMRGNKENRNATITDSKETNDGEELDNKEPINLENEDTVSGFLYDKIQKEVINLRKLCE  445

Query  635   MKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKR  528
             +K+ +LN KDEEIKML KK++ LTKA+EVES+K KR
Sbjct  446   VKDGNLNAKDEEIKMLMKKVDALTKAMEVESKKMKR  481



>ref|XP_006586778.1| PREDICTED: microtubule-associated protein 70-5-like [Glycine 
max]
Length=571

 Score =   466 bits (1199),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 340/570 (60%), Positives = 427/570 (75%), Gaps = 48/570 (8%)
 Frame = -3

Query  2024  MAAGYEEVGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKAL  1845
             M A  E  G  EL L+  DP  L++  L NQL EK +EL   QSE K LRATE  KDKA+
Sbjct  1     MVASEEIYGGEELSLVQPDPMGLQIDRLHNQLTEKVKELANCQSEIKALRATEAKKDKAI  60

Query  1844  EELGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDD  1665
             EEL NEV +L++KL+++E+ ++ K LE KKL  EKK+AL AQYAAEA LRR++A+QKEDD
Sbjct  61    EELRNEVGKLDDKLRLTEDHLKHKKLEIKKLTEEKKDALAAQYAAEATLRRLHADQKEDD  120

Query  1664  SIPIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIV  1485
              +P+ESVI PLEAEIKMY+NEIA+LQEDK+A+ER  KSKEAALLEAE+IL+SALERVLIV
Sbjct  121   FVPLESVITPLEAEIKMYRNEIASLQEDKKALERLTKSKEAALLEAEKILRSALERVLIV  180

Query  1484  EEVQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIR  1305
             EEVQN+NF+L+RQIEICQEE KIL+KT+RQK+LEVE+LSQTI ELEE IL+ G  AN IR
Sbjct  181   EEVQNENFDLKRQIEICQEEIKILEKTHRQKILEVEKLSQTIHELEEIILSSGVNANAIR  240

Query  1304  DYrrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQA  1125
             DY+RQISE+QEE+RTLERELARVKVSANRVAT+VANEWKDENDKVMPVKQWLEERRI+QA
Sbjct  241   DYQRQISELQEEKRTLERELARVKVSANRVATVVANEWKDENDKVMPVKQWLEERRIMQA  300

Query  1124  EMQRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKAN  945
             EMQRLKDKLAISERTAKAE+QLKDKLKLRLKTLE+GLK   N+ V+   +S  S+  K  
Sbjct  301   EMQRLKDKLAISERTAKAESQLKDKLKLRLKTLEEGLKHFSNHPVSSNSVSAKSEKSK--  358

Query  944   HLFGILSS----KKRSASQPRASMVNTTseqesssensgEY--------NDQKKRH----  813
              +   L++    + RS SQPR S + ++  Q+S+++++ +         +  KK++    
Sbjct  359   -ILSFLTTNSGLRNRSTSQPRGSAIGSSLFQKSNAKSNTDSVTGSLIPGSIMKKKYGSAE  417

Query  812   ----HGLWYSRNKI---DEKEN-----AGMKENS--------------DKLTDSGNFSKN  711
                  G+W SR+K+   DEKEN     AGM  N               D   DS + S N
Sbjct  418   NVLKKGIWASRHKVADSDEKENEMQVNAGMNSNKCNDEKEAAEIKTSIDDNDDSKSNSCN  477

Query  710   D---EDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESR  540
             D    D+VSGFLYDRLQKE IN+RK  ++KE++L+TKDEEIK+LTKK++ LTKA+E+E +
Sbjct  478   DLGSNDVVSGFLYDRLQKEFINLRKSCEIKESNLHTKDEEIKILTKKVDALTKAMEIEWK  537

Query  539   KTKREAAIREKDSSTIKYKYDGNIRQTNSS  450
             K KREAA REK++++ K   +  +R++NSS
Sbjct  538   KMKREAAAREKEAASTKSDDNRKLRRSNSS  567



>emb|CAN63131.1| hypothetical protein VITISV_001458 [Vitis vinifera]
Length=605

 Score =   466 bits (1198),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 345/609 (57%), Positives = 403/609 (66%), Gaps = 115/609 (19%)
 Frame = -3

Query  2000  GVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVK  1821
             G  EL L H+DP +LE   LQNQLKEK+RELGVA SE K LRAT  LKDKALE+  NEV 
Sbjct  11    GGDELSLAHSDPIVLEFNRLQNQLKEKDRELGVASSEIKALRATIVLKDKALEQFRNEVN  70

Query  1820  RLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVI  1641
             +L+E+L + ENL++QK+LE KKL +EKK+ L AQ+AAEAALRRV+A QK+DD++PIE VI
Sbjct  71    KLDERLGVIENLLKQKDLEIKKLTSEKKDXLAAQFAAEAALRRVHANQKDDDTVPIEDVI  130

Query  1640  APLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNF  1461
             APLEA+IKMYK EI  LQED +A+ERH KSKE+ALLEAERIL+SALER LIVEEVQNQNF
Sbjct  131   APLEADIKMYKIEIGRLQEDNKALERHIKSKESALLEAERILRSALERALIVEEVQNQNF  190

Query  1460  ELRRQIEIC----------------------------QEENKILDKTNRQKVLEVERLSQ  1365
             EL+RQIEIC                            QEENKILDKTNRQKVLEVE+LSQ
Sbjct  191   ELKRQIEICQARFPARPFYVQCVILTFKFTQVKIFHSQEENKILDKTNRQKVLEVEKLSQ  250

Query  1364  TileleeailaggaaANTIRDYrrqiseiqeerrtlerelaRVKVSANRVATIVANEWKD  1185
             TI ELEEAILAGG AAN IRDYRRQISE+ EE+RTLERELARVKVSANRVAT+VANEWKD
Sbjct  251   TIQELEEAILAGGVAANAIRDYRRQISELNEEKRTLERELARVKVSANRVATVVANEWKD  310

Query  1184  ENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQT  1005
             ENDKVMP+KQWLEERR+LQAE QRL+DKLAISERTAKAEAQLKDKLKLRLKTLE+GLKQ 
Sbjct  311   ENDKVMPIKQWLEERRLLQAETQRLRDKLAISERTAKAEAQLKDKLKLRLKTLEEGLKQ-  369

Query  1004  GNNNVNPKVLSGFSKPEKANHLFGILSS-------------------KKRSASQPRASMV  882
                     V S FSKPEK+N      S                    K+RS SQPR S +
Sbjct  370   --------VSSRFSKPEKSNPYLSCRSPKPENGPITFWRFLSGNGGLKRRSTSQPRGSCI  421

Query  881   NTTse----------qesssensgEYNDQKKRH--------HGLWYSRNKIDE---KENA  765
               TS              ++      N  KK++          LW SR+K+ +   KEN 
Sbjct  422   GKTSPFDWPPNVENGAADAAGELKGVNSLKKKYASGENMLRKSLWASRSKVADIGGKENT  481

Query  764   GMKENSDKLTDS------------------------GNFSKNDEDMVSGFLYDRLQKEVI  657
              MK N+D   D                         G+   + EDMVS FLYDRLQ+EVI
Sbjct  482   EMKSNTDMHIDKFNNDTAVSADAKIKGGAKEETQNVGSAGFDSEDMVSAFLYDRLQREVI  541

Query  656   NMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYD  477
             N+RK  +              ML +K++ L+KAIEVES+K KREAA REK++ + K   +
Sbjct  542   NLRKSCE--------------MLMRKVDALSKAIEVESKKIKREAAAREKEAISTKADEN  587

Query  476   GNIRQTNSS  450
               IR T+SS
Sbjct  588   KKIRNTDSS  596



>ref|XP_010686630.1| PREDICTED: microtubule-associated protein 70-5 [Beta vulgaris 
subsp. vulgaris]
Length=547

 Score =   459 bits (1181),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 305/515 (59%), Positives = 390/515 (76%), Gaps = 33/515 (6%)
 Frame = -3

Query  1976  HTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKLKI  1797
              TDP++LEL  LQNQLKEK+ ELG A +E K  R T+ L++KA++EL     RL+EKL++
Sbjct  16    QTDPYVLELNRLQNQLKEKDNELGDAHNEIKASRVTQALQEKAIDELKTTCNRLDEKLRV  75

Query  1796  SENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEIK  1617
             +EN+++QKNLE KKL  EKK+AL AQ+AAEAALRR++ +QK+DD +PI+S+IAPLEAEIK
Sbjct  76    TENILQQKNLEMKKLAEEKKDALAAQFAAEAALRRLHTDQKDDDFLPIDSIIAPLEAEIK  135

Query  1616  MYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIEI  1437
             MYKNEIA+L +DK+AMER  KSKE ALLE E+IL+SALER LIVE++QNQN ELRR+IEI
Sbjct  136   MYKNEIASLLDDKKAMERLTKSKETALLETEKILRSALERALIVEDIQNQNLELRRKIEI  195

Query  1436  CQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeerrtl  1257
             CQEENKIL+KTNRQKV+EVE+LSQT+ ELEEA+LAGGA AN +RD++R+ISE+ EE+R L
Sbjct  196   CQEENKILEKTNRQKVVEVEKLSQTVQELEEAVLAGGATANVVRDFKRKISELYEEKRIL  255

Query  1256  erelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTA  1077
             ERELAR +VSANRVAT+VANEWKDENDKVMPVKQWLEERR++QAEMQRL+DKLA++ERTA
Sbjct  256   ERELARARVSANRVATVVANEWKDENDKVMPVKQWLEERRVMQAEMQRLRDKLAVTERTA  315

Query  1076  KAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILS----SKKRS  909
             KAEAQLK+K KLRLK +E+GLK   +N   PK           + + G ++    +KKRS
Sbjct  316   KAEAQLKEKFKLRLKVVEEGLKHASSNECTPKT------SNTTHQILGFVTNNGGAKKRS  369

Query  908   ASQPRASMVN--TTseqesssensgEYNDQKKRHH----GLWYSRNKIDEKENAGMKENS  747
             +SQPRAS++N  ++   +   E      +   R +     LW S++K    E  G KENS
Sbjct  370   SSQPRASVINSRSSPLHQPWMEKVNSLENHISRENISKKSLWGSKSKAMGAECGG-KENS  428

Query  746   DKLTDSGNFSKN---------------DEDMVSGFLYDRLQKEVINMRKCFDMKENDLNT  612
             + L    + SKN               +ED VSGFLYDRLQKEVIN+RK    K++ L+ 
Sbjct  429   E-LIAKADMSKNNKSAIQTEIESKDIGNEDAVSGFLYDRLQKEVINLRKTCQAKDDGLSA  487

Query  611   KDEEIKMLTKKIETLTKAIEVESRKTKREAAIREK  507
             K+EEIKML KK++TL+KAIEVE+RK K+E +  +K
Sbjct  488   KEEEIKMLIKKVDTLSKAIEVEARKVKKEPSAGQK  522



>ref|XP_006584097.1| PREDICTED: microtubule-associated protein 70-5-like isoform X2 
[Glycine max]
Length=573

 Score =   459 bits (1181),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 322/560 (58%), Positives = 401/560 (72%), Gaps = 49/560 (9%)
 Frame = -3

Query  1988  LCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEE  1809
             L L+  DP +LE+  LQNQLKEKE+EL   Q E K LR+TE LKDKA+EEL N V +L+E
Sbjct  12    LPLVQPDPVVLEINRLQNQLKEKEKELATCQGEIKALRSTEALKDKAIEELRNGVSKLDE  71

Query  1808  KLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLE  1629
             +L+I+E+ ++QKNLE KKL +EKK AL +QYAAEA LRRV+A QK++D +PIE  IAPLE
Sbjct  72    RLRITEDHLKQKNLEIKKLTDEKKNALASQYAAEATLRRVHANQKDEDFVPIERAIAPLE  131

Query  1628  AEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRR  1449
             AEIKMYKNEI ALQEDK+A+ER  K KE+ALLEAERIL+SAL+R L+VEEV+NQN +L+R
Sbjct  132   AEIKMYKNEITALQEDKKALERLTKLKESALLEAERILRSALDRALVVEEVRNQNIDLKR  191

Query  1448  QIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqee  1269
             QIEICQEENK+L+K +RQK+LEVE+LSQTI ELEE ILA GA AN +RDY++QISE+QEE
Sbjct  192   QIEICQEENKLLEKNHRQKILEVEKLSQTIQELEEVILASGATANAVRDYQQQISELQEE  251

Query  1268  rrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAIS  1089
             +RTLERELARVKVS NR+A  VANEWKDEN KVMPV+QWLEERRI+QAE+QRLKDK AIS
Sbjct  252   KRTLERELARVKVSTNRIANAVANEWKDENHKVMPVRQWLEERRIMQAEIQRLKDKQAIS  311

Query  1088  ERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILSS----  921
             ERTAKAE+QLKDKLKLRLKTLE+GLK   NN +   V     K EK+N + G L++    
Sbjct  312   ERTAKAESQLKDKLKLRLKTLEEGLKHFSNNPITSNVSYASQKAEKSN-ILGFLTTSAGL  370

Query  920   KKRSASQPRASMVNTTseqess--------sensgEYNDQKKRHH--------GLWYSRN  789
             +KRS SQPRA  V ++  Q  +           + +     K++         G+W SR+
Sbjct  371   RKRSTSQPRACTVGSSLFQTPNIKNNRGDIVAGNLKLGSPTKKYGSTENMLTKGIWASRS  430

Query  788   KI---DEKENAGMKENSDKLTDSGNF------------------------SKNDEDMVSG  690
             K+    EKEN  M+ N D   +  N                           + +D+VSG
Sbjct  431   KVADNGEKENE-MQVNRDMTLNRCNDESEATEIKTIVDVEEDPPESKKPKGSSRDDVVSG  489

Query  689   FLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIRE  510
             FLYD+LQKEVIN+RK  ++K++ L  KDEEIKML KK+  LTKA+EVE +K KREAA RE
Sbjct  490   FLYDKLQKEVINLRKSCEIKDSSLQAKDEEIKMLIKKVGVLTKAMEVEWKKMKREAAARE  549

Query  509   KDSSTIKYKYDGNIRQTNSS  450
             K++S+ K   +   R  NSS
Sbjct  550   KEASSTKSDDNRKNRSANSS  569



>ref|XP_006584096.1| PREDICTED: microtubule-associated protein 70-5-like isoform X1 
[Glycine max]
 gb|KHN42272.1| Microtubule-associated protein 70-5 [Glycine soja]
Length=593

 Score =   459 bits (1180),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 322/560 (58%), Positives = 401/560 (72%), Gaps = 49/560 (9%)
 Frame = -3

Query  1988  LCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEE  1809
             L L+  DP +LE+  LQNQLKEKE+EL   Q E K LR+TE LKDKA+EEL N V +L+E
Sbjct  12    LPLVQPDPVVLEINRLQNQLKEKEKELATCQGEIKALRSTEALKDKAIEELRNGVSKLDE  71

Query  1808  KLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLE  1629
             +L+I+E+ ++QKNLE KKL +EKK AL +QYAAEA LRRV+A QK++D +PIE  IAPLE
Sbjct  72    RLRITEDHLKQKNLEIKKLTDEKKNALASQYAAEATLRRVHANQKDEDFVPIERAIAPLE  131

Query  1628  AEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRR  1449
             AEIKMYKNEI ALQEDK+A+ER  K KE+ALLEAERIL+SAL+R L+VEEV+NQN +L+R
Sbjct  132   AEIKMYKNEITALQEDKKALERLTKLKESALLEAERILRSALDRALVVEEVRNQNIDLKR  191

Query  1448  QIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqee  1269
             QIEICQEENK+L+K +RQK+LEVE+LSQTI ELEE ILA GA AN +RDY++QISE+QEE
Sbjct  192   QIEICQEENKLLEKNHRQKILEVEKLSQTIQELEEVILASGATANAVRDYQQQISELQEE  251

Query  1268  rrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAIS  1089
             +RTLERELARVKVS NR+A  VANEWKDEN KVMPV+QWLEERRI+QAE+QRLKDK AIS
Sbjct  252   KRTLERELARVKVSTNRIANAVANEWKDENHKVMPVRQWLEERRIMQAEIQRLKDKQAIS  311

Query  1088  ERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILSS----  921
             ERTAKAE+QLKDKLKLRLKTLE+GLK   NN +   V     K EK+N + G L++    
Sbjct  312   ERTAKAESQLKDKLKLRLKTLEEGLKHFSNNPITSNVSYASQKAEKSN-ILGFLTTSAGL  370

Query  920   KKRSASQPRASMVNTTseqess--------sensgEYNDQKKRHH--------GLWYSRN  789
             +KRS SQPRA  V ++  Q  +           + +     K++         G+W SR+
Sbjct  371   RKRSTSQPRACTVGSSLFQTPNIKNNRGDIVAGNLKLGSPTKKYGSTENMLTKGIWASRS  430

Query  788   KI---DEKENAGMKENSDKLTDSGNF------------------------SKNDEDMVSG  690
             K+    EKEN  M+ N D   +  N                           + +D+VSG
Sbjct  431   KVADNGEKENE-MQVNRDMTLNRCNDESEATEIKTIVDVEEDPPESKKPKGSSRDDVVSG  489

Query  689   FLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIRE  510
             FLYD+LQKEVIN+RK  ++K++ L  KDEEIKML KK+  LTKA+EVE +K KREAA RE
Sbjct  490   FLYDKLQKEVINLRKSCEIKDSSLQAKDEEIKMLIKKVGVLTKAMEVEWKKMKREAAARE  549

Query  509   KDSSTIKYKYDGNIRQTNSS  450
             K++S+ K   +   R  NSS
Sbjct  550   KEASSTKSDDNRKNRSANSS  569



>ref|XP_004486342.1| PREDICTED: microtubule-associated protein 70-5-like [Cicer arietinum]
Length=570

 Score =   454 bits (1169),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 330/563 (59%), Positives = 405/563 (72%), Gaps = 48/563 (9%)
 Frame = -3

Query  2003  VGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEV  1824
             V   EL L+     +LE+  LQNQL EK  EL   Q E K LRATE  KDKA+EEL  E+
Sbjct  4     VASEELPLVQPGAVVLEIDHLQNQLTEKVNELVTCQGEIKALRATEAQKDKAIEELRKEI  63

Query  1823  KRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESV  1644
              +L+E+L++SE+ ++ KNLE K L +EKK+AL AQYAAEAALRR++ ++KEDD +P ESV
Sbjct  64    NKLDERLRLSEDHLKHKNLEIKNLTDEKKDALAAQYAAEAALRRLHIDEKEDDFLPFESV  123

Query  1643  IAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQN  1464
             I PLEAEIKM +NEI ALQEDK+A+ER  KSKE+ALLEAE IL+SALER LIVEEVQN+N
Sbjct  124   ITPLEAEIKMCRNEITALQEDKKALERLTKSKESALLEAEIILRSALERALIVEEVQNEN  183

Query  1463  FELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqis  1284
             F+L+RQIEICQEENK+L+K++RQK++EVE+LSQTI ELEE IL+ GA AN +RDY+RQIS
Sbjct  184   FDLKRQIEICQEENKLLEKSHRQKIVEVEKLSQTIHELEELILSSGANANVVRDYKRQIS  243

Query  1283  eiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKD  1104
             E+QEE+RTLERELARVKVSANR+AT+ ANEWKDENDKVMPV+QWLEERRI+QAEMQRLK+
Sbjct  244   ELQEEKRTLERELARVKVSANRIATVAANEWKDENDKVMPVRQWLEERRIMQAEMQRLKE  303

Query  1103  KLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILS  924
             KLAISERTAKAE+QLKDKLKLRLKTLE+GLKQ    +++    SG  K +K+N L  + +
Sbjct  304   KLAISERTAKAESQLKDKLKLRLKTLEEGLKQF---SMSSNAFSGTPKADKSNILSFVTN  360

Query  923   S---KKRSASQPRASMV---------------NTTseqesssensgEYNDQKK-RHHGLW  801
             S   + RS SQPRAS +               N       SS    +Y   +     G+W
Sbjct  361   SDGLRNRSTSQPRASTIGSALFKKPNIKGNIDNIAGNLNPSSITKMKYGSTENVLKKGIW  420

Query  800   YSRNKID---EKEN-----AGMK-ENSDKLTDSGNF--------------SKND---EDM  699
              SRNK     EKEN      GM  +  D    SGN               S ND    D+
Sbjct  421   ASRNKFSDGGEKENEMQVKTGMNLKKCDGERGSGNVKTSSVDVNEDSKSNSCNDLGSNDV  480

Query  698   VSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAA  519
             VSGFLYD+LQKEVIN+RK  + K++ L+TKDEEIKMLTKK++ LTKA+EVE +K KREAA
Sbjct  481   VSGFLYDKLQKEVINLRKSCETKDSSLHTKDEEIKMLTKKVDALTKAMEVEWKKMKREAA  540

Query  518   IREKDSSTIKYKYDGNIRQTNSS  450
              REK+ ++IK      IR +NSS
Sbjct  541   AREKEFASIKSDDKRKIRSSNSS  563



>ref|XP_004507603.1| PREDICTED: microtubule-associated protein 70-5-like [Cicer arietinum]
Length=576

 Score =   450 bits (1157),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 323/566 (57%), Positives = 405/566 (72%), Gaps = 59/566 (10%)
 Frame = -3

Query  1991  ELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             EL L+ +DP +LE+  L NQ+KEK +EL + Q E K LR+TE LKDKA+EEL NEV +L+
Sbjct  11    ELSLVMSDPIVLEINRLHNQIKEKVKELAICQGEVKALRSTEALKDKAIEELRNEVSKLD  70

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             E+L+ +E+ ++QKNLE KKL +EKKEAL AQYAAEA LRRV+A QK++DS+PI++VIAPL
Sbjct  71    ERLRAAEDHLKQKNLEIKKLTDEKKEALAAQYAAEATLRRVHANQKDEDSVPIDNVIAPL  130

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAEIKMY+N+I  L EDK+A+ER  KSKE ALLE E+IL+SALER L VEEVQNQNF+L+
Sbjct  131   EAEIKMYRNKITTLHEDKKALERLKKSKETALLEGEKILQSALERALRVEEVQNQNFDLK  190

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             RQI+I QEENKIL+K+ RQK+LEVE+L QTI ELEE ILA GAAAN +RDY+RQISE+QE
Sbjct  191   RQIDIYQEENKILEKSGRQKILEVEKLGQTIHELEEVILANGAAANVVRDYQRQISELQE  250

Query  1271  errtlerelaRVKVSANRVATIVA-NEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLA  1095
             ++RTLERELARV+VSANR+A +VA NEWK E+DKVMPVKQWLEERRI+QAEMQRLKDKL 
Sbjct  251   QKRTLERELARVRVSANRIANVVAANEWKGESDKVMPVKQWLEERRIMQAEMQRLKDKLT  310

Query  1094  ISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILSS--  921
             +SERTAKAE+QLK+KLK+RLKTLE GLK   + +    V S   K EK+N + G L+S  
Sbjct  311   VSERTAKAESQLKEKLKVRLKTLEAGLKHFSSYSATSNVFSWSPKEEKSN-IRGFLTSGG  369

Query  920   -KKRSASQPRASMV--------NTTseqesssensgEYNDQKKRHH---------GLWYS  795
              +KRS SQPRAS V        N           + +     K+++         G+W S
Sbjct  370   SRKRSTSQPRASSVGSPLFQQTNIKKNNTDIVGENSKQGSPTKKNYTSAENMLKKGMWVS  429

Query  794   RNKI---DEKENAGMKENSD----------------------------KLTDSGNFSKND  708
             R K+    EKEN  M+ N+D                            K  DSG+     
Sbjct  430   RRKVADSGEKENE-MQVNTDMHLNNFNDGREAAEIKIIVDVDEDLQSKKPNDSGS-----  483

Query  707   EDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKR  528
             +D+VS FLYDRLQKEVIN+R   + K++ L+ KDEEIK+L KK++ LTK++EVE +KTKR
Sbjct  484   DDVVSSFLYDRLQKEVINLRISCENKDSSLHAKDEEIKLLMKKVDALTKSMEVEWKKTKR  543

Query  527   EAAIREKDSSTIKYKYDGNIRQTNSS  450
             EAA REK+ S+IK      IR TNSS
Sbjct  544   EAAAREKEVSSIKPDDSKKIRNTNSS  569



>ref|XP_007154039.1| hypothetical protein PHAVU_003G086000g [Phaseolus vulgaris]
 gb|ESW26033.1| hypothetical protein PHAVU_003G086000g [Phaseolus vulgaris]
Length=575

 Score =   449 bits (1156),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 318/557 (57%), Positives = 407/557 (73%), Gaps = 48/557 (9%)
 Frame = -3

Query  1982  LLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKL  1803
             L+ +DP +LE+ SLQNQLKEK +EL   Q+E K LRATE LKDKA+EEL N V +L+E+L
Sbjct  14    LVQSDPVVLEINSLQNQLKEKVKELTTCQNEIKALRATEALKDKAVEELRNRVGKLDERL  73

Query  1802  KISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAE  1623
              ++E+ ++QK+LE KKL +EKK+AL +QYAAEA LRRV+  QK++D IPIE+VIAPLEAE
Sbjct  74    GVTEDRLKQKHLEIKKLTDEKKDALASQYAAEATLRRVHTIQKDEDFIPIETVIAPLEAE  133

Query  1622  IKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQI  1443
             IKMY+NEI +LQEDK+++ER  KSKEAALLEAERIL+SALER L+VEEV+NQNF+L+RQI
Sbjct  134   IKMYRNEITSLQEDKKSLERLTKSKEAALLEAERILQSALERALVVEEVRNQNFDLKRQI  193

Query  1442  EICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeerr  1263
             EI QEENKIL+K +RQK+LEVE+LSQTI ELEE ILA GA AN +RDY+R+ SE+QEE+R
Sbjct  194   EISQEENKILEKKHRQKILEVEKLSQTIQELEEIILASGATANAVRDYQRRTSELQEEKR  253

Query  1262  tlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISER  1083
              LERELARVKVSANR+A +VANEWKDENDKVMPV+QWLEERRI+QAE+QRLK KLA SER
Sbjct  254   KLERELARVKVSANRIANVVANEWKDENDKVMPVRQWLEERRIMQAEIQRLKVKLATSER  313

Query  1082  TAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILSS----KK  915
             TAKAE+QLKDKLKLRLKTLE+GLK   +      V     K EK+N + G L++    +K
Sbjct  314   TAKAESQLKDKLKLRLKTLEEGLKHFSSYPNILNVPCASPKAEKSN-ILGFLTTSSDLRK  372

Query  914   RSASQPRASMVNTTseqesssensg-------EYNDQKKRHH--------GLWYSRNKI-  783
             RS SQPRAS V ++  Q+ + +N+        +     K++         G+  SR+K+ 
Sbjct  373   RSTSQPRASRVGSSLFQQPNVKNNTDILAGNLKLGSPIKKYSTAENVLKKGMLASRSKVA  432

Query  782   --DEKENAGMKENSDKLTDSGN------------------------FSKNDEDMVSGFLY  681
                EKEN  M+ N+D   +  N                        +    +D+VSGFLY
Sbjct  433   DNAEKENE-MQVNTDMTLNRCNDEREAAEIKTTVNVDEEDPESKKPYGSGRDDVVSGFLY  491

Query  680   DRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDS  501
             D+LQ+EVIN+R   + K++ L +KDEEIKMLTKK++ LTKA++VE +K KREAA REK++
Sbjct  492   DKLQREVINLRMSCETKDSSLQSKDEEIKMLTKKVDALTKAMQVEWKKMKREAASREKEA  551

Query  500   STIKYKYDGNIRQTNSS  450
             S+ K   +   R  NSS
Sbjct  552   SSTKSDDNRKNRSANSS  568



>ref|XP_006600289.1| PREDICTED: microtubule-associated protein 70-5-like [Glycine 
max]
Length=571

 Score =   446 bits (1148),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 319/572 (56%), Positives = 410/572 (72%), Gaps = 52/572 (9%)
 Frame = -3

Query  2024  MAAGYEEVGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKAL  1845
             M +  E+ G  +L L+  DP  LE+  LQNQLKEK++EL   Q E K LR+TE LKDKA+
Sbjct  1     MVSCEEKYG-EKLTLVQPDPVALEINRLQNQLKEKDKELATCQGEMKALRSTEALKDKAI  59

Query  1844  EELGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDD  1665
             EEL N   +L+E+L+++E+ ++QKNLE KKL +EKK+AL +QYAAEA LRRV+A QK++D
Sbjct  60    EELRNGASKLDERLRVTEDHLKQKNLEIKKLTDEKKDALASQYAAEATLRRVHANQKDED  119

Query  1664  SIPIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIV  1485
              +PIESVIAPLEAEIKMY+NEI ALQEDK+A+E+  KSKE+ALLEAERIL+SALER L+V
Sbjct  120   FVPIESVIAPLEAEIKMYRNEITALQEDKKALEQLTKSKESALLEAERILRSALERALVV  179

Query  1484  EEVQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIR  1305
             EEV+NQN +L+RQIEICQ E K+L+K +RQK+LEVE+LS+TI +LEE ILA GA AN +R
Sbjct  180   EEVRNQNIDLKRQIEICQVEKKLLEKNHRQKILEVEKLSKTIQQLEEVILASGATANAVR  239

Query  1304  DYrrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQA  1125
             D +RQISE+QEE+RTLERELARVKVSANR+A +VANEWKDENDKVMPV+QWLEERRI+Q 
Sbjct  240   DCQRQISELQEEKRTLERELARVKVSANRIANVVANEWKDENDKVMPVRQWLEERRIMQG  299

Query  1124  EMQRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKAN  945
             E+Q+LKDKLAISERTA+AE+QLKDKLKLRL+TLE+GLK   +  +   V     K EK+N
Sbjct  300   EIQQLKDKLAISERTARAESQLKDKLKLRLRTLEEGLKHFSSYPITLNVSYASPKAEKSN  359

Query  944   HLFGILSS---KKRSASQPRASMVNTTseqesssensg-------EYNDQKKRHH-----  810
              L  + ++   +KRS SQPRAS V ++  Q  + +N+        +     K++      
Sbjct  360   ILAFLTTNGGLRKRSTSQPRASSVGSSLFQTPNIKNNTDIVAGNLKLGSPTKKYGSTENM  419

Query  809   ---GLWYSRNKIDEKENAGMKENS---------DKLTDSG--------------------  726
                G+W  R+K+    N G KEN          ++ TD                      
Sbjct  420   LKKGMWALRSKV---ANNGEKENEMQVKTDMTLNRYTDESEATEIKTIVNLDEDAESKKP  476

Query  725   NFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVE  546
             N S  D D+VSGFLYD+LQKEVIN+RK  ++K++ L  KDEEIKML KK++ LTKA+EVE
Sbjct  477   NGSSRD-DVVSGFLYDKLQKEVINLRKSCEIKDSSLLAKDEEIKMLIKKVDVLTKAMEVE  535

Query  545   SRKTKREAAIREKDSSTIKYKYDGNIRQTNSS  450
              +K KREAA REK++S+ K   +   R  NSS
Sbjct  536   WKKMKREAAAREKEASSTKSDDNRKKRSGNSS  567



>gb|KHN03540.1| Microtubule-associated protein 70-5 [Glycine soja]
Length=582

 Score =   446 bits (1146),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 319/572 (56%), Positives = 410/572 (72%), Gaps = 52/572 (9%)
 Frame = -3

Query  2024  MAAGYEEVGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKAL  1845
             M +  E+ G  +L L+  DP  LE+  LQNQLKEK++EL   Q E K LR+TE LKDKA+
Sbjct  1     MVSCEEKYG-EKLTLVQPDPVALEINRLQNQLKEKDKELATCQGEMKALRSTEALKDKAI  59

Query  1844  EELGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDD  1665
             EEL N   +L+E+L+++E+ ++QKNLE KKL +EKK+AL +QYAAEA LRRV+A QK++D
Sbjct  60    EELRNGASKLDERLRVTEDHLKQKNLEIKKLTDEKKDALASQYAAEATLRRVHANQKDED  119

Query  1664  SIPIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIV  1485
              +PIESVIAPLEAEIKMY+NEI ALQEDK+A+E+  KSKE+ALLEAERIL+SALER L+V
Sbjct  120   FVPIESVIAPLEAEIKMYRNEITALQEDKKALEQLTKSKESALLEAERILRSALERALVV  179

Query  1484  EEVQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIR  1305
             EEV+NQN +L+RQIEICQ E K+L+K +RQK+LEVE+LS+TI +LEE ILA GA AN +R
Sbjct  180   EEVRNQNIDLKRQIEICQVEKKLLEKNHRQKILEVEKLSKTIQQLEEVILASGATANAVR  239

Query  1304  DYrrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQA  1125
             D +RQISE+QEE+RTLERELARVKVSANR+A +VANEWKDENDKVMPV+QWLEERRI+Q 
Sbjct  240   DCQRQISELQEEKRTLERELARVKVSANRIANVVANEWKDENDKVMPVRQWLEERRIMQG  299

Query  1124  EMQRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKAN  945
             E+Q+LKDKLAISERTA+AE+QLKDKLKLRL+TLE+GLK   +  +   V     K EK+N
Sbjct  300   EIQQLKDKLAISERTARAESQLKDKLKLRLRTLEEGLKHFSSYPITLNVSYASPKAEKSN  359

Query  944   HLFGILSS---KKRSASQPRASMVNTTseqesssensg-------EYNDQKKRHH-----  810
              L  + ++   +KRS SQPRAS V ++  Q  + +N+        +     K++      
Sbjct  360   ILAFLTTNGGLRKRSTSQPRASSVGSSLFQTPNIKNNTDIVAGNLKLGSPTKKYGSTENM  419

Query  809   ---GLWYSRNKIDEKENAGMKENS---------DKLTDSG--------------------  726
                G+W  R+K+    N G KEN          ++ TD                      
Sbjct  420   LKKGMWALRSKV---ANNGEKENEMQVKTDMTLNRYTDESEATEIKTIVNLDEDAESKKP  476

Query  725   NFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVE  546
             N S  D D+VSGFLYD+LQKEVIN+RK  ++K++ L  KDEEIKML KK++ LTKA+EVE
Sbjct  477   NGSSRD-DVVSGFLYDKLQKEVINLRKSCEIKDSSLLAKDEEIKMLIKKVDVLTKAMEVE  535

Query  545   SRKTKREAAIREKDSSTIKYKYDGNIRQTNSS  450
              +K KREAA REK++S+ K   +   R  NSS
Sbjct  536   WKKMKREAAAREKEASSTKSDDNRKKRSGNSS  567



>gb|KEH36973.1| myosin II heavy chain family protein [Medicago truncatula]
Length=552

 Score =   442 bits (1137),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 317/532 (60%), Positives = 396/532 (74%), Gaps = 36/532 (7%)
 Frame = -3

Query  1991  ELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             E+ L+  D  +LE+  LQN+L EK  EL     E K +RA E  KDKA+EEL NEV +++
Sbjct  6     EVPLVKPDVVVLEIDHLQNKLIEKVNELATCHGEIKAIRAIEAKKDKAIEELRNEVSKMD  65

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             E+L++ E+ ++ KNLE KKL +EKK+AL AQYAAE+ALRR++ +QKE+D  P ESVI PL
Sbjct  66    ERLRLKEDHLKNKNLEIKKLTDEKKDALAAQYAAESALRRLHTDQKEEDFYPFESVITPL  125

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             E EIKMY+ EI ALQEDK+A+ER  KSKE ALLEAERIL+SALER LIVEEVQN+NF+L+
Sbjct  126   EDEIKMYRTEITALQEDKKALERLTKSKELALLEAERILRSALERALIVEEVQNENFDLK  185

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             RQIEICQEENKIL+K++RQK++EVE+LSQTI ELEE IL+ GA AN IRDY+RQISE+QE
Sbjct  186   RQIEICQEENKILEKSHRQKIVEVEKLSQTIHELEELILSNGATANLIRDYKRQISELQE  245

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             E+RTLERELARVKVSANR+AT+ ANEWKDE+DKVMPV+QWLEERRI+QAEMQRLK+KLAI
Sbjct  246   EKRTLERELARVKVSANRIATVAANEWKDESDKVMPVRQWLEERRIMQAEMQRLKEKLAI  305

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILSS---  921
             SERTAKAE+QLKDKLKLRLKTLE+GLKQ    +VN    S   K +K+N L  + ++   
Sbjct  306   SERTAKAESQLKDKLKLRLKTLEEGLKQF---SVNSNAFSVSPKADKSNILSFVTNNGGL  362

Query  920   KKRSASQPRASMVNTTseqes---------------ssensgEYNDQKK-RHHGLWYSRN  789
             + RS SQPR S V  T  Q++                S    +Y   +     G+W S+N
Sbjct  363   RNRSTSQPRGSTVGRTLFQKANIKGNIESMAGNRKPGSITKMKYGSTENVLKKGIWASKN  422

Query  788   KID---EKEN------AGMKENSDKLTDSGNFSKND---EDMVSGFLYDRLQKEVINMRK  645
             K     EKEN        +K N+D+  DS   S ND    D+VSGFLYD+LQKEVIN++K
Sbjct  423   KFSDGGEKENEIQVNTGSVKTNADE--DSKFNSSNDLESNDVVSGFLYDKLQKEVINLKK  480

Query  644   CFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIK  489
               + K++ L+TKDEEIKMLTKK++ LTKA+EVE +K KRE A REK+ ++IK
Sbjct  481   TCETKDSTLHTKDEEIKMLTKKVDALTKAMEVEWKKMKREIAAREKEVASIK  532



>ref|XP_010087647.1| hypothetical protein L484_010598 [Morus notabilis]
 gb|EXB29540.1| hypothetical protein L484_010598 [Morus notabilis]
Length=548

 Score =   439 bits (1130),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 325/562 (58%), Positives = 406/562 (72%), Gaps = 53/562 (9%)
 Frame = -3

Query  2024  MAAGYEEVGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKAL  1845
             MA   E+ G  EL L+H DP +LEL  L++ LKEKERELGVAQ E K L ATE LKDKA+
Sbjct  1     MACHEEQYGSEELSLVHPDPVVLELNRLKDLLKEKERELGVAQGEIKSLTATEALKDKAV  60

Query  1844  EELGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDD  1665
             EEL  +V++++EKL+++ENL+E KNLE KKL ++KK+AL AQ+AAEAALRR++A QK+DD
Sbjct  61    EELTIQVQKMDEKLRVNENLLEHKNLEIKKLTSDKKDALAAQFAAEAALRRLHANQKDDD  120

Query  1664  SIPIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIV  1485
             ++P+ SV+APLEAEIKMYKNEIAALQEDK+A+ER  KSKE+ALLEAERIL+SALER LIV
Sbjct  121   ALPLASVVAPLEAEIKMYKNEIAALQEDKKALERLTKSKESALLEAERILRSALERALIV  180

Query  1484  EEVQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIR  1305
             EE                EEN+IL+KTNRQKVLEVE+LSQTI ELEE +LA GAAAN +R
Sbjct  181   EE----------------EENRILEKTNRQKVLEVEKLSQTIQELEEVVLAAGAAANAVR  224

Query  1304  DYrrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQA  1125
             D++RQI E+ EE+RTLERELAR KVSA R+AT+VANEWKDENDKVMPVKQWLEERR++QA
Sbjct  225   DHKRQIEELNEEKRTLERELARAKVSATRIATVVANEWKDENDKVMPVKQWLEERRLMQA  284

Query  1124  EMQRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKAN  945
             EMQRL+DKL +SERTAKAEAQLK+K KLRLKTLE GLK   + + N     G  K EK++
Sbjct  285   EMQRLRDKLTVSERTAKAEAQLKEKFKLRLKTLEDGLKDVSSFSNNTSAFCGSPKTEKSS  344

Query  944   HLFGILSS----KKRSASQPRASMV--NTTseq-----esssensgEYNDQKKRH-----  813
             ++ G L+S    +KRS SQPR S +  NT  +Q     E         N  +K++     
Sbjct  345   NILGFLTSTGGLRKRSTSQPRGSTLSRNTLLQQPNLDNEIVVGELKGANTMRKKNAPGEN  404

Query  812   ---HGLWYSRNK---IDEKEN--------------AGMKENSDKLTDSGNFSKND-EDMV  696
                 GLW SRNK   I EKEN              +G  ++     D+   + +D EDMV
Sbjct  405   LLKKGLWTSRNKIADIAEKENTDTKTNTNNSDTIVSGELKSKGSAGDTEAATNSDGEDMV  464

Query  695   SGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAI  516
             SGFLYDRLQKEVI++RK  + KENDL+ KD+EIK L KK+E L KA+EVES++ KREAA 
Sbjct  465   SGFLYDRLQKEVISLRKFCEAKENDLSAKDQEIKNLMKKVEALAKAMEVESKRVKREAAA  524

Query  515   REKDSSTIKYKYDGNIRQTNSS  450
             RE+++++ K   +   R  NS+
Sbjct  525   REREAASAKIDGNSKKRVVNSA  546



>ref|XP_006283554.1| hypothetical protein CARUB_v10004607mg [Capsella rubella]
 gb|EOA16452.1| hypothetical protein CARUB_v10004607mg [Capsella rubella]
Length=513

 Score =   436 bits (1120),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 309/508 (61%), Positives = 381/508 (75%), Gaps = 44/508 (9%)
 Frame = -3

Query  1970  DPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKLKISE  1791
             +PF+   +SLQNQLKEKE+EL  A++E + LR  E+LKD+  +EL   V++LEEKL  +E
Sbjct  6     NPFVSNTSSLQNQLKEKEKELLAAKAEVEALRTNEELKDRVFKELRESVRKLEEKLGATE  65

Query  1790  NLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEIKMY  1611
             NLVEQK +E KKL  EK++AL AQ AAE ALRRVY  Q+EDDS+P+ES+IAPLEA+IK +
Sbjct  66    NLVEQKEVEMKKLEEEKEDALAAQDAAEEALRRVYTHQQEDDSLPLESIIAPLEAQIKFH  125

Query  1610  KNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIEICQ  1431
             K +I ALQEDK+A+ER  KSKE+AL+EAERILKSALER LIVEEVQN NFELRRQIEICQ
Sbjct  126   KQQIFALQEDKKALERLTKSKESALIEAERILKSALERALIVEEVQNHNFELRRQIEICQ  185

Query  1430  EENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeerrtler  1251
             +ENK L+K NRQKVLE+E+LSQ+I+ELEEAILAGG AAN +RDYRRQIS++ +E+RTLER
Sbjct  186   DENKFLEKINRQKVLEIEKLSQSIVELEEAILAGGTAANAVRDYRRQISQLNDEKRTLER  245

Query  1250  elaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTAKA  1071
             ELARVKVSA+RVA  VANEWKDEND+VMPVK+WLEERR+L  EMQ+LKDKLA+SERTAKA
Sbjct  246   ELARVKVSASRVALAVANEWKDENDRVMPVKKWLEERRLLHGEMQKLKDKLAVSERTAKA  305

Query  1070  EAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILS----SKKRSAS  903
             E+QLK++LKLRLKT+E GLK      V+P      +K E++  + G L+    SKKRS S
Sbjct  306   ESQLKERLKLRLKTIEDGLKCPNTFLVSPT-----TKTERSGKILGFLTSGGGSKKRSTS  360

Query  902   QPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKI---DEKENAGMKENSDKLTD  732
             QPR S+                      R H L    +++   DEKEN+ +  N   LTD
Sbjct  361   QPRGSITG--------------------RIHALNQPIHRVAESDEKENSKITANG--LTD  398

Query  731   S---GNFSKND-------EDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTK  582
                 G   K +       EDMVSGFLYDRLQKEVI +RK  + KE  +NTK+EEIKML K
Sbjct  399   QHEKGGQRKTEEDGDVDTEDMVSGFLYDRLQKEVIALRKICESKEGTINTKNEEIKMLLK  458

Query  581   KIETLTKAIEVESRKTKREAAIREKDSS  498
             K++ LTKAIEVE++K KREAA REK+++
Sbjct  459   KVDALTKAIEVETKKAKREAAAREKENA  486



>ref|XP_002868078.1| atmap70-5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44337.1| atmap70-5 [Arabidopsis lyrata subsp. lyrata]
Length=510

 Score =   431 bits (1108),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 293/491 (60%), Positives = 377/491 (77%), Gaps = 13/491 (3%)
 Frame = -3

Query  1970  DPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKLKISE  1791
             +PF+ + +SLQNQL EKE+EL  A++E + LR  E  KD+A +EL   V++LEE+L  +E
Sbjct  6     NPFVSDTSSLQNQLIEKEKELLTAKAEIEALRTNEGHKDRAFKELRENVRKLEEQLGATE  65

Query  1790  NLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEIKMY  1611
             N+V+QK +E K+L  EK++AL AQ AAE ALRRVY  Q++DDS+P+ES+IAPLEA+IK  
Sbjct  66    NIVDQKEVEMKRLEGEKEDALAAQDAAEEALRRVYTHQQDDDSLPLESIIAPLEAQIKFQ  125

Query  1610  KNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIEICQ  1431
             K+EI+ALQEDK+A+ER  KSKE+ALLEAERIL+SALER LIVEEVQN NFELRRQIEICQ
Sbjct  126   KHEISALQEDKKALERLTKSKESALLEAERILRSALERALIVEEVQNHNFELRRQIEICQ  185

Query  1430  EENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeerrtler  1251
             +ENK L+K NRQKVLE+E+LSQ+I+ELEEAILAGG AAN +RDYRRQIS++ EE+RTLER
Sbjct  186   DENKFLEKINRQKVLEIEKLSQSIVELEEAILAGGTAANAVRDYRRQISQLNEEKRTLER  245

Query  1250  elaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTAKA  1071
             ELARVKVSA+RVA  VANEWKDEND+VMPVKQWLEERRIL  EMQ+LKDKL++SERTAKA
Sbjct  246   ELARVKVSASRVALAVANEWKDENDRVMPVKQWLEERRILHGEMQKLKDKLSVSERTAKA  305

Query  1070  EAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILSSKKRSASQPRA  891
             E+QLK++LKLRLKT+E GLK      V+P      +K EK+  + G L+S     S+ R+
Sbjct  306   ESQLKERLKLRLKTIEDGLKGPNTCKVSP-----TTKTEKSGKILGFLTSG--GGSKKRS  358

Query  890   SMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKENAGMKENSDKLTDSGNFSKN  711
             +  + T    + S+     ++  ++ +    + +  D+ E  G +    K  + GN   +
Sbjct  359   TSGSITGRIHALSQPIHIVSESDEKENSKISANDITDQHEEDGKR----KAEEDGNV--D  412

Query  710   DEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTK  531
              EDMVSGFLYDRLQKEVI +RK  + KE  +N K+EEIKML KK++ LTKAIEVE++K K
Sbjct  413   SEDMVSGFLYDRLQKEVIALRKICESKEGTINAKNEEIKMLLKKVDALTKAIEVETKKAK  472

Query  530   REAAIREKDSS  498
             REAA REK+++
Sbjct  473   REAAAREKENA  483



>ref|XP_003610594.1| hypothetical protein MTR_4g133890 [Medicago truncatula]
 gb|AES92791.1| myosin II heavy chain family protein [Medicago truncatula]
Length=565

 Score =   431 bits (1108),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 305/545 (56%), Positives = 392/545 (72%), Gaps = 57/545 (10%)
 Frame = -3

Query  1991  ELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             E  ++ +DP +LE+  L NQ KEK +++   QSE K LR+TE LKDKA+EEL NEV +L+
Sbjct  11    EPPVVLSDPMVLEINRLHNQFKEKVKDVATCQSEIKALRSTEALKDKAIEELINEVSKLD  70

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             E+L+++E+ ++QKN+  KKL ++KK A+ AQYAAEA LRRV+A Q ++DS+PI++VIAPL
Sbjct  71    ERLRVTEDRLKQKNIGIKKLTDKKKSAMAAQYAAEATLRRVHANQNDEDSVPIDNVIAPL  130

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             +AEIKMY+NEI ALQED + +ER  KSKE ALL+AERIL+SALE+ LI+EEVQNQNF+L+
Sbjct  131   QAEIKMYRNEITALQEDNKTLERLKKSKEKALLDAERILQSALEKALIIEEVQNQNFDLK  190

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             RQI+I QEE KIL+K++RQK+LEVE+LSQTI ELEE ILA GA AN +RDY+RQ SE+QE
Sbjct  191   RQIDIYQEETKILEKSHRQKILEVEKLSQTIQELEEVILANGATANVVRDYQRQFSELQE  250

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             E+RTLEREL RVKVSANR+A   ANEWKDENDKVMPVKQWLEERRI+QAEMQRLKDKLAI
Sbjct  251   EKRTLERELERVKVSANRIANGKANEWKDENDKVMPVKQWLEERRIIQAEMQRLKDKLAI  310

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILSS---  921
             SERTAKAE+Q+K+KLK+RLKTLE+GLK            S  SK EK+N +    +S   
Sbjct  311   SERTAKAESQMKEKLKVRLKTLEEGLKH-----------SSISKAEKSNIISSPTASGGP  359

Query  920   KKRSASQPRASMVNTTseqesssensgEYNDQKKRHHG----------------LWYSRN  789
             KKRS SQPRAS + +   Q+++ +N+    D   +                   +W SR+
Sbjct  360   KKRSTSQPRASAIGSPLFQQTNIKNNTNTVDGNLKQENPIKMKYTSAENMLKKRIWTSRS  419

Query  788   KI---DEKEN-------------------AGMKE----NSDKLTDSGNFSKNDEDMVSGF  687
             K+    EKEN                   A +K     N D  +   N+S +D D+VSGF
Sbjct  420   KVADGGEKENEIQVNTDMNLNQFNAESEAAEIKTIVDVNEDFQSKKPNYSCSD-DLVSGF  478

Query  686   LYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREK  507
             LYDRLQ+EVI +RK  + K++ L  KDEEIKM  KK++ LTK++EVE +K KR+AA REK
Sbjct  479   LYDRLQREVIKLRKSCETKDSRLQAKDEEIKMFMKKVDALTKSMEVECKKMKRDAAAREK  538

Query  506   DSSTI  492
             + STI
Sbjct  539   EVSTI  543



>gb|KEH32682.1| myosin II heavy chain family protein [Medicago truncatula]
Length=586

 Score =   431 bits (1107),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 305/545 (56%), Positives = 392/545 (72%), Gaps = 57/545 (10%)
 Frame = -3

Query  1991  ELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             E  ++ +DP +LE+  L NQ KEK +++   QSE K LR+TE LKDKA+EEL NEV +L+
Sbjct  19    EPPVVLSDPMVLEINRLHNQFKEKVKDVATCQSEIKALRSTEALKDKAIEELINEVSKLD  78

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             E+L+++E+ ++QKN+  KKL ++KK A+ AQYAAEA LRRV+A Q ++DS+PI++VIAPL
Sbjct  79    ERLRVTEDRLKQKNIGIKKLTDKKKSAMAAQYAAEATLRRVHANQNDEDSVPIDNVIAPL  138

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             +AEIKMY+NEI ALQED + +ER  KSKE ALL+AERIL+SALE+ LI+EEVQNQNF+L+
Sbjct  139   QAEIKMYRNEITALQEDNKTLERLKKSKEKALLDAERILQSALEKALIIEEVQNQNFDLK  198

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             RQI+I QEE KIL+K++RQK+LEVE+LSQTI ELEE ILA GA AN +RDY+RQ SE+QE
Sbjct  199   RQIDIYQEETKILEKSHRQKILEVEKLSQTIQELEEVILANGATANVVRDYQRQFSELQE  258

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             E+RTLEREL RVKVSANR+A   ANEWKDENDKVMPVKQWLEERRI+QAEMQRLKDKLAI
Sbjct  259   EKRTLERELERVKVSANRIANGKANEWKDENDKVMPVKQWLEERRIIQAEMQRLKDKLAI  318

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILSS---  921
             SERTAKAE+Q+K+KLK+RLKTLE+GLK            S  SK EK+N +    +S   
Sbjct  319   SERTAKAESQMKEKLKVRLKTLEEGLKH-----------SSISKAEKSNIISSPTASGGP  367

Query  920   KKRSASQPRASMVNTTseqesssensgEYNDQKKRHHG----------------LWYSRN  789
             KKRS SQPRAS + +   Q+++ +N+    D   +                   +W SR+
Sbjct  368   KKRSTSQPRASAIGSPLFQQTNIKNNTNTVDGNLKQENPIKMKYTSAENMLKKRIWTSRS  427

Query  788   KI---DEKEN-------------------AGMKE----NSDKLTDSGNFSKNDEDMVSGF  687
             K+    EKEN                   A +K     N D  +   N+S +D D+VSGF
Sbjct  428   KVADGGEKENEIQVNTDMNLNQFNAESEAAEIKTIVDVNEDFQSKKPNYSCSD-DLVSGF  486

Query  686   LYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREK  507
             LYDRLQ+EVI +RK  + K++ L  KDEEIKM  KK++ LTK++EVE +K KR+AA REK
Sbjct  487   LYDRLQREVIKLRKSCETKDSRLQAKDEEIKMFMKKVDALTKSMEVECKKMKRDAAAREK  546

Query  506   DSSTI  492
             + STI
Sbjct  547   EVSTI  551



>ref|XP_010440039.1| PREDICTED: microtubule-associated protein 70-5 [Camelina sativa]
Length=513

 Score =   427 bits (1097),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 310/527 (59%), Positives = 387/527 (73%), Gaps = 49/527 (9%)
 Frame = -3

Query  1970  DPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKLKISE  1791
             +PF+   +SLQNQLK+KE+EL  A++E + LR  E+LKD+  +EL   V++LEEKL  SE
Sbjct  6     NPFVSNTSSLQNQLKDKEKELLAAKAEVEALRTNEELKDRVFKELRESVRKLEEKLGASE  65

Query  1790  NLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEIKMY  1611
             NLVEQK +E KKL  EK++AL AQ AAE ALRRVY  Q++DD +P+ES+IAPLEA+IK +
Sbjct  66    NLVEQKEVEMKKLKEEKEDALAAQDAAEEALRRVYTHQQDDDFLPLESIIAPLEAQIKFH  125

Query  1610  KNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIEICQ  1431
             K++I ALQEDK+A+ER  KSKE+AL+EAERILKSALER LIVEEVQN NFELRRQIEICQ
Sbjct  126   KHQICALQEDKKALERLTKSKESALIEAERILKSALERALIVEEVQNHNFELRRQIEICQ  185

Query  1430  EENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeerrtler  1251
             +ENK L+K NRQKVLE+E+LSQ+I+ELEEAILAGG AAN +RDYRRQIS++ +E+RTLER
Sbjct  186   DENKFLEKINRQKVLEIEKLSQSIVELEEAILAGGTAANAVRDYRRQISQLNDEKRTLER  245

Query  1250  elaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTAKA  1071
             ELARVKVSA+RVA  VANEWKDEND+VMPVK+WLEERR+L  EMQ+LKDKLA+SERTAKA
Sbjct  246   ELARVKVSASRVALAVANEWKDENDRVMPVKKWLEERRLLHGEMQKLKDKLAVSERTAKA  305

Query  1070  EAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILS----SKKRSAS  903
             E+QLK++LKLRLKT+E GLK T    V+P      +K EK+  + G L+    SKK S S
Sbjct  306   ESQLKERLKLRLKTIEDGLKGTNTFLVSPT-----TKTEKSGKILGFLTSGGGSKKWSNS  360

Query  902   QPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKI---DEKENAGMKENSDKLTD  732
             QPR S                       R H L +  N++   +EKEN+ +  N   LTD
Sbjct  361   QPRGSDTG--------------------RIHALDHPINRVVESNEKENSKITTNG--LTD  398

Query  731   ------------SGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKML  588
                          GN   + ED+VSGFLYDRLQKEVI +RK  + KE  +N K+EEIKML
Sbjct  399   QHEEDGKGKTEEDGNV--HFEDVVSGFLYDRLQKEVIALRKLCESKEGTINAKNEEIKML  456

Query  587   TKKIETLTKAIEVESRKTKREAAIREKDSS-TIKYKYDGNIRQTNSS  450
              KK++ LTKAIEVE++K KREAA REK+++  +  +     R+TN S
Sbjct  457   LKKVDALTKAIEVETKKAKREAAAREKENALAVVNEEPKECRKTNCS  503



>ref|XP_006856278.1| hypothetical protein AMTR_s00047p00081310 [Amborella trichopoda]
 gb|ERN17745.1| hypothetical protein AMTR_s00047p00081310 [Amborella trichopoda]
Length=588

 Score =   429 bits (1103),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 309/554 (56%), Positives = 402/554 (73%), Gaps = 59/554 (11%)
 Frame = -3

Query  1979  LHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKLK  1800
             + +DP +LEL  L+N LK+ +RELG+A +E K L+ TE+LK+KA+EEL +++K+L+EKL+
Sbjct  15    VSSDPIVLELNRLENHLKDNDRELGIAHAEIKALKVTERLKEKAVEELNDDLKKLDEKLR  74

Query  1799  ISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEI  1620
              +ENL+E KNLE KKL++E+++AL AQ+AAEA LRRV+A QK++D IP+++V+AP+E+EI
Sbjct  75    FTENLLEDKNLEIKKLVSERRDALAAQFAAEATLRRVHANQKDEDYIPLDAVLAPMESEI  134

Query  1619  KMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIE  1440
             +M +NEI+ LQEDK+A+ER  KSKE ALLE ER+LK A+ER L+VE++QNQN EL+RQI+
Sbjct  135   RMCRNEISVLQEDKKALERLTKSKELALLETERMLKIAIERALLVEDLQNQNLELKRQID  194

Query  1439  ICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeerrt  1260
             ICQEEN+ILDK NRQKV EVE+LSQTI ELEE+ILAGGAAAN +RDY+RQI E+ EERRT
Sbjct  195   ICQEENRILDKANRQKVAEVEKLSQTIHELEESILAGGAAANAVRDYQRQILEMNEERRT  254

Query  1259  lerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISERT  1080
             LERELARVK+ ANRVAT+VANEWKD+NDKVMPVKQWLEER++LQ E+QRL+DKL +SERT
Sbjct  255   LERELARVKILANRVATVVANEWKDDNDKVMPVKQWLEERKVLQGEIQRLRDKLNVSERT  314

Query  1079  AKAEAQlkdklklrlktLEQGLKQ--TGNNNVNPKVLSGFSKPEKANHLFGILSS----K  918
             AKAE+QLKDK KLRLKTLE+GLKQ  T + N     L    KPE    + G LSS    +
Sbjct  315   AKAESQLKDKFKLRLKTLEEGLKQVTTSSPNTEGSHLKQTVKPEP---VLGYLSSNMGPR  371

Query  917   KRSASQPRASM----------VNTTseqesssensgEYNDQKKRH--------HGLWYSR  792
             KRS SQPRAS            N TSE  +S+      N  K ++          LW  R
Sbjct  372   KRSQSQPRASFNAEQSTVQQRPNVTSENSNSNRTLEHVNSLKYKYISGKNLVKKNLWAPR  431

Query  791   NKIDEKENAGMKENSDKLTDSG-------------NFS-----------KND-----EDM  699
             NK+   ++ G KENS++  D G             +FS           K+D     ED+
Sbjct  432   NKL--VDDVG-KENSERKEDVGLEEFASVGPEVSKDFSAEAHSMQSTPEKDDLNVDCEDI  488

Query  698   VSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAA  519
             VSGFLYD+LQKEV+N+RK    K+  L  KDEEIKML KKI+TLTKA+E E +K +RE+A
Sbjct  489   VSGFLYDKLQKEVLNLRKSSQEKDGLLTAKDEEIKMLVKKIDTLTKAMETELKKMRRESA  548

Query  518   IREKDSSTIKYKYD  477
              +E++ +  + + D
Sbjct  549   SKERELTPRRVQKD  562



>gb|KFK32193.1| hypothetical protein AALP_AA6G209500 [Arabis alpina]
Length=499

 Score =   426 bits (1094),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 302/508 (59%), Positives = 366/508 (72%), Gaps = 56/508 (11%)
 Frame = -3

Query  1970  DPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKLKISE  1791
             +PF+   +SLQNQLKEKE+EL  A++E + LR  E+LKD+AL EL   V++LEE+L  + 
Sbjct  6     NPFVYNTSSLQNQLKEKEKELLAAKAELEALRTKEELKDRALGELRENVRKLEERLGATN  65

Query  1790  NLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEIKMY  1611
             NLVEQ+ ++ KKL  EK++AL AQ AAE ALRRVY   ++DDS P+ES+IAPLEA+IK +
Sbjct  66    NLVEQQEVDMKKLEEEKEDALAAQDAAEEALRRVYTHNQDDDSTPLESIIAPLEAQIKFH  125

Query  1610  KNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIEICQ  1431
             K++I+ALQED +A+ER  KSKEAALLEAE IL+SALER LIVEEVQN NFEL RQIEICQ
Sbjct  126   KHQISALQEDNKALERLTKSKEAALLEAEGILRSALERALIVEEVQNHNFELCRQIEICQ  185

Query  1430  EENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeerrtler  1251
             EE K L+K NR K LE+E+LSQTI ELEEAILAGG AAN +RDYRRQIS++ EE+RTLER
Sbjct  186   EEYKFLEKINRHKALEIEKLSQTIGELEEAILAGGKAANAVRDYRRQISQLNEEKRTLER  245

Query  1250  elaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTAKA  1071
             ELARVKVSA+RVA  VANEWKDEND+VMPVKQWLEERRIL  EMQ+LKDKLA+SERTAKA
Sbjct  246   ELARVKVSASRVALAVANEWKDENDRVMPVKQWLEERRILHGEMQKLKDKLAVSERTAKA  305

Query  1070  EAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILS-----SKKRSA  906
             E QLK++LKLRLKT+E G K  G N          +K EK+  + G L+     SKKRS 
Sbjct  306   ETQLKERLKLRLKTIEDGFK--GQNT---------TKNEKSGKILGFLTSGGGGSKKRST  354

Query  905   SQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKENAGMKENSDKLTD--  732
             SQPR                         R + L +   + D KEN  +  N   LTD  
Sbjct  355   SQPRG------------------------RIYALNHRVTESDGKENTKITANG--LTDQH  388

Query  731   ----------SGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTK  582
                        GN   + EDMVSGFLYDRLQKEVI +RK  D K+  +NTK+EEIKML K
Sbjct  389   EEDDKRKAEEDGNV--DSEDMVSGFLYDRLQKEVIALRKICDSKDGTINTKNEEIKMLLK  446

Query  581   KIETLTKAIEVESRKTKREAAIREKDSS  498
             K++ LTKAIEVE++K KREAA REK+++
Sbjct  447   KVDALTKAIEVETKKAKREAAAREKENA  474



>ref|NP_193455.2| microtubule-associated protein 70-5 [Arabidopsis thaliana]
 sp|Q8GYX3.1|MP705_ARATH RecName: Full=Microtubule-associated protein 70-5; Short=AtMAP70-5; 
AltName: Full=70 kDa microtubule-associated protein 5 
[Arabidopsis thaliana]
 dbj|BAC42006.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64836.1| At4g17220 [Arabidopsis thaliana]
 emb|CAJ31082.1| 70 kDa microtubule associated protein Type 5 [Arabidopsis thaliana]
 gb|AEE83864.1| microtubule-associated protein 70-5 [Arabidopsis thaliana]
Length=513

 Score =   426 bits (1094),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 305/510 (60%), Positives = 381/510 (75%), Gaps = 48/510 (9%)
 Frame = -3

Query  1970  DPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKLKISE  1791
             +PF+ + +SLQ+QLKEKE+EL  A++E + LR  E+LKD+  +EL   V++LEEKL  +E
Sbjct  6     NPFVSDTSSLQSQLKEKEKELLAAKAEVEALRTNEELKDRVFKELRENVRKLEEKLGATE  65

Query  1790  NLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEIKMY  1611
             N V+QK LE KKL  EK++AL AQ AAE ALRRVY  Q++DDS+P+ES+IAPLE++IK++
Sbjct  66    NQVDQKELERKKLEEEKEDALAAQDAAEEALRRVYTHQQDDDSLPLESIIAPLESQIKIH  125

Query  1610  KNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIEICQ  1431
             K+EI+ALQEDK+A+ER  KSKE+ALLEAERIL+SALER LIVEEVQN NFELRRQIEICQ
Sbjct  126   KHEISALQEDKKALERLTKSKESALLEAERILRSALERALIVEEVQNHNFELRRQIEICQ  185

Query  1430  EENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeerrtler  1251
             +ENK L+K NRQKVLE+E+LSQ+I+ELEEAILAGG AAN +RDYRRQIS++ +E+RTLER
Sbjct  186   DENKFLEKINRQKVLEIEKLSQSIVELEEAILAGGTAANAVRDYRRQISQLNDEKRTLER  245

Query  1250  elaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTAKA  1071
             ELARVKVSA+RVA  VANEWKDEND+VMPVKQWLEERRIL  EMQ+LKDKLA+SERTAKA
Sbjct  246   ELARVKVSASRVALAVANEWKDENDRVMPVKQWLEERRILHGEMQKLKDKLAVSERTAKA  305

Query  1070  EAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILS----SKKRSAS  903
             E+QLK++LKLRLKT+E GLK      V+P      +K EK+  + G L+    SKKRS+S
Sbjct  306   ESQLKERLKLRLKTIEDGLKGPNTFFVSPT-----TKTEKSGKILGFLTSGGGSKKRSSS  360

Query  902   QPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKI---DEKENAGMKENSDKLTD  732
             Q R S+                      R H +    +++   DE EN+ +  N   LTD
Sbjct  361   QLRGSVTG--------------------RIHAMNQPIDRVGESDEMENSKITANG--LTD  398

Query  731   ------------SGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKML  588
                          GN     EDMVSGFLYDRLQKEVI +RK  + KE  +N K+EEIKML
Sbjct  399   QHEEDSERKTEEDGNVY--SEDMVSGFLYDRLQKEVIALRKLCESKEGTINAKNEEIKML  456

Query  587   TKKIETLTKAIEVESRKTKREAAIREKDSS  498
              KK++ LTKAIEVE++K KREAA REK+++
Sbjct  457   LKKVDALTKAIEVETKKAKREAAAREKENA  486



>ref|XP_010434704.1| PREDICTED: microtubule-associated protein 70-5-like [Camelina 
sativa]
Length=513

 Score =   423 bits (1088),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 308/527 (58%), Positives = 387/527 (73%), Gaps = 49/527 (9%)
 Frame = -3

Query  1970  DPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKLKISE  1791
             +PF+   +SLQNQLK+KE+EL  A++E + LR  E+LKD+  +EL   V++LE+KL  +E
Sbjct  6     NPFVSNTSSLQNQLKDKEKELLAAKAEVEALRTNEELKDRVSKELKESVRKLEDKLGATE  65

Query  1790  NLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEIKMY  1611
             NLVEQK +E KKL  EK++AL AQ AAE ALRRVY  Q++DD +P+ES+IAPLEA+IK +
Sbjct  66    NLVEQKEVEMKKLKEEKEDALAAQDAAEEALRRVYTHQQDDDFLPLESIIAPLEAQIKFH  125

Query  1610  KNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIEICQ  1431
             K+EI ALQEDK+A+ER  KSKE+AL+EAERILKSALER LIVEEVQN NFELRRQIEICQ
Sbjct  126   KHEIFALQEDKKALERLTKSKESALIEAERILKSALERALIVEEVQNHNFELRRQIEICQ  185

Query  1430  EENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeerrtler  1251
             +ENK L+K NRQKVLE+E+LSQ+I+ELEEAILAGG AAN +RDYRRQIS++ +E+RTLER
Sbjct  186   DENKFLEKINRQKVLEIEKLSQSIVELEEAILAGGTAANAVRDYRRQISQLNDEKRTLER  245

Query  1250  elaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTAKA  1071
             ELARVKVSA+RVA  VANEWKDEND+VMPVK+WLEERR+L  EMQ+LKDKLA+SERTAKA
Sbjct  246   ELARVKVSASRVALAVANEWKDENDRVMPVKKWLEERRLLHGEMQKLKDKLAVSERTAKA  305

Query  1070  EAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILS----SKKRSAS  903
             E+QLK++LKLRLKT+E GLK T    V+P      +K EK+  + G L+    SKK S S
Sbjct  306   ESQLKERLKLRLKTIEDGLKGTNTFLVSPT-----TKTEKSGKILGFLTSGGGSKKWSNS  360

Query  902   QPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKI---DEKENAGMKENSDKLTD  732
             QPR S                       R H L ++ N++   +EKEN+ +  N   LTD
Sbjct  361   QPRGSDTG--------------------RIHALDHTINRVVESNEKENSKITTNG--LTD  398

Query  731   ------------SGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKML  588
                          GN   + ED+VSGFLYDRLQKEVI +RK  + KE  +N K+EEIKML
Sbjct  399   QHEEDGKRKTEEDGNV--DFEDVVSGFLYDRLQKEVIALRKLCESKEGTINAKNEEIKML  456

Query  587   TKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDG-NIRQTNSS  450
              KK++ LTKAIE+E++K KREAA REK+++      +    R+TN S
Sbjct  457   LKKVDALTKAIEIETKKAKREAAAREKENALAMVNEEPKQCRKTNCS  503



>ref|XP_009144675.1| PREDICTED: microtubule-associated protein 70-5-like [Brassica 
rapa]
Length=559

 Score =   424 bits (1091),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 306/508 (60%), Positives = 378/508 (74%), Gaps = 45/508 (9%)
 Frame = -3

Query  1970  DPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKLKISE  1791
             +PF    +SLQNQL+EK++EL  A++E + LR  E+LK++   EL   V++LEE+L +S+
Sbjct  55    NPFASNTSSLQNQLREKDKELLAAKAEIEALRTNEELKNREFGELRENVRKLEERLGVSK  114

Query  1790  NLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEIKMY  1611
             NLV QK +E KKL  EK++AL AQ AAE ALRRVY  Q+EDD +P+ESVIAPLEA+IK  
Sbjct  115   NLVVQKEVEMKKLEEEKEDALAAQDAAEEALRRVYTHQQEDDPLPLESVIAPLEAQIKFQ  174

Query  1610  KNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIEICQ  1431
             K++I+ALQEDK+A+ER  KSKE+ALLEAERILKSALER LIVEEVQN NFELRRQIEICQ
Sbjct  175   KHQISALQEDKKALERLTKSKESALLEAERILKSALERALIVEEVQNHNFELRRQIEICQ  234

Query  1430  EENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeerrtler  1251
             EE K L+K NRQKVLE+E+LSQTI ELEEAILAGG AAN +RDYRRQIS++ EE+RTLER
Sbjct  235   EEYKFLEKINRQKVLEIEKLSQTIGELEEAILAGGTAANAVRDYRRQISQLNEEKRTLER  294

Query  1250  elaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTAKA  1071
             EL+RVKVSA+RVA  VANEWKDEND+VMPVKQWLEERR+L  EMQ+LKDKLA+SERTAKA
Sbjct  295   ELSRVKVSASRVALAVANEWKDENDRVMPVKQWLEERRLLHGEMQKLKDKLAVSERTAKA  354

Query  1070  EAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILS-----SKKRSA  906
             E+QLK++LKLRLKT+E GLK      V+P      +K EK+  + G L+     SKKRS 
Sbjct  355   ESQLKERLKLRLKTIEDGLKSPNMFTVSPTT----TKAEKSGKILGFLTSGVGGSKKRST  410

Query  905   SQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKENAGMKENSDKLTDSG  726
             SQPR S+                      R H L    N+ +E++    KENS K+T +G
Sbjct  411   SQPRGSLTG--------------------RIHALNQPINRGEERDG---KENS-KVTSNG  446

Query  725   --NF----------SKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTK  582
               N           +  +EDMVSGFLYDRLQKEVI++RK  + KE  +N K+EEIKML K
Sbjct  447   LTNVDEEEEQRKAEADGNEDMVSGFLYDRLQKEVISLRKICESKEGTINAKNEEIKMLLK  506

Query  581   KIETLTKAIEVESRKTKREAAIREKDSS  498
             K++ LTKAIEVE++K KREAA REK+++
Sbjct  507   KVDALTKAIEVETKKAKREAAAREKENA  534



>ref|XP_010449651.1| PREDICTED: microtubule-associated protein 70-5-like [Camelina 
sativa]
Length=514

 Score =   421 bits (1082),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 302/509 (59%), Positives = 378/509 (74%), Gaps = 45/509 (9%)
 Frame = -3

Query  1970  DPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKLKISE  1791
             +PF+   +SLQNQLK+KE+EL  A++E + LR  E+LKD+  +EL   V++LE+KL  +E
Sbjct  6     NPFVSNTSSLQNQLKDKEKELLAAKAEVEALRTNEELKDRVFDELRESVRKLEDKLGATE  65

Query  1790  NLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEIKMY  1611
             NLVEQK +E KKL  EK++AL AQ AAE ALRRVY  Q++DD +P+ES+IAPLEA+IK +
Sbjct  66    NLVEQKEVEMKKLKEEKEDALAAQDAAEEALRRVYTHQQDDDFLPLESIIAPLEAQIKFH  125

Query  1610  KNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIEICQ  1431
             K++I ALQEDK+A+ER  KSKE+AL+EAERILKSALER LIVEEVQN NFELRRQIEICQ
Sbjct  126   KHQIFALQEDKKALERLTKSKESALIEAERILKSALERALIVEEVQNHNFELRRQIEICQ  185

Query  1430  EENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeerrtler  1251
             +ENK L+K NRQKVLE+E+LSQ+I+ELEEAILAGG AAN +RDYRRQIS++ +E+RTLER
Sbjct  186   DENKFLEKINRQKVLEIEKLSQSIVELEEAILAGGTAANAVRDYRRQISQLNDEKRTLER  245

Query  1250  elaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTAKA  1071
             ELARVKVSA+RVA  VANEWKDEND+VMPVK+WLEERR+L  EMQ+LKDKLA+SERTAKA
Sbjct  246   ELARVKVSASRVALAVANEWKDENDRVMPVKKWLEERRLLHGEMQKLKDKLAVSERTAKA  305

Query  1070  EAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILS----SKKRSAS  903
             E+QLK++LKLRLKT+E  LK T    V+P      +K EK+  + G L+    SKK S S
Sbjct  306   ESQLKERLKLRLKTIEDSLKGTNTFLVSPT-----TKTEKSGKILGFLTSGGGSKKWSNS  360

Query  902   QPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKI---DEKENAGMKENS-----  747
             QPR S                       R H L +  N++   +EKEN+ +  N      
Sbjct  361   QPRGSDTG--------------------RIHALDHPINRVVESNEKENSKITTNGLIEQH  400

Query  746   ------DKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLT  585
                    K  + GN   + EDMVSGFLYDRLQKEVI +RK  + KE  +N K+EEIKML 
Sbjct  401   EEEDGKRKTEEDGNV--DFEDMVSGFLYDRLQKEVIALRKLCESKEGTINAKNEEIKMLL  458

Query  584   KKIETLTKAIEVESRKTKREAAIREKDSS  498
             KK++ LTKAIEVE++K KREAA REK+++
Sbjct  459   KKVDALTKAIEVETKKAKREAAAREKENA  487



>ref|XP_010538455.1| PREDICTED: microtubule-associated protein 70-5 [Tarenaya hassleriana]
 ref|XP_010538457.1| PREDICTED: microtubule-associated protein 70-5 [Tarenaya hassleriana]
Length=518

 Score =   421 bits (1082),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 300/509 (59%), Positives = 374/509 (73%), Gaps = 40/509 (8%)
 Frame = -3

Query  1970  DPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKLKISE  1791
             DPF+ EL  L NQLK   +E+  A+ E    RA E  KDKA E+L  +V++LEEKL+ SE
Sbjct  6     DPFVPELHYLHNQLK-GTKEVLAARGEMDVQRADETPKDKAFEKLKKDVRKLEEKLRASE  64

Query  1790  NLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAE--QKEDDSIPIESVIAPLEAEIK  1617
             +L+EQK +E KK+  EK++AL AQYAAEA L RVYA+  QK+DDSIP+ES+I+PLEA+IK
Sbjct  65    DLLEQKEVEMKKVREEKEDALAAQYAAEATLGRVYADSDQKDDDSIPLESIISPLEAQIK  124

Query  1616  MYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIEI  1437
             ++K EI  LQED +A+ER  K+KEAAL+EAERIL+SALER LIVE+VQNQNFELRRQIEI
Sbjct  125   IHKQEILTLQEDNKALERLTKAKEAALVEAERILRSALERALIVEDVQNQNFELRRQIEI  184

Query  1436  CQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeerrtl  1257
             CQEENKIL+KTNRQKVLE+E+LS TI  LE+AILAGG+AAN +RDYRR+ISE+ EE+RTL
Sbjct  185   CQEENKILEKTNRQKVLEIEKLSHTIHSLEQAILAGGSAANAVRDYRRRISELNEEKRTL  244

Query  1256  erelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTA  1077
             ERELARVKVSANRVA  VANEWKDEND+VMPVK+WLEERR+L  EMQ+LKDKLAISERTA
Sbjct  245   ERELARVKVSANRVALAVANEWKDENDRVMPVKKWLEERRLLHGEMQKLKDKLAISERTA  304

Query  1076  KAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILSSKKRSASQP  897
             KAEAQLK+KL+LRLKT+E  LK       NP   S  +K EK   +   LS   RS SQP
Sbjct  305   KAEAQLKEKLRLRLKTIEDSLK-------NPNTFSVSTKIEKTGKVLSFLS---RSTSQP  354

Query  896   RASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKENAGMKENSDKLTDSGNFS  717
             R SMV  +        +        KR + +  S    D KEN+ +K N   +    +  
Sbjct  355   RGSMVIRSYALNQLCVS--------KRSNKVADS----DGKENSEIKANGSCVHGEESRK  402

Query  716   KNDE---------------DMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTK  582
             K DE               DMVSGFLYDRLQ+EVIN+R+  + K+  ++ KDEEIK+L K
Sbjct  403   KTDESDENGSGKGEEEASGDMVSGFLYDRLQREVINLRRATEAKDGTIHAKDEEIKILMK  462

Query  581   KIETLTKAIEVESRKTKREAAIREKDSST  495
             ++++LTKAIEVE++K KREAA RE+++++
Sbjct  463   RVDSLTKAIEVETKKAKREAAARERENAS  491



>ref|XP_006414258.1| hypothetical protein EUTSA_v10024950mg [Eutrema salsugineum]
 gb|ESQ55711.1| hypothetical protein EUTSA_v10024950mg [Eutrema salsugineum]
Length=512

 Score =   419 bits (1077),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 302/498 (61%), Positives = 377/498 (76%), Gaps = 23/498 (5%)
 Frame = -3

Query  1970  DPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKLKISE  1791
             +P  +  +SLQNQLKEK++EL  A++E + LR  E+LK++A  EL   V++LEE+L  +E
Sbjct  6     NPLAINTSSLQNQLKEKDKELLAAKAEIEALRTNEELKNRAFGELRENVRKLEERLGANE  65

Query  1790  NLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEIKMY  1611
             NLV+QK +E KKL  EK++AL AQ AAE ALRRVY  Q +DDS P+ESVIAPLE +IK  
Sbjct  66    NLVKQKEVEVKKLEEEKEDALAAQDAAEEALRRVYTHQHDDDSSPLESVIAPLEDQIKFQ  125

Query  1610  KNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIEICQ  1431
             K++I+ALQEDK+A+ER  KSKE+ALLEAERIL+SALER LIVEEVQN NFELRRQIEICQ
Sbjct  126   KHQISALQEDKKALERLTKSKESALLEAERILRSALERALIVEEVQNHNFELRRQIEICQ  185

Query  1430  EENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeerrtler  1251
             +ENK L+K NRQKVLE+E+LSQTI ELEEAILAGG AAN +RDYRRQIS++ EE+RTLER
Sbjct  186   DENKFLEKINRQKVLEIEKLSQTIGELEEAILAGGTAANAVRDYRRQISQLNEEKRTLER  245

Query  1250  elaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTAKA  1071
             ELARVKVSA+RVA  VANEWKDEND+VMP+KQWL+ERR+L  EMQ+LKDKLAISERTAKA
Sbjct  246   ELARVKVSASRVALAVANEWKDENDRVMPIKQWLDERRLLHGEMQKLKDKLAISERTAKA  305

Query  1070  EAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILS----SKKRSAS  903
             E+QLK++LKLRLKT+E GLK     + +P      +K EK+  + G L+    SKKRS S
Sbjct  306   ESQLKERLKLRLKTIEDGLKGPNKFSDSPTT----TKTEKSIKILGFLTNGGGSKKRSTS  361

Query  902   QPRASM---VNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKENAGMKENSDKLTD  732
             QPR S+   ++  ++       S    + K   +GL      ID+ E  G +    K  +
Sbjct  362   QPRGSLTGRIHALNQTIHRVPESDGKENSKVEANGL------IDQHEEDGKR----KAEE  411

Query  731   SGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIE  552
              GN   + EDMVSGFLYDRLQKEVI +RK  + KE  +N K+EEIKML KK++ LTKAIE
Sbjct  412   DGNV--DSEDMVSGFLYDRLQKEVITLRKICESKEGTINAKNEEIKMLLKKVDALTKAIE  469

Query  551   VESRKTKREAAIREKDSS  498
             VE++K KREAA REK+++
Sbjct  470   VETKKAKREAAAREKENA  487



>emb|CDY35590.1| BnaC01g21120D [Brassica napus]
Length=514

 Score =   416 bits (1068),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 305/512 (60%), Positives = 374/512 (73%), Gaps = 49/512 (10%)
 Frame = -3

Query  1970  DPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKLKISE  1791
             +PF    +SLQNQL+EK++EL  A++E + LR  E+LK++   EL   V++LEE+L +S+
Sbjct  6     NPFASNTSSLQNQLREKDKELLAAKAEIEALRTNEELKNREFGELRENVRKLEERLGVSK  65

Query  1790  NLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEIKMY  1611
             NLVE K +E KKL  EK++AL AQ AAE ALRRVY  Q+EDD +P+ESVIAP EA+IK  
Sbjct  66    NLVEHKEVEMKKLEEEKEDALAAQDAAEEALRRVYTHQQEDDPLPLESVIAPFEAQIKFQ  125

Query  1610  KNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIEICQ  1431
             K++I ALQEDK+A+ER  KSKE+ALLEAERILKSALER LIVEEVQN NFELRRQIEICQ
Sbjct  126   KHQIFALQEDKKALERLTKSKESALLEAERILKSALERALIVEEVQNHNFELRRQIEICQ  185

Query  1430  EENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqise--iqeerrtl  1257
             EE K L+K NRQKVLE+E+LSQTI ELEEAILAGG AAN +RDYRRQIS+    EE+RTL
Sbjct  186   EEYKFLEKINRQKVLEIEKLSQTIGELEEAILAGGTAANAVRDYRRQISQLNASEEKRTL  245

Query  1256  erelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTA  1077
             ERELARVKVSA+RVA   ANEWKDEND+VMPVKQWLEERR+L  EMQ+LKDKLA+SERTA
Sbjct  246   ERELARVKVSASRVALAFANEWKDENDRVMPVKQWLEERRLLHGEMQKLKDKLAVSERTA  305

Query  1076  KAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILS-----SKKR  912
             KAE+QLK++LKLRLKT+E GLK     +V+P      +K EK+  + G L+     SKKR
Sbjct  306   KAESQLKERLKLRLKTIEDGLKCLNMLSVSPTT----TKAEKSGKILGFLTSGGGGSKKR  361

Query  911   SASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKENAGMKENSDKLTD  732
             S SQPR S+                      R H L    N+ +E++    KENS K+T 
Sbjct  362   STSQPRGSLTG--------------------RIHALNQPINRGEERDG---KENS-KVTS  397

Query  731   SG--NFSK------------NDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIK  594
             +G  N  +             +EDMVSGFLYDRLQKEVI++RK  + KE  +N K+EEIK
Sbjct  398   NGVTNVDEEEEEQQRKAEEDGNEDMVSGFLYDRLQKEVISLRKICESKEGTINAKNEEIK  457

Query  593   MLTKKIETLTKAIEVESRKTKREAAIREKDSS  498
             ML KK+  LTKAIEVE++K KREAA REK+++
Sbjct  458   MLLKKVHALTKAIEVETKKAKREAAAREKENA  489



>gb|KHN40802.1| Microtubule-associated protein 70-5 [Glycine soja]
Length=549

 Score =   412 bits (1060),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 322/570 (56%), Positives = 400/570 (70%), Gaps = 70/570 (12%)
 Frame = -3

Query  2024  MAAGYEEVGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKAL  1845
             M A  E  G  EL L+  DP  L++  L NQL EK +EL   QSE K LRATE  KDKA+
Sbjct  1     MVASEEIYGGEELSLVQPDPMGLQIDRLHNQLTEKVKELANCQSEIKALRATEAKKDKAI  60

Query  1844  EELGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDD  1665
             EEL NEV +L++KL+++E+ ++ K LE KKL  EKK+AL AQYAAEA LRR++A+QKEDD
Sbjct  61    EELRNEVGKLDDKLRLTEDHLKHKKLEIKKLTEEKKDALAAQYAAEATLRRLHADQKEDD  120

Query  1664  SIPIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIV  1485
              +P+ESVI PLEAEIKMY+NEIA+LQEDK+A+ER  KSKEAALLEAE+IL+SALER    
Sbjct  121   FVPLESVITPLEAEIKMYRNEIASLQEDKKALERLTKSKEAALLEAEKILRSALER----  176

Query  1484  EEVQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIR  1305
                               EE KIL+KT+RQK+LEVE+LSQTI ELEE IL+ G  AN IR
Sbjct  177   ------------------EEIKILEKTHRQKILEVEKLSQTIHELEEIILSSGVNANAIR  218

Query  1304  DYrrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQA  1125
             DY+RQISE+QEE+RTLERELARVKVSANRVAT+VANEWKDENDKVMPVKQWLEERRI+QA
Sbjct  219   DYQRQISELQEEKRTLERELARVKVSANRVATVVANEWKDENDKVMPVKQWLEERRIMQA  278

Query  1124  EMQRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKAN  945
             EMQRLKDKLAISERTAKAE+QLKDKLKLRLKTLE+GLK   N+ V+   +S  S+  K  
Sbjct  279   EMQRLKDKLAISERTAKAESQLKDKLKLRLKTLEEGLKHFSNHPVSSNSVSAKSEKSK--  336

Query  944   HLFGILSS----KKRSASQPRASMV--------NTTseqesssensgEYNDQKKRH----  813
              +   L++    + RS SQPR S +        N  S  +S + +    +  KK++    
Sbjct  337   -ILSFLTTNSGLRNRSTSQPRGSAIGSSLFQKSNAKSNTDSVTGSLIPGSIMKKKYGSAE  395

Query  812   ----HGLWYSRNKI---DEKEN-----AGMKENS--------------DKLTDSGNFSKN  711
                  G+W SR+K+   DEKEN     AGM  N               D   DS + S N
Sbjct  396   NVLKKGIWASRHKVADSDEKENEMQVNAGMNSNKCNDEKEAAEIKTSIDDNDDSKSNSCN  455

Query  710   D---EDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESR  540
             D    D+VSGFLYDRLQKE IN+RK  ++KE++L+TKDEEIK+LTKK++ LTKA+E+E +
Sbjct  456   DLGSNDVVSGFLYDRLQKEFINLRKSCEIKESNLHTKDEEIKILTKKVDALTKAMEIEWK  515

Query  539   KTKREAAIREKDSSTIKYKYDGNIRQTNSS  450
             K KREAA REK++++ K   +  +R++NSS
Sbjct  516   KMKREAAAREKEAASTKSDDNRKLRRSNSS  545



>ref|XP_006350273.1| PREDICTED: microtubule-associated protein 70-5-like, partial 
[Solanum tuberosum]
Length=423

 Score =   405 bits (1041),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 291/443 (66%), Positives = 336/443 (76%), Gaps = 68/443 (15%)
 Frame = -3

Query  1841  ELGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDS  1662
             +L NE +RLE KLKI EN+VEQKNL+ K+L+NEKKEAL AQYAAEA LRRVYA+QK+DD+
Sbjct  2     QLRNEFRRLEGKLKIGENVVEQKNLDIKRLVNEKKEALAAQYAAEATLRRVYADQKDDDA  61

Query  1661  IPIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVE  1482
              P+ES+IAPLEAEIKMYKNEIAALQED R++ERH +SKEAALLEAERILKSALER LIVE
Sbjct  62    PPLESIIAPLEAEIKMYKNEIAALQEDTRSLERHTRSKEAALLEAERILKSALERALIVE  121

Query  1481  EVQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRD  1302
             E+QNQN+ELRRQIEI QEENKILDKTNRQK+LEVE+LSQTILELEEAILAGGAAANT+RD
Sbjct  122   EIQNQNYELRRQIEIFQEENKILDKTNRQKILEVEKLSQTILELEEAILAGGAAANTLRD  181

Query  1301  YrrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAE  1122
             Y+R+ISE+QEE+RTLEREL+RVKVSANRVAT+VANEWKDENDKVMPVKQWLEERR+LQAE
Sbjct  182   YKRRISELQEEKRTLERELSRVKVSANRVATVVANEWKDENDKVMPVKQWLEERRLLQAE  241

Query  1121  MQRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANH  942
             MQRL+DKL+ISERTAKAEAQLKDKLKLRLKTLE+GLKQ  N N       G +KP+K  H
Sbjct  242   MQRLRDKLSISERTAKAEAQLKDKLKLRLKTLEEGLKQAFNPN-------GSTKPQKTKH  294

Query  941   LFGILSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKI----DEK  774
               G              S+V  +                      LW SRNKI      K
Sbjct  295   YLG-------------NSLVKKS----------------------LWTSRNKIIGNTVGK  319

Query  773   ENAGMKENS----------------------DKLTDSGNFSKNDEDMVSGFLYDRLQKEV  660
             ENA M+ENS                      D+   +G    +++D+VSGFLYD+LQKEV
Sbjct  320   ENAEMQENSIVDINYKETIDAHKIKNRGGDQDEHKTNGCSQSDNDDIVSGFLYDKLQKEV  379

Query  659   INMRKCFDMKENDLNTKDEEIKM  591
             I +RK  + KE+ LNTKDEEIK+
Sbjct  380   ICLRKFCETKESALNTKDEEIKV  402



>emb|CDY42967.1| BnaA01g17870D [Brassica napus]
Length=500

 Score =   407 bits (1047),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 298/511 (58%), Positives = 368/511 (72%), Gaps = 60/511 (12%)
 Frame = -3

Query  1970  DPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKLKISE  1791
             +PF    +SLQNQL+EK++EL  A++E + LR  E+LK +   EL   V++LEE+L IS+
Sbjct  6     NPFASNTSSLQNQLREKDKELLAAKAEIEALRTNEELKKREFGELRENVRKLEERLGISK  65

Query  1790  NLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEIKMY  1611
             NLV QK +E KKL  EK++AL AQ AAE ALRRVY  Q+EDD +P+ESVIAPLEA+IK  
Sbjct  66    NLVVQKEVEMKKLEEEKEDALAAQDAAEEALRRVYTHQQEDDPLPLESVIAPLEAQIKFQ  125

Query  1610  KNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIEICQ  1431
             K++I+ALQEDK+A+ER  KSKE+ALLEAERILKSALER LIVEEVQN NFELRRQIEICQ
Sbjct  126   KHQISALQEDKKALERLTKSKESALLEAERILKSALERALIVEEVQNHNFELRRQIEICQ  185

Query  1430  EENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeerrtler  1251
             EE K L+K NRQKVLE+E+LSQTI ELEEAILAGG AAN             EE+RTLER
Sbjct  186   EEYKFLEKINRQKVLEIEKLSQTIGELEEAILAGGTAANA------------EEKRTLER  233

Query  1250  elaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTAKA  1071
             ELARVKVSA+RVA  VANEWKDEND+VMPVKQWLEERR+L  EMQ+LKDKLA+SERTAKA
Sbjct  234   ELARVKVSASRVALAVANEWKDENDRVMPVKQWLEERRLLHGEMQKLKDKLAVSERTAKA  293

Query  1070  EAQl----kdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILS-----SK  918
             E+QL    +++LKLRLKT+E GLK      V+P      +K EK+  + G L+     SK
Sbjct  294   ESQLNNLIQERLKLRLKTVEDGLKSPNMFTVSPTT----TKAEKSGKILGFLTSGGGGSK  349

Query  917   KRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKENAGMKENSDKL  738
             KRS SQPR S+ +                    R H L    N+ +E++    KENS K+
Sbjct  350   KRSTSQPRGSITS--------------------RIHALNQPINRGEERDG---KENS-KV  385

Query  737   TDSGNFSKND-----------EDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKM  591
             T +G+  +++           EDMVSGFLYDRLQKEVI++RK  + KE  +N K+EEIKM
Sbjct  386   TSNGSADQHEGKAEEDGNVDSEDMVSGFLYDRLQKEVISLRKICESKEGTINAKNEEIKM  445

Query  590   LTKKIETLTKAIEVESRKTKREAAIREKDSS  498
             L KK++ LTKAIEVE++K KREAA REK+++
Sbjct  446   LLKKVDALTKAIEVETKKAKREAAAREKENA  476



>ref|XP_008441104.1| PREDICTED: microtubule-associated protein 70-5-like [Cucumis 
melo]
Length=488

 Score =   406 bits (1043),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 293/488 (60%), Positives = 360/488 (74%), Gaps = 41/488 (8%)
 Frame = -3

Query  2024  MAAGYEE-VGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKA  1848
             M + YEE VG  E C++H DP +LEL  LQN L EK RELG A+SE K L+ATE  KDKA
Sbjct  1     MVSYYEEHVGREEDCVVHPDPVVLELNRLQNLLSEKNRELGAARSEIKALKATEAQKDKA  60

Query  1847  LEELGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKED  1668
             LEEL +EV +L++KL+ +ENL+E KNLE K+L  EKK+A+ AQYAAEA LRRVYA QK+D
Sbjct  61    LEELKSEVDKLDDKLRATENLLEHKNLEIKRLTTEKKDAVAAQYAAEATLRRVYANQKDD  120

Query  1667  DSIPIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLI  1488
             DS+ + SVIAPLEAEIK+YKNE+A LQEDK+A+ER  KSKEAALLEAE+IL+SALER LI
Sbjct  121   DSLTLASVIAPLEAEIKIYKNEVALLQEDKKALERLTKSKEAALLEAEKILRSALERALI  180

Query  1487  VEEVQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTI  1308
             VEEVQN NFEL+RQIEICQEEN+IL+KTNRQKV+EVERL QTI +LEEAILAGGA AN +
Sbjct  181   VEEVQNHNFELKRQIEICQEENRILEKTNRQKVIEVERLGQTIEDLEEAILAGGATANMV  240

Query  1307  RDYrrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQ  1128
             RDY+RQI E+ EE+RTLERELAR KVSA+RVAT+VANEWKDENDKVMPVKQWLEER++LQ
Sbjct  241   RDYKRQIEELHEEKRTLERELARAKVSAHRVATVVANEWKDENDKVMPVKQWLEERKLLQ  300

Query  1127  AEMQRLKDKLAISERTAKAEAQlkdkl-klrlktLEQGLKQTGNNNVNPKVLSGFSKPEK  951
             AE+QR+K+KLAISERTAKAEAQLK +  KLRLKTLE+GLKQ   + +N   + G  K E+
Sbjct  301   AELQRMKEKLAISERTAKAEAQLKVEKFKLRLKTLEEGLKQIQISPLNSNAICGSPKAER  360

Query  950   ANHLFGILSS--KKRSASQPRAS--------MVNTTseqesssensgEYNDQKKRH----  813
             +N++ G L+S  +KRS S  R S        +V T   +++++      N  KK +    
Sbjct  361   SNNILGFLTSNGRKRSTSLSRPSIITKSSNILVQTADYEKATAPELNRSNSLKKTYASAR  420

Query  812   -----HGLWYS-RNK---IDEKENAGMKENSD----KLTDS-----GNFSKN-------D  708
                    +W + R++   IDEKE   M+ N +     +TDS     G    N       +
Sbjct  421   ENVIKKSMWATGRSRVVEIDEKEGNEMRGNKENRNATITDSKETNDGEGLDNKEPINLEN  480

Query  707   EDMVSGFL  684
             ED VSGFL
Sbjct  481   EDTVSGFL  488



>emb|CAB78725.1| putative protein [Arabidopsis thaliana]
Length=515

 Score =   404 bits (1039),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 300/516 (58%), Positives = 375/516 (73%), Gaps = 58/516 (11%)
 Frame = -3

Query  1970  DPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKLKISE  1791
             +PF+ + +SLQ+QLKEKE+EL  A++E + LR  E+LKD+  +EL   V++LEEKL  +E
Sbjct  6     NPFVSDTSSLQSQLKEKEKELLAAKAEVEALRTNEELKDRVFKELRENVRKLEEKLGATE  65

Query  1790  NLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEIKMY  1611
             N V+QK LE KKL  EK++AL AQ AAE ALRRVY  Q++DDS+P+ES+IAPLE++IK++
Sbjct  66    NQVDQKELERKKLEEEKEDALAAQDAAEEALRRVYTHQQDDDSLPLESIIAPLESQIKIH  125

Query  1610  KNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIEICQ  1431
             K+EI+ALQEDK+A+ER  KSKE+ALLEAERIL+SALER LIVEEVQN NFELRRQIEICQ
Sbjct  126   KHEISALQEDKKALERLTKSKESALLEAERILRSALERALIVEEVQNHNFELRRQIEICQ  185

Query  1430  EENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqise--iqeerrtl  1257
             +ENK L+K NRQKVLE+E+LSQ+I+ELEEAILAGG AAN +RDYRRQIS+    +E+RTL
Sbjct  186   DENKFLEKINRQKVLEIEKLSQSIVELEEAILAGGTAANAVRDYRRQISQLNASDEKRTL  245

Query  1256  erelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTA  1077
             ERELARVKVSA+RVA  VANEWKDEND+VMPVKQWLEERRIL  EMQ+LKDKLA+SERTA
Sbjct  246   ERELARVKVSASRVALAVANEWKDENDRVMPVKQWLEERRILHGEMQKLKDKLAVSERTA  305

Query  1076  KAEAQ----lkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILS----S  921
             KAE+Q      ++LKLRLKT+E GLK      V+P      +K EK+  + G L+    S
Sbjct  306   KAESQLKVIAYERLKLRLKTIEDGLKGPNTFFVSPT-----TKTEKSGKILGFLTSGGGS  360

Query  920   KKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKI---DEKENAGMKEN  750
             KKRS+SQ R S+                      R H +    +++   DE EN+ +  N
Sbjct  361   KKRSSSQLRGSVTG--------------------RIHAMNQPIDRVGESDEMENSKITAN  400

Query  749   SDKLTD------------SGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKD  606
                LTD             GN     EDMVSGFLYDRLQKEVI +RK  + KE  +N K+
Sbjct  401   G--LTDQHEEDSERKTEEDGNVY--SEDMVSGFLYDRLQKEVIALRKLCESKEGTINAKN  456

Query  605   EEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSS  498
             EEI    KK++ LTKAIEVE++K KREAA REK+++
Sbjct  457   EEI----KKVDALTKAIEVETKKAKREAAAREKENA  488



>emb|CAB10503.1| myosin II heavy chain like protein [Arabidopsis thaliana]
Length=550

 Score =   405 bits (1041),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 300/516 (58%), Positives = 375/516 (73%), Gaps = 58/516 (11%)
 Frame = -3

Query  1970  DPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKLKISE  1791
             +PF+ + +SLQ+QLKEKE+EL  A++E + LR  E+LKD+  +EL   V++LEEKL  +E
Sbjct  6     NPFVSDTSSLQSQLKEKEKELLAAKAEVEALRTNEELKDRVFKELRENVRKLEEKLGATE  65

Query  1790  NLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEIKMY  1611
             N V+QK LE KKL  EK++AL AQ AAE ALRRVY  Q++DDS+P+ES+IAPLE++IK++
Sbjct  66    NQVDQKELERKKLEEEKEDALAAQDAAEEALRRVYTHQQDDDSLPLESIIAPLESQIKIH  125

Query  1610  KNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIEICQ  1431
             K+EI+ALQEDK+A+ER  KSKE+ALLEAERIL+SALER LIVEEVQN NFELRRQIEICQ
Sbjct  126   KHEISALQEDKKALERLTKSKESALLEAERILRSALERALIVEEVQNHNFELRRQIEICQ  185

Query  1430  EENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqise--iqeerrtl  1257
             +ENK L+K NRQKVLE+E+LSQ+I+ELEEAILAGG AAN +RDYRRQIS+    +E+RTL
Sbjct  186   DENKFLEKINRQKVLEIEKLSQSIVELEEAILAGGTAANAVRDYRRQISQLNASDEKRTL  245

Query  1256  erelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTA  1077
             ERELARVKVSA+RVA  VANEWKDEND+VMPVKQWLEERRIL  EMQ+LKDKLA+SERTA
Sbjct  246   ERELARVKVSASRVALAVANEWKDENDRVMPVKQWLEERRILHGEMQKLKDKLAVSERTA  305

Query  1076  KAEAQ----lkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILS----S  921
             KAE+Q      ++LKLRLKT+E GLK      V+P      +K EK+  + G L+    S
Sbjct  306   KAESQLKVIAYERLKLRLKTIEDGLKGPNTFFVSPT-----TKTEKSGKILGFLTSGGGS  360

Query  920   KKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKI---DEKENAGMKEN  750
             KKRS+SQ R S+                      R H +    +++   DE EN+ +  N
Sbjct  361   KKRSSSQLRGSVTG--------------------RIHAMNQPIDRVGESDEMENSKITAN  400

Query  749   SDKLTD------------SGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKD  606
                LTD             GN     EDMVSGFLYDRLQKEVI +RK  + KE  +N K+
Sbjct  401   G--LTDQHEEDSERKTEEDGNVY--SEDMVSGFLYDRLQKEVIALRKLCESKEGTINAKN  456

Query  605   EEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSS  498
             EEI    KK++ LTKAIEVE++K KREAA REK+++
Sbjct  457   EEI----KKVDALTKAIEVETKKAKREAAAREKENA  488



>emb|CDX90483.1| BnaA03g42980D [Brassica napus]
Length=503

 Score =   400 bits (1028),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 298/500 (60%), Positives = 376/500 (75%), Gaps = 36/500 (7%)
 Frame = -3

Query  1970  DPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKLKISE  1791
             +PF    +SLQ+QLKEK++EL  A++E + LR  E+L+++A EEL   V++ EE+L    
Sbjct  6     NPFASNTSSLQSQLKEKDKELLAAKAEIEALRTNEELENRAFEELRENVRKWEERLGQKV  65

Query  1790  NLV-EQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEIKM  1614
             + V E++ +E KKL  EK++AL AQ AAE ALRRVY  Q+EDDS+P+ESVIAPLEA+IK 
Sbjct  66    HCVMEEQEVEMKKLEEEKEDALAAQEAAEEALRRVYTHQQEDDSLPLESVIAPLEAQIKF  125

Query  1613  YKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIEIC  1434
              K++I+ALQEDK+A+ER  KSKE+ALLEAERILKSALER LIVEEVQN NFELRRQIEIC
Sbjct  126   QKHQISALQEDKKALERLTKSKESALLEAERILKSALERALIVEEVQNHNFELRRQIEIC  185

Query  1433  QEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeerrtle  1254
             QEE K L+K NRQKVLE+E+LSQTI ELEEAILAGG AAN +RDYRRQIS++  ++RTLE
Sbjct  186   QEEYKFLEKINRQKVLEIEKLSQTIGELEEAILAGGTAANAVRDYRRQISQLNAKKRTLE  245

Query  1253  relaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTAK  1074
             RELARVKVSA+RVA  VANEWKDEND+VMPVKQWLEERR+L  EMQ+LKDKLA+SERTAK
Sbjct  246   RELARVKVSASRVALAVANEWKDENDRVMPVKQWLEERRLLHGEMQKLKDKLAVSERTAK  305

Query  1073  AEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILS------SKKR  912
             AE+QLK++LKLRLKT+E GLK + N     +     +K EK+  + G L+      SKKR
Sbjct  306   AESQLKERLKLRLKTIEDGLKSSQNTFSMSQTT---TKTEKSGKILGFLTSGGGGGSKKR  362

Query  911   SASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKENAGMKENSDKLTD  732
             S+SQPR S+                      R H +    N++ E +    KENS K++ 
Sbjct  363   SSSQPRGSITG--------------------RIHAVNQPINRVGETDG---KENS-KISA  398

Query  731   SGNFSKN--DEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKA  558
             +G   ++  +EDMVSGFLYDRLQKEVI +RK  + KE+ +N K+EEIKML KK++ LTKA
Sbjct  399   NGLVDQDAKEEDMVSGFLYDRLQKEVIALRKVCESKEDTINAKNEEIKMLLKKVDALTKA  458

Query  557   IEVESRKTKREAAIREKDSS  498
             IEVE++K KREAA REK+++
Sbjct  459   IEVETKKAKREAAAREKENA  478



>ref|XP_009136832.1| PREDICTED: microtubule-associated protein 70-5-like [Brassica 
rapa]
Length=495

 Score =   397 bits (1019),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 299/499 (60%), Positives = 374/499 (75%), Gaps = 42/499 (8%)
 Frame = -3

Query  1970  DPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKLKISE  1791
             +PF    +SLQ+QLKEK++EL  A++E + LR  E+L+++A EEL   V++ EE+L    
Sbjct  6     NPFASNTSSLQSQLKEKDKELLAAKAEIEALRTNEELENRAFEELRENVRKWEERLG---  62

Query  1790  NLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEIKMY  1611
                 QK +E KKL  EK++AL AQ AAE ALRRVY  Q+EDDS+P+ESVIAPLEA+IK  
Sbjct  63    ----QKEVEMKKLEEEKEDALAAQEAAEEALRRVYTHQQEDDSLPLESVIAPLEAQIKFQ  118

Query  1610  KNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIEICQ  1431
             K++I+ALQEDK+A+ER  KSKE+ALLEAERILKSALER LIVEEVQN NFELRRQIEICQ
Sbjct  119   KHQISALQEDKKALERLTKSKESALLEAERILKSALERALIVEEVQNHNFELRRQIEICQ  178

Query  1430  EENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeerrtler  1251
             EE K L+K NRQKVLE+E+LSQTI ELEEAILAGG AAN +RDYRRQIS++ EE+RTLER
Sbjct  179   EEYKFLEKINRQKVLEIEKLSQTIGELEEAILAGGTAANAVRDYRRQISQLNEEKRTLER  238

Query  1250  elaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTAKA  1071
             ELARVKVSA+RVA  VANEWKD+ND+VMPVKQWLEERR+L  EMQ+LKDKLA+SERTAKA
Sbjct  239   ELARVKVSASRVALAVANEWKDDNDRVMPVKQWLEERRLLHGEMQKLKDKLAVSERTAKA  298

Query  1070  EAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILS------SKKRS  909
             E+QLK++LKLRLKT+E GLK + N     +     +K EK+  + G L+      SKKRS
Sbjct  299   ESQLKERLKLRLKTIEDGLKSSQNTFSMSQTT---TKTEKSGKILGFLTSGGGGGSKKRS  355

Query  908   ASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKENAGMKENSDKLTDS  729
             +SQPR S+                      R H +    N++ E +    KENS K++ +
Sbjct  356   SSQPRGSITG--------------------RIHAVNQPINRVGETDG---KENS-KISAN  391

Query  728   GNFSKN--DEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAI  555
             G   ++  +EDMVSGFLYDRLQKEVI +RK  + KE+ +N K+EEIKML KK++ LTKAI
Sbjct  392   GLVDQDAKEEDMVSGFLYDRLQKEVIALRKVCESKEDTINAKNEEIKMLLKKVDALTKAI  451

Query  554   EVESRKTKREAAIREKDSS  498
             EVE++K KREAA REK+++
Sbjct  452   EVETKKAKREAAAREKENA  470



>gb|ACU18231.1| unknown [Glycine max]
Length=365

 Score =   385 bits (990),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 261/367 (71%), Positives = 309/367 (84%), Gaps = 6/367 (2%)
 Frame = -3

Query  2024  MAAGYEEVGVAELCLLHTDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKAL  1845
             M A  +  G  E+ L+  DP  L++  LQNQL EK +EL   QSE K LRATE  KDKA+
Sbjct  1     MVASEDIYGGEEVSLVQPDPVGLQIDRLQNQLTEKVKELATCQSEIKALRATEAKKDKAI  60

Query  1844  EELGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDD  1665
             EEL NEV +L++KL+++E+ ++ K LE KKL  EKK+AL AQYAAEA LRR++A+QKEDD
Sbjct  61    EELRNEVGKLDDKLRLTEDHLKHKKLEIKKLTEEKKDALAAQYAAEATLRRLHADQKEDD  120

Query  1664  SIPIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIV  1485
              +P+ESVI PLEAEIKMY+NEIA+LQEDK+A+ER  KSKEAALLEAE+IL+SALERVLIV
Sbjct  121   FVPLESVITPLEAEIKMYRNEIASLQEDKKALERLTKSKEAALLEAEKILRSALERVLIV  180

Query  1484  EEVQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIR  1305
             EEVQN+NF+L+RQIEICQEENKIL+KT+RQK+LEVE+LSQTI ELEE IL+ G  AN +R
Sbjct  181   EEVQNENFDLKRQIEICQEENKILEKTHRQKILEVEKLSQTIHELEEVILSSGVNANAVR  240

Query  1304  DYrrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQA  1125
             DY+RQISE+QEE+RTLERELARVKVSANRVAT+VANEWKDENDKVMPVKQWLEERRI+QA
Sbjct  241   DYQRQISELQEEKRTLERELARVKVSANRVATVVANEWKDENDKVMPVKQWLEERRIMQA  300

Query  1124  EMQRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKAN  945
             EMQRLKDKLAISERTAKAE+QLKDKLK+RLKTLE+GLK   NN V+    SG +K EK  
Sbjct  301   EMQRLKDKLAISERTAKAESQLKDKLKMRLKTLEEGLKHFSNNPVSSN--SGSAKSEK--  356

Query  944   HLFGILS  924
               + ILS
Sbjct  357   --YKILS  361



>ref|XP_006415832.1| hypothetical protein EUTSA_v10007068mg [Eutrema salsugineum]
 gb|ESQ34185.1| hypothetical protein EUTSA_v10007068mg [Eutrema salsugineum]
Length=628

 Score =   391 bits (1005),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 276/535 (52%), Positives = 383/535 (72%), Gaps = 27/535 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+RELG A +E K LR +E+ ++KA+EEL  E+ +L+
Sbjct  62    ITLLHGSDPVKVELNRLENEVRDKDRELGEAHAEIKALRFSERQREKAVEELTEELAKLD  121

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+++E KNLE KK+  EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  122   EKLKLTESILESKNLEIKKINEEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  181

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQED RA++R  KSKEAALL+AER ++ AL +  +V+++QN+N EL 
Sbjct  182   EAELKLARSEIGKLQEDNRALDRLTKSKEAALLDAERTIEGALAKAAMVDDLQNKNQELM  241

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  242   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNE  301

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  302   ERKTLDRELARAKVTANRVATVVANEWKDGNDKVMPVKQWLEERRFLQGEMQQLRDKLAI  361

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNV--NPKVLSGFSKPEKANHLFGILS--  924
             ++R AK+EAQLK+K +LRLK LE+ L+ T N++     +  S  + P +   L G  S  
Sbjct  362   TDRAAKSEAQLKEKFQLRLKVLEETLRGTSNSSTRNTSETRSMSNGPSRRQSLGGADSLQ  421

Query  923   --------SKKRSASQPRASM-VNTTseqesssensgEYNDQKK---RHHGLW-------  801
                     SKK  ASQ R S+ +N+TS  +++   S  ++   +   R   L        
Sbjct  422   KFPSNGSFSKKAPASQMRHSLSINSTSVLKNAKGTSKSFDGGTRSLDRGKALLNGPGNYS  481

Query  800   YSRNKIDEKENA---GMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMK  630
             +S+   D KE     G KENS++  +S N +   ED V G LYD LQKEV+++RK    K
Sbjct  482   FSKASDDSKEAETANGWKENSEEKPESENPAAETEDSVPGVLYDLLQKEVVSLRKASHEK  541

Query  629   ENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIR  465
             +  L  KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++ + D + R
Sbjct  542   DQSLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRVEKDQDTR  596



>ref|XP_002890697.1| At1g68060/T23K23_9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66956.1| At1g68060/T23K23_9 [Arabidopsis lyrata subsp. lyrata]
Length=634

 Score =   390 bits (1002),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 276/535 (52%), Positives = 385/535 (72%), Gaps = 27/535 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+RELG A +E K LR +E+ ++KA+EEL  E+ +L+
Sbjct  67    ITLLHGSDPVKVELNRLENEVRDKDRELGEAHAEIKALRLSERQREKAVEELTEELAKLD  126

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+++E KNLE KK+  EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  127   EKLKLTESILESKNLEIKKINEEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  186

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQED RA++R  KSKEAALLEAER +++A+ +  +V+++QN+N EL 
Sbjct  187   EAELKLARSEIGKLQEDNRALDRLTKSKEAALLEAERTVEAAMAKAAMVDDLQNKNQELM  246

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILD+ +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  247   KQIEICQEENKILDRMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNE  306

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  307   ERKTLDRELARAKVTANRVATVVANEWKDGNDKVMPVKQWLEERRFLQGEMQQLRDKLAI  366

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNV--NPKVLSGFSKPEKANHLFGILS--  924
             ++R AK+EAQLK+K +LRLK LE+ L+ T +++    P+  S  + P +   L G  +  
Sbjct  367   TDRAAKSEAQLKEKFQLRLKVLEETLRGTSSSSTRNTPEARSMSNGPSRRQSLGGAENLQ  426

Query  923   --------SKKRSASQPRASM-VNTTseqesssensgEYNDQKK---RHHGLW-----YS  795
                     SKK  ASQ R S+ +N+TS  +++   S  ++   +   R   L      YS
Sbjct  427   KFPSNGALSKKAPASQMRHSLSINSTSVLKNAKGTSKSFDGGTRSLDRGKALLNGPGNYS  486

Query  794   RNKI--DEKE---NAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMK  630
              NK   D KE     G KENS++   S +     ED V G LYD LQKEV+++RK  + K
Sbjct  487   FNKATDDSKEAESGNGWKENSEEKPQSEDPEATTEDSVPGVLYDLLQKEVVSLRKASNEK  546

Query  629   ENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIR  465
             +  L  KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++ + D + R
Sbjct  547   DQSLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRVEKDQDAR  601



>gb|ABD65109.1| Myosin II heavy chain-like domain containing protein [Brassica 
oleracea]
Length=508

 Score =   384 bits (986),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 291/521 (56%), Positives = 360/521 (69%), Gaps = 75/521 (14%)
 Frame = -3

Query  1970  DPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKLKISE  1791
             +PF    +SLQNQL+EK++EL  A++E + LR  E+LK++   EL   V++LEE+L +S+
Sbjct  6     NPFASNTSSLQNQLREKDKELLAAKAEIEALRTNEELKNREFGELRENVRKLEERLGVSK  65

Query  1790  NLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEIKMY  1611
             NLVE K +E KKL  EK++AL AQ AAE ALRRVY  Q+EDD +P+ESVIAP EA+IK  
Sbjct  66    NLVEHKEVEMKKLEEEKEDALAAQDAAEEALRRVYTHQQEDDPLPLESVIAPFEAQIKFQ  125

Query  1610  KNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIEICQ  1431
             K++I ALQEDK+A+ER  KSKE+ALLEAERILKSALER LIVEEVQN NFELRRQIEICQ
Sbjct  126   KHQIFALQEDKKALERLTKSKESALLEAERILKSALERALIVEEVQNHNFELRRQIEICQ  185

Query  1430  EENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeerrtler  1251
             EE K L+K NRQKVLE+E+LSQTI ELEEAILAGG AAN             EE+RTLER
Sbjct  186   EEYKFLEKINRQKVLEIEKLSQTIGELEEAILAGGTAANA------------EEKRTLER  233

Query  1250  elaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTAKA  1071
             ELARVKVSA+RVA   ANEWKDEND+VMPVKQWLEERR+L  EMQ+LKDKLA+SERTAKA
Sbjct  234   ELARVKVSASRVALAFANEWKDENDRVMPVKQWLEERRLLHGEMQKLKDKLAVSERTAKA  293

Query  1070  EAQ-----------lkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILS  924
             E+Q           ++++LKLRLKT+E GLK     +V+P      +K EK+  + G L+
Sbjct  294   ESQLKVDEYIISLVVQERLKLRLKTIEDGLKCLNMLSVSPTT----TKAEKSGKILGFLT  349

Query  923   -----SKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKENAGM  759
                  SKKRS SQPR S+                      R H L    N+ +E++    
Sbjct  350   SGGGGSKKRSTSQPRGSLTG--------------------RIHALNQPINRGEERDG---  386

Query  758   KENSDKLTDSG--NFSK------------NDEDMVSGFLYDRLQKEVINMRKCFDMKEND  621
             KENS K+T +G  N  +             +EDMVSGFLYDRLQKEVI++RK  + KE  
Sbjct  387   KENS-KVTSNGVTNVDEEEEEQQRKAEEDGNEDMVSGFLYDRLQKEVISLRKICESKEGT  445

Query  620   LNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSS  498
             +N K+EEI     K+  LTKAIEVE++K KREAA REK+++
Sbjct  446   INAKNEEI-----KVHALTKAIEVETKKAKREAAAREKENA  481



>ref|XP_007026345.1| Microtubule-associated proteins 70-5 isoform 2, partial [Theobroma 
cacao]
 gb|EOY28967.1| Microtubule-associated proteins 70-5 isoform 2, partial [Theobroma 
cacao]
Length=439

 Score =   382 bits (980),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 263/432 (61%), Positives = 312/432 (72%), Gaps = 48/432 (11%)
 Frame = -3

Query  1601  IAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIEICQEEN  1422
             +A LQEDKRA+ER  KSKE+ALLEAERIL+SALER LIVEEVQNQNFELRRQIEICQEEN
Sbjct  1     VALLQEDKRALERLTKSKESALLEAERILRSALERALIVEEVQNQNFELRRQIEICQEEN  60

Query  1421  KILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeerrtlerela  1242
             KIL+KTNRQKVLEVE+LSQTI ELEEAILAGGAAAN+IRDY+R+ISE+ EE+RTL+RELA
Sbjct  61    KILEKTNRQKVLEVEKLSQTIQELEEAILAGGAAANSIRDYQRRISELHEEKRTLDRELA  120

Query  1241  RVKVSANRVATIVANEWKDENDKVMPVKQWLEERRIL-QAEMQRLKDKLAISERTAKAEA  1065
             RVKVSANRVAT+VANEWKDENDKVMPVKQWLE+RR+L QAEMQRLKDKLA+SERTAKAEA
Sbjct  121   RVKVSANRVATVVANEWKDENDKVMPVKQWLEDRRLLQQAEMQRLKDKLAVSERTAKAEA  180

Query  1064  QlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILSS----KKRSASQP  897
             QLK+K KLRLK LE GLK   + + NP    G  KPEK++++ G L+S    +KRS SQP
Sbjct  181   QLKEKFKLRLKILEDGLKHVSSFSGNPNASCGSPKPEKSSNILGFLTSSGGLRKRSTSQP  240

Query  896   RASMVNTTseqesssensgEYND----------QKKRHHG-------LWYSRNKI---DE  777
             R S ++ TS  +  S  +   N           +KK   G       LW SR K+    E
Sbjct  241   RGSTISRTSILQRPSVETETANANNGLRQVSNLKKKGASGENMLRKNLWTSRCKVADSSE  300

Query  776   KENAGMKENSD-----------------------KLTDSGNFSKNDEDMVSGFLYDRLQK  666
             KEN  MK N+D                       +  + GN   N ED VSGFLYDRLQK
Sbjct  301   KENTAMKVNTDINISKDGDTTGSAGIKNKECCNEETENRGNADCNVEDTVSGFLYDRLQK  360

Query  665   EVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
             EVIN+RKC + K++ LN+KDEEIKML KK+E  +KA+EVES++ KREA  +EK++ + K 
Sbjct  361   EVINLRKCCEAKDSSLNSKDEEIKMLMKKVEAFSKAMEVESKRLKREAVAKEKENGSAKM  420

Query  485   KYDGNIRQTNSS  450
                  +R  NSS
Sbjct  421   DDSKKLRNINSS  432



>ref|NP_173873.5| microtubule-associated protein 70-2 [Arabidopsis thaliana]
 sp|Q8L7S4.1|MP702_ARATH RecName: Full=Microtubule-associated protein 70-2; Short=AtMAP70-2; 
AltName: Full=70 kDa microtubule-associated protein 2 
[Arabidopsis thaliana]
 gb|AAM91095.1| At1g68060/T23K23_9 [Arabidopsis thaliana]
 gb|AAN33201.1| At1g68060/T23K23_9 [Arabidopsis thaliana]
 gb|AEE30561.1| microtubule-associated protein 70-2 [Arabidopsis thaliana]
Length=634

 Score =   388 bits (997),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 276/535 (52%), Positives = 384/535 (72%), Gaps = 27/535 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+RELG A +E K LR +E+ ++KA+EEL  E+ +L+
Sbjct  67    ITLLHGSDPVKVELNRLENEVRDKDRELGEANAEIKALRLSERQREKAVEELTEELTKLD  126

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+++E KNLE KK+  EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  127   EKLKLTESILESKNLEIKKINEEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  186

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQED RA++R  KSKEAALLEAER +++A+ +  +V+++QN+N EL 
Sbjct  187   EAELKLARSEIGKLQEDNRALDRLTKSKEAALLEAERTVEAAMAKAAMVDDLQNKNQELM  246

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILD+ +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  247   KQIEICQEENKILDRMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNE  306

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  307   ERKTLDRELARAKVTANRVATVVANEWKDGNDKVMPVKQWLEERRFLQGEMQQLRDKLAI  366

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNV--NPKVLSGFSKPEKANHLFGILS--  924
             ++R AK+EAQLK+K +LRLK LE+ L+ T ++     P+  S  + P +   L G  +  
Sbjct  367   TDRAAKSEAQLKEKFQLRLKVLEETLRGTSSSATRNTPEARSMSNGPSRRQSLGGAENLQ  426

Query  923   --------SKKRSASQPRASM-VNTTseqesssensgEYNDQKK---RHHGLW-----YS  795
                     SKK  ASQ R S+ +N+TS  +++   S  ++   +   R   L      YS
Sbjct  427   KFTSNGALSKKAPASQMRHSLSINSTSVLKNAKGTSKSFDGGTRSVDRGKALLNGPGNYS  486

Query  794   RNKI--DEKE---NAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMK  630
              NK   D KE     G KENS++   S +     ED V G LYD LQKEV+++RK  + K
Sbjct  487   FNKATDDSKEAESGNGWKENSEEKPQSEDPEAATEDSVPGVLYDLLQKEVVSLRKASNEK  546

Query  629   ENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIR  465
             +  L  KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++ + D + R
Sbjct  547   DQSLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRVEKDQDAR  601



>emb|CDY09638.1| BnaC07g34230D [Brassica napus]
Length=503

 Score =   384 bits (985),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 299/501 (60%), Positives = 369/501 (74%), Gaps = 38/501 (8%)
 Frame = -3

Query  1970  DPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKLKISE  1791
             +PF    +SLQ+QLKEK++EL  A++E + LR  E+LK++A EEL   V++ EE+L    
Sbjct  6     NPFASNTSSLQSQLKEKDKELLAAKAEIEALRTNEELKNRAFEELTENVRKWEERLGQKV  65

Query  1790  NLV-EQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEIKM  1614
             + V E++ +E KKL  EK++AL AQ AAE ALRRVY  + EDDS+P+ESVIAPLEA+IK 
Sbjct  66    HCVMEEQEVEMKKLEEEKEDALAAQEAAEEALRRVYTHEHEDDSLPLESVIAPLEAQIKF  125

Query  1613  YKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIEIC  1434
              K++I+ALQEDK+A+ER  KSKE+ALLEAERILKSALER LIVEEVQN NFELRRQIEI 
Sbjct  126   QKHQISALQEDKKALERLTKSKESALLEAERILKSALERALIVEEVQNHNFELRRQIEIF  185

Query  1433  QEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeerrtle  1254
             QEE K L+K NRQKVLE+E+LSQTI ELEEAILAGG AAN +RDYRRQIS++  ++RTLE
Sbjct  186   QEEYKFLEKINRQKVLEIEKLSQTIGELEEAILAGGTAANAVRDYRRQISQLNAKKRTLE  245

Query  1253  relaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTAK  1074
             RELARVKVSA+RVA  VANEWKDEND+VMPVKQWLEERR+L  EMQ+LKDKL +SERTAK
Sbjct  246   RELARVKVSASRVALAVANEWKDENDRVMPVKQWLEERRLLHGEMQKLKDKLGVSERTAK  305

Query  1073  AEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILS------SKKR  912
             AE+QLK++LKLRLKT+E GLK + N           +K EK+  + G L+      SKKR
Sbjct  306   AESQLKERLKLRLKTIEDGLKSSPNTFSISTT---TTKTEKSGKILGFLTSGGGGGSKKR  362

Query  911   SASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKENAGMKENSDKLTD  732
             S+SQPR S+                      R H L    N+  E +    KENS K++ 
Sbjct  363   SSSQPRGSVTG--------------------RIHALNQPTNRAAETDG---KENS-KISA  398

Query  731   SGNFSKND---EDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTK  561
             +G  S  D   EDMVSGFLYDRLQKEVI +RK  + KE  +N K+EEIKML KK++ LTK
Sbjct  399   NG-LSDQDAKGEDMVSGFLYDRLQKEVIALRKVCESKEGTINAKNEEIKMLLKKVDALTK  457

Query  560   AIEVESRKTKREAAIREKDSS  498
             AIEVE++K KREAA REK+++
Sbjct  458   AIEVETKKAKREAAAREKENT  478



>ref|XP_009411128.1| PREDICTED: microtubule-associated protein 70-5 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009411129.1| PREDICTED: microtubule-associated protein 70-5 [Musa acuminata 
subsp. malaccensis]
Length=558

 Score =   384 bits (986),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 284/524 (54%), Positives = 367/524 (70%), Gaps = 48/524 (9%)
 Frame = -3

Query  1973  TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKLKIS  1794
             +DP ++EL  L+N L EKERELG+A+ E K L+ATE  KDKA+ EL NEVK+++EKL+ +
Sbjct  17    SDPVMIELNRLENGLLEKERELGLAKCEIKTLKATELSKDKAVMELSNEVKKMDEKLRAT  76

Query  1793  ENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEIKM  1614
             E  +E KNLE KKLINEKKEAL AQ++AEAALRRV+A QK+++ +P+  + APLE++I+ 
Sbjct  77    EKQLENKNLEIKKLINEKKEALAAQFSAEAALRRVHATQKDEELVPVGVLTAPLESDIRQ  136

Query  1613  YKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIEIC  1434
             YKNEI  LQED +A+ER  KSKEAAL+EAE +L+SALE+ + VE V+N+N EL+RQ+EIC
Sbjct  137   YKNEIVMLQEDNKALERLTKSKEAALVEAEALLQSALEQAMSVEMVRNKNLELKRQMEIC  196

Query  1433  QEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeerrtle  1254
             QEEN+ L+KT+RQKV+EVERL++TI ELEE+ILA    AN IRD +RQISE+ EE+R +E
Sbjct  197   QEENRTLEKTHRQKVVEVERLTKTITELEESILASSVTANAIRDCQRQISELNEEKRMVE  256

Query  1253  relaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTAK  1074
             RELARVKVSA+R+AT+ ANEWKD+NDKV+PVKQWLEERR LQ E+QRL+DKLA++ERTAK
Sbjct  257   RELARVKVSASRMATVAANEWKDDNDKVIPVKQWLEERRFLQGEIQRLRDKLALAERTAK  316

Query  1073  AEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGI--LSSKKRSASQ  900
             AE QLKDKL LRLKT+E+ LK +G              PEK   L G      KKRSAS+
Sbjct  317   AERQLKDKLSLRLKTVEECLKPSG-------------LPEKHGELPGGKKYGVKKRSASR  363

Query  899   PRASMVNTTseqesssensgEYNDQ-------KKRHHGLWYSRNKID-EKENA--GMKEN  750
             PRAS     +       +     D+        +++     SR+  D EKENA   +K N
Sbjct  364   PRASHATKNASVLQQPHSISGNGDKIFDGKNPVQKNLSAPRSRSFSDSEKENAETNVKPN  423

Query  749   SD----------KLTDSGN-------------FSKNDEDMVSGFLYDRLQKEVINMRKCF  639
                         +LT   N                + EDMVSGFLYDRLQKEV+N+R   
Sbjct  424   GHVDDDVVTGKTELTHEVNAKECGHIKSEMKRLGVDCEDMVSGFLYDRLQKEVLNLRGSQ  483

Query  638   DMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREK  507
               KE+ L+ KD+EIKML KK++ LTKA+E+E +KT+R A  RE+
Sbjct  484   KDKESLLSAKDDEIKMLQKKVDVLTKAVEMELKKTRRNAVARER  527



>ref|XP_006584098.1| PREDICTED: microtubule-associated protein 70-5-like isoform X3 
[Glycine max]
Length=534

 Score =   381 bits (978),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 281/488 (58%), Positives = 346/488 (71%), Gaps = 49/488 (10%)
 Frame = -3

Query  1772  NLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEIKMYKNEIAA  1593
             NLE KKL +EKK AL +QYAAEA LRRV+A QK++D +PIE  IAPLEAEIKMYKNEI A
Sbjct  25    NLEIKKLTDEKKNALASQYAAEATLRRVHANQKDEDFVPIERAIAPLEAEIKMYKNEITA  84

Query  1592  LQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIEICQEENKIL  1413
             LQEDK+A+ER  K KE+ALLEAERIL+SAL+R L+VEEV+NQN +L+RQIEICQEENK+L
Sbjct  85    LQEDKKALERLTKLKESALLEAERILRSALDRALVVEEVRNQNIDLKRQIEICQEENKLL  144

Query  1412  DKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeerrtlerelaRVK  1233
             +K +RQK+LEVE+LSQTI ELEE ILA GA AN +RDY++QISE+QEE+RTLERELARVK
Sbjct  145   EKNHRQKILEVEKLSQTIQELEEVILASGATANAVRDYQQQISELQEEKRTLERELARVK  204

Query  1232  VSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkd  1053
             VS NR+A  VANEWKDEN KVMPV+QWLEERRI+QAE+QRLKDK AISERTAKAE+QLKD
Sbjct  205   VSTNRIANAVANEWKDENHKVMPVRQWLEERRIMQAEIQRLKDKQAISERTAKAESQLKD  264

Query  1052  klklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILSS----KKRSASQPRASM  885
             KLKLRLKTLE+GLK   NN +   V     K EK+N + G L++    +KRS SQPRA  
Sbjct  265   KLKLRLKTLEEGLKHFSNNPITSNVSYASQKAEKSN-ILGFLTTSAGLRKRSTSQPRACT  323

Query  884   VNTTseqess--------sensgEYNDQKKRHH--------GLWYSRNKI---DEKENAG  762
             V ++  Q  +           + +     K++         G+W SR+K+    EKEN  
Sbjct  324   VGSSLFQTPNIKNNRGDIVAGNLKLGSPTKKYGSTENMLTKGIWASRSKVADNGEKENE-  382

Query  761   MKENSDKLTDSGNF------------------------SKNDEDMVSGFLYDRLQKEVIN  654
             M+ N D   +  N                           + +D+VSGFLYD+LQKEVIN
Sbjct  383   MQVNRDMTLNRCNDESEATEIKTIVDVEEDPPESKKPKGSSRDDVVSGFLYDKLQKEVIN  442

Query  653   MRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDG  474
             +RK  ++K++ L  KDEEIKML KK+  LTKA+EVE +K KREAA REK++S+ K   + 
Sbjct  443   LRKSCEIKDSSLQAKDEEIKMLIKKVGVLTKAMEVEWKKMKREAAAREKEASSTKSDDNR  502

Query  473   NIRQTNSS  450
               R  NSS
Sbjct  503   KNRSANSS  510



>ref|XP_006306974.1| hypothetical protein CARUB_v10008549mg [Capsella rubella]
 gb|EOA39872.1| hypothetical protein CARUB_v10008549mg [Capsella rubella]
Length=646

 Score =   384 bits (987),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 276/535 (52%), Positives = 382/535 (71%), Gaps = 27/535 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N +++K+RELG A +E K LR +E+ ++KA+EEL  E+ +L+
Sbjct  65    ITLLHGSDPVKVELNRLENDVRDKDRELGEAHAEIKALRLSERQREKAVEELTEELTKLD  124

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E++++ KNLE KK+  EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  125   EKLKLTESILQSKNLEIKKINEEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  184

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQED RA++R  KSKEAALLEAER ++SA+ +  +V+++QN+N EL 
Sbjct  185   EAELKLARSEIGKLQEDNRALDRLTKSKEAALLEAERTVESAMAKAALVDDLQNKNQELM  244

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILD+ +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  245   KQIEICQEENKILDRMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNE  304

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  305   ERKTLDRELARAKVTANRVATVVANEWKDGNDKVMPVKQWLEERRFLQGEMQQLRDKLAI  364

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVN-PKVLSGFSKPEKANHLFGILS---  924
             ++R AK+EAQLK+K +LRLK LE+ L+ T ++  N P   S  + P +   L G  +   
Sbjct  365   TDRAAKSEAQLKEKFQLRLKVLEETLRGTSSSTRNTPDARSMSNGPSRRQSLGGAENLQK  424

Query  923   -------SKKRSASQPRASM-VNTTseqesssensgEYNDQKK---RHHGLW-----YSR  792
                    SKK   SQ R S+ +N+TS  +++   S  ++   +   R   L      YS 
Sbjct  425   FPSNGSLSKKAPTSQMRHSLSINSTSVLKNAKGTSKSFDGGTRSLDRGKALLNGPGNYSF  484

Query  791   NKI--DEKE---NAGMKENSDKLTDSGNFSK-NDEDMVSGFLYDRLQKEVINMRKCFDMK  630
             NK   D KE     G KENS++   S + +    ED V G LYD LQKEV+++RK    K
Sbjct  485   NKATDDSKEAESGNGWKENSEEKPQSEDPAAVTSEDSVPGVLYDLLQKEVVSLRKASHEK  544

Query  629   ENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIR  465
             +  L  KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++ + D + R
Sbjct  545   DQSLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRVEKDQDTR  599



>ref|XP_008452405.1| PREDICTED: microtubule-associated protein 70-1 [Cucumis melo]
Length=633

 Score =   382 bits (981),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 274/530 (52%), Positives = 379/530 (72%), Gaps = 32/530 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             L LLH +DP  +EL  L+N++++K+RELG AQ++ K L+ +E+L++KA+EEL +E+ R+E
Sbjct  67    LNLLHGSDPVKVELNRLENEVRDKDRELGEAQAKIKALKLSERLREKAVEELTDELSRVE  126

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  127   EKLKLTESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  186

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAAL++AER ++SAL +  +V+++QN+N EL 
Sbjct  187   EAELKLARQEIAKLQDDNKALDRLTKSKEAALIDAERTVQSALAKASMVDDLQNKNQELM  246

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  247   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  306

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  307   ERKTLDRELARAKVTANRVAVVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLAI  366

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQT--GNNNVNPKVLSGFSKPEKANHLFGI----  930
             +ERTAK+EAQLK+K +LRL+ LE+ L+ +  GNN   P+  S  + P +   L G+    
Sbjct  367   TERTAKSEAQLKEKYQLRLRVLEESLRGSSGGNNRSTPEGRSISNGPSRRQSLGGVDNIS  426

Query  929   ------LSSKKRSASQPRASMVNTTseqesssensgEYND-------QKKRHHGLW--YS  795
                     SK+   SQ R+   ++++  + +   S  ++         K   +GL   YS
Sbjct  427   KLTSNGFLSKRTPGSQFRSLSSSSSTVLKHAKGTSKSFDGGTRSLDRGKVSLNGLLPSYS  486

Query  794   RNKI-----DEKENAGMKENSDKLTDSGNFSKN--DEDMVSGFLYDRLQKEVINMRKCFD  636
              N+      D + N   K N D   + GN S     ED V G LYD LQKEVI +RK   
Sbjct  487   FNQSCDATKDSEVNNDWKSNPD---EKGNESPTIESEDSVPGTLYDLLQKEVIALRKAGH  543

Query  635   MKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
              K+  L  KD+ I+ML KK+ETLTKA+EVE+RK +RE A  EK+ + ++ 
Sbjct  544   EKDQSLKDKDDAIEMLAKKVETLTKAMEVEARKMRREVAAMEKEVAAMRV  593



>gb|KFK44516.1| hypothetical protein AALP_AA1G266900 [Arabis alpina]
Length=626

 Score =   381 bits (978),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 277/540 (51%), Positives = 386/540 (71%), Gaps = 32/540 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+RELG +Q+E K LR +E+ ++KA+EEL  E+ +L+
Sbjct  54    ITLLHGSDPVKVELNRLENEVRDKDRELGESQAEIKALRLSERQREKAVEELTEELTKLD  113

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+ +E KNLE KK+  EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  114   EKLKLTESNLESKNLEIKKINEEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  173

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQED RA++R  KSKEAALLEAER ++ A+ +  +V+++QN+N EL 
Sbjct  174   EAELKLARSEIGKLQEDNRALDRLTKSKEAALLEAERTVEGAMAKAAMVDDLQNKNQELM  233

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  234   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNE  293

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  294   ERKTLDRELARAKVTANRVATVVANEWKDGNDKVMPVKQWLEERRFLQGEMQQLRDKLAI  353

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNV---NPKVLSGFSKPEKANHLFGILS-  924
             ++R AK+EAQLK+K +LRLK LE+ L+ T + +     P+  S  + P +   L G  + 
Sbjct  354   TDRAAKSEAQLKEKFQLRLKVLEETLRGTSSISSTRNTPEARSMSNGPSRRQSLGGAENL  413

Query  923   ----------SKKRSASQPRASM-VNTTseqesssensgEYNDQKK---RHHGLW-----  801
                       SKK  ASQ R S+ +N+TS  +++   S  ++   +   R   L      
Sbjct  414   QKFPSNGGALSKKAPASQMRHSLSINSTSVLKNAKGTSKSFDGGTRSLDRGKALLNGPGN  473

Query  800   YSRNKI--DEKE---NAGMKENSDKLTDSGN---FSKNDEDMVSGFLYDRLQKEVINMRK  645
             YS NK   D KE     G KEN ++  +S N    +++ +D V G LYD LQKEV+++RK
Sbjct  474   YSFNKAADDSKETESGNGWKENPEEKIESENPAAATEDTQDSVPGVLYDLLQKEVVSLRK  533

Query  644   CFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIR  465
                 K+  L  KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++ + D +IR
Sbjct  534   GSHEKDQSLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRVEKDQDIR  593



>gb|KGN49724.1| hypothetical protein Csa_5G083860 [Cucumis sativus]
Length=631

 Score =   380 bits (977),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 272/530 (51%), Positives = 379/530 (72%), Gaps = 32/530 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             L LLH +DP  +EL  L+N++++K+RELG AQ++ + L+ +E+L++KA+EEL +E+ R+E
Sbjct  65    LNLLHGSDPVKVELNRLENEVRDKDRELGEAQAKIRALKLSERLREKAVEELTDELSRVE  124

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  125   EKLKLTESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  184

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAAL++AER ++SAL +  +V+++QN+N EL 
Sbjct  185   EAELKLARQEIAKLQDDNKALDRLTKSKEAALIDAERTVQSALAKASMVDDLQNKNQELM  244

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  245   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  304

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  305   ERKTLDRELARAKVTANRVAVVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLAI  364

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQT--GNNNVNPKVLSGFSKPEKANHLFGI----  930
             +ERTAK+EAQLK+K +LRL+ LE+ L+ +  GNN   P+  S  + P +   L G+    
Sbjct  365   TERTAKSEAQLKEKYQLRLRVLEESLRGSSGGNNRSTPEGRSISNGPSRRQSLGGVDNIS  424

Query  929   ------LSSKKRSASQPRASMVNTTseqesssensgEYND-------QKKRHHGLW--YS  795
                     SK+   SQ R+   ++++  + +   S  ++         K   +GL   YS
Sbjct  425   KLTSNGFLSKRTPGSQFRSLSSSSSTVLKHAKGTSKSFDGGTRSLDRGKVSLNGLLPSYS  484

Query  794   RNKI-----DEKENAGMKENSDKLTDSGNFSKN--DEDMVSGFLYDRLQKEVINMRKCFD  636
              N+      D + N   K N D   + GN S     ED V G LYD LQKEVI +RK   
Sbjct  485   FNQSCDATKDSEVNNDWKSNPD---EKGNESPTLESEDSVPGTLYDLLQKEVIGLRKAGH  541

Query  635   MKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
              K+  L  KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++ 
Sbjct  542   EKDQSLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRV  591



>ref|XP_004170227.1| PREDICTED: microtubule-associated protein 70-1-like isoform 2 
[Cucumis sativus]
Length=610

 Score =   380 bits (975),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 272/530 (51%), Positives = 379/530 (72%), Gaps = 32/530 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             L LLH +DP  +EL  L+N++++K+RELG AQ++ + L+ +E+L++KA+EEL +E+ R+E
Sbjct  44    LNLLHGSDPVKVELNRLENEVRDKDRELGEAQAKIRALKLSERLREKAVEELTDELSRVE  103

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  104   EKLKLTESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  163

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAAL++AER ++SAL +  +V+++QN+N EL 
Sbjct  164   EAELKLARQEIAKLQDDNKALDRLTKSKEAALIDAERTVQSALAKASMVDDLQNKNQELM  223

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  224   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  283

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  284   ERKTLDRELARAKVTANRVAVVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLAI  343

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQT--GNNNVNPKVLSGFSKPEKANHLFGI----  930
             +ERTAK+EAQLK+K +LRL+ LE+ L+ +  GNN   P+  S  + P +   L G+    
Sbjct  344   TERTAKSEAQLKEKYQLRLRVLEESLRGSSGGNNRSTPEGRSISNGPSRRQSLGGVDNIS  403

Query  929   ------LSSKKRSASQPRASMVNTTseqesssensgEYND-------QKKRHHGLW--YS  795
                     SK+   SQ R+   ++++  + +   S  ++         K   +GL   YS
Sbjct  404   KLTSNGFLSKRTPGSQFRSLSSSSSTVLKHAKGTSKSFDGGTRSLDRGKVSLNGLLPSYS  463

Query  794   RNKI-----DEKENAGMKENSDKLTDSGNFSKN--DEDMVSGFLYDRLQKEVINMRKCFD  636
              N+      D + N   K N D   + GN S     ED V G LYD LQKEVI +RK   
Sbjct  464   FNQSCDATKDSEVNNDWKSNPD---EKGNESPTLESEDSVPGTLYDLLQKEVIGLRKAGH  520

Query  635   MKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
              K+  L  KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++ 
Sbjct  521   EKDQSLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRV  570



>ref|XP_004170226.1| PREDICTED: microtubule-associated protein 70-1-like isoform 1 
[Cucumis sativus]
Length=619

 Score =   380 bits (976),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 272/530 (51%), Positives = 379/530 (72%), Gaps = 32/530 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             L LLH +DP  +EL  L+N++++K+RELG AQ++ + L+ +E+L++KA+EEL +E+ R+E
Sbjct  65    LNLLHGSDPVKVELNRLENEVRDKDRELGEAQAKIRALKLSERLREKAVEELTDELSRVE  124

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  125   EKLKLTESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  184

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAAL++AER ++SAL +  +V+++QN+N EL 
Sbjct  185   EAELKLARQEIAKLQDDNKALDRLTKSKEAALIDAERTVQSALAKASMVDDLQNKNQELM  244

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  245   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  304

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  305   ERKTLDRELARAKVTANRVAVVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLAI  364

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQT--GNNNVNPKVLSGFSKPEKANHLFGI----  930
             +ERTAK+EAQLK+K +LRL+ LE+ L+ +  GNN   P+  S  + P +   L G+    
Sbjct  365   TERTAKSEAQLKEKYQLRLRVLEESLRGSSGGNNRSTPEGRSISNGPSRRQSLGGVDNIS  424

Query  929   ------LSSKKRSASQPRASMVNTTseqesssensgEYND-------QKKRHHGLW--YS  795
                     SK+   SQ R+   ++++  + +   S  ++         K   +GL   YS
Sbjct  425   KLTSNGFLSKRTPGSQFRSLSSSSSTVLKHAKGTSKSFDGGTRSLDRGKVSLNGLLPSYS  484

Query  794   RNKI-----DEKENAGMKENSDKLTDSGNFSKN--DEDMVSGFLYDRLQKEVINMRKCFD  636
              N+      D + N   K N D   + GN S     ED V G LYD LQKEVI +RK   
Sbjct  485   FNQSCDATKDSEVNNDWKSNPD---EKGNESPTLESEDSVPGTLYDLLQKEVIGLRKAGH  541

Query  635   MKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
              K+  L  KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++ 
Sbjct  542   EKDQSLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRV  591



>ref|XP_004142301.1| PREDICTED: LOW QUALITY PROTEIN: microtubule-associated protein 
70-1-like [Cucumis sativus]
Length=615

 Score =   380 bits (975),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 272/529 (51%), Positives = 379/529 (72%), Gaps = 32/529 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             L LLH +DP  +EL  L+N++++K+RELG AQ++ + L+ +E+L++KA+EEL +E+ R+E
Sbjct  49    LNLLHGSDPVKVELNRLENEVRDKDRELGEAQAKIRALKLSERLREKAVEELTDELSRVE  108

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  109   EKLKLTESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  168

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAAL++AER ++SAL +  +V+++QN+N EL 
Sbjct  169   EAELKLARQEIAKLQDDNKALDRLTKSKEAALIDAERTVQSALAKASMVDDLQNKNQELM  228

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  229   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  288

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  289   ERKTLDRELARAKVTANRVAVVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLAI  348

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQT--GNNNVNPKVLSGFSKPEKANHLFGI----  930
             +ERTAK+EAQLK+K +LRL+ LE+ L+ +  GNN   P+  S  + P +   L G+    
Sbjct  349   TERTAKSEAQLKEKYQLRLRVLEESLRGSSGGNNRSTPEGRSISNGPSRRQSLGGVDNIS  408

Query  929   ------LSSKKRSASQPRASMVNTTseqesssensgEYND-------QKKRHHGLW--YS  795
                     SK+   SQ R+   ++++  + +   S  ++         K   +GL   YS
Sbjct  409   KLTSNGFLSKRTPGSQFRSLSSSSSTVLKHAKGTSKSFDGGTRSLDRGKVSLNGLLPSYS  468

Query  794   RNKI-----DEKENAGMKENSDKLTDSGNFSKN--DEDMVSGFLYDRLQKEVINMRKCFD  636
              N+      D + N   K N D   + GN S     ED V G LYD LQKEVI +RK   
Sbjct  469   FNQSCDATKDSEVNNDWKSNPD---EKGNESPTLESEDSVPGTLYDLLQKEVIGLRKAGH  525

Query  635   MKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIK  489
              K+  L  KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++
Sbjct  526   EKDQSLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMR  574



>emb|CDY36126.1| BnaA08g19220D [Brassica napus]
Length=617

 Score =   379 bits (972),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 279/552 (51%), Positives = 390/552 (71%), Gaps = 32/552 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             +  LH +DP  +EL  L+N++++K+RELG A +E K LR +E+ ++KA+EE   E+ +L+
Sbjct  59    ITQLHGSDPVKVELNRLENEVRDKDRELGEAHAEIKALRLSERQREKAVEEHTEELAKLD  118

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E++++ KNLE KK+  EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  119   EKLKLTESILQSKNLEIKKINEEKKASMAAQFAAEATLRRVHAAQKDDDIPPIEAILAPL  178

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQED RA++R  KSKEAALL+AER ++ AL +  +V+++QN+N EL 
Sbjct  179   EAELKLARSEIGKLQEDNRALDRLTKSKEAALLDAERTIEGALAKAALVDDLQNKNQELM  238

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV +VE+L+QT+ ELEEA+LAGG AAN++RDY+R+  E+ E
Sbjct  239   KQIEICQEENKILDKMHRQKVADVEKLTQTVKELEEAVLAGGTAANSVRDYQRKFQEMNE  298

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  299   ERKTLDRELARAKVTANRVATVVANEWKDGNDKVMPVKQWLEERRFLQGEMQQLRDKLAI  358

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVN----PKVLSGFSKPEKANHLFGILS  924
             + R AK+EAQLK+K +LRLK LE+ LK T ++++      + +S  S P +   L G  +
Sbjct  359   TNRAAKSEAQLKEKFQLRLKVLEETLKGTSSSSIRNTSERRTMS--SGPSRRQSLGGSEN  416

Query  923   ----------SKKRSASQPRASM-VNTTseqesssensgEYNDQKK---RHHGLW-----  801
                       SKK  ASQ R S+ +N+TS  ++S   S  ++   +   R   L      
Sbjct  417   LQRFPSNGALSKKAPASQMRHSLSINSTSMLKNSKGTSTSFDGGTRSLDRGKALLNGPGN  476

Query  800   YSRNKID----EKENA-GMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFD  636
             YS NK      E E A G K++S++ T S N     ED V G LYD LQKEV+++RK   
Sbjct  477   YSFNKASDESKEPEPATGWKDSSEEKTQSENTPAASEDSVPGVLYDLLQKEVVSLRKASH  536

Query  635   MKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQTN  456
              K+  L  KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++ + D + R   
Sbjct  537   EKDQSLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRVEKDQDNRAKR  596

Query  455   -SSLKSSIKVAK  423
              S++KSS   A+
Sbjct  597   FSNIKSSSNTAQ  608



>ref|XP_006391189.1| hypothetical protein EUTSA_v10018271mg [Eutrema salsugineum]
 gb|ESQ28475.1| hypothetical protein EUTSA_v10018271mg [Eutrema salsugineum]
Length=630

 Score =   379 bits (973),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 278/540 (51%), Positives = 379/540 (70%), Gaps = 27/540 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+RELG A +E K LR +E+ ++KA+EEL +++ RLE
Sbjct  64    ITLLHGSDPVKVELNRLENEVRDKDRELGEAHAEIKALRLSERQREKAVEELTDDLTRLE  123

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L+E KNLE KK+  EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  124   EKLKLTESLLESKNLEIKKINEEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  183

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQED RA++R  KSKEAALL+AER +++AL +  +V+++QN+N EL 
Sbjct  184   EAELKLARSEIGKLQEDNRALDRLTKSKEAALLDAERTVQTALAKAALVDDLQNKNQELM  243

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  244   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNE  303

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  304   ERKTLDRELARAKVTANRVATVVANEWKDGNDKVMPVKQWLEERRFLQGEMQQLRDKLAI  363

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNV--NPKVLSGFSKPEKANHLFGI----  930
             S+R AK+EAQLKD+ +LRLK LE+ L+ T +++V   P+  S  + P +   L G     
Sbjct  364   SDRAAKSEAQLKDRFQLRLKVLEETLRGTSSSSVRNTPEGRSMSNGPSRRQSLGGSDNLQ  423

Query  929   ------LSSKKRSASQPRASMV-NTTseqesssensgEYNDQKK---RHHGLW-----YS  795
                     SKK  + Q R S   N+TS  +++   S  ++   +   R   L      YS
Sbjct  424   KFASNGFLSKKSPSFQMRNSFTSNSTSVLKNAKGTSKSFDGGTRSLDRGKALLNGPGNYS  483

Query  794   RNKI--DEKENA---GMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMK  630
               K   D KE       KE S++   S   +   ED V G LYD LQKEV+ +RK    K
Sbjct  484   FTKACDDAKEPESPDAWKETSEEKPPSELPAPATEDNVPGVLYDLLQKEVVALRKSSHEK  543

Query  629   ENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQTNSS  450
             +  L  KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++   D + R   SS
Sbjct  544   DQSLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRVDKDQDSRAKRSS  603



>ref|XP_010499143.1| PREDICTED: microtubule-associated protein 70-2-like isoform X1 
[Camelina sativa]
 ref|XP_010499145.1| PREDICTED: microtubule-associated protein 70-2-like isoform X2 
[Camelina sativa]
Length=639

 Score =   379 bits (973),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 271/538 (50%), Positives = 382/538 (71%), Gaps = 30/538 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N +++K+RELG A +E K LR +E+ ++KA+EEL  E+ +L+
Sbjct  69    ITLLHGSDPVKVELNRLENDVRDKDRELGEAHAEIKALRLSERQREKAVEELTEELTKLD  128

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E++++ KNLE KK+  EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  129   EKLKLTESILQSKNLEIKKINEEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  188

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQED RA++R  KSKEAALLEAER +++A+ +  +V+++QN+N EL 
Sbjct  189   EAELKLARSEIGKLQEDNRALDRLTKSKEAALLEAERTVEAAMAKAAMVDDLQNKNQELM  248

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILD+ +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  249   KQIEICQEENKILDRMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNE  308

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  309   ERKTLDRELARAKVTANRVATVVANEWKDGNDKVMPVKQWLEERRFLQGEMQQLRDKLAI  368

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNV--NPKVLSGFSKPEKANHLFGI----  930
             ++R AK+EAQLK+K +LRL+ LE+ L+ T N++    P+  S  + P +   L G     
Sbjct  369   TDRAAKSEAQLKEKFQLRLRVLEETLRGTTNSSTRNTPEARSMSNGPSRRQSLGGAENLQ  428

Query  929   -LSS-----KKRSASQPRASM-VNTTseqesssensgEYNDQKK---RHHGLW-----YS  795
                S     KK  +SQ R S+ +N+TS  +++   S  ++   +   R   L      YS
Sbjct  429   KFPSNGALLKKTPSSQMRHSLSINSTSVLKNAKGTSKSFDGGTRSLDRGKALVNGPGNYS  488

Query  794   RNKIDEKENA-------GMKENSDKLTDSGN-FSKNDEDMVSGFLYDRLQKEVINMRKCF  639
              NK  +  N+       G KENS++   S    +   ED V G LYD LQKEV+++RK  
Sbjct  489   FNKATDDSNSKEAESGNGWKENSEEKPQSEEPAAAATEDSVPGVLYDLLQKEVVSLRKAS  548

Query  638   DMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIR  465
               K+  L  KD+ I+ML KK+ETLTKA+EVE++K +RE +  EK+ + ++ + D + R
Sbjct  549   HEKDQSLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVSAMEKEVAAMRVEKDQDTR  606



>emb|CDY04200.1| BnaC06g26150D [Brassica napus]
Length=617

 Score =   378 bits (971),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 277/548 (51%), Positives = 385/548 (70%), Gaps = 28/548 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  LEL  L+N++++K+RELG A +E + LR +E+ ++KA+EEL +E+ +LE
Sbjct  55    ITLLHGSDPVKLELNRLENEVRDKDRELGEAHAEIRALRLSERQREKAVEELTDELTKLE  114

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L++ KNLE +K+  EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  115   EKLKLTESLLQGKNLEIRKINEEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  174

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQED RA++R  KSKEAALL+AER +++A+ +  +V+++QN+N EL 
Sbjct  175   EAELKLARSEIGKLQEDNRALDRLTKSKEAALLDAERTVQTAMAKAALVDDLQNKNQELM  234

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+L+GGAAAN +RDY+R+  E+ E
Sbjct  235   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLSGGAAANAVRDYQRKFQEMNE  294

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  295   ERKTLDRELARAKVTANRVATVVANEWKDGNDKVMPVKQWLEERRFLQGEMQQLRDKLAI  354

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFG-------  933
             S+R AK+EAQLKDK +LRLK LE+ L+ T  N    + +S  + P +   L G       
Sbjct  355   SDRAAKSEAQLKDKFQLRLKVLEETLRGTSRNTTEGRSMS--NGPSRRQSLGGSDNLQKF  412

Query  932   ----ILSSKKRSASQPRASMVNTTseqesssensgEYNDQKK---RHHGLW-----YSRN  789
                  L  K  S+    A   N++S  +++   S  ++   +   R   L      YS N
Sbjct  413   ASNGFLPKKSPSSQMRNAFTSNSSSVLKNAKGTSRSFDGGTRSLDRGKALLNGPGKYSFN  472

Query  788   K-IDE-KEN---AGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKEN  624
             K  DE KE+   +  KE+S++ T S       ED V G LYD LQKEV+ +RK    K+ 
Sbjct  473   KACDEAKESESPSAWKEDSEEKTTSELPPPTTEDNVPGVLYDLLQKEVVALRKSSHEKDQ  532

Query  623   DLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIR-QTNSSL  447
              L  KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++   D + R +  SS 
Sbjct  533   SLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRVDKDQDNRTKRTSST  592

Query  446   KSSIKVAK  423
             K+S   A+
Sbjct  593   KNSSNTAQ  600



>emb|CDY01879.1| BnaC06g29190D [Brassica napus]
Length=624

 Score =   378 bits (970),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 275/538 (51%), Positives = 382/538 (71%), Gaps = 28/538 (5%)
 Frame = -3

Query  1979  LH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKL  1803
             LH +DP  +EL  L+N++++K+RELG A +E K LR +E+ ++KA+EEL +E+ +LEEKL
Sbjct  60    LHGSDPVKVELNRLENEVRDKDRELGEAHAEIKALRLSERQREKAVEELTDELTKLEEKL  119

Query  1802  KISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAE  1623
             K++E+L++ +NLE KK+  EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APLEAE
Sbjct  120   KLTESLLQGRNLEIKKINEEKKASMVAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEAE  179

Query  1622  IKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQI  1443
             +K+ ++EI  LQED RA++R  KSKEAALL+AER +++A+ +  +V+++QN+N EL +QI
Sbjct  180   LKLARSEIGKLQEDNRALDRLTKSKEAALLDAERTIQTAMAKAALVDDLQNKNQELMKQI  239

Query  1442  EICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeerr  1263
             EICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R+  E+ EER+
Sbjct  240   EICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNEERK  299

Query  1262  tlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISER  1083
             TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAIS+R
Sbjct  300   TLDRELARAKVTANRVATVVANEWKDGNDKVMPVKQWLEERRFLQGEMQQLRDKLAISDR  359

Query  1082  TAKAEAQlkdklklrlktLEQGLKQTGNNNV--NPKVLSGFSKPEKANHLFGI-------  930
              AK+EAQLK+K +LRLK LE+ L+ T +++V   P+  S  + P +   L G        
Sbjct  360   AAKSEAQLKEKFQLRLKVLEETLRGTSSSSVRNTPEGRSMSNGPSRRQSLCGADNLQKFG  419

Query  929   ---LSSKKRSASQPR-ASMVNTTseqesssensgEYNDQKK---RHHGLW-----YSRNK  786
                   KK S+SQ R A   N+TS  +++   S  ++   +   R   L      YS NK
Sbjct  420   SNGFLPKKSSSSQMRNAFTSNSTSVLKNAKGTSRSFDGGTRSLDRGKALLNGPGKYSFNK  479

Query  785   -IDEKENA-----GMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKEN  624
               DE + +       KE+S++ + S   +   ED V G LYD LQKEV+ +RK    K+ 
Sbjct  480   ACDEAKESESSPNAWKEDSEEKSPSELPAPTTEDNVPGVLYDLLQKEVVALRKSSHEKDQ  539

Query  623   DLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQTNSS  450
              L  KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++   D + R   SS
Sbjct  540   SLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRVDKDHDNRAKRSS  597



>ref|XP_010477983.1| PREDICTED: microtubule-associated protein 70-2 [Camelina sativa]
Length=640

 Score =   378 bits (971),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 271/538 (50%), Positives = 382/538 (71%), Gaps = 30/538 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N +++K+RELG A +E K LR +E+ ++KA+EEL  E+ +L+
Sbjct  70    ITLLHGSDPVKVELNRLENDVRDKDRELGEAHAEIKALRLSERQREKAVEELTEELTKLD  129

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E++++ KNLE KK+  EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  130   EKLKLTESILQSKNLEIKKINEEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  189

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQED RA++R  KSKEAALLEAER +++A+ +  +V+++QN+N EL 
Sbjct  190   EAELKLARSEIGKLQEDNRALDRLTKSKEAALLEAERTVEAAMAKAAMVDDLQNKNQELM  249

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILD+ +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  250   KQIEICQEENKILDRMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNE  309

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  310   ERKTLDRELARAKVTANRVATVVANEWKDGNDKVMPVKQWLEERRFLQGEMQQLRDKLAI  369

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNV--NPKVLSGFSKPEKANHLFGI----  930
             ++R AK+EAQLK+K +LRL+ LE+ L+ T + +    P+  S  + P +   L G     
Sbjct  370   TDRAAKSEAQLKEKFQLRLRVLEETLRGTSSISTRNTPEARSMSNGPSRRQSLGGAENLQ  429

Query  929   -LSS-----KKRSASQPRASM-VNTTseqesssensgEYNDQKK---RHHGLW-----YS  795
                S     KK  +SQ R S+ +N+TS  +++   S  ++   +   R   L      YS
Sbjct  430   KFPSNGALLKKTPSSQMRHSLSINSTSVLKNAKGTSKSFDGGTRSLDRGKALVNGPGNYS  489

Query  794   RNKIDEKENA-------GMKENSDKLTDSGN-FSKNDEDMVSGFLYDRLQKEVINMRKCF  639
              NK  +  N+       G KENS++   S    +   ED V G LYD LQKEV+++RK  
Sbjct  490   FNKATDDSNSKEAESGNGWKENSEEKPQSEEPAAAATEDSVPGVLYDLLQKEVVSLRKAS  549

Query  638   DMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIR  465
               K+  L  KD+ I+ML KK+ETLTKA+EVE++K +RE +  EK+ + ++ + D +IR
Sbjct  550   HEKDQSLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVSAMEKEVAAMRVEKDQDIR  607



>ref|NP_001067398.1| Os12g0640900 [Oryza sativa Japonica Group]
 sp|Q2QLI6.1|MP701_ORYSJ RecName: Full=Microtubule-associated protein 70-1; Short=AtMAP70-1; 
AltName: Full=70 kDa microtubule-associated protein 1 
[Oryza sativa Japonica Group]
 gb|ABA99627.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF30417.1| Os12g0640900 [Oryza sativa Japonica Group]
 dbj|BAG90086.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE53684.1| hypothetical protein OsJ_37030 [Oryza sativa Japonica Group]
Length=567

 Score =   375 bits (964),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 270/510 (53%), Positives = 367/510 (72%), Gaps = 19/510 (4%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             LLH +DP  +ELT L+N+L+ KE+ELG AQ+E K LR +E+ ++KA+E+L  E+ +++ K
Sbjct  31    LLHGSDPVRVELTRLENELQYKEKELGEAQAEIKALRLSERAREKAVEDLTEELTKVDGK  90

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK++E+L+E KNLE KK+ +EKK AL AQ+AAEA LRRV+A QK+DD  PIE+++APLEA
Sbjct  91    LKLTESLLESKNLEAKKINDEKKAALAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEA  150

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+ ++EIA LQ+D RA++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL +Q
Sbjct  151   ELKLARHEIAKLQDDNRALDRLTKSKEAALLEAERTVQIALAKASLVDDLQNKNQELMKQ  210

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILD+ +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ EER
Sbjct  211   IEICQEENKILDRMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNEER  270

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             +TL+RELAR KVSANRVA +VANEWKD NDKVMPVKQWLEERRILQ EMQ+L+DKLAI+E
Sbjct  271   KTLDRELARAKVSANRVAVVVANEWKDGNDKVMPVKQWLEERRILQGEMQQLRDKLAIAE  330

Query  1085  RTAKAEAQlkdklklrlktLEQGLK-QTGNNNVNPKVLSGFSKPEKANHLFGILSSKKRS  909
             R A++EAQLKDK +LRLK LE+GL+  T   NV+          +  +   G LS  KR 
Sbjct  331   RAARSEAQLKDKFQLRLKVLEEGLRMSTTRTNVSAARRQSIGGADSLSKTNGFLS--KRP  388

Query  908   ASQPRAS-------MVNTTseqesssensgEYNDQKKRH---HGLWYSRNKIDEKENAGM  759
             + Q R+S       +VN       S +      D+ K H    G+  S +  ++KE+   
Sbjct  389   SFQMRSSVSTTTTTLVNHAKGASKSFDGGCRSLDRYKGHVNGSGMNVSTDSSEDKESNNS  448

Query  758   KENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKK  579
              E +++ T     S   ED VSG LYD LQKEVI +RK    K+  L  KD+ ++ML KK
Sbjct  449   DEKANEFT-----SVETEDTVSGLLYDTLQKEVIALRKACHEKDQSLKDKDDAVEMLAKK  503

Query  578   IETLTKAIEVESRKTKREAAIREKDSSTIK  489
             ++TLTKA+E E +K + E A  EK+ + ++
Sbjct  504   VDTLTKAMESEGKKRRMEVAAMEKEMAALR  533



>gb|ABD65132.1| Myosin II heavy chain-like domain containing protein [Brassica 
oleracea]
Length=497

 Score =   373 bits (958),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 292/500 (58%), Positives = 355/500 (71%), Gaps = 61/500 (12%)
 Frame = -3

Query  1970  DPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKLKISE  1791
             +PF    +SLQ+QLKEK++EL  A++E + LR  E+LK++A EEL   V++ EE+L    
Sbjct  6     NPFASNTSSLQSQLKEKDKELLAAKAEIEALRTNEELKNRAFEELTENVRKWEERLG---  62

Query  1790  NLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEIKMY  1611
                 QK +E KKL  EK++AL AQ AAE ALRRVY  + EDDS+P+ESVIAPLEA+IK  
Sbjct  63    ----QKEVEMKKLEEEKEDALAAQEAAEEALRRVYTHEHEDDSLPLESVIAPLEAQIKFQ  118

Query  1610  KNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIEICQ  1431
             K++I+ LQEDK+A+ER  KSKE+ALLEAERILKSALER LIVEEVQN NFELRRQIEI Q
Sbjct  119   KHQISVLQEDKKALERLTKSKESALLEAERILKSALERALIVEEVQNHNFELRRQIEIFQ  178

Query  1430  EENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeerrtler  1251
             EE K L+K NRQKVLE+E+LSQTI ELEEAILAGG AAN             EE+RTLER
Sbjct  179   EEYKFLEKINRQKVLEIEKLSQTIGELEEAILAGGTAANA------------EEKRTLER  226

Query  1250  elaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTAKA  1071
             ELARVKVSA+RVA  VANEWKDEND+VMPVKQWLEERR+L  EMQ+LKDKLA+SERTAKA
Sbjct  227   ELARVKVSASRVALAVANEWKDENDRVMPVKQWLEERRLLHGEMQKLKDKLAVSERTAKA  286

Query  1070  EAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILS------SKKRS  909
             E QLK++LKLRLKT+E GLK + +           +K EK+  + G L+      SKKRS
Sbjct  287   ETQLKERLKLRLKTIEDGLKGSISQTT--------TKTEKSGKILGFLTSGGGGGSKKRS  338

Query  908   ASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKENAGMKENSDKLTDS  729
             +SQPR S+                      R H L    N+  E +    KENS K++ +
Sbjct  339   SSQPRGSITG--------------------RIHALNQPTNRAAETDG---KENS-KISAN  374

Query  728   GNFSKND---EDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKA  558
             G  S  D   EDMVSGFLYDRLQKEVI +RK  + KE  +N K+EEIKML KK++ LTKA
Sbjct  375   G-LSDQDAKGEDMVSGFLYDRLQKEVIALRKVCESKEGTINAKNEEIKMLLKKVDALTKA  433

Query  557   IEVESRKTKREAAIREKDSS  498
             IEVE++K KREAA REK+++
Sbjct  434   IEVETKKAKREAAAREKENT  453



>ref|XP_002525998.1| Myosin heavy chain, clone, putative [Ricinus communis]
 gb|EEF36422.1| Myosin heavy chain, clone, putative [Ricinus communis]
Length=614

 Score =   377 bits (967),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 267/529 (50%), Positives = 372/529 (70%), Gaps = 31/529 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+RELG AQ+E K LR +E+L++KA+EEL +E+ ++E
Sbjct  62    ITLLHGSDPVKVELNRLENEVRDKDRELGEAQAEIKALRLSERLREKAVEELTDELSKVE  121

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  122   EKLKLTESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  181

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL 
Sbjct  182   EAELKLARQEIAKLQDDNKALDRLTKSKEAALLEAERTVQVALAKASMVDDLQNKNQELM  241

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  242   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  301

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  302   ERKTLDRELARAKVTANRVATVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLAI  361

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVN-PKVLSGFSKPEKANHLFGI-----  930
             +ER AK+EAQLK+K  LRLK LE+ L+ + +N  + P+  S  + P +   L G      
Sbjct  362   TERAAKSEAQLKEKYHLRLKVLEESLRGSSSNTRSMPEGRSTSNGPSRRQSLGGADNFSK  421

Query  929   -----LSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKID-EKEN  768
                    SK+   SQ R+S+ + +  + +   +       +    G   SR  ++    N
Sbjct  422   FTSNGFLSKRTPTSQLRSSLSSNSVLKHAKGTSKSFDGGTRSLDRG---SRALLNGSSPN  478

Query  767   AGMKENSD--KLTDSGNFSKND-------------EDMVSGFLYDRLQKEVINMRKCFDM  633
                 +  D  K T++ N  K +             ED V G LYD LQKEV+ +RK    
Sbjct  479   CSFNQPCDETKDTEAANMWKGNSDEKPVEFPVTETEDTVPGVLYDLLQKEVVALRKAGHE  538

Query  632   KENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
             K+  L  KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++ 
Sbjct  539   KDQSLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRV  587



>ref|XP_010319385.1| PREDICTED: microtubule-associated protein 70-2 [Solanum lycopersicum]
Length=617

 Score =   376 bits (966),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 276/525 (53%), Positives = 373/525 (71%), Gaps = 26/525 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             L LLH +DP  LEL  L+N+L++K+REL  AQ+E K LR +E+L++KA+EEL +E  R++
Sbjct  54    LNLLHGSDPVKLELNRLENELRDKDRELSEAQAEIKSLRLSERLREKAVEELTDEWSRVD  113

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L+E KNLE KK+  EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  114   EKLKLTESLLESKNLEIKKINEEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  173

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAALL+AER ++SAL +  +V+++QN+N +L 
Sbjct  174   EAELKLARQEIAKLQDDNKALDRLTKSKEAALLDAERTVQSALAKASMVDDLQNKNQDLM  233

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILD+ +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  234   KQIEICQEENKILDRMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  293

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD +DKVMPVKQWLEER+ LQ E+Q+L+DKLAI
Sbjct  294   ERKTLDRELARAKVTANRVATVVANEWKDASDKVMPVKQWLEERKFLQGELQQLRDKLAI  353

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNN-NVNPKVLSGFSKPEKANHLFGI-----  930
             SERTAK+EAQLK+K  LRLK LE+ LK T       P   S  + P +   L G      
Sbjct  354   SERTAKSEAQLKEKYHLRLKVLEETLKSTSTGARTIPDGRSSSNGPSRRRSLGGADNISK  413

Query  929   LSS----KKRSAS-QPRASMVNTTseqesssen-----sgEYNDQKKRHHGLWYSRN---  789
             L+S     KRS S Q R+S  +T  +    +       S   +  KK  +G   + N   
Sbjct  414   LTSNGILPKRSPSFQLRSSGASTVLKHAKGTSKSFDGGSRSLDRSKKLLNGTGPNFNSSK  473

Query  788   -----KIDEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKEN  624
                  K +E E+   K N D+  +    ++  ED V G LYD LQKEVI +RK    K+ 
Sbjct  474   SCDVSKDNETESNSWKANQDEKHNDSQMART-EDTVPGVLYDLLQKEVIALRKAGHEKDQ  532

Query  623   DLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIK  489
              LN KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ S ++
Sbjct  533   SLNDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVSAMR  577



>ref|XP_010932544.1| PREDICTED: microtubule-associated protein 70-2-like isoform X3 
[Elaeis guineensis]
Length=611

 Score =   375 bits (964),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 267/526 (51%), Positives = 373/526 (71%), Gaps = 29/526 (6%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             LLH +DP  +EL  L+N++++KERELG A +E K LR +E+ +++A+EEL  E+ ++EEK
Sbjct  58    LLHGSDPVKVELNRLENEVRDKERELGEAHAEIKALRLSERARERAVEELTEELAKVEEK  117

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++AP+EA
Sbjct  118   LKLTESLLENKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPVEA  177

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+   EIA LQ+D RA++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL +Q
Sbjct  178   ELKLAHQEIAKLQDDNRALDRLTKSKEAALLEAERTVQVALAKASMVDDLQNKNQELMKQ  237

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILDK +RQKV EVE+L+QT+ ELEEAILAGGAAAN +RDY+R+  E+ EER
Sbjct  238   IEICQEENKILDKLHRQKVAEVEKLTQTVRELEEAILAGGAAANAVRDYQRKFQEMNEER  297

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             + L+RELAR K++ANRVA +VANEWKD NDKVMPV+QWLEERR +Q EMQ+L+DKLAI+E
Sbjct  298   KILDRELARAKITANRVAVVVANEWKDANDKVMPVRQWLEERRFMQGEMQQLRDKLAIAE  357

Query  1085  RTAKAEAQlkdklklrlktLEQGLK--QTGNNNVNPKVLSGFSKPEKANHLFGILSSKKR  912
             RTA++EAQLK+K +LRL+ LE+GL+   +G+N  N +  S  + P +   L G  +  K 
Sbjct  358   RTARSEAQLKEKFQLRLRVLEEGLRMSSSGSNRTNVEGKSASNGPSRRQSLGGAENVSKS  417

Query  911   SAS----------QPRASMVNTTseqesssensgEYNDQKKRH--------HGLWYSRNK  786
             S +          Q R+++ ++TS     ++ + +  D   R         +G+  S N+
Sbjct  418   SPNGLLLRRLPSFQLRSNLSSSTSAVLKHAKGTSKSFDGGTRSLDRGKVIAYGIGDSLNR  477

Query  785   I-----DEKENAGMKENSD-KLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKEN  624
                   D + N   KEN D K  +  N   ND   VSG LYD LQKEVI +RK    K+ 
Sbjct  478   SSDAIRDNETNNSWKENQDEKPVELTNADSNDS--VSGLLYDMLQKEVITLRKACHEKDQ  535

Query  623   DLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
              L  KD+ I+ML KK++TLTKA+EVE++K +RE A  EK+ + ++ 
Sbjct  536   SLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREMAAMEKEVAAMRV  581



>ref|XP_006355060.1| PREDICTED: microtubule-associated protein 70-1-like [Solanum 
tuberosum]
Length=617

 Score =   375 bits (964),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 280/526 (53%), Positives = 376/526 (71%), Gaps = 28/526 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             L LLH +DP  +EL  L+N+L++K+REL  AQ+E K LR +E+L++KA+EEL +E  R++
Sbjct  54    LNLLHGSDPVKVELNRLENELRDKDRELSEAQAEIKSLRLSERLREKAVEELTDEWSRVD  113

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L+E KNLE KK+  EKK ++TAQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  114   EKLKLTESLLESKNLEIKKINEEKKASMTAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  173

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAALL+AER ++SAL +  +V+++QN+N +L 
Sbjct  174   EAELKLARQEIAKLQDDNKALDRLTKSKEAALLDAERTVQSALAKASMVDDLQNKNQDLM  233

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILD+ +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  234   KQIEICQEENKILDRMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  293

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD +DKVMPVKQWLEER+ LQ E+Q+L+DKLAI
Sbjct  294   ERKTLDRELARAKVTANRVATVVANEWKDASDKVMPVKQWLEERKFLQGELQQLRDKLAI  353

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNN-NVNPKVLSGFSKPEKANHLFGI-----  930
             SERTAK+EAQLK+K  LRLK LE+ LK T       P   S  + P +   L G      
Sbjct  354   SERTAKSEAQLKEKYHLRLKVLEETLKSTSTGARTTPDGRSSSNGPSRRRSLGGADNISK  413

Query  929   LSS----KKRSAS-QPRASMVNTTseqesssen-----sgEYNDQKKRHHGLWYSRN---  789
             L+S     KRS S Q R+S  +T  +    +       S   +  KK  +G   + N   
Sbjct  414   LTSNGILPKRSPSFQLRSSGASTVLKHAKGTSKSFDGGSRSLDRSKKLLNGTGPNFNSSK  473

Query  788   -----KIDEKENAGMKENSD-KLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKE  627
                  K +E E+   K N D KL DS   ++  ED V G LYD LQKEVI +RK    K+
Sbjct  474   SCDGTKDNETESNLWKANQDEKLNDS-QMTRT-EDTVPGVLYDLLQKEVIALRKAGHEKD  531

Query  626   NDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIK  489
               LN KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ S ++
Sbjct  532   QSLNDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVSAMR  577



>ref|XP_010932545.1| PREDICTED: microtubule-associated protein 70-2-like isoform X4 
[Elaeis guineensis]
 ref|XP_010932546.1| PREDICTED: microtubule-associated protein 70-2-like isoform X4 
[Elaeis guineensis]
 ref|XP_010932547.1| PREDICTED: microtubule-associated protein 70-2-like isoform X4 
[Elaeis guineensis]
Length=610

 Score =   375 bits (963),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 267/526 (51%), Positives = 373/526 (71%), Gaps = 29/526 (6%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             LLH +DP  +EL  L+N++++KERELG A +E K LR +E+ +++A+EEL  E+ ++EEK
Sbjct  58    LLHGSDPVKVELNRLENEVRDKERELGEAHAEIKALRLSERARERAVEELTEELAKVEEK  117

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++AP+EA
Sbjct  118   LKLTESLLENKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPVEA  177

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+   EIA LQ+D RA++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL +Q
Sbjct  178   ELKLAHQEIAKLQDDNRALDRLTKSKEAALLEAERTVQVALAKASMVDDLQNKNQELMKQ  237

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILDK +RQKV EVE+L+QT+ ELEEAILAGGAAAN +RDY+R+  E+ EER
Sbjct  238   IEICQEENKILDKLHRQKVAEVEKLTQTVRELEEAILAGGAAANAVRDYQRKFQEMNEER  297

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             + L+RELAR K++ANRVA +VANEWKD NDKVMPV+QWLEERR +Q EMQ+L+DKLAI+E
Sbjct  298   KILDRELARAKITANRVAVVVANEWKDANDKVMPVRQWLEERRFMQGEMQQLRDKLAIAE  357

Query  1085  RTAKAEAQlkdklklrlktLEQGLK--QTGNNNVNPKVLSGFSKPEKANHLFGILSSKKR  912
             RTA++EAQLK+K +LRL+ LE+GL+   +G+N  N +  S  + P +   L G  +  K 
Sbjct  358   RTARSEAQLKEKFQLRLRVLEEGLRMSSSGSNRTNVEGKSASNGPSRRQSLGGAENVSKS  417

Query  911   SAS----------QPRASMVNTTseqesssensgEYNDQKKRH--------HGLWYSRNK  786
             S +          Q R+++ ++TS     ++ + +  D   R         +G+  S N+
Sbjct  418   SPNGLLLRRLPSFQLRSNLSSSTSAVLKHAKGTSKSFDGGTRSLDRGKVIAYGIGDSLNR  477

Query  785   I-----DEKENAGMKENSD-KLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKEN  624
                   D + N   KEN D K  +  N   ND   VSG LYD LQKEVI +RK    K+ 
Sbjct  478   SSDAIRDNETNNSWKENQDEKPVELTNADSNDS--VSGLLYDMLQKEVITLRKACHEKDQ  535

Query  623   DLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
              L  KD+ I+ML KK++TLTKA+EVE++K +RE A  EK+ + ++ 
Sbjct  536   SLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREMAAMEKEVAAMRV  581



>ref|XP_010932543.1| PREDICTED: microtubule-associated protein 70-2-like isoform X2 
[Elaeis guineensis]
Length=620

 Score =   375 bits (964),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 267/526 (51%), Positives = 373/526 (71%), Gaps = 29/526 (6%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             LLH +DP  +EL  L+N++++KERELG A +E K LR +E+ +++A+EEL  E+ ++EEK
Sbjct  58    LLHGSDPVKVELNRLENEVRDKERELGEAHAEIKALRLSERARERAVEELTEELAKVEEK  117

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++AP+EA
Sbjct  118   LKLTESLLENKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPVEA  177

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+   EIA LQ+D RA++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL +Q
Sbjct  178   ELKLAHQEIAKLQDDNRALDRLTKSKEAALLEAERTVQVALAKASMVDDLQNKNQELMKQ  237

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILDK +RQKV EVE+L+QT+ ELEEAILAGGAAAN +RDY+R+  E+ EER
Sbjct  238   IEICQEENKILDKLHRQKVAEVEKLTQTVRELEEAILAGGAAANAVRDYQRKFQEMNEER  297

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             + L+RELAR K++ANRVA +VANEWKD NDKVMPV+QWLEERR +Q EMQ+L+DKLAI+E
Sbjct  298   KILDRELARAKITANRVAVVVANEWKDANDKVMPVRQWLEERRFMQGEMQQLRDKLAIAE  357

Query  1085  RTAKAEAQlkdklklrlktLEQGLK--QTGNNNVNPKVLSGFSKPEKANHLFGILSSKKR  912
             RTA++EAQLK+K +LRL+ LE+GL+   +G+N  N +  S  + P +   L G  +  K 
Sbjct  358   RTARSEAQLKEKFQLRLRVLEEGLRMSSSGSNRTNVEGKSASNGPSRRQSLGGAENVSKS  417

Query  911   SAS----------QPRASMVNTTseqesssensgEYNDQKKRH--------HGLWYSRNK  786
             S +          Q R+++ ++TS     ++ + +  D   R         +G+  S N+
Sbjct  418   SPNGLLLRRLPSFQLRSNLSSSTSAVLKHAKGTSKSFDGGTRSLDRGKVIAYGIGDSLNR  477

Query  785   I-----DEKENAGMKENSD-KLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKEN  624
                   D + N   KEN D K  +  N   ND   VSG LYD LQKEVI +RK    K+ 
Sbjct  478   SSDAIRDNETNNSWKENQDEKPVELTNADSNDS--VSGLLYDMLQKEVITLRKACHEKDQ  535

Query  623   DLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
              L  KD+ I+ML KK++TLTKA+EVE++K +RE A  EK+ + ++ 
Sbjct  536   SLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREMAAMEKEVAAMRV  581



>ref|XP_010460414.1| PREDICTED: microtubule-associated protein 70-2 [Camelina sativa]
Length=640

 Score =   376 bits (965),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 272/539 (50%), Positives = 382/539 (71%), Gaps = 31/539 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N +++K+RELG A +E K LR +E+ ++KA+EEL  E+ +L+
Sbjct  69    ITLLHGSDPVKVELNRLENDVRDKDRELGEAHAEIKALRLSERQREKAVEELTEELTKLD  128

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E++++ KNLE KK+  EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  129   EKLKLTESILQSKNLEIKKINEEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  188

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQED RA++R  KSKEAALLEAER +++A+ +  +V+++QN+N EL 
Sbjct  189   EAELKLARSEIGKLQEDNRALDRLTKSKEAALLEAERTVEAAMAKAAMVDDLQNKNQELM  248

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILD+ +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  249   KQIEICQEENKILDRMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNE  308

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  309   ERKTLDRELARAKVTANRVATVVANEWKDGNDKVMPVKQWLEERRFLQGEMQQLRDKLAI  368

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNV--NPKVLSGFSKPEKANHLFGI----  930
             ++R AK+EAQLK+K +LRL+ LE+ L+ T +++    P+  S  + P +   L G     
Sbjct  369   TDRAAKSEAQLKEKFQLRLRVLEETLRGTTSSSTRNTPEARSMSNGPSRRQSLGGAENLQ  428

Query  929   -LSS-----KKRSASQPRASM-VNTTseqesssensgEYNDQKK---RHHGLW-----YS  795
                S     KK  +SQ R S+ +N+TS  +++   S  ++   +   R   L      YS
Sbjct  429   KFPSNGALLKKTPSSQMRHSLSINSTSVLKNAKGTSKSFDGGTRSLDRGKALVNGPGNYS  488

Query  794   RNKI--DEKE---NAGMKENSDKLTDSGNFSKND----EDMVSGFLYDRLQKEVINMRKC  642
              NK   D KE     G KEN ++   S + S       ED V G LYD LQKEV+++RK 
Sbjct  489   FNKATDDSKEAESGNGWKENPEEKPQSEDPSAAAAAATEDSVPGVLYDLLQKEVVSLRKA  548

Query  641   FDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIR  465
                K+  L  KD+ I+ML KK+ETLTKA+EVE++K +RE +  EK+ + ++ + D + R
Sbjct  549   SHEKDQSLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVSAMEKEVAAMRVEKDQDTR  607



>ref|XP_009105356.1| PREDICTED: microtubule-associated protein 70-1 [Brassica rapa]
 emb|CDX96050.1| BnaA07g26810D [Brassica napus]
Length=625

 Score =   375 bits (963),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 273/538 (51%), Positives = 377/538 (70%), Gaps = 28/538 (5%)
 Frame = -3

Query  1979  LH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKL  1803
             LH +DP  +EL  L+N++++K+RELG A +E K LR +E+ ++KA+EEL +E+ +LEEKL
Sbjct  61    LHGSDPVKVELNRLENEVRDKDRELGEAHAEIKALRLSERQREKAVEELTDELTKLEEKL  120

Query  1802  KISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAE  1623
             K++E+L++ KNLE KK+  EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APLEAE
Sbjct  121   KLTESLLQGKNLEIKKINEEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEAE  180

Query  1622  IKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQI  1443
             +K+ ++EI  LQED RA++R  KSKEAALL+AER +++A+ +  +V+++QN+N EL +QI
Sbjct  181   LKLARSEIGKLQEDNRALDRLTKSKEAALLDAERTVQTAMAKAALVDDLQNKNQELMKQI  240

Query  1442  EICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeerr  1263
             EICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R+  E+ EER+
Sbjct  241   EICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNEERK  300

Query  1262  tlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISER  1083
             TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAIS+R
Sbjct  301   TLDRELARAKVTANRVATVVANEWKDGNDKVMPVKQWLEERRFLQGEMQQLRDKLAISDR  360

Query  1082  TAKAEAQlkdklklrlktLEQGLKQTGNNNV--NPKVLSGFSKPEKANHLFGI-------  930
              AK+EAQLK+K +LRLK LE+ L+ T ++++   P+  S  + P +   L G        
Sbjct  361   AAKSEAQLKEKFQLRLKVLEETLRGTSSSSIRNTPEGRSMSNGPSRRQSLGGADNLQKFG  420

Query  929   ---LSSKKRSASQPR-ASMVNTTseqesssensgEYNDQKK---RHHGLW-----YSRNK  786
                   KK  +SQ R A   N+TS  +++   S  ++   +   R   L      YS NK
Sbjct  421   SNGFLPKKSPSSQMRNAFTSNSTSVLKNAKGTSRSFDGGTRSLDRGKALLNGPGKYSFNK  480

Query  785   I------DEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKEN  624
                     E      KE+S++   S   +   ED V G LYD LQKEV+ +RK    K+ 
Sbjct  481   ACEEAKESESSPNAWKEDSEEKPPSELPAPTTEDNVPGVLYDLLQKEVVALRKSSHEKDQ  540

Query  623   DLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQTNSS  450
              L  KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++   D + R   SS
Sbjct  541   SLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRVDKDQDNRAKRSS  598



>ref|XP_002875092.1| atmap70-3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51351.1| atmap70-3 [Arabidopsis lyrata subsp. lyrata]
Length=625

 Score =   375 bits (962),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 262/532 (49%), Positives = 370/532 (70%), Gaps = 22/532 (4%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N +++K+REL  AQ+E K LR +E+ ++KA+EE+  E+ ++ 
Sbjct  62    ITLLHGSDPVKIELNRLENDVRDKDRELSEAQAEIKALRLSERQREKAVEEVSEELGKMS  121

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK+SENL++ KNLE KK+  EK+ ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  122   EKLKLSENLLDSKNLEIKKINEEKRASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  181

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQ+D RA++R  KSKEAALL+AER ++SAL +  +V+++QN+N EL 
Sbjct  182   EAELKLARHEIIKLQDDNRALDRLTKSKEAALLDAERTVQSALAKASMVDDLQNKNQELM  241

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEEN+ILDK +RQKV EVE+ +QT+ ELEEA+LAGG AAN +RDY+R+  E+ E
Sbjct  242   KQIEICQEENRILDKLHRQKVAEVEKFTQTVRELEEAVLAGGTAANAVRDYQRKFQEMNE  301

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ERR L+RELAR KVSA+RVAT+VANEWKD +DKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  302   ERRVLDRELARAKVSASRVATVVANEWKDGSDKVMPVKQWLEERRFLQGEMQQLRDKLAI  361

Query  1091  SERTAKAEAQlkdklklrlktLEQGLK--QTGNNNVNPKVLSGFSKPEKANHLFGI----  930
             ++R AK+EAQLK+K +LRL+ LE+ L+   +  N   P+  S  + P +   L G     
Sbjct  362   ADRAAKSEAQLKEKFQLRLRVLEESLRGPSSSGNRSTPEGRSISNGPSRRQSLGGADIIP  421

Query  929   ------LSSKKRSASQPRASMVNTTseqesssensgEYNDQKK---RHHGLW------YS  795
                     SK+  +SQ R+   +T++  + +   S  ++   +   R   L       + 
Sbjct  422   KLTANGFFSKRTPSSQFRSLNASTSTILKHAKGTSSSFDGGSRSLDRSKLLTNEPRSKFP  481

Query  794   RNKIDEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLN  615
              N+  E+ + G   NS K  DS   +  + D V G L+D LQKEVI +RK  + K+  L 
Sbjct  482   SNQSSEETSGGESPNSTKQGDSVKAAATNNDSVPGVLHDLLQKEVITLRKAANDKDQSLR  541

Query  614   TKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQT  459
              KDE I+ML KK+ETLTKA+EVE++K +RE A  EK+ S ++    G+  +T
Sbjct  542   DKDEAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVSAMRVDNKGSDSRT  593



>dbj|BAK06943.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=576

 Score =   373 bits (957),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 272/534 (51%), Positives = 372/534 (70%), Gaps = 21/534 (4%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +ELT L+N L  KE+ELG AQ+E K LR +E+ ++KA+E+L  E+ +++
Sbjct  35    ISLLHGSDPVRVELTRLENDLHYKEKELGDAQAEIKALRLSERAREKAVEDLTEELAKVD  94

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
              KLK++E+L+E KNLE KK+ +EKK AL AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  95    GKLKLTESLLESKNLEAKKINDEKKAALAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  154

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D RA++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL 
Sbjct  155   EAELKLARQEIAKLQDDNRALDRLTKSKEAALLEAERTVQIALAKASLVDDLQNKNQELM  214

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILD+ +RQKV EVE+L+QT+ ELEEA+LAGGAAAN ++DY+R++ E+ E
Sbjct  215   KQIEICQEENKILDRMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVKDYQRKVQEMNE  274

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             E +TL+RELAR KVSANRVA +VANEWKD NDKVMPVKQWLEERR+LQ EMQ+L+DKLAI
Sbjct  275   EMKTLDRELARAKVSANRVAVVVANEWKDGNDKVMPVKQWLEERRLLQGEMQQLRDKLAI  334

Query  1091  SERTAKAEAQlkdklklrlktLEQGLK-QTGNNNVNPKVLSGFSKPEKANHLFGILSSKK  915
             +ER A++EAQLKDK +LRLK LE+GL+  T   N +          E A+   G LS  K
Sbjct  335   AERAARSEAQLKDKFQLRLKVLEEGLRMSTSRTNASAARRQSIGGAESASKTNGFLS--K  392

Query  914   RSASQPR-------ASMVNTTseqesssensgEYNDQKKRH---HGLWYSRNKIDEKENA  765
             R + Q R        ++VN       S +      D+ K H    G+  S +  ++KE+ 
Sbjct  393   RPSFQMRTSVSTTTTTLVNHAKGASKSFDGGCRSLDRYKGHVNGVGMNVSTDSSEDKESN  452

Query  764   GMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLT  585
                E   + T     S   ED VSG LYD LQKEV+ +RK    K+  L  KD+ ++ML 
Sbjct  453   NSDEKPSEFT-----SVESEDTVSGMLYDMLQKEVVALRKACHEKDQSLKDKDDAVEMLA  507

Query  584   KKIETLTKAIEVESRKTKREAAIREKDSSTIKY--KYDGNIRQTNSSLKSSIKV  429
             KK++TLTKA+E E++K +R+ A  EK+   ++   + D   R+  SS  S+ +V
Sbjct  508   KKVDTLTKAMESEAKKMRRDVAAMEKEVVAMRLEKEQDTKARRFGSSSASASQV  561



>ref|XP_010932540.1| PREDICTED: microtubule-associated protein 70-2-like isoform X1 
[Elaeis guineensis]
 ref|XP_010932541.1| PREDICTED: microtubule-associated protein 70-2-like isoform X1 
[Elaeis guineensis]
Length=644

 Score =   375 bits (963),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 267/525 (51%), Positives = 373/525 (71%), Gaps = 29/525 (6%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             LLH +DP  +EL  L+N++++KERELG A +E K LR +E+ +++A+EEL  E+ ++EEK
Sbjct  58    LLHGSDPVKVELNRLENEVRDKERELGEAHAEIKALRLSERARERAVEELTEELAKVEEK  117

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++AP+EA
Sbjct  118   LKLTESLLENKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPVEA  177

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+   EIA LQ+D RA++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL +Q
Sbjct  178   ELKLAHQEIAKLQDDNRALDRLTKSKEAALLEAERTVQVALAKASMVDDLQNKNQELMKQ  237

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILDK +RQKV EVE+L+QT+ ELEEAILAGGAAAN +RDY+R+  E+ EER
Sbjct  238   IEICQEENKILDKLHRQKVAEVEKLTQTVRELEEAILAGGAAANAVRDYQRKFQEMNEER  297

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             + L+RELAR K++ANRVA +VANEWKD NDKVMPV+QWLEERR +Q EMQ+L+DKLAI+E
Sbjct  298   KILDRELARAKITANRVAVVVANEWKDANDKVMPVRQWLEERRFMQGEMQQLRDKLAIAE  357

Query  1085  RTAKAEAQlkdklklrlktLEQGLK--QTGNNNVNPKVLSGFSKPEKANHLFGILSSKKR  912
             RTA++EAQLK+K +LRL+ LE+GL+   +G+N  N +  S  + P +   L G  +  K 
Sbjct  358   RTARSEAQLKEKFQLRLRVLEEGLRMSSSGSNRTNVEGKSASNGPSRRQSLGGAENVSKS  417

Query  911   SAS----------QPRASMVNTTseqesssensgEYNDQKKRH--------HGLWYSRNK  786
             S +          Q R+++ ++TS     ++ + +  D   R         +G+  S N+
Sbjct  418   SPNGLLLRRLPSFQLRSNLSSSTSAVLKHAKGTSKSFDGGTRSLDRGKVIAYGIGDSLNR  477

Query  785   I-----DEKENAGMKENSD-KLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKEN  624
                   D + N   KEN D K  +  N   ND   VSG LYD LQKEVI +RK    K+ 
Sbjct  478   SSDAIRDNETNNSWKENQDEKPVELTNADSNDS--VSGLLYDMLQKEVITLRKACHEKDQ  535

Query  623   DLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIK  489
              L  KD+ I+ML KK++TLTKA+EVE++K +RE A  EK+ + ++
Sbjct  536   SLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREMAAMEKEVAAMR  580



>emb|CAJ31079.1| 70 kDa microtubule associated protein Type 2 [Arabidopsis thaliana]
Length=607

 Score =   373 bits (958),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 268/510 (53%), Positives = 369/510 (72%), Gaps = 27/510 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+RELG A +E K LR +E+ ++KA+EEL  E+ +L+
Sbjct  67    ITLLHGSDPVKVELNRLENEVRDKDRELGEANAEIKALRLSERQREKAVEELTEELTKLD  126

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+++E KNLE KK+  EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  127   EKLKLTESILESKNLEIKKINEEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  186

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQED RA++R  KSKEAALLEAER +++A+ +  +V+++QN+N EL 
Sbjct  187   EAELKLARSEIGKLQEDNRALDRLTKSKEAALLEAERTVEAAMAKAAMVDDLQNKNQELM  246

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILD+ +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  247   KQIEICQEENKILDRMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNE  306

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  307   ERKTLDRELARAKVTANRVATVVANEWKDGNDKVMPVKQWLEERRFLQGEMQQLRDKLAI  366

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNV--NPKVLSGFSKPEKANHLFGILS--  924
             ++R AK+EAQLK+K +LRLK LE+ L+ T ++     P+  S  + P +   L G  +  
Sbjct  367   TDRAAKSEAQLKEKFQLRLKVLEETLRGTSSSATRNTPEARSMSNGPSRRQSLGGAENLQ  426

Query  923   --------SKKRSASQPRASM-VNTTseqesssensgEYNDQKK---RHHGLW-----YS  795
                     SKK  ASQ R S+ +N+TS  +++   S  ++   +   R   L      YS
Sbjct  427   KFTSNGALSKKAPASQMRHSLSINSTSVLKNAKGTSKSFDGGTRSVDRGKALLNGPGNYS  486

Query  794   RNKI--DEKE---NAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMK  630
              NK   D KE     G KENS++   S +     ED V G LYD LQKEV+++RK  + K
Sbjct  487   FNKATDDSKEAESGNGWKENSEEKPQSEDPEAATEDSVPGVLYDLLQKEVVSLRKASNEK  546

Query  629   ENDLNTKDEEIKMLTKKIETLTKAIEVESR  540
             +  L  KD+ I+ML KK+ETLTKA+EVE++
Sbjct  547   DQSLKDKDDAIEMLAKKVETLTKAMEVEAK  576



>ref|XP_010531687.1| PREDICTED: microtubule-associated protein 70-2-like [Tarenaya 
hassleriana]
Length=615

 Score =   374 bits (959),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 269/530 (51%), Positives = 371/530 (70%), Gaps = 29/530 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++KERELG A +E K LR +E+ ++KA+EEL + + +LE
Sbjct  48    ITLLHGSDPVKVELNRLENEVRDKERELGEAHAEIKALRLSERQREKAVEELTDGLAKLE  107

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L+E KNLE KK+I EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  108   EKLKLTESLLESKNLEVKKIIEEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  167

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EI  LQED RA++R  K KEAALL+AER +++AL +  +V+++QN+N EL 
Sbjct  168   EAELKLARQEIGRLQEDNRALDRLTKQKEAALLDAERTVQAALAKAALVDDLQNKNQELM  227

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK NRQKV EVE+L+Q + ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  228   KQIEICQEENKILDKMNRQKVAEVEKLTQAVRELEEAVLAGGAAANAVRDYQRKVQEMNE  287

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+T++RELAR KV+ANRVAT+VANEWKD  DKVMPVKQWLEERR LQ E Q+L+DKL+I
Sbjct  288   ERKTIDRELARAKVTANRVATVVANEWKDGKDKVMPVKQWLEERRFLQGETQQLRDKLSI  347

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNV-----------NPKVLSGFSKPEKAN  945
             +ER AK+EAQLK+K +LRLK LE  L+ T + +             P     F   +   
Sbjct  348   AERAAKSEAQLKEKFQLRLKVLEDTLRGTSSGSSRNASEGRSMSNGPSRRQSFGGADNIQ  407

Query  944   HLF--GILSSK-KRSASQPRASM-VNTTseqesssensgEYNDQKK---RHHGLW-----  801
              L   G L+ K    ASQ R S+  N+TS  +++   S  ++   +   R   L      
Sbjct  408   KLSSNGFLTKKIPAPASQLRQSLSSNSTSVLKNAKGTSRSFDGGTRSLDRRKVLLNGPGN  467

Query  800   YSRNKIDE-----KENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFD  636
             YS NK  E     +  +  KEN+++   S N ++ +ED + G LYD LQKEVI +RK   
Sbjct  468   YSFNKASEELKEAESPSAWKENAEEKPLSQNLARANEDSIPGVLYDLLQKEVIALRKASH  527

Query  635   MKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
              K+  L  KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++ 
Sbjct  528   EKDQSLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVATMEKEVAAMRV  577



>emb|CDY27573.1| BnaA09g28340D [Brassica napus]
Length=626

 Score =   374 bits (959),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 271/537 (50%), Positives = 376/537 (70%), Gaps = 31/537 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             +  LH +DP  +EL  L+N++++K+RELG A +E K LR +E+ ++KA+EEL  E+ +L+
Sbjct  60    ITQLHGSDPVKVELNRLENEVRDKDRELGEAHAEIKALRLSERQREKAVEELTEELAKLD  119

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E++++ KNLE KK+  EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  120   EKLKLTESILQTKNLEIKKINEEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  179

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQED RA++R  KSKEAALL+AER ++ AL +  +V+++QN+N EL 
Sbjct  180   EAELKLARSEIGKLQEDNRALDRLTKSKEAALLDAERTIEGALAKAAMVDDLQNKNQELM  239

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  240   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNE  299

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  300   ERKTLDRELARAKVTANRVATVVANEWKDGNDKVMPVKQWLEERRFLQGEMQQLRDKLAI  359

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILS----  924
             ++R AK+EAQLK+K +LRLK LE+ L+ T + N  P+  S  + P       G       
Sbjct  360   TDRAAKSEAQLKEKFQLRLKVLEETLRGTSSRNT-PEARSMSNGPTSRRQSLGGSDNLQK  418

Query  923   -------SKKRSASQPRASM-VNTTseqesssensgEYNDQKK---RHHGLW-----YSR  792
                    SKK   SQ R S+ +N+TS  +++   S  ++   +   R   L      YS 
Sbjct  419   FPSNGSFSKKAPVSQMRHSLSINSTSVLKNAKGTSKSFDGGTRSLDRGKALLNGPGNYSF  478

Query  791   NKIDEKENA--------GMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFD  636
             NK    + A        G KE S++   S N +   ED V G LYD LQKEV+++RK   
Sbjct  479   NKPASDDAAKETELAANGWKETSEEKPQSENPAAT-EDSVPGVLYDLLQKEVVSLRKASH  537

Query  635   MKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIR  465
              K+  L  KD+ I+ML KK+ETLTKA+EVE++K +RE +  EK+ + ++ + D + R
Sbjct  538   EKDQSLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVSAMEKEVAAMRVEKDQDNR  594



>emb|CDY07403.1| BnaA07g24820D [Brassica napus]
Length=618

 Score =   373 bits (958),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 274/539 (51%), Positives = 376/539 (70%), Gaps = 28/539 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  LEL  L+N++++K+RELG A +E + LR +E+ ++KA+EEL +E+ +LE
Sbjct  55    ITLLHGSDPVKLELNRLENEVRDKDRELGEAHAEIRALRLSERQREKAVEELTDELTKLE  114

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L++ KNLE +K+  EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  115   EKLKLTESLLQGKNLEIRKINEEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  174

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQED RA++R  KSKEAALL+AER ++SA+ +  +V+++QN+N EL 
Sbjct  175   EAELKLARSEIGKLQEDNRALDRLTKSKEAALLDAERTVQSAMAKAALVDDLQNKNQELM  234

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  235   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNE  294

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  295   ERKTLDRELARAKVTANRVATVVANEWKDGNDKVMPVKQWLEERRFLQGEMQQLRDKLAI  354

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQT----------GNNNVNPKVLSGFSKPEK-AN  945
             S+R AK+EAQLKDK +LRLK LE+ L+ T          GN +   + L G    +K A+
Sbjct  355   SDRAAKSEAQLKDKFQLRLKVLEETLRGTSRNTTEGRSMGNGSSRRQSLGGSDNLQKFAS  414

Query  944   HLFGILSSKKRSASQPRASMVNTTseqesssensgEYNDQKK---RHHGLW-----YSRN  789
             +  G L  K  S+    A   N+ S   ++   S  ++   +   R   L      YS N
Sbjct  415   N--GFLPKKSPSSQMRNAFNSNSNSVLRNAKGTSRSFDGGTRSLDRGKALLNGPGKYSFN  472

Query  788   KI------DEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKE  627
             K        E  +A  +E+S++   S       ED V G LYD LQKEV+ +RK    K+
Sbjct  473   KACDEAKESESPSAWKEEDSEEKPPSELPPPTTEDNVPGVLYDLLQKEVVALRKSSHEKD  532

Query  626   NDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQTNSS  450
               L  KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++   D + R   SS
Sbjct  533   QSLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRVDKDQDNRARRSS  591



>ref|XP_006664255.1| PREDICTED: microtubule-associated protein 70-1-like [Oryza brachyantha]
Length=575

 Score =   372 bits (955),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 267/511 (52%), Positives = 366/511 (72%), Gaps = 19/511 (4%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             LLH +DP  +ELT L+N+L+ KE+ELG AQ+E K LR +E+ ++KA+E+L  E+ +++ K
Sbjct  34    LLHGSDPVRVELTRLENELQYKEKELGEAQAEIKALRLSERAREKAVEDLTEELSKVDAK  93

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK++E+L+E KNLE KK+ +EKK AL AQ+AAEA LRRV+A QK+DD  PIE+++APLEA
Sbjct  94    LKLTESLLESKNLEAKKINDEKKAALAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEA  153

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+ + EIA LQ+D RA++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL +Q
Sbjct  154   ELKIARQEIAKLQDDNRALDRLTKSKEAALLEAERTVQIALAKASLVDDLQNKNQELMKQ  213

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILD+ +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ EER
Sbjct  214   IEICQEENKILDRMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNEER  273

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             +TL+RELAR KVSANRVA +VANEWKD NDKVMPVKQWLEERRILQ EMQ+L+DKL+I+E
Sbjct  274   KTLDRELARAKVSANRVAVVVANEWKDGNDKVMPVKQWLEERRILQGEMQQLRDKLSIAE  333

Query  1085  RTAKAEAQlkdklklrlktLEQGLK-QTGNNNVNPKVLSGFSKPEKANHLFGILSSKKRS  909
             R A++EAQLKDK +LRLK LE+GL+  T   NVN          +  +   G L+  KR 
Sbjct  334   RAARSEAQLKDKFQLRLKVLEEGLRMSTTRTNVNTARRQSIGGADSLSKTNGFLA--KRP  391

Query  908   ASQPRAS-------MVNTTseqesssensgEYNDQKKRH---HGLWYSRNKIDEKENAGM  759
             + Q R+S       +VN       S +      D+ K H    G+  S +  ++KE+   
Sbjct  392   SFQMRSSVSTTTTTLVNHAKGASKSFDGGCRSLDRYKGHINGSGMNVSTDSSEDKESNNS  451

Query  758   KENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKK  579
              E +++ T     S   ED VSG LYD LQKEV+ +RK    K+  L  KD+ ++ML KK
Sbjct  452   DEKANEFT-----SVESEDTVSGLLYDTLQKEVVALRKACHEKDQSLKDKDDAVEMLAKK  506

Query  578   IETLTKAIEVESRKTKREAAIREKDSSTIKY  486
             ++TLTKA+E E++K + E    EK+ + ++ 
Sbjct  507   VDTLTKAMESEAKKRRLEVGAMEKEMAALRM  537



>ref|XP_009768285.1| PREDICTED: microtubule-associated protein 70-2-like [Nicotiana 
sylvestris]
Length=622

 Score =   373 bits (958),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 268/526 (51%), Positives = 371/526 (71%), Gaps = 26/526 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  LEL  L+N++++K+REL  AQ E K LR +E+L++KA+EEL +E+ R+ 
Sbjct  59    MNLLHGSDPVKLELNRLENEVRDKDRELSEAQVEIKALRLSERLREKAVEELTDELSRVY  118

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  119   EKLKLTESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  178

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAALL+AER ++SAL +  +V+++QN+N EL 
Sbjct  179   EAELKLARQEIAKLQDDNKALDRLTKSKEAALLDAERTVQSALAKASMVDDLQNKNQELM  238

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILD+ +RQKV EVE+L+Q++ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  239   KQIEICQEENKILDRMHRQKVAEVEKLTQSVRELEEAVLAGGAAANAVRDYQRKVQEMNE  298

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR+LQ EMQ+L+DKLAI
Sbjct  299   ERKTLDRELARAKVTANRVATVVANEWKDANDKVMPVKQWLEERRVLQGEMQQLRDKLAI  358

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNN-NVNPKVLSGFSKPEKANHLFGI-----  930
             +ERTAK+EA LK+K +LRLK LE+ L+ + +     P   S  + P +   L G      
Sbjct  359   TERTAKSEAMLKEKYQLRLKVLEETLRSSSSGARSTPDGRSSSNGPSRRQSLSGAESISK  418

Query  929   LSS----KKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGL---------WYSRN  789
             L+S     KRS S    S V++T  + +   +       +    G          + S  
Sbjct  419   LTSNGFLPKRSPSFQLRSSVSSTVLKHAKGTSKSFDGGSRSLDRGKKLLNVTGPNFNSSK  478

Query  788   KID-----EKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKEN  624
              +D     E E+   K N D+   S   S+  ED V G LYD LQKEV+++RK    K+ 
Sbjct  479   SVDGAKDSETESTSWKANQDEKPTSLPVSE-PEDTVPGLLYDLLQKEVVSLRKAGHEKDQ  537

Query  623   DLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
              L  KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++ 
Sbjct  538   SLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRV  583



>ref|XP_009105067.1| PREDICTED: microtubule-associated protein 70-1-like [Brassica 
rapa]
Length=618

 Score =   373 bits (958),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 274/539 (51%), Positives = 376/539 (70%), Gaps = 28/539 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  LEL  L+N++++K+RELG A +E + LR +E+ ++KA+EEL +E+ +LE
Sbjct  55    ITLLHGSDPVKLELNRLENEVRDKDRELGEAHAEIRALRLSERQREKAVEELTDELTKLE  114

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L++ KNLE +K+  EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  115   EKLKLTESLLQGKNLEIRKINEEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  174

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQED RA++R  KSKEAALL+AER ++SA+ +  +V+++QN+N EL 
Sbjct  175   EAELKLARSEIGKLQEDNRALDRLTKSKEAALLDAERTVQSAMAKAALVDDLQNKNQELM  234

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  235   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNE  294

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  295   ERKTLDRELARAKVTANRVATVVANEWKDGNDKVMPVKQWLEERRFLQGEMQQLRDKLAI  354

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQT----------GNNNVNPKVLSGFSKPEK-AN  945
             S+R AK+EAQLKDK +LRLK LE+ L+ T          GN +   + L G    +K A+
Sbjct  355   SDRAAKSEAQLKDKFQLRLKVLEETLRGTSRNTTEGRSMGNGSSRRQSLGGSDNLQKFAS  414

Query  944   HLFGILSSKKRSASQPRASMVNTTseqesssensgEYNDQKK---RHHGLW-----YSRN  789
             +  G L  K  S+    A   N+ S   ++   S  ++   +   R   L      YS N
Sbjct  415   N--GFLPKKSPSSQMRNAFNSNSNSVLRNAKGTSRSFDGGTRSLDRGKALLNGPGKYSFN  472

Query  788   KI------DEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKE  627
             K        E  +A  +E+S++   S       ED V G LYD LQKEV+ +RK    K+
Sbjct  473   KACDEAKESESPSAWKEEDSEEKPPSELPPPTTEDNVPGVLYDLLQKEVVALRKSSHEKD  532

Query  626   NDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQTNSS  450
               L  KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++   D + R   SS
Sbjct  533   QSLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRVDKDQDNRARRSS  591



>ref|NP_001170596.1| hypothetical protein [Zea mays]
 gb|ACR34163.1| unknown [Zea mays]
 gb|AFW76888.1| hypothetical protein ZEAMMB73_452857 [Zea mays]
Length=606

 Score =   373 bits (957),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 272/553 (49%), Positives = 381/553 (69%), Gaps = 36/553 (7%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + L+H +DP  +ELT L+N+L++KERELG AQ+E + LR +E+ ++KA+EEL +E++++ 
Sbjct  33    IALMHGSDPVRVELTRLENELRDKERELGEAQTEIRALRLSERAREKAVEELTDELEKMA  92

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L+E KNLE KK+ +EKK AL AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  93    EKLKLTESLLESKNLEVKKINDEKKAALAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  152

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + E A LQ+D RA++R  K KEAALLEAER ++ A+ +  +V+++QN+N EL 
Sbjct  153   EAELKLSRQENAKLQDDNRALDRLTKQKEAALLEAERTVQIAMAKAAMVDDLQNKNQELI  212

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEIC EENKILDK +RQK+ EVE+LSQT+ ELEEA+L GGA AN +RDY+R+  EI E
Sbjct  213   KQIEICHEENKILDKLHRQKIAEVEKLSQTVRELEEAVLQGGATANVVRDYQRRFQEINE  272

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             E+RTL+RELAR KV+ANRVA++VANEWKD NDKVMPVKQWLEERR  Q EMQ+L+DKLAI
Sbjct  273   EKRTLDRELARAKVTANRVASVVANEWKDSNDKVMPVKQWLEERRFFQGEMQQLRDKLAI  332

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLS-GFSK-PEKANHLF------  936
             +ERTA++EAQLK+K +LRLK LE GL+   + ++ P      FS  P +   L       
Sbjct  333   TERTARSEAQLKEKYQLRLKVLEDGLRGPPSGSIRPPTEGKSFSNVPSRRLSLGGADNIS  392

Query  935   -----GILSSKKRSASQPRASMVNTTseqesssensgEYN------DQKKRH----HGLW  801
                  G+LS +  S +   +   N++   + +   S  ++      D++K H    H L 
Sbjct  393   RLSPNGLLSRRSPSFNSRSSLTSNSSLVLKHAKGTSKSFDGGTRSLDRRKVHGNGAHLLN  452

Query  800   YSRNKIDEKEN-----AGMKENSDKLTDSGNFSKNDEDM-------VSGFLYDRLQKEVI  657
              S + + +KE        M E +++  DS    K++E M       VSGFLYD LQKEVI
Sbjct  453   RSTDAVRDKETNDSWKGDMDEKTNESADSNTDGKSNETMNNNSAETVSGFLYDMLQKEVI  512

Query  656   NMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYD  477
             ++RK    K+  L  KD+ I+ML KK++TLTKA+EVE++K +RE A  EK+ + ++   +
Sbjct  513   SLRKTCHEKDQILKDKDDAIEMLAKKVDTLTKAMEVEAKKVRREVASMEKEVAAMRASKE  572

Query  476   GNIRQTNSSLKSS  438
               IR      K S
Sbjct  573   QEIRAKRLGTKGS  585



>ref|XP_009776285.1| PREDICTED: microtubule-associated protein 70-2-like [Nicotiana 
sylvestris]
Length=629

 Score =   373 bits (958),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 274/525 (52%), Positives = 369/525 (70%), Gaps = 26/525 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             L LLH +DP  LEL  L+N++++K+REL  AQ+E K LR +E+L++KA+EEL  E+ R++
Sbjct  66    LNLLHGSDPVKLELNRLENEVRDKDRELCEAQAEIKALRFSERLREKAVEELTAELSRVD  125

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L+E KNLE KK+  EKK  + AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  126   EKLKLTESLLESKNLEIKKINEEKKAFMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  185

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAALL+AER ++SAL +  +V+++QN+N EL 
Sbjct  186   EAELKLARQEIAKLQDDNKALDRLTKSKEAALLDAERTVQSALAKASMVDDLQNKNQELM  245

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILD+ +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  246   KQIEICQEENKILDRMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  305

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEER+ LQ EMQ+L+DKLAI
Sbjct  306   ERKTLDRELARAKVTANRVATVVANEWKDANDKVMPVKQWLEERKFLQGEMQQLRDKLAI  365

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNN-NVNPKVLSGFSKPEKANHLFGI-----  930
             +ER AK+EAQLK+K  LRLK LE  L+ T       P   S  + P +   L G      
Sbjct  366   TERAAKSEAQLKEKYHLRLKVLEDTLRSTSTGARTTPDGRSSSNGPSRRQSLGGAENISK  425

Query  929   LSS----KKRSAS-QPRASMVNTTseqesssensgEYN----DQKK---RHHGLWYS---  795
             L+S     KRS S Q R+S  +T  +    +  S +      D+ K      G  ++   
Sbjct  426   LTSNGFLPKRSPSFQLRSSGASTVLKHAKGTSKSFDGGSRSLDRTKNLLNGTGPTFNSSK  485

Query  794   ---RNKIDEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKEN  624
                R K +E  N   K N D+  +    ++  ED V G LYD LQKEVI +RK    K+ 
Sbjct  486   SCDRTKDNETANISWKANQDEKHNDSQVTET-EDTVPGVLYDLLQKEVIALRKAGHEKDQ  544

Query  623   DLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIK  489
               N KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ S ++
Sbjct  545   SFNDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVSAMR  589



>ref|XP_010513903.1| PREDICTED: microtubule-associated protein 70-3-like isoform X1 
[Camelina sativa]
Length=628

 Score =   373 bits (957),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 265/564 (47%), Positives = 381/564 (68%), Gaps = 25/564 (4%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N +++K+REL  +Q+E K LR +E+ ++KA+EEL  E+ ++ 
Sbjct  64    ITLLHGSDPVKIELNRLENDVRDKDRELSESQAEIKALRLSERQREKAVEELTEELGKMS  123

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++ENL++ KNLE KK+  EK+ ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  124   EKLKLTENLLDSKNLEIKKINEEKRASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  183

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQ+D RA++R  KSKEAALL+AER ++SAL +  +V+++QN+N EL 
Sbjct  184   EAELKLARHEIVKLQDDNRALDRLTKSKEAALLDAERTVQSALAKASMVDDLQNKNQELM  243

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEEN+ILD+ +RQKV EVE+ +QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  244   KQIEICQEENRILDRMHRQKVAEVEKFTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNE  303

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ERR L+RELAR KVSA+RVAT+VANEWKD +DKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  304   ERRVLDRELARAKVSASRVATVVANEWKDGSDKVMPVKQWLEERRFLQGEMQQLRDKLAI  363

Query  1091  SERTAKAEAQlkdklklrlktLEQGLK--QTGNNNVNPKVLSGFSKPEKANHLFGI----  930
             ++R AK+EAQLK+K +LRL+ LE+ L+   +G N   P+  S  + P +   + G     
Sbjct  364   ADRAAKSEAQLKEKFQLRLRVLEESLRGPPSGGNRSTPEGRSISNGPSRRQSIGGADIIP  423

Query  929   ------LSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHG---------LWYS  795
                     SK+ S+SQ R+   +T++  + +   S  ++   +   G           + 
Sbjct  424   KLTSNGFFSKRTSSSQFRSLNASTSTILKHAKGTSRSFDGGSRSIDGSKLLTNEPRSKFP  483

Query  794   RNKIDEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLN  615
              N+  E ++     NS K  +    +  + D V G L+D LQKEVI +RK    K+  L 
Sbjct  484   VNQSSEGKSGDDSPNSTKQGEPDKAAATNNDSVPGVLHDLLQKEVITLRKASHDKDQSLR  543

Query  614   TKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQTNSSLKSSI  435
              KDE I+ML KK+ETLTKA+EVE++K +RE A  EK+ S ++ +  G+  +T     +S 
Sbjct  544   DKDEAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVSAMRVENKGSDSRTRRPSTNSK  603

Query  434   KVAKT*DVKQVACSSFASSDLGCT  363
               + T    Q+   S  S  +G T
Sbjct  604   GASTT---AQLLSGSRGSGRMGMT  624



>gb|KHG19724.1| Uncharacterized protein F383_26314 [Gossypium arboreum]
Length=621

 Score =   372 bits (956),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 276/534 (52%), Positives = 373/534 (70%), Gaps = 36/534 (7%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+RELG AQ+E K LR +E+ ++KA+EEL +E+ R+E
Sbjct  65    ITLLHGSDPVKVELNRLENEVRDKDRELGEAQAEIKALRMSERQREKAVEELTDELSRME  124

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  125   EKLKLAESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  184

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL 
Sbjct  185   EAELKLSRQEIAKLQDDNKALDRLTKSKEAALLEAERTVQVALAKASMVDDLQNKNQELM  244

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  245   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  304

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  305   ERKTLDRELARAKVTANRVATVVANEWKDSNDKVMPVKQWLEERRFLQGEMQQLRDKLAI  364

Query  1091  SERTAKAEAQlkdklklrlktLEQGL--------------KQTGNNNVNPKVLSG---FS  963
             +ERTAK+EAQLK+K +LRL+ LE+ L              +   N     + L G   FS
Sbjct  365   TERTAKSEAQLKEKYQLRLRVLEESLRGSSNSVSRSTSDGRSMSNGPSRRQSLGGADSFS  424

Query  962   KPEKANHLFGILSSKKRSAS-QPRASMVNTTseqesssensgEYNDQKK--RHHGLW--Y  798
             K      L       KRS S Q R+S+ ++T  + +   +       +   R   L+   
Sbjct  425   KLASNGFL------PKRSPSFQLRSSLSSSTVLKHAKGTSKSFDGGTRSLDRAKTLFNGS  478

Query  797   SRNKIDEKENAGMKEN---SDKLTDSGNFSKND-EDMVSGFLYDRLQKEVINMRKCFDMK  630
               N    + + G KE    S  + D  +F   D ED V G LYD LQKEVI +RK    K
Sbjct  479   GSNISFNQPSEGAKEGEAPSTAIPD--DFQPVDKEDNVPGVLYDLLQKEVIALRKAGHEK  536

Query  629   ENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY-KYDGN  471
             +  L  KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ S ++  K  GN
Sbjct  537   DQSLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVSAMRVEKEHGN  590



>gb|ACO87662.1| myosin heavy chain [Brachypodium sylvaticum]
Length=576

 Score =   371 bits (952),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 265/510 (52%), Positives = 363/510 (71%), Gaps = 19/510 (4%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             LLH +DP  +ELT L+N L  KE+ELG AQ+E + LR +E+ ++KA+E+L  E+ +++ K
Sbjct  35    LLHGSDPVRVELTRLENDLHYKEKELGDAQAEIRALRLSERAREKAVEDLTEELAKVDGK  94

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK++E+L+E KNLE KK+ +EKK AL AQ+AAEA LRRV+A QK+DD  PIE+++APLEA
Sbjct  95    LKLTESLLESKNLEAKKINDEKKAALAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEA  154

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+ + EIA LQ+D RA++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL +Q
Sbjct  155   ELKLARQEIAKLQDDNRALDRLTKSKEAALLEAERTVQIALAKASLVDDLQNKNQELMKQ  214

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILD+ +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ EE 
Sbjct  215   IEICQEENKILDRMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVLEMNEEM  274

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             +TL+RELAR KVSANRVA +VANEWKD NDKVMPVKQWLEERRILQ EMQ+L+D+LAI+E
Sbjct  275   KTLDRELARAKVSANRVAVVVANEWKDGNDKVMPVKQWLEERRILQGEMQQLRDRLAIAE  334

Query  1085  RTAKAEAQlkdklklrlktLEQGLKQ-TGNNNVNPKVLSGFSKPEKANHLFGILSSKKRS  909
             R A++EAQLKDK +LRLK LE+GL+  T   N +          E  +   G LS  KR 
Sbjct  335   RAARSEAQLKDKFQLRLKVLEEGLRMPTSRTNASAARRQSIGGAESVSKTNGFLS--KRP  392

Query  908   ASQPRASMVNTTseqesssensgEYNDQKKRH------H----GLWYSRNKIDEKENAGM  759
             + Q R+ +  TT+   + ++ + +  D   R       H    G+  S +  ++KE+   
Sbjct  393   SFQMRSPVSTTTTTLVNHAKGASKSFDGGCRSLDRYKGHVNGIGMNVSTDSSEDKESNNS  452

Query  758   KENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKK  579
              E   + T     S   ED VSG LYD LQKEV+ +RK    K+  L  KD+ ++ML KK
Sbjct  453   DEKPSEFT-----SVESEDTVSGMLYDMLQKEVVALRKACHEKDQSLKDKDDAVEMLAKK  507

Query  578   IETLTKAIEVESRKTKREAAIREKDSSTIK  489
             ++TLTKA+E E++K +RE A  EK+   ++
Sbjct  508   VDTLTKAMESEAKKMRREVAAMEKEVVAMR  537



>gb|EEC69752.1| hypothetical protein OsI_39288 [Oryza sativa Indica Group]
Length=535

 Score =   369 bits (948),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 266/496 (54%), Positives = 359/496 (72%), Gaps = 19/496 (4%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             LLH +DP  +ELT L+N+L+ KE+ELG AQ+E K LR +E+ ++KA+E+L  E+ +++ K
Sbjct  31    LLHGSDPVRVELTRLENELQYKEKELGEAQAEIKALRLSERAREKAVEDLTEELTKVDGK  90

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK++E+L+E KNLE KK+ +EKK AL AQ+AAEA LRRV+A QK+DD  PIE+++APLEA
Sbjct  91    LKLTESLLESKNLEAKKINDEKKAALAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEA  150

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+ ++EIA LQ+D RA++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL +Q
Sbjct  151   ELKLARHEIAKLQDDNRALDRLTKSKEAALLEAERTVQIALAKASLVDDLQNKNQELMKQ  210

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILD+ +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ EER
Sbjct  211   IEICQEENKILDRMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNEER  270

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             +TL+RELAR KVSANRVA +VANEWKD NDKVMPVKQWLEERRILQ EMQ+L+DKLAI+E
Sbjct  271   KTLDRELARAKVSANRVAVVVANEWKDGNDKVMPVKQWLEERRILQGEMQQLRDKLAIAE  330

Query  1085  RTAKAEAQlkdklklrlktLEQGLK-QTGNNNVNPKVLSGFSKPEKANHLFGILSSKKRS  909
             R A++EAQLKDK +LRLK LE+GL+  T   NV+          +  +   G LS  KR 
Sbjct  331   RAARSEAQLKDKFQLRLKVLEEGLRMSTTRTNVSAARRQSIGGADSLSKTNGFLS--KRP  388

Query  908   ASQPRAS-------MVNTTseqesssensgEYNDQKKRH---HGLWYSRNKIDEKENAGM  759
             + Q R+S       +VN       S +      D+ K H    G+  S +  ++KE+   
Sbjct  389   SFQMRSSVSTTTTTLVNHAKGASKSFDGGCRSLDRYKGHVNGSGMNVSTDSSEDKESNNS  448

Query  758   KENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKK  579
              E +++ T     S   ED VSG LYD LQKEVI +RK    K+  L  KD+ ++ML KK
Sbjct  449   DEKANEFT-----SVETEDTVSGLLYDTLQKEVIALRKACHEKDQSLKDKDDAVEMLAKK  503

Query  578   IETLTKAIEVESRKTK  531
             ++TLTKA+E E +K +
Sbjct  504   VDTLTKAMESEGKKMR  519



>ref|XP_004963351.1| PREDICTED: microtubule-associated protein 70-1-like [Setaria 
italica]
Length=729

 Score =   375 bits (963),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 267/502 (53%), Positives = 370/502 (74%), Gaps = 14/502 (3%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             LLH +DP  +ELT L+N+L+ KE+ELG AQ+E K LR +++ ++KA+++L  E+ +++EK
Sbjct  189   LLHGSDPVRVELTRLENELQYKEKELGDAQAEIKALRLSDRAREKAVQDLTEELAKVDEK  248

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK++E+L+E KNLE KK+ +EKK AL AQ+AAEA LRRV+A QK+DD  PIE+++APLEA
Sbjct  249   LKLTESLLETKNLEAKKINDEKKAALAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEA  308

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+ + EIA LQ+D RA++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL +Q
Sbjct  309   ELKLARQEIAKLQDDNRALDRLTKSKEAALLEAERTVQIALAKASLVDDLQNKNQELMKQ  368

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILD+ +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ EE 
Sbjct  369   IEICQEENKILDRMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNEEM  428

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             +TL+RELAR KVSANRVA +VANEWKD NDKVMPVKQWL++RRILQ EMQ+L+DKLAI+E
Sbjct  429   KTLDRELARAKVSANRVAVVVANEWKDGNDKVMPVKQWLDQRRILQGEMQQLRDKLAIAE  488

Query  1085  RTAKAEAQlkdklklrlktLEQGLK-QTGNNNVNP---KVLSGFSKPEKANHLFGILSSK  918
             R A++EAQLK+K +LRLK LE+GL+  T   NV+    + + G     KAN   G LS  
Sbjct  489   RAARSEAQLKEKFQLRLKVLEEGLRMSTSRTNVSTTRRQSIGGADGLSKAN---GFLS--  543

Query  917   KRSASQPRASMVNTTseqesssensgEYNDQKK---RHHGLWYSRNKIDEKENAGMKENS  747
             KR + Q R+S+  TT+    +   S  ++   +   R+ GL          +++  KE+S
Sbjct  544   KRPSFQMRSSVSTTTTLVNHAKGASKSFDGGCRSLERYKGLVNGNGMNVSTDSSEDKESS  603

Query  746   DKLTDSGNF-SKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIET  570
             +       F S   ED+VSG LYD +QKEVI +RK    K+  L  KD+ ++ML KK++T
Sbjct  604   NSDEKCNEFASAESEDLVSGALYDFVQKEVIALRKACHEKDQSLKDKDDAVEMLAKKVDT  663

Query  569   LTKAIEVESRKTKREAAIREKD  504
             LTKA+E E++K++RE A  EK+
Sbjct  664   LTKAMESEAKKSRRELAAMEKE  685



>ref|XP_009610620.1| PREDICTED: microtubule-associated protein 70-2-like [Nicotiana 
tomentosiformis]
Length=622

 Score =   372 bits (954),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 267/526 (51%), Positives = 369/526 (70%), Gaps = 26/526 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  LEL  L+N++++K+REL  AQ E K LR +E+L++KA+EEL +E+ R+ 
Sbjct  59    MNLLHGSDPVKLELNRLENEVRDKDRELSEAQVEIKALRLSERLREKAVEELTDELSRVY  118

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  119   EKLKLTESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  178

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAALL+AER ++SAL +  +V+++QN+N EL 
Sbjct  179   EAELKLARQEIAKLQDDNKALDRLTKSKEAALLDAERTVQSALAKASMVDDLQNKNQELM  238

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILD+ +RQKV EVE+L+Q++ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  239   KQIEICQEENKILDRMHRQKVAEVEKLTQSVRELEEAVLAGGAAANAVRDYQRKVQEMNE  298

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR+LQ EMQ+L+DKLAI
Sbjct  299   ERKTLDRELARAKVTANRVATVVANEWKDANDKVMPVKQWLEERRVLQGEMQQLRDKLAI  358

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGN-NNVNPKVLSGFSKPEKANHLFGI-----  930
             +ERTAK+EA LK+K +LRLK LE+ L+ +       P   S  + P +   L G      
Sbjct  359   TERTAKSEAMLKEKYQLRLKVLEETLRSSSTAARSTPDGRSSSNGPSRRQSLSGAESISK  418

Query  929   LSS----KKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGL---------WYSRN  789
             L+S     KRS S    S V++T  + +   +       +    G          + S  
Sbjct  419   LTSNGFLPKRSPSFQLRSSVSSTVLKHAKGTSKSFDGGSRSLDRGKKLLNVTGPNFNSSK  478

Query  788   KID-----EKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKEN  624
              +D     E E+   K N D+   +G      ED V G LYD LQKEV+++RK    K+ 
Sbjct  479   SVDGAKDSETESTSWKANQDE-KPTGLPVSEPEDTVPGLLYDLLQKEVVSLRKAGHEKDQ  537

Query  623   DLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
              L  KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++ 
Sbjct  538   SLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRV  583



>ref|XP_006292757.1| hypothetical protein CARUB_v10019005mg [Capsella rubella]
 gb|EOA25655.1| hypothetical protein CARUB_v10019005mg [Capsella rubella]
Length=628

 Score =   372 bits (955),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 262/532 (49%), Positives = 370/532 (70%), Gaps = 22/532 (4%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N +++K+REL  +Q+E K LR +E+ ++KA+EEL  E+ ++ 
Sbjct  65    ITLLHGSDPVKIELNRLENDVRDKDRELSESQAEIKALRLSERQREKAVEELTEELGKMS  124

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++ENL++ KNLE KK+  EK+ ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  125   EKLKLTENLLDSKNLEIKKINEEKRASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  184

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQ+D RA++R  KSKEAALL+AER ++SAL +  +V+++QN+N EL 
Sbjct  185   EAELKLARHEIVKLQDDNRALDRLTKSKEAALLDAERTVQSALAKASMVDDLQNKNQELM  244

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEEN+ILDK +RQKV EVE+ +QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  245   KQIEICQEENRILDKLHRQKVAEVEKFTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNE  304

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ERR L+REL+R KVSA+RVAT+VANEWKD +DKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  305   ERRVLDRELSRAKVSASRVATVVANEWKDGSDKVMPVKQWLEERRFLQGEMQQLRDKLAI  364

Query  1091  SERTAKAEAQlkdklklrlktLEQGLK--QTGNNNVNPKVLSGFSKPEKANHLFGI----  930
             ++R AK+EAQLK+K +LRL+ LE+ L+   +  N   P+  S  + P +   L G     
Sbjct  365   ADRAAKSEAQLKEKFQLRLRVLEESLRGPPSSGNRSTPEGRSISNGPSRRQSLGGADIIP  424

Query  929   ------LSSKKRSASQPRASMVNTTseqesssensgEYNDQKK---RHHGLW------YS  795
                     SKK  +SQ R+   +T++  + +   S  ++   +   R   L       + 
Sbjct  425   KLTSNGFFSKKTPSSQFRSLNASTSTILKHAKGTSRSFDGGSRSLDRSKLLTNEPRSKFP  484

Query  794   RNKIDEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLN  615
              N+  E +N G   NS K  +S   +  + D V G L+D LQKEVI +RK    K+  L 
Sbjct  485   VNQSSEGKNGGESPNSTKQEESEKVAATNNDSVPGVLHDLLQKEVITLRKAAHDKDQSLR  544

Query  614   TKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQT  459
              KDE I+ML KK+ETLTKA+EVE++K +RE A  EK+ S ++    G+  +T
Sbjct  545   DKDEAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVSAMRVDNKGSDSRT  596



>ref|XP_009113829.1| PREDICTED: LOW QUALITY PROTEIN: microtubule-associated protein 
70-2-like [Brassica rapa]
Length=626

 Score =   372 bits (954),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 269/537 (50%), Positives = 374/537 (70%), Gaps = 31/537 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             +  LH +DP  +EL  L+N++++K+RELG A +E K LR +E+ ++KA+EEL  E+ +L+
Sbjct  60    ITQLHGSDPVKVELNRLENEVRDKDRELGEAHAEIKALRLSERQREKAVEELTEELAKLD  119

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E++++ KNLE KK+  EKK ++  Q+AAEA LRRV+A QK+DD  PIE+++ PL
Sbjct  120   EKLKLTESILQTKNLEIKKINEEKKASMATQFAAEATLRRVHAAQKDDDMPPIEAILXPL  179

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQED RA++R  KSKEAALL+AER ++ AL +  +V+++QN+N EL 
Sbjct  180   EAELKLARSEIGKLQEDNRALDRLTKSKEAALLDAERTIEGALAKAAMVDDLQNKNQELM  239

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  240   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNE  299

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  300   ERKTLDRELARAKVTANRVATVVANEWKDGNDKVMPVKQWLEERRFLQGEMQQLRDKLAI  359

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILS----  924
             ++R AK+EAQLK+K +LRLK LE+ L+ T + N  P+  S  + P       G       
Sbjct  360   TDRAAKSEAQLKEKFQLRLKVLEETLRGTSSRNT-PEARSMSNGPTSRRQSLGGSDNLQK  418

Query  923   -------SKKRSASQPRASM-VNTTseqesssensgEYNDQKK---RHHGLW-----YSR  792
                    SKK   SQ R S+ +N+TS  +++   S  ++   +   R   L      YS 
Sbjct  419   FPSNGSFSKKAPVSQMRHSLSINSTSVLKNAKGTSKSFDGGTRSLDRGKALLNGPGNYSF  478

Query  791   NKIDEKENA--------GMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFD  636
             NK    + A        G KE S++   S N +   ED V G LYD LQKEV+++RK   
Sbjct  479   NKPASDDAAKEPELAANGWKETSEEKPQSENPAAT-EDSVPGVLYDLLQKEVVSLRKASH  537

Query  635   MKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIR  465
              K+  L  KD+ I+ML KK+ETLTKA+EVE++K +RE +  EK+ + ++ + D + R
Sbjct  538   EKDQSLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVSAMEKEVAAMRVEKDQDNR  594



>ref|XP_003575438.1| PREDICTED: microtubule-associated protein 70-1 [Brachypodium 
distachyon]
Length=576

 Score =   370 bits (949),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 264/514 (51%), Positives = 365/514 (71%), Gaps = 19/514 (4%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             LLH +DP  +ELT L+N L  KE+ELG AQ+E + LR +E+ ++KA+E+L  E+ +++ K
Sbjct  35    LLHGSDPVRVELTRLENDLHYKEKELGDAQAEIRALRLSERAREKAVEDLTEELAKVDGK  94

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK++E+L+E KNLE KK+ +EKK AL AQ+AAEA LRRV+A Q++DD  PIE+++APLEA
Sbjct  95    LKLTESLLESKNLEAKKINDEKKAALAAQFAAEATLRRVHAAQRDDDMPPIEAILAPLEA  154

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             ++K+ + EIA LQ+D RA++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL +Q
Sbjct  155   DLKLARQEIAKLQDDNRALDRLTKSKEAALLEAERTVQIALAKASLVDDLQNKNQELVKQ  214

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILD+ +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ EE 
Sbjct  215   IEICQEENKILDRMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNEEM  274

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             +TL+RELAR KVSANRVA +VANEWKD NDKVMPVKQWLEERRILQ EMQ+L+D+LAI+E
Sbjct  275   KTLDRELARAKVSANRVAVVVANEWKDGNDKVMPVKQWLEERRILQGEMQQLRDRLAIAE  334

Query  1085  RTAKAEAQlkdklklrlktLEQGLKQ-TGNNNVNPKVLSGFSKPEKANHLFGILSSKKRS  909
             R A++EAQLKDK +LRLK LE+GL+  T   N +          E  +   G LS  KR 
Sbjct  335   RAARSEAQLKDKFQLRLKVLEEGLRMPTSRTNASAARRQSIGGAESVSKTNGFLS--KRP  392

Query  908   ASQPRASMVNTTseqesssensgEYNDQKKRH------H----GLWYSRNKIDEKENAGM  759
             + Q R+ +  TT+   + ++ + +  D   R       H    G+  S +  ++KE+   
Sbjct  393   SFQMRSPVSTTTTTLVNHAKGASKSFDGGCRSLDRYKGHVNGIGMNVSTDSSEDKESNNS  452

Query  758   KENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKK  579
              E   + T     S   ED VSG LYD LQKEV+ +RK    K+  L  KD+ ++ML KK
Sbjct  453   DEKPSEFT-----SVESEDTVSGMLYDMLQKEVVALRKACHEKDQSLKDKDDAVEMLAKK  507

Query  578   IETLTKAIEVESRKTKREAAIREKDSSTIKYKYD  477
             ++TLTKA+E E++K +RE A  EK+   ++ + D
Sbjct  508   VDTLTKAMESEAKKMRREVAAMEKEVVAMRLEKD  541



>emb|CDX84971.1| BnaC05g20840D [Brassica napus]
Length=615

 Score =   371 bits (952),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 267/529 (50%), Positives = 371/529 (70%), Gaps = 25/529 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             +  LH +DP  +EL  L+N++++K+RELG A +E K LR +E+ ++KA+EEL  E+ +L+
Sbjct  59    ITQLHGSDPVKVELNRLENEVRDKDRELGEAHAEIKALRLSERQREKAVEELTEELAKLD  118

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E++++ KNLE KK+  EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  119   EKLKLTESILQTKNLEIKKINEEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  178

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQED RA++R  KSKEAALL+AER ++ AL +  +V+++QN+N EL 
Sbjct  179   EAELKLARSEIGKLQEDNRALDRLTKSKEAALLDAERTIEGALAKAAMVDDLQNKNQELM  238

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  239   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNE  298

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  299   ERKTLDRELARAKVTANRVATVVANEWKDGNDKVMPVKQWLEERRFLQGEMQQLRDKLAI  358

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILS----  924
             ++R AK+EAQLK+K +LRLK LE+ L+ T ++   P+  S  + P       G       
Sbjct  359   TDRAAKSEAQLKEKFQLRLKVLEETLRGTSSSRNTPEARSMSNGPTSRRQSLGGSDNLQK  418

Query  923   -------SKKRSASQPRASM-VNTTseqesssensgEYNDQKK---RHHGLW-----YSR  792
                    SKK   SQ R S+ +N+TS  +++   S  ++   +   R   L      YS 
Sbjct  419   FPSNGAFSKKAPVSQMRHSLSINSTSVLKNAKGTSKSFDGGTRSLDRGKALLNGPGNYSF  478

Query  791   NKIDEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNT  612
             NK     +   KE   +L  +G      ED V G LYD LQKEV ++RK    K+  L  
Sbjct  479   NK--PASDDATKE--PELAANGENPAATEDSVPGVLYDLLQKEVASLRKASHEKDQSLKD  534

Query  611   KDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIR  465
             KD+ I+ML KK+ETLTKA+EVE++K +RE +  EK+ + ++ + D + R
Sbjct  535   KDDAIEMLAKKVETLTKAMEVEAKKMRREVSAMEKEVAAMRVEKDQDNR  583



>ref|XP_002438163.1| hypothetical protein SORBIDRAFT_10g009020 [Sorghum bicolor]
 gb|EER89530.1| hypothetical protein SORBIDRAFT_10g009020 [Sorghum bicolor]
Length=606

 Score =   370 bits (950),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 273/553 (49%), Positives = 379/553 (69%), Gaps = 36/553 (7%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + L+H +DP  +ELT L+N+L++KERELG AQ+E + LR +E+ ++KA+EEL +E++++ 
Sbjct  33    IALMHGSDPVRVELTRLENELRDKERELGEAQTEIRALRLSERAREKAVEELTDELEKMA  92

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L+E KNLE KK+ +EKK AL AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  93    EKLKLTESLLESKNLEVKKINDEKKAALAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  152

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D RA++R  K KEAALLEAER ++ A+ +  +V+++QN+N EL 
Sbjct  153   EAELKLSRQEIAKLQDDNRALDRLTKQKEAALLEAERTVQIAMAKAAMVDDLQNKNQELI  212

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEIC EENKILDK +RQK+ EVE+LSQT+ ELEEA+L GGA AN +RDY+R+  EI E
Sbjct  213   KQIEICHEENKILDKLHRQKIAEVEKLSQTVRELEEAVLQGGATANVVRDYQRRFQEINE  272

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             E+RTL+RELAR KV+ANRVA++VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLA+
Sbjct  273   EKRTLDRELARAKVTANRVASVVANEWKDSNDKVMPVKQWLEERRFLQGEMQQLRDKLAV  332

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLS-GFS-KPEKANHLF------  936
             +ERTA++EAQLK+K +LRLK LE GL+   + +  P      FS  P +   L       
Sbjct  333   AERTARSEAQLKEKYQLRLKVLEDGLRGPPSGSSRPPTEGKSFSNGPSRRLSLGGADNIS  392

Query  935   -----GILSSKKRSASQPRASMVNTTseqesssensgEYN------DQKKRH----HGLW  801
                  G+LS +  S     +   N++   + +   S  ++      D+ K H    H L 
Sbjct  393   KLSPNGLLSRRSPSFHSRSSLSSNSSLVLKHAKGTSKSFDGGTRSLDRGKVHGNGAHLLN  452

Query  800   YSRNKIDEKE-NAGMKENSDKLTDSGNFSKNDE-----------DMVSGFLYDRLQKEVI  657
              S + + +KE N   K + D+ T+    S  DE           + VSGFLYD LQKEVI
Sbjct  453   RSTDAVRDKETNDSWKGDMDERTNDSAVSNADEKSNEATNNNSAETVSGFLYDMLQKEVI  512

Query  656   NMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYD  477
             ++RK    K+  L  KD+ I+ML KK++TLTKA+EVE++K +RE A  EK+ + ++   +
Sbjct  513   SLRKTCHEKDQILKDKDDAIEMLAKKVDTLTKAMEVEAKKVRREVAAMEKEVAAMRASKE  572

Query  476   GNIRQTNSSLKSS  438
               IR      K S
Sbjct  573   QEIRAKRLGTKGS  585



>emb|CDY51769.1| BnaC05g49520D [Brassica napus]
Length=602

 Score =   370 bits (949),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 262/555 (47%), Positives = 375/555 (68%), Gaps = 43/555 (8%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N+L++K+REL  AQ+E K L+ +E+ ++KA+EEL +E+ ++ 
Sbjct  42    ITLLHGSDPVRIELNRLENELRDKDRELSEAQAEIKALKLSERQREKAVEELTDELGKMS  101

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
              KLK+ ENL+E KNLE KK+  EKK ++ AQ+AAEA+LRRV+A QK+DD  PIE+++APL
Sbjct  102   AKLKLIENLLETKNLEIKKINEEKKASMAAQFAAEASLRRVHAAQKDDDMPPIEAILAPL  161

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EI  LQ+D ++++R  KSKEAALL+AER ++SAL +  +V+++QN+N EL 
Sbjct  162   EAELKLARQEIVKLQDDNKSLDRLTKSKEAALLDAERTVQSALAKASMVDDLQNKNQELM  221

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEEN+I+DK +RQKV EVE+L Q++ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  222   KQIEICQEENRIIDKMHRQKVAEVEKLMQSVRELEEAVLAGGAAANAVRDYQRKFQEMNE  281

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+ LERELAR KV+ANRVAT+VANEWKD ND+VMPV+QWLEERR +Q EMQ+L+DKLAI
Sbjct  282   ERKILERELARAKVNANRVATVVANEWKDSNDQVMPVRQWLEERRFMQGEMQQLRDKLAI  341

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILSSKK-  915
             ++R AK+EAQLK+K  LRL+ LE+ LK+  N    P V S  + P +   L G  +S K 
Sbjct  342   ADRAAKSEAQLKEKFLLRLRVLEESLKKPSNRGT-PVVRSSSNGPTRRQSLVGAETSPKY  400

Query  914   ----------RSASQPRASMVNTTseqesssensgEYNDQKKR-----------------  816
                       R +SQPR++  + ++  + +   S  ++   +                  
Sbjct  401   SSSNGSVTKSRPSSQPRSATASASTVLKHARGTSSSFDGGTRSLDRNKVLMNRPGSKFPS  460

Query  815   -HHGLWYSRNKIDEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCF  639
              HH       +++   +  ++E+ DK TD+        D V G LYD LQKEVI +RK  
Sbjct  461   NHHS-SEGATRVESPSSIKVEESDDKSTDN--------DSVPGVLYDLLQKEVITLRKAA  511

Query  638   DMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTI---KYKYDGNI  468
               K+  L  KD+ I+ML KK+ETLTKA+EVE++K +RE A+  K+ + +   K   D   
Sbjct  512   HEKDQSLRDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAVMGKEVAAMRVDKGHQDSKT  571

Query  467   RQTNSSLKSSIKVAK  423
             R+ +S  K S   A+
Sbjct  572   RRISSISKGSSNTAQ  586



>ref|XP_009390353.1| PREDICTED: microtubule-associated protein 70-1-like [Musa acuminata 
subsp. malaccensis]
Length=621

 Score =   370 bits (950),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 268/527 (51%), Positives = 373/527 (71%), Gaps = 35/527 (7%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             LLH +DP  +EL  L+N++++K+REL  A +E K LR +E+ +++A+EEL  E+ +L+EK
Sbjct  64    LLHGSDPVKVELNRLENEVRDKDRELSEAHAEIKALRLSERARERAVEELTEELTKLDEK  123

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK++E+L+E +NLE KK+ +EKK AL AQ+AAEA LRRV+A QK+DD  PIE+++APLEA
Sbjct  124   LKLTESLLESRNLEIKKINDEKKAALAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEA  183

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+ + EIA LQ+D RA++R  KSKEAALL+AER ++ AL +  +V+++QN+N EL +Q
Sbjct  184   ELKLARQEIAKLQDDNRALDRLTKSKEAALLDAERTVQIALAKASLVDDLQNKNQELMKQ  243

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILDK +RQKV EVE+LSQT+ ELEEA+LAGGAAAN +RDY+R++ E+ EE 
Sbjct  244   IEICQEENKILDKMHRQKVAEVEKLSQTVRELEEAVLAGGAAANAVRDYQRKVQEMSEEM  303

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             +TL+REL+R KV+ANRVA +VANEWKD NDKVMPVKQWLEERR +Q EMQ+L+DKLAISE
Sbjct  304   KTLDRELSRAKVTANRVAVVVANEWKDANDKVMPVKQWLEERRFMQGEMQQLRDKLAISE  363

Query  1085  RTAKAEAQlkdklklrlktLEQGLKQ--TGNNNVNPK---VLSGFSK----------PEK  951
             RTA++EAQLK+K  LRLK LE GL+   +G N +N +   V +G S+          P+ 
Sbjct  364   RTARSEAQLKEKFHLRLKVLEDGLRMSASGTNRINVEGKNVSNGPSRRQSLGGADNIPKS  423

Query  950   ANHLFGILSSKKRSASQPRASMVNTTseqesssensgEYNDQKK--RHHGLWYSRNKIDE  777
             AN   G LS  +R + Q R+S+ ++T  + +   +       +   R   L      +  
Sbjct  424   AN---GFLS--RRPSFQMRSSISSSTVLKHAKGASKSFDGGTRSLDRSKALLNGAGLLLN  478

Query  776   KENAGMKEN----------SDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKE  627
             K +   ++N           DK T+  N   + +D VSG LYD LQKEVI++RK    K+
Sbjct  479   KSSDATRDNVLQNSWKENPDDKTTEFPNV--DADDCVSGLLYDMLQKEVISLRKACHEKD  536

Query  626   NDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
               L  KD+ I+ML KK++TLTKA+EVE++K +RE A  EK+ + I+ 
Sbjct  537   QSLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREVAAMEKEVAAIRV  583



>ref|XP_009109859.1| PREDICTED: microtubule-associated protein 70-2 isoform X1 [Brassica 
rapa]
 ref|XP_009109860.1| PREDICTED: microtubule-associated protein 70-2 isoform X1 [Brassica 
rapa]
Length=611

 Score =   370 bits (949),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 264/510 (52%), Positives = 367/510 (72%), Gaps = 25/510 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             +  LH +DP  +EL  L+N++++K+RELG A +E K LR +E+ ++KA+EE   E+ +L+
Sbjct  59    ITQLHGSDPVKVELNRLENEVRDKDRELGEAHAEIKALRLSERQREKAVEEHTEELAKLD  118

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E++++ KNLE KK+  EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  119   EKLKLTESILQSKNLEIKKINEEKKASMAAQFAAEATLRRVHAAQKDDDIPPIEAILAPL  178

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQED RA++R  KSKEAALL+AER ++ AL +  +V+++QN+N EL 
Sbjct  179   EAELKLARSEIGKLQEDNRALDRLTKSKEAALLDAERTIEGALAKAALVDDLQNKNQELM  238

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV +VE+L+QT+ ELEEA+LAGGAAAN +RDY R+  E+ E
Sbjct  239   KQIEICQEENKILDKMHRQKVADVEKLTQTVRELEEAVLAGGAAANAVRDYERKFQEMNE  298

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  299   ERKTLDRELARAKVTANRVATVVANEWKDGNDKVMPVKQWLEERRFLQGEMQQLRDKLAI  358

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNV--NPKVLSGFSKPEKANHLFGILS--  924
             ++R AK+EAQLK+K +LRLK LE+ LK T ++++    +  +  S+P +   L G  +  
Sbjct  359   TDRAAKSEAQLKEKFQLRLKVLEETLKGTSSSSIRNTSETRTMSSEPSRRQSLGGSENLQ  418

Query  923   --------SKKRSASQPRASM-VNTTseqesssensgEYNDQKK---RHHGLW-----YS  795
                     SKK  ASQ R S+ +N+TS  ++S   S  ++   +   R   L      YS
Sbjct  419   KIPANGALSKKAPASQMRHSLSINSTSMLKNSKGTSTSFDGGTRSLDRGKALLNGPGNYS  478

Query  794   RNKIDEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLN  615
              NK  ++     +  S++ T S N     ED V G LYD LQKEV+++RK    K+  L 
Sbjct  479   FNKASDESK---EPESEETTQSENTPAASEDSVPGVLYDLLQKEVVSLRKASHEKDQSLK  535

Query  614   TKDEEIKMLTKKIETLTKAIEVESRKTKRE  525
              KD+ I+ML KK+ETLTKA+EVE++K +RE
Sbjct  536   DKDDAIEMLAKKVETLTKAMEVEAKKMRRE  565



>ref|XP_009109861.1| PREDICTED: microtubule-associated protein 70-2 isoform X2 [Brassica 
rapa]
Length=594

 Score =   369 bits (947),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 264/507 (52%), Positives = 366/507 (72%), Gaps = 25/507 (5%)
 Frame = -3

Query  1979  LH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKL  1803
             LH +DP  +EL  L+N++++K+RELG A +E K LR +E+ ++KA+EE   E+ +L+EKL
Sbjct  62    LHGSDPVKVELNRLENEVRDKDRELGEAHAEIKALRLSERQREKAVEEHTEELAKLDEKL  121

Query  1802  KISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAE  1623
             K++E++++ KNLE KK+  EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APLEAE
Sbjct  122   KLTESILQSKNLEIKKINEEKKASMAAQFAAEATLRRVHAAQKDDDIPPIEAILAPLEAE  181

Query  1622  IKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQI  1443
             +K+ ++EI  LQED RA++R  KSKEAALL+AER ++ AL +  +V+++QN+N EL +QI
Sbjct  182   LKLARSEIGKLQEDNRALDRLTKSKEAALLDAERTIEGALAKAALVDDLQNKNQELMKQI  241

Query  1442  EICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeerr  1263
             EICQEENKILDK +RQKV +VE+L+QT+ ELEEA+LAGGAAAN +RDY R+  E+ EER+
Sbjct  242   EICQEENKILDKMHRQKVADVEKLTQTVRELEEAVLAGGAAANAVRDYERKFQEMNEERK  301

Query  1262  tlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISER  1083
             TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI++R
Sbjct  302   TLDRELARAKVTANRVATVVANEWKDGNDKVMPVKQWLEERRFLQGEMQQLRDKLAITDR  361

Query  1082  TAKAEAQlkdklklrlktLEQGLKQTGNNNV--NPKVLSGFSKPEKANHLFGILS-----  924
              AK+EAQLK+K +LRLK LE+ LK T ++++    +  +  S+P +   L G  +     
Sbjct  362   AAKSEAQLKEKFQLRLKVLEETLKGTSSSSIRNTSETRTMSSEPSRRQSLGGSENLQKIP  421

Query  923   -----SKKRSASQPRASM-VNTTseqesssensgEYNDQKK---RHHGLW-----YSRNK  786
                  SKK  ASQ R S+ +N+TS  ++S   S  ++   +   R   L      YS NK
Sbjct  422   ANGALSKKAPASQMRHSLSINSTSMLKNSKGTSTSFDGGTRSLDRGKALLNGPGNYSFNK  481

Query  785   IDEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKD  606
               ++     +  S++ T S N     ED V G LYD LQKEV+++RK    K+  L  KD
Sbjct  482   ASDESK---EPESEETTQSENTPAASEDSVPGVLYDLLQKEVVSLRKASHEKDQSLKDKD  538

Query  605   EEIKMLTKKIETLTKAIEVESRKTKRE  525
             + I+ML KK+ETLTKA+EVE++K +RE
Sbjct  539   DAIEMLAKKVETLTKAMEVEAKKMRRE  565



>ref|NP_001159233.1| hypothetical protein [Zea mays]
 gb|ACN25533.1| unknown [Zea mays]
 gb|AFW85149.1| hypothetical protein ZEAMMB73_229044 [Zea mays]
Length=606

 Score =   369 bits (948),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 267/536 (50%), Positives = 375/536 (70%), Gaps = 36/536 (7%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + L+H +DP  +ELT L+N+L++KERELG AQ+E + LR +E+ ++KA+EEL +E++++ 
Sbjct  33    MALMHGSDPVRVELTRLENELRDKERELGEAQTEIRALRLSERAREKAVEELTDELEKMA  92

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L+E KNLE KK+ +E+K AL AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  93    EKLKLTESLLESKNLEVKKINDERKAALAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  152

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D RA++R  K KEAALLEAER ++ A+ +  +V+++QN+N EL 
Sbjct  153   EAELKLSRQEIANLQDDNRALDRLTKQKEAALLEAERTVQIAMAKAAMVDDLQNKNQELI  212

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEIC EENKILDK +RQK+ EVE+LSQT+ ELEEA+L GGA AN +RDY+R+  EI E
Sbjct  213   KQIEICHEENKILDKLHRQKIAEVEKLSQTVRELEEAVLQGGATANVVRDYQRRFQEINE  272

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             E+RTL+RELAR KV+ANRVA++VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLA+
Sbjct  273   EKRTLDRELARAKVTANRVASVVANEWKDSNDKVMPVKQWLEERRFLQGEMQQLRDKLAV  332

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLS-GFS-KPEKANHLF------  936
             +ERTA++EAQLK+K +LRLK LE GL+   + +  P      FS  P +   L       
Sbjct  333   AERTARSEAQLKEKYQLRLKVLEDGLRGPPSGSSRPTTEGKSFSNGPSRRLSLGGADNIS  392

Query  935   -----GILSSKKRSASQPRASMVNTTseqesssensgEYN------DQKKRH----HGLW  801
                  G+LS +  S     + + N++   + +   S  ++      D+ K H    H L 
Sbjct  393   KLSPNGLLSRRSPSFHSRSSLLSNSSLVLKHAKGTSKSFDGGTRSLDRGKIHGSGAHLLN  452

Query  800   YSRNKIDEKEN-----AGMKENSDKLTDSG-------NFSKNDEDMVSGFLYDRLQKEVI  657
              S + + +KE        M E +++  D+          +KN  + VSGFLYD LQKEVI
Sbjct  453   RSTDAVRDKETSDSWKGDMDERTNERADNNTDEKSNETTNKNSAETVSGFLYDMLQKEVI  512

Query  656   NMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIK  489
             ++RK    K+  L  KD+ I+ML KK++TLTKA+EVE+RK +RE A  EK+ + ++
Sbjct  513   SLRKSCHEKDQILKDKDDAIEMLAKKVDTLTKAMEVEARKVRREVAAMEKEVAAMR  568



>ref|XP_010424947.1| PREDICTED: microtubule-associated protein 70-3 isoform X1 [Camelina 
sativa]
Length=630

 Score =   370 bits (949),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 266/564 (47%), Positives = 382/564 (68%), Gaps = 26/564 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N +++K+REL  +Q+E K LR +E+ ++KA+EEL  E+ ++ 
Sbjct  67    ITLLHGSDPVKIELNRLENDVRDKDRELSESQAEIKALRLSERQREKAVEELTEELGKMS  126

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++ENL++ KNLE KK+  EK+ ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  127   EKLKLTENLLDSKNLEIKKINEEKRASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  186

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQ+D RA++R  KSKEAALL+AER ++SAL +  +V+++QN+N EL 
Sbjct  187   EAELKLARHEIVKLQDDNRALDRLTKSKEAALLDAERTVQSALAKASMVDDLQNKNQELM  246

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEEN+ILD+ +RQKV EVE+ +QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  247   KQIEICQEENRILDRMHRQKVAEVEKFTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNE  306

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ERR L+RELAR KVSA+RVAT+VANEWKD +DKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  307   ERRVLDRELARAKVSASRVATVVANEWKDGSDKVMPVKQWLEERRFLQGEMQQLRDKLAI  366

Query  1091  SERTAKAEAQlkdklklrlktLEQGLK--QTGNNNVNPKVLSGFSKPEKANHLFGI----  930
             ++R AK+EAQLK+K +LRL+ LE+ L+   +G N   P+  S  + P +   + G     
Sbjct  367   ADRAAKSEAQLKEKFQLRLRVLEESLRGPPSGGNRSTPEGRSISNGPSRRQSIGGADIIP  426

Query  929   ------LSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHG---------LWYS  795
                     SK+  +SQ R+   +T++  + +   S  ++   +   G           + 
Sbjct  427   KLTSNGFFSKRTPSSQFRSLNASTSTILKHAKGTSRSFDGGSRSLDGSKLLTNEPRSKFP  486

Query  794   RNKIDEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLN  615
              N+  E ++     NS K  +S   + N+ D V G L+D LQKEV+ +RK    K+  L 
Sbjct  487   VNQSSEGKSGDESPNSTKQGESDKAAANN-DSVPGVLHDLLQKEVVTLRKASHDKDQSLR  545

Query  614   TKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQTNSSLKSSI  435
              KDE I+ML KK+ETLTKA+EVE++K +RE A  EK+ S ++    G+  +T     ++ 
Sbjct  546   DKDEAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVSAMRVDNKGSDSRTRRP-STNA  604

Query  434   KVAKT*DVKQVACSSFASSDLGCT  363
             K A T    Q+   S  S  +G T
Sbjct  605   KGAST--TAQLLSGSRGSGRMGMT  626



>ref|XP_006301058.1| hypothetical protein CARUB_v10021451mg [Capsella rubella]
 gb|EOA33956.1| hypothetical protein CARUB_v10021451mg [Capsella rubella]
Length=614

 Score =   369 bits (948),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 271/535 (51%), Positives = 375/535 (70%), Gaps = 22/535 (4%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+REL  A +E K LR +E+ ++KA EEL +E+ +L+
Sbjct  53    ITLLHGSDPVKVELNRLENEVRDKDRELSEAHAEIKALRLSERQREKACEELTDELAKLD  112

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
              KLK++E+L++ KNLE KK+  EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  113   GKLKLTESLLQSKNLEIKKINEEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  172

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQED RA++R  KSKEAALL+AER +++AL +  +V+++QN+N EL 
Sbjct  173   EAELKLARSEIGKLQEDNRALDRLTKSKEAALLDAERTVETALAKAALVDDLQNKNQELM  232

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILD+ +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  233   KQIEICQEENKILDRMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNE  292

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  293   ERKTLDRELARAKVTANRVATVVANEWKDGNDKVMPVKQWLEERRFLQGEMQQLRDKLAI  352

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNV--NPKVLSGFSKPEKANHLFG-----  933
             S+R AK+EAQLKDK +LRLK LE+ L+ T +++    P+  S  + P +   L G     
Sbjct  353   SDRAAKSEAQLKDKFQLRLKVLEETLRGTSSSSFRSTPEGRSMSNGPSRRQSLSGSDNLQ  412

Query  932   -ILSSKKRSASQPRASMVNTTseqesssensgEYNDQKK---RHHGLW-----YSRNK-I  783
                S+   S   P  +  N+TS  +++   S  ++   +   R   L      YS NK  
Sbjct  413   KFASNGFLSKKTPMRNSFNSTSVLKNAKGTSKSFDGGTRSLDRGKALLNGPGNYSFNKAC  472

Query  782   DEKENA----GMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLN  615
             DE +        KENS++   S   +   ED V G LYD LQKEV+ +RK    K+  L 
Sbjct  473   DEPKEPESPNTWKENSEEKPPSELPAPTTEDNVPGVLYDLLQKEVVALRKSSHEKDQSLK  532

Query  614   TKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQTNSS  450
              KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++   D + R   SS
Sbjct  533   DKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRVDKDQDNRAKRSS  587



>ref|XP_010926101.1| PREDICTED: microtubule-associated protein 70-1-like [Elaeis guineensis]
Length=626

 Score =   370 bits (949),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 273/530 (52%), Positives = 381/530 (72%), Gaps = 32/530 (6%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             +LH +DP  +EL+ L+N++++K+RELG AQ+E K L+ +E+ ++KA+EEL  E+ + + K
Sbjct  65    MLHGSDPVRVELSRLENEVRDKDRELGEAQAEIKALKLSERAREKAVEELTEELAKADGK  124

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK++E+L+E KNLE KK+ +EKK AL AQ+AAEA LRRV+A QK+DD  PIE+++APLEA
Sbjct  125   LKLTESLLENKNLEVKKINDEKKAALAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEA  184

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+ + EIA LQ+D RA++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL +Q
Sbjct  185   ELKLARQEIAKLQDDNRALDRLTKSKEAALLEAERTVQIALAKASMVDDLQNKNQELMKQ  244

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILDK +RQKV EVE+LSQT+ ELEEA+LAGGAAAN +RDY+R++ E+ EE 
Sbjct  245   IEICQEENKILDKMHRQKVAEVEKLSQTVKELEEAVLAGGAAANVVRDYQRKVQEMNEEM  304

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             +TL+RELAR KV+ANRVA +VANEWKD NDKVMPV+QWLEERR LQ EMQ+L+DKLAI+E
Sbjct  305   KTLDRELARAKVTANRVAVVVANEWKDANDKVMPVRQWLEERRFLQGEMQQLRDKLAIAE  364

Query  1085  RTAKAEAQlkdklklrlktLEQGLKQT--GNNNVNPKVLSGFSKPEK------ANHLF--  936
             RTA++EAQLK+K +LRLK LE+GL+ +  G+N  N +  S  + P +      A ++F  
Sbjct  365   RTARSEAQLKEKYQLRLKVLEEGLRMSANGSNRTNVEGRSVSNGPSRRQSLGGAENIFKS  424

Query  935   ---GILSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRH--------HGLWYSRN  789
                G LS  +R + Q R+S+ ++T      ++ + +  D   R         +G   S N
Sbjct  425   SPNGFLS--RRPSFQSRSSLSSSTCAVLKYAKGTSKSFDGGTRSLDRGKVFANGSGLSLN  482

Query  788   KI-----DEKENAGMKENSD-KLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKE  627
             K      D + +   KEN D K  +  N   + +D VSG LYD LQKEVI +RK    K+
Sbjct  483   KSSDATRDNEAHGSWKENPDEKPNELPNV--DTDDCVSGLLYDMLQKEVITLRKACYEKD  540

Query  626   NDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYD  477
               L  KD+ I+ML KK++TLTKA+EVE++K +RE A+ EK+ + I+ + D
Sbjct  541   QSLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREVAVMEKEVAAIRAEKD  590



>ref|XP_008781372.1| PREDICTED: microtubule-associated protein 70-1-like [Phoenix 
dactylifera]
Length=625

 Score =   369 bits (948),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 269/528 (51%), Positives = 372/528 (70%), Gaps = 28/528 (5%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             +LH +DP  +EL+ L+N++++K+RELG AQ+E K L+ +E+ ++KA+EEL  E+ + EEK
Sbjct  64    MLHGSDPVRVELSRLENEVRDKDRELGEAQAEIKALKLSERAREKAVEELTEELAKAEEK  123

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK++E+L+E KNLE KK+ +EKK AL AQ+AAEA LRRV+A QK+DD  PIE+++APLEA
Sbjct  124   LKLTESLLENKNLEVKKINDEKKAALAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEA  183

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+ + EIA LQ+D RA++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL +Q
Sbjct  184   ELKLARQEIAKLQDDNRALDRLTKSKEAALLEAERTVQIALAKASMVDDLQNKNQELMKQ  243

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILDK +RQKV EVE+LSQT+ ELEEA+LAGGAAAN +RDY+R++ E+ EE 
Sbjct  244   IEICQEENKILDKMHRQKVAEVEKLSQTVKELEEAVLAGGAAANAVRDYQRKVQEMNEEM  303

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             +TL+RELAR KV+ANRVA +VANEWKD NDKVMPV+QWLEERR +Q EMQ+L+DKLAISE
Sbjct  304   KTLDRELARAKVTANRVAVVVANEWKDANDKVMPVRQWLEERRFMQGEMQQLRDKLAISE  363

Query  1085  RTAKAEAQlkdklklrlktLEQGLKQT--GNNNVNPKVLSGFSKPEKANHLFGILSSKKR  912
             R A++EAQLK+K +LR+K LE+GL+ +  G+N  N +  S  + P +   L G  +  K 
Sbjct  364   RAARSEAQLKEKYQLRIKVLEEGLRMSANGSNRTNVEGRSVSNGPSRRQSLGGAENISKS  423

Query  911   S-----ASQP------------RASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKI  783
             S     + +P             A +       +S    +   +  K   +G   S NK 
Sbjct  424   SPNGFLSKRPSFQSRSSLSSSTSAVLKYAKGTSKSFDGGTRSLDRSKVFANGSGLSLNKS  483

Query  782   -----DEKENAGMKENSD-KLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKEND  621
                  D + +   KENSD K  +  N   + +D VSG LYD LQKEVI +RK    K+  
Sbjct  484   SDATRDNETHGSWKENSDEKPNELPNV--DTDDCVSGLLYDMLQKEVITLRKACHEKDQI  541

Query  620   LNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYD  477
             L  KD+ I+ML KK++TLTKA+EVE++K +RE A  EK+ + ++ + D
Sbjct  542   LKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREVAAMEKEVAAMRTEKD  589



>ref|XP_010513904.1| PREDICTED: microtubule-associated protein 70-3-like isoform X2 
[Camelina sativa]
Length=627

 Score =   369 bits (948),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 258/532 (48%), Positives = 370/532 (70%), Gaps = 22/532 (4%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N +++K+REL  +Q+E K LR +E+ ++KA+EEL  E+ ++ 
Sbjct  64    ITLLHGSDPVKIELNRLENDVRDKDRELSESQAEIKALRLSERQREKAVEELTEELGKMS  123

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++ENL++ KNLE KK+  EK+ ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  124   EKLKLTENLLDSKNLEIKKINEEKRASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  183

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQ+D RA++R  KSKEAALL+AER ++SAL +  +V+++QN+N EL 
Sbjct  184   EAELKLARHEIVKLQDDNRALDRLTKSKEAALLDAERTVQSALAKASMVDDLQNKNQELM  243

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEEN+ILD+ +RQKV EVE+ +QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  244   KQIEICQEENRILDRMHRQKVAEVEKFTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNE  303

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ERR L+RELAR KVSA+RVAT+VANEWKD +DKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  304   ERRVLDRELARAKVSASRVATVVANEWKDGSDKVMPVKQWLEERRFLQGEMQQLRDKLAI  363

Query  1091  SERTAKAEAQlkdklklrlktLEQGLK--QTGNNNVNPKVLSGFSKPEKANHLFGI----  930
             ++R AK+EAQLK+K +LRL+ LE+ L+   +G N   P+  S  + P +   + G     
Sbjct  364   ADRAAKSEAQLKEKFQLRLRVLEESLRGPPSGGNRSTPEGRSISNGPSRRQSIGGADIIP  423

Query  929   ------LSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHG---------LWYS  795
                     SK+ S+SQ R+   +T++  + +   S  ++   +   G           + 
Sbjct  424   KLTSNGFFSKRTSSSQFRSLNASTSTILKHAKGTSRSFDGGSRSIDGSKLLTNEPRSKFP  483

Query  794   RNKIDEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLN  615
              N+  E ++     NS K  +    +  + D V G L+D LQKEVI +RK    K+  L 
Sbjct  484   VNQSSEGKSGDDSPNSTKQGEPDKAAATNNDSVPGVLHDLLQKEVITLRKASHDKDQSLR  543

Query  614   TKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQT  459
              KDE I+ML KK+ETLTKA+EVE++K +RE A  EK+ S ++ +  G+  +T
Sbjct  544   DKDEAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVSAMRVENKGSDSRT  595



>ref|NP_001189497.1| microtubule-associated protein 70-3 [Arabidopsis thaliana]
 gb|AEC05493.1| microtubule-associated protein 70-3 [Arabidopsis thaliana]
Length=630

 Score =   369 bits (948),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 268/564 (48%), Positives = 380/564 (67%), Gaps = 25/564 (4%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N +++K+REL  +Q+E K LR +E+ ++KA+EEL  E+ ++ 
Sbjct  66    ITLLHGSDPVKVELNRLENDVRDKDRELSESQAEIKALRLSERQREKAVEELTEELGKMS  125

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++ENL++ KNLE KK+  EK+ ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  126   EKLKLTENLLDSKNLEIKKINEEKRASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  185

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQ+D RA++R  KSKEAALL+AER ++SAL +  +V+++QN+N EL 
Sbjct  186   EAELKLARHEIVKLQDDNRALDRLTKSKEAALLDAERTVQSALAKASMVDDLQNKNQELM  245

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEEN+ILDK +RQKV EVE+ +QT+ ELEEA+LAGG AAN +RDY+R+  E+ E
Sbjct  246   KQIEICQEENRILDKLHRQKVAEVEKFTQTVRELEEAVLAGGTAANAVRDYQRKFQEMNE  305

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ERR L+RELAR KVSA+RVAT+VANEWKD +DKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  306   ERRILDRELARAKVSASRVATVVANEWKDGSDKVMPVKQWLEERRFLQGEMQQLRDKLAI  365

Query  1091  SERTAKAEAQlkdklklrlktLEQGLK--QTGNNNVNPKVLSGFSKPEKANHLFGI----  930
             ++R AK+EAQLK+K +LRL+ LE+ L+   +  N   P+  S  + P +   L G     
Sbjct  366   ADRAAKSEAQLKEKFQLRLRVLEESLRGPSSSGNRSTPEGRSMSNGPSRRQSLGGADIIP  425

Query  929   ------LSSKKRSASQPRASMVNTTseqesssensgEYNDQKK---RHHGLW------YS  795
                     SK+  +SQ R+   +T++  + +   S  ++   +   R   L       + 
Sbjct  426   KLTSNGFFSKRSPSSQFRSLNASTSTILKHAKGTSRSFDGGSRSLDRSKVLTNEPRSKFP  485

Query  794   RNKIDEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLN  615
              N+  E  + G   NS K  DS   +  + D V G L+D LQKEVI +RK  + K+  L 
Sbjct  486   LNQSSEGTSGGGSPNSTKQGDSEKAAGTNNDSVPGVLHDLLQKEVITLRKAANDKDQSLR  545

Query  614   TKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQTNSSLKSSI  435
              KDE I+ML KK+ETLTKA+EVE++K +RE A  EK+ S ++    G+  +T     +S 
Sbjct  546   DKDEAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVSAMRVDNKGSDSRTRRHSTNSK  605

Query  434   KVAKT*DVKQVACSSFASSDLGCT  363
               + T    Q+   S  S  +G T
Sbjct  606   GASTT---AQLLSGSRGSGRMGMT  626



>gb|KDO60764.1| hypothetical protein CISIN_1g007087mg [Citrus sinensis]
Length=618

 Score =   369 bits (946),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 261/524 (50%), Positives = 376/524 (72%), Gaps = 23/524 (4%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+RELG AQ+E K LR +E+L++KA+EEL  E+ ++E
Sbjct  62    MTLLHGSDPVKVELNRLENEVRDKDRELGEAQAEIKALRLSERLREKAVEELTEELSKVE  121

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++ENL+E KNLE KK+ +EK+ ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  122   EKLKLAENLIETKNLEIKKINDEKRASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  181

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL 
Sbjct  182   EAELKLARQEIAKLQDDNKALDRLTKSKEAALLEAERTVQVALAKASMVDDLQNKNQELM  241

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  242   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  301

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+D+LAI
Sbjct  302   ERKTLDRELARAKVTANRVATVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDRLAI  361

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNP-----KVLSGFSKPEK---ANHLF  936
             +ERTAK+EAQLK+K  LRLK LE+ L+ + N +         + +G S+ +    A+++ 
Sbjct  362   TERTAKSEAQLKEKYHLRLKVLEESLRGSSNGSGRSTSDGRSISNGSSRRQSLGGADNIS  421

Query  935   GILSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKENAGMK  756
              + S+   S   P +  +++++  + +   S  ++   +    L  S+  ++   N  + 
Sbjct  422   KLTSNGFISKRTPSSRSLSSSTVLKHAKGTSKSFDGGTR---SLDRSKVLLNGSPNQSID  478

Query  755   ENSDKLTDS---GNF--------SKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTK  609
                D  T +   GN         S + ED V G LYD LQKEV+ +RK    K+  L  K
Sbjct  479   ATKDSDTPNTWKGNLEDKPSEFQSTDTEDSVPGVLYDLLQKEVVALRKAGHEKDQSLKDK  538

Query  608   DEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYD  477
             D+ I++L KK++TLTKA+EVE++K +RE A  EK+ + ++ + D
Sbjct  539   DDAIEILAKKVDTLTKAMEVEAKKMRREVAAMEKEVAAMRVEKD  582



>ref|XP_010916224.1| PREDICTED: microtubule-associated protein 70-1-like isoform X3 
[Elaeis guineensis]
Length=621

 Score =   369 bits (947),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 271/526 (52%), Positives = 379/526 (72%), Gaps = 32/526 (6%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             +LH +DP  +EL+ L+N++++K+RELG AQ+E + LR +E+ ++KA+EEL  E+ ++E K
Sbjct  65    MLHGSDPVRVELSRLENEVRDKDRELGEAQAEIRALRLSERAREKAVEELTEELAKVEGK  124

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK++E+L+E KNLE KK+ +EKK AL AQ+AAEA LRRV+A QK+DD  PIE+++APLEA
Sbjct  125   LKLTESLLENKNLEVKKINDEKKAALAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEA  184

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+ + EIA LQ+D RA++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL +Q
Sbjct  185   ELKLSRQEIAKLQDDNRALDRLTKSKEAALLEAERTVQIALAKASMVDDLQNKNQELMKQ  244

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILDK +RQKV EVE+LSQT+ ELEEA+LAGGAAAN +RDY+R++ E+ +E 
Sbjct  245   IEICQEENKILDKMHRQKVAEVEKLSQTVKELEEAVLAGGAAANAVRDYQRKVQEMNDEM  304

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             +TL+RELAR KV+ANRVA +VANEWKD NDKVMPV+QWLEERR +Q EMQ+L+DKLAI+E
Sbjct  305   KTLDRELARAKVTANRVAVVVANEWKDANDKVMPVRQWLEERRFMQGEMQQLRDKLAIAE  364

Query  1085  RTAKAEAQlkdklklrlktLEQGLKQT--GNNNVNPKVLSGFSKPEKANHLF--------  936
             RTA++EAQLK+K +LRLK LE+GL+ +  G N  N +  S  + P +   L         
Sbjct  365   RTARSEAQLKEKYQLRLKVLEEGLRMSANGGNRTNAEGRSVSNGPSRRQSLGGAENISKS  424

Query  935   ---GILSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRH--------HGLWYSRN  789
                G LS  KR + Q R+S+ ++TS     ++ + +  D   R         +G  +S N
Sbjct  425   SPNGFLS--KRPSFQLRSSLSSSTSTVLKHAKGTSKSFDGGTRSLDRGKVFANGSGFSLN  482

Query  788   KIDE--KEN---AGMKENSD-KLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKE  627
             K  +  +EN      KEN D K ++  N   + ++ VSG LYD LQKEVI +RK    K+
Sbjct  483   KSSDATRENEAHGSWKENPDEKPSELPNV--DIDNCVSGLLYDMLQKEVITLRKACYEKD  540

Query  626   NDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIK  489
               L  KD+ I+ML KK++TLTKA+EVE++K +RE A  EK+ + ++
Sbjct  541   QSLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREVAAMEKEVAAMR  586



>ref|XP_010916222.1| PREDICTED: microtubule-associated protein 70-1-like isoform X1 
[Elaeis guineensis]
Length=627

 Score =   369 bits (947),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 271/526 (52%), Positives = 379/526 (72%), Gaps = 32/526 (6%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             +LH +DP  +EL+ L+N++++K+RELG AQ+E + LR +E+ ++KA+EEL  E+ ++E K
Sbjct  65    MLHGSDPVRVELSRLENEVRDKDRELGEAQAEIRALRLSERAREKAVEELTEELAKVEGK  124

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK++E+L+E KNLE KK+ +EKK AL AQ+AAEA LRRV+A QK+DD  PIE+++APLEA
Sbjct  125   LKLTESLLENKNLEVKKINDEKKAALAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEA  184

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+ + EIA LQ+D RA++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL +Q
Sbjct  185   ELKLSRQEIAKLQDDNRALDRLTKSKEAALLEAERTVQIALAKASMVDDLQNKNQELMKQ  244

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILDK +RQKV EVE+LSQT+ ELEEA+LAGGAAAN +RDY+R++ E+ +E 
Sbjct  245   IEICQEENKILDKMHRQKVAEVEKLSQTVKELEEAVLAGGAAANAVRDYQRKVQEMNDEM  304

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             +TL+RELAR KV+ANRVA +VANEWKD NDKVMPV+QWLEERR +Q EMQ+L+DKLAI+E
Sbjct  305   KTLDRELARAKVTANRVAVVVANEWKDANDKVMPVRQWLEERRFMQGEMQQLRDKLAIAE  364

Query  1085  RTAKAEAQlkdklklrlktLEQGLKQT--GNNNVNPKVLSGFSKPEKANHLF--------  936
             RTA++EAQLK+K +LRLK LE+GL+ +  G N  N +  S  + P +   L         
Sbjct  365   RTARSEAQLKEKYQLRLKVLEEGLRMSANGGNRTNAEGRSVSNGPSRRQSLGGAENISKS  424

Query  935   ---GILSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRH--------HGLWYSRN  789
                G LS  KR + Q R+S+ ++TS     ++ + +  D   R         +G  +S N
Sbjct  425   SPNGFLS--KRPSFQLRSSLSSSTSTVLKHAKGTSKSFDGGTRSLDRGKVFANGSGFSLN  482

Query  788   KIDE--KEN---AGMKENSD-KLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKE  627
             K  +  +EN      KEN D K ++  N   + ++ VSG LYD LQKEVI +RK    K+
Sbjct  483   KSSDATRENEAHGSWKENPDEKPSELPNV--DIDNCVSGLLYDMLQKEVITLRKACYEKD  540

Query  626   NDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIK  489
               L  KD+ I+ML KK++TLTKA+EVE++K +RE A  EK+ + ++
Sbjct  541   QSLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREVAAMEKEVAAMR  586



>gb|KDP38119.1| hypothetical protein JCGZ_04762 [Jatropha curcas]
Length=625

 Score =   369 bits (947),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 271/535 (51%), Positives = 372/535 (70%), Gaps = 36/535 (7%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + L+H +DP  LEL  L+N++++K+RELG AQ+E K LR +E+LK+KA+EE   E+ ++E
Sbjct  60    ITLMHGSDPVKLELNRLENEVRDKDRELGEAQAEIKALRLSERLKEKAVEERTEELSKVE  119

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  120   EKLKLTESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  179

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EI  LQ+D +A++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL 
Sbjct  180   EAELKLARLEITKLQDDNKALDRLTKSKEAALLEAERTVQVALAKASMVDDLQNKNQELM  239

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  240   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  299

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  300   ERKTLDRELARAKVTANRVATVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLAI  359

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFS---KPEKANHLFGI---  930
             +ERTAK+EAQLK+K +LRLK LE+ L+  G+++ N     G S    P +   L G    
Sbjct  360   TERTAKSEAQLKEKYQLRLKVLEESLR--GSSSSNRSAAEGRSISNGPSRRQSLGGADNI  417

Query  929   -------LSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRH--HGLWYSRNKIDE  777
                      SK+   SQ R S+ ++T+     ++ + +  D   R    G     N    
Sbjct  418   SKLTSNGFLSKRTPTSQLR-SLSSSTNSVLKHAKGTSKSFDGGTRSLDRGSRVLLNGAS-  475

Query  776   KENAGMKENSDKLTDS-------GN-------FSKND-EDMVSGFLYDRLQKEVINMRKC  642
               N    +  D+  D+       GN       F   + ED V G LYD LQKEV+ +RK 
Sbjct  476   -PNCSFNQPCDRTKDAEATDTWKGNPDEKPSEFPAAETEDSVPGILYDLLQKEVVALRKA  534

Query  641   FDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYD  477
                K+  L  KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++ + D
Sbjct  535   GHEKDQSLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRVEKD  589



>ref|XP_002284904.1| PREDICTED: microtubule-associated protein 70-2 [Vitis vinifera]
 emb|CBI26828.3| unnamed protein product [Vitis vinifera]
Length=637

 Score =   369 bits (948),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 277/574 (48%), Positives = 385/574 (67%), Gaps = 37/574 (6%)
 Frame = -3

Query  2105  VFVVSPPSDTSLVACNN*AKREGIEIKMAAGYEEVGVAELC-LLH-TDPFILELTSLQNQ  1932
             V+VVS P    L    +  + +G   + A+    +   E   LLH +DP  +EL  L+N+
Sbjct  34    VYVVSTPP---LTVSQSFKEGKGSSRRRASVRPSLDADEFINLLHGSDPVKVELNRLENE  90

Query  1931  LKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKLKISENLVEQKNLETKKL  1752
             +++K+RELG AQ+E K LR +E+L++KA+EE+  E+ ++EEKLK++E+L+E KNLE KK+
Sbjct  91    VRDKDRELGEAQAEIKALRFSERLREKAVEEITEELSKVEEKLKLTESLLESKNLEIKKI  150

Query  1751  INEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEIKMYKNEIAALQEDKRA  1572
              +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APLEAE+K+ + EIA LQ+D +A
Sbjct  151   NDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEAELKLARQEIAKLQDDNKA  210

Query  1571  MERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIEICQEENKILDKTNRQK  1392
             ++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL +QIEICQEENKILDK +RQK
Sbjct  211   LDRLTKSKEAALLEAERTVQVALAKASMVDDLQNKNQELMKQIEICQEENKILDKMHRQK  270

Query  1391  VLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeerrtlerelaRVKVSANRVA  1212
             V EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVA
Sbjct  271   VAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVA  330

Query  1211  TIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlk  1032
              +VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI+ERTAK+EAQLK+K  LRLK
Sbjct  331   VVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLAITERTAKSEAQLKEKYHLRLK  390

Query  1031  tLEQGLKQTGNNN--VNPKVLSGFSKPEKANHLFGILSSKKRSASQPRASMVNTTseqes  858
              +E+ L+ + N+N    P+V S  + P +   L G   +   S   P   +   T   + 
Sbjct  391   VIEESLRGSSNSNNRSTPEVRSVSNGPSRRQSLGG---ADNISKFIPNGFLSKRTPTSQL  447

Query  857   ssensgEYNDQKKRHHGLWYS---------RNKI---DEKENAGMKENSDKLTD------  732
              S  S   +   +   G   S         R K+       N  + ++ D   D      
Sbjct  448   RSSLSSGSSSVLRHAKGTSKSFDGGTRSLDRGKVLLNGTLPNYALNQSCDATKDIEVHDA  507

Query  731   -SGN-------FSKND-EDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKK  579
               GN       F   D ED V G LYD LQKEV+++RK    K+  L  KD+ I+ML KK
Sbjct  508   WKGNSDEKPNEFPVVDTEDSVPGVLYDMLQKEVVSLRKAGHEKDQSLKDKDDAIEMLAKK  567

Query  578   IETLTKAIEVESRKTKREAAIREKDSSTIKYKYD  477
             ++TLTKA+EVE++K +RE A  EK+ + ++ + D
Sbjct  568   VDTLTKAMEVEAKKMRREVAAMEKEVAAMRVEKD  601



>ref|XP_006469252.1| PREDICTED: microtubule-associated protein 70-2-like [Citrus sinensis]
Length=618

 Score =   369 bits (946),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 261/524 (50%), Positives = 376/524 (72%), Gaps = 23/524 (4%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+RELG AQ+E K LR +E+L++KA+EEL  E+ ++E
Sbjct  62    MTLLHGSDPVKVELNRLENEVRDKDRELGEAQAEIKALRLSERLREKAVEELTEELSKVE  121

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++ENL+E KNLE KK+ +EK+ ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  122   EKLKLAENLIETKNLEIKKINDEKRASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  181

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL 
Sbjct  182   EAELKLARQEIAKLQDDNKALDRLTKSKEAALLEAERTVQVALAKASMVDDLQNKNQELM  241

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  242   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  301

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+D+LAI
Sbjct  302   ERKTLDRELARAKVTANRVATVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDRLAI  361

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNP-----KVLSGFSKPEK---ANHLF  936
             +ERTAK+EAQLK+K  LRLK LE+ L+ + N +         + +G S+ +    A+++ 
Sbjct  362   TERTAKSEAQLKEKYHLRLKVLEESLRGSSNGSGRSTSDGRSISNGSSRRQSLGGADNIS  421

Query  935   GILSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKENAGMK  756
              + S+   S   P +  +++++  + +   S  ++   +    L  S+  ++   N  + 
Sbjct  422   KLTSNGFISKRTPSSRSLSSSTVLKHAKGTSKSFDGGTR---SLDRSKVLLNGSPNQSID  478

Query  755   ENSDKLTDS---GNF--------SKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTK  609
                D  T +   GN         S + ED V G LYD LQKEV+ +RK    K+  L  K
Sbjct  479   ATKDSDTPNTWKGNLEDKPSEFQSTDTEDSVPGVLYDLLQKEVVALRKAGHEKDQSLKDK  538

Query  608   DEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYD  477
             D+ I++L KK++TLTKA+EVE++K +RE A  EK+ + ++ + D
Sbjct  539   DDAIEILAKKVDTLTKAMEVEAKKMRREVAAMEKEVAAMRVEKD  582



>ref|XP_006828475.1| hypothetical protein AMTR_s00060p00151140 [Amborella trichopoda]
 gb|ERM95891.1| hypothetical protein AMTR_s00060p00151140 [Amborella trichopoda]
Length=632

 Score =   369 bits (946),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 275/545 (50%), Positives = 378/545 (69%), Gaps = 31/545 (6%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             LLH +DP  +EL  L+N +++K+RELG AQ+E K L+ +E+L++KA+EEL  E+ +++EK
Sbjct  56    LLHGSDPVKVELNRLENDVRDKDRELGEAQAEIKALKLSERLREKAVEELTEELSKVDEK  115

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK +ENL+E KNLE KKL +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APLEA
Sbjct  116   LKATENLLENKNLEIKKLNDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEA  175

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+ + EIA LQ+D +A++R  KSKEAALL+AER ++ AL +  +V+++QN+N EL +Q
Sbjct  176   ELKLARQEIAKLQDDNKALDRLTKSKEAALLDAERTVQFALAKASMVDDLQNKNQELMKQ  235

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILDK +RQKV EVE+LSQT+ ELEEA+LAGGAAAN +RDY+R++ E+ EER
Sbjct  236   IEICQEENKILDKMHRQKVAEVEKLSQTVRELEEAVLAGGAAANAVRDYQRKVQEMNEER  295

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             +TL+RELAR KV+ANRVA +VANEWKD NDKVMPVKQWLE+RR +Q EMQ+L+DKLAI+E
Sbjct  296   KTLDRELARAKVTANRVAVVVANEWKDANDKVMPVKQWLEDRRFMQGEMQQLRDKLAIAE  355

Query  1085  RTAKAEAQlkdklklrlktLEQGLKQTGNNNVNP--------------KVLSG---FSKP  957
             RTA+ EAQLK+K +LRLK LE  LK +   NV P              + L G   FSK 
Sbjct  356   RTARYEAQLKEKYQLRLKVLEDSLKASTTGNVRPSSEGRSTSNGPSRRQSLGGSENFSKV  415

Query  956   EKANHLFGILSSKKRSASQPRASMV--NTTseqesssensgEYNDQKKRHHGLWYSRNKI  783
                  L    S++ RS++    S+V  N     +S    +   +  K   +G+  + N  
Sbjct  416   ASNGFLRRSPSTQLRSSTSSSTSIVLKNAKGTSKSFDGGTRSLDRSKIISNGI--ALNGT  473

Query  782   DEKENAGMKENSDKLT---DSGN----FSKND-EDMVSGFLYDRLQKEVINMRKCFDMKE  627
               K   G + N    T   DSG      +K+D +D VSG LYD LQKEVI +RK    K+
Sbjct  474   ISKITDGTRTNDTSSTWKEDSGGKPNELAKHDPDDTVSGLLYDMLQKEVIALRKASHEKD  533

Query  626   NDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQTN-SS  450
               L  KD+ I+ML KK++TL+KA+EVE++K +RE A  EK+ + ++ + + + R     S
Sbjct  534   QSLKDKDDAIEMLAKKVDTLSKAMEVEAKKMRREVAAMEKEVAAMRIEKEHDQRAKRLGS  593

Query  449   LKSSI  435
              K S+
Sbjct  594   FKGSV  598



>ref|XP_011024158.1| PREDICTED: microtubule-associated protein 70-2-like [Populus 
euphratica]
 ref|XP_011024166.1| PREDICTED: microtubule-associated protein 70-2-like [Populus 
euphratica]
Length=619

 Score =   368 bits (945),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 263/526 (50%), Positives = 372/526 (71%), Gaps = 27/526 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  LEL  L+N++++K+RELG AQ+E K LR +E+L++KA+EEL +E+ +++
Sbjct  57    MTLLHGSDPVKLELNRLENEVRDKDRELGEAQAEIKALRLSERLREKAVEELTDELSKVD  116

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK+ E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  117   EKLKLMESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  176

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAAL+EAER ++ AL +  +V+++QN+N EL 
Sbjct  177   EAELKLARQEIAKLQDDNKALDRLTKSKEAALIEAERTVQVALAKASMVDDLQNKNQELM  236

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  237   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  296

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  297   ERKTLDRELARAKVTANRVATVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLAI  356

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFS-KPEKANHLFGILSSKK  915
             +ERTAK+EAQLK+K +LRLK LE+ L+ + +NN +     G S  P +   L G  +  K
Sbjct  357   TERTAKSEAQLKEKYQLRLKVLEESLRGSSSNNRSMPEGRGISNGPSRRQSLGGADNISK  416

Query  914   RSAS---------------------QPRASMVNTTseqesssensgEYNDQKKRHHGLWY  798
              +++                       + +  +      S   +S    +   ++H    
Sbjct  417   LTSNGFLSKRTQSRSLSSSTLSVLKHAKGTSKSFDGGTRSLDRSSKLLLNGAGQNHSFNQ  476

Query  797   SRNKIDEKEN-AGMKENSDKLTDSGNFSKND-EDMVSGFLYDRLQKEVINMRKCFDMKEN  624
              R+   + E  +  K NSD+  +   F + D ED V G LY+ LQK+V+ +RK    K+ 
Sbjct  477   PRDGTKDTETPSPWKGNSDEKPN--EFPQADTEDSVPGILYELLQKQVVALRKAGHEKDQ  534

Query  623   DLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
              L  KD+ I+ML KK+ETLTKA+EVE++K +RE A+ EK+ + ++ 
Sbjct  535   SLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAVMEKEVAAMRV  580



>ref|XP_010043962.1| PREDICTED: microtubule-associated protein 70-2 [Eucalyptus grandis]
 ref|XP_010043963.1| PREDICTED: microtubule-associated protein 70-2 [Eucalyptus grandis]
 gb|KCW85970.1| hypothetical protein EUGRSUZ_B02673 [Eucalyptus grandis]
 gb|KCW85971.1| hypothetical protein EUGRSUZ_B02673 [Eucalyptus grandis]
Length=629

 Score =   369 bits (946),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 271/530 (51%), Positives = 374/530 (71%), Gaps = 28/530 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  LEL  L+N++++K+RELG AQ+E K LR +E+L++KA+EEL  E+ ++E
Sbjct  66    ITLLHGSDPVKLELNRLENEVRDKDRELGEAQAEIKALRLSERLREKAVEELTEELSKVE  125

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E L+E KNLE KK+  EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  126   EKLKLTEKLLENKNLEIKKINEEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  185

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ K EIA LQ+D +A++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL 
Sbjct  186   EAELKLAKQEIAKLQDDNKALDRLTKSKEAALLEAERTVQVALAKASMVDDLQNKNQELM  245

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILD+ +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  246   KQIEICQEENKILDRLHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  305

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ERRTL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  306   ERRTLDRELARAKVTANRVATVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLAI  365

Query  1091  SERTAKAEAQlkdklklrlktLEQGLK-QTGNNNVNPKVLSGFSKPEKANHLF-------  936
             +ER A++EA LK++ + RLK +E+ L+  +G+NN +    S  + P +   L        
Sbjct  366   TERAARSEALLKERYQSRLKVIEESLRGSSGSNNRSALERSMSNGPSRRQSLGGADNVSR  425

Query  935   ----GILSSKKRSASQPRASMVNTTseqesssensgEYN----DQKK---RHHGLWYSRN  789
                 G+LS K  S S+  +S   T  +    +  S +      D+ K      G  YS N
Sbjct  426   LTASGLLSRKSASQSKSFSSGATTVLKHAKGTSRSFDGGTRSLDRGKVLSNGTGANYSPN  485

Query  788   KI-----DEKENAGMKENSDKLTDSGNFSKND-EDMVSGFLYDRLQKEVINMRKCFDMKE  627
             +      + +EN   K NSD   +S  F+  +  D V G LYD LQKEV+ +RK    K+
Sbjct  486   RSCDVTKEGEENDFSKGNSD--NNSNEFAPVETRDSVPGVLYDILQKEVVALRKAGHEKD  543

Query  626   NDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYD  477
               +  KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++ + D
Sbjct  544   QSIKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRVEKD  593



>ref|XP_010916223.1| PREDICTED: microtubule-associated protein 70-1-like isoform X2 
[Elaeis guineensis]
Length=626

 Score =   368 bits (945),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 271/526 (52%), Positives = 379/526 (72%), Gaps = 32/526 (6%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             +LH +DP  +EL+ L+N++++K+RELG AQ+E + LR +E+ ++KA+EEL  E+ ++E K
Sbjct  65    MLHGSDPVRVELSRLENEVRDKDRELGEAQAEIRALRLSERAREKAVEELTEELAKVEGK  124

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK++E+L+E KNLE KK+ +EKK AL AQ+AAEA LRRV+A QK+DD  PIE+++APLEA
Sbjct  125   LKLTESLLENKNLEVKKINDEKKAALAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEA  184

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+ + EIA LQ+D RA++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL +Q
Sbjct  185   ELKLSRQEIAKLQDDNRALDRLTKSKEAALLEAERTVQIALAKASMVDDLQNKNQELMKQ  244

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILDK +RQKV EVE+LSQT+ ELEEA+LAGGAAAN +RDY+R++ E+ +E 
Sbjct  245   IEICQEENKILDKMHRQKVAEVEKLSQTVKELEEAVLAGGAAANAVRDYQRKVQEMNDEM  304

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             +TL+RELAR KV+ANRVA +VANEWKD NDKVMPV+QWLEERR +Q EMQ+L+DKLAI+E
Sbjct  305   KTLDRELARAKVTANRVAVVVANEWKDANDKVMPVRQWLEERRFMQGEMQQLRDKLAIAE  364

Query  1085  RTAKAEAQlkdklklrlktLEQGLKQT--GNNNVNPKVLSGFSKPEKANHLF--------  936
             RTA++EAQLK+K +LRLK LE+GL+ +  G N  N +  S  + P +   L         
Sbjct  365   RTARSEAQLKEKYQLRLKVLEEGLRMSANGGNRTNAEGRSVSNGPSRRQSLGGAENISKS  424

Query  935   ---GILSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRH--------HGLWYSRN  789
                G LS  KR + Q R+S+ ++TS     ++ + +  D   R         +G  +S N
Sbjct  425   SPNGFLS--KRPSFQLRSSLSSSTSTVLKHAKGTSKSFDGGTRSLDRGKVFANGSGFSLN  482

Query  788   KIDE--KEN---AGMKENSD-KLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKE  627
             K  +  +EN      KEN D K ++  N   + ++ VSG LYD LQKEVI +RK    K+
Sbjct  483   KSSDATRENEAHGSWKENPDEKPSELPNV--DIDNCVSGLLYDMLQKEVITLRKACYEKD  540

Query  626   NDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIK  489
               L  KD+ I+ML KK++TLTKA+EVE++K +RE A  EK+ + ++
Sbjct  541   QSLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREVAAMEKEVAAMR  586



>emb|CDP16283.1| unnamed protein product [Coffea canephora]
Length=627

 Score =   368 bits (945),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 270/525 (51%), Positives = 372/525 (71%), Gaps = 28/525 (5%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             LLH +DP  LEL  L+N++++K+RELG AQ+E K LR +E+L++KA+EEL +E+ R+EEK
Sbjct  66    LLHGSDPVKLELNRLENEVRDKDRELGEAQAEIKALRFSERLREKAVEELTDELARVEEK  125

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK++E+L+E +NLE KK+ +EKK ++ AQ+AAEA LRRV++ QK+DD  PIE+++APLEA
Sbjct  126   LKLTESLLESRNLEIKKINDEKKASMAAQFAAEATLRRVHSAQKDDDMPPIEAILAPLEA  185

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+ + EIA LQ+D +A++R  KSKEAALLE ER ++ AL +  +V+++QN+N EL +Q
Sbjct  186   ELKLARQEIAKLQDDNKALDRLTKSKEAALLEVERTVQVALAKASMVDDLQNKNQELMKQ  245

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ EER
Sbjct  246   IEICQEENKILDKLHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNEER  305

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             +TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAISE
Sbjct  306   KTLDRELARAKVTANRVATVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLAISE  365

Query  1085  RTAKAEAQlkdklklrlktLEQGLKQTGNNNV--NPKVLSGFSKPEKANHLFGI-----L  927
             RTAK+EAQLK+K +LRLK LE+ L+ + N++V   P   S  +   +   L G      L
Sbjct  366   RTAKSEAQLKEKYQLRLKVLEETLR-SPNSSVRNTPDGRSSSNGLSRRQSLGGAENISKL  424

Query  926   SS----KKRSAS-QPRASMVNTTseqesssensgEYNDQKKRHHGLWYS-----------  795
             +S     KRS S Q R+S  +T  +    +  S +   +      +  +           
Sbjct  425   TSNGFLPKRSPSFQMRSSGSSTVLKHAKGTSKSFDGGSRSLDRSKILLNGTGPNFKMSQS  484

Query  794   --RNKIDEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKEND  621
                 K  E + +  KEN D+       ++ D D V G LYD LQKEV+ +RK    K+  
Sbjct  485   CDGTKDSEPQKSTWKENQDEKPSDVQVTETD-DTVPGLLYDLLQKEVVALRKAGHEKDQS  543

Query  620   LNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
             L  KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++ 
Sbjct  544   LKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRV  588



>ref|XP_011027239.1| PREDICTED: microtubule-associated protein 70-1-like [Populus 
euphratica]
Length=622

 Score =   368 bits (944),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 267/538 (50%), Positives = 369/538 (69%), Gaps = 26/538 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N+L++K+RELG A +E K L+ +E+ K+KA+EE+ +E+ ++E
Sbjct  61    ITLLHGSDPVRVELNRLENELRDKDRELGEALAEIKSLKNSERSKEKAVEEVTDELDKVE  120

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK +E L+E KNLE KK+ +EKK AL AQ+AAEA LRRV+A QK+D+  PIE++I PL
Sbjct  121   EKLKATEALLESKNLEIKKINDEKKAALAAQFAAEATLRRVHAAQKDDEMPPIEAIITPL  180

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + E+A LQ+D RA++R  KSKEAALL+AER ++ AL +  +V+++QN+N EL 
Sbjct  181   EAELKLARMEVAKLQDDNRALDRLTKSKEAALLDAERTVQIALAKASLVDDLQNKNQELM  240

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  241   KQIEICQEENKILDKMHRQKVAEVEKLMQTVHELEEAVLAGGAAANAVRDYQRKVQEMNE  300

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             E++TLERE+AR KVSANRVAT+VANEWKD NDKVMPVKQWLEERR  Q EMQ+L+DKLA+
Sbjct  301   EKKTLEREVARAKVSANRVATVVANEWKDGNDKVMPVKQWLEERRFFQGEMQQLRDKLAV  360

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQT-GNNNVNPKVLSGFSKPEKANHLFGI-----  930
             +ER AKAEAQLKDK +LR K LE+ LK + GN+   P+  +  + P +   L G      
Sbjct  361   AERAAKAEAQLKDKYQLRFKVLEERLKASNGNSRATPEGRNTSNGPSRRQSLSGAENFSR  420

Query  929   -----LSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRH--HGLWYSRNKIDEKE  771
                    S+K S SQ  +   N+ +     ++ S    D   R     L       D   
Sbjct  421   SSFNGYLSRKASNSQAGSLQANSAATLLRHAKMSSRSFDGGSRSLDDKLLVGGTGKDNAP  480

Query  770   NAGMKENSDKL----------TDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKEND  621
              A   +  +            T + N     ED VSGFLYD LQK+VI +RK    K+  
Sbjct  481   AAASDQTQNTERIETEEIENGTSTENLKSEQEDQVSGFLYDMLQKDVITLRKACHEKDQS  540

Query  620   LNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY--KYDGNIRQTNS  453
             L  KD+ I+ML KK++TL KA+EVE++K +RE A REK+ + ++   ++D  +R++++
Sbjct  541   LKDKDDAIEMLAKKVDTLNKAMEVEAKKMRREVAAREKEVAAMRVNKEHDHRMRRSSA  598



>ref|XP_003570689.1| PREDICTED: microtubule-associated protein 70-2 [Brachypodium 
distachyon]
Length=599

 Score =   367 bits (942),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 261/526 (50%), Positives = 363/526 (69%), Gaps = 26/526 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             L L+H +DP  +EL  L+N++++K+RELG AQ+E K LR +E+ ++KA+EEL  E+++L+
Sbjct  36    LTLMHGSDPLKVELNRLENEVRDKDRELGEAQAEIKALRLSERAREKAVEELTAELEKLD  95

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E L++ KNLE KK  +EKK A+ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  96    EKLKLTEALLDSKNLELKKTNDEKKAAMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  155

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQED RA++R  K KEAALLEAE+ +++AL +  +V+++QN+N +L 
Sbjct  156   EAELKLARQEIAKLQEDNRALDRLTKQKEAALLEAEKTVQTALAKAAMVDDMQNKNQDLM  215

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILD+ +RQKV EVE+LSQT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  216   KQIEICQEENKILDRLHRQKVAEVEKLSQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  275

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+ L+RELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  276   ERKVLDRELARTKVTANRVAVVVANEWKDGNDKVMPVKQWLEERRFLQGEMQQLRDKLAI  335

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILSSKKR  912
             +ERTA++EAQ+K+K + RLK LE GL+   + +  P    G S    ++    +  +   
Sbjct  336   AERTARSEAQVKEKYQWRLKVLEDGLRGPPSGSSRPPT-EGKSISNVSSRRLSLGGADNL  394

Query  911   SASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYS---------RNKIDEKENAGM  759
             S + P   +   +    S S  S   +   K   G   S         R K+       +
Sbjct  395   SKTSPNGVLARRSPSFNSRSSLSASSSLVLKHAKGTSRSFDGGTRSLDRGKVLGNGPHLL  454

Query  758   KENSDKLTD--------SGNFSKNDE-------DMVSGFLYDRLQKEVINMRKCFDMKEN  624
               ++D + D        +G   K+ E       DMVSG LYD LQKEV+++RK    K+ 
Sbjct  455   NRSTDAVRDCETTDNWKAGTEEKSSETANSDSTDMVSGVLYDMLQKEVVSLRKACHEKDQ  514

Query  623   DLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
              L  KD+ I+ML KK++TLTKA+EVE++K +RE A  EK+ S I+ 
Sbjct  515   SLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREVAAMEKEVSAIRL  560



>gb|EMT08820.1| hypothetical protein F775_15881 [Aegilops tauschii]
Length=569

 Score =   365 bits (938),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 265/558 (47%), Positives = 381/558 (68%), Gaps = 46/558 (8%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + L+H +DP  +ELT L+N+L++KERELG A +E + LR +E+ ++KA+EEL +E++R++
Sbjct  1     MALMHGSDPVRVELTRLENELRDKERELGEAHTEMRALRLSERAREKAVEELTDELERMD  60

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E  ++ KNLE KK+ +EKK A+ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  61    EKLKLTEYHLDNKNLEVKKINDEKKAAMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  120

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQED RA++R  K KEAALLEAER ++ A+ +  +V+++QN+N +L 
Sbjct  121   EAELKLSRQEIAKLQEDNRALDRLTKQKEAALLEAERTVQIAMAKAAMVDDLQNKNQDLM  180

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEIC EENKILDK +RQKV EVE+LSQT+ ELEE++LAGGAAAN +RDY+R++ E+ +
Sbjct  181   KQIEICHEENKILDKLHRQKVAEVEKLSQTVRELEESVLAGGAAANAVRDYQRKVQEMND  240

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR +Q EMQ+L+DKLA+
Sbjct  241   ERKTLDRELARAKVTANRVAVVVANEWKDSNDKVMPVKQWLEERRFMQGEMQQLRDKLAV  300

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKV--------------LSGFSKPE  954
             +ERTA++EAQLK+K +LRLK LE GL+   + +  P                L G     
Sbjct  301   AERTARSEAQLKEKYQLRLKVLEDGLRGPPSGSSRPPTEGKSFSNGPSRRLSLGGADNMS  360

Query  953   KANHLFGILSSKKRSASQPRASMVNTTseqesssensgEYN------DQKKRH----HGL  804
             K +   G+L+ +  S     +   +++   + +   S  ++      D+ K H    H L
Sbjct  361   KVSP-NGLLTRRSPSFHSRSSLSSSSSLILKHAKGTSKSFDGGTRSLDRGKVHGNGSHLL  419

Query  803   WYSRNKIDEKE-NAGMKENSDKLTDSGNFSKNDE-----------DMVSGFLYDRLQKEV  660
               S + + ++E N G K   D+ T+    S  D+           +MVSGFLY+ LQKEV
Sbjct  420   NKSTDAVKDREANDGWKGTVDEGTNESPNSNADQRSNETTNSNSIEMVSGFLYNMLQKEV  479

Query  659   INMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKY  480
             +++RK    K+  L  KD+ I+ML KK++TLTKA+EVE++K +RE A  EK+ + ++   
Sbjct  480   VSLRKACHEKDQSLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREVAAMEKEVAAMRVDK  539

Query  479   D--------GNIRQTNSS  450
             D        GN + + SS
Sbjct  540   DQEIKARRLGNSKGSGSS  557



>ref|XP_010424948.1| PREDICTED: microtubule-associated protein 70-3 isoform X2 [Camelina 
sativa]
Length=629

 Score =   367 bits (943),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 258/532 (48%), Positives = 370/532 (70%), Gaps = 23/532 (4%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N +++K+REL  +Q+E K LR +E+ ++KA+EEL  E+ ++ 
Sbjct  67    ITLLHGSDPVKIELNRLENDVRDKDRELSESQAEIKALRLSERQREKAVEELTEELGKMS  126

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++ENL++ KNLE KK+  EK+ ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  127   EKLKLTENLLDSKNLEIKKINEEKRASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  186

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQ+D RA++R  KSKEAALL+AER ++SAL +  +V+++QN+N EL 
Sbjct  187   EAELKLARHEIVKLQDDNRALDRLTKSKEAALLDAERTVQSALAKASMVDDLQNKNQELM  246

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEEN+ILD+ +RQKV EVE+ +QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  247   KQIEICQEENRILDRMHRQKVAEVEKFTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNE  306

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ERR L+RELAR KVSA+RVAT+VANEWKD +DKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  307   ERRVLDRELARAKVSASRVATVVANEWKDGSDKVMPVKQWLEERRFLQGEMQQLRDKLAI  366

Query  1091  SERTAKAEAQlkdklklrlktLEQGLK--QTGNNNVNPKVLSGFSKPEKANHLFGI----  930
             ++R AK+EAQLK+K +LRL+ LE+ L+   +G N   P+  S  + P +   + G     
Sbjct  367   ADRAAKSEAQLKEKFQLRLRVLEESLRGPPSGGNRSTPEGRSISNGPSRRQSIGGADIIP  426

Query  929   ------LSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHG---------LWYS  795
                     SK+  +SQ R+   +T++  + +   S  ++   +   G           + 
Sbjct  427   KLTSNGFFSKRTPSSQFRSLNASTSTILKHAKGTSRSFDGGSRSLDGSKLLTNEPRSKFP  486

Query  794   RNKIDEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLN  615
              N+  E ++     NS K  +S   + N+ D V G L+D LQKEV+ +RK    K+  L 
Sbjct  487   VNQSSEGKSGDESPNSTKQGESDKAAANN-DSVPGVLHDLLQKEVVTLRKASHDKDQSLR  545

Query  614   TKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQT  459
              KDE I+ML KK+ETLTKA+EVE++K +RE A  EK+ S ++    G+  +T
Sbjct  546   DKDEAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVSAMRVDNKGSDSRT  597



>ref|XP_006395855.1| hypothetical protein EUTSA_v10003816mg [Eutrema salsugineum]
 gb|ESQ33141.1| hypothetical protein EUTSA_v10003816mg [Eutrema salsugineum]
Length=631

 Score =   367 bits (941),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 259/533 (49%), Positives = 371/533 (70%), Gaps = 23/533 (4%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+REL  +Q+E K LR +E+ ++KA+EEL  E+ ++ 
Sbjct  66    ITLLHGSDPVKVELNRLENEVRDKDRELSESQAEIKALRLSERQREKAVEELTEELGKMS  125

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++ENL+E KNLE +K+  EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  126   EKLKLTENLLESKNLEIRKINEEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  185

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQ+D RA++R  KSKEAALL+AER +++AL +  +V+++QN+N EL 
Sbjct  186   EAELKLARHEIVKLQDDNRALDRLTKSKEAALLDAERTVQTALAKASMVDDLQNKNQELM  245

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEEN+ILD+ +RQKV EVE+ +QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  246   KQIEICQEENRILDRLHRQKVAEVEKFTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNE  305

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ERR L+RELAR KVSA+RVAT+VANEWKD +DKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  306   ERRILDRELARAKVSASRVATVVANEWKDGSDKVMPVKQWLEERRFLQGEMQQLRDKLAI  365

Query  1091  SERTAKAEAQlkdklklrlktLEQGLK--QTGNNNVNPKVLSGFSKPEKANHLFGI----  930
             ++R AK+EAQLK+K +LRL+ LE+ L+   +  N   P   S  + P +   L G     
Sbjct  366   ADRAAKSEAQLKEKFQLRLRVLEESLRGPSSSGNRATPDGRSISNGPSRRQSLGGADIIP  425

Query  929   ------LSSKKRSASQPRASMVNTTseqesssensgEYN------DQKKRHHGLWYSRNK  786
                     SK+  +SQ R+   + ++  + +   S  ++      D+ K       S+  
Sbjct  426   KLTSNGFFSKRTPSSQFRSLNASASTVLKHAKGTSRSFDGGSRSLDRSKPLINEPVSKFP  485

Query  785   IDEKENAGMKE----NSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDL  618
             ++ + + G  E    NS K  DS   +  + D V G L+D LQKEVI +RK  + K+  L
Sbjct  486   MNHQSSEGTSEGESPNSSKQGDSEKPAGTNSDSVPGVLHDLLQKEVITLRKAANDKDQSL  545

Query  617   NTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQT  459
               KDE I+ML +K+ETLTKA+EVE++K +RE A  EK+ S ++    G+  +T
Sbjct  546   RDKDEAIEMLARKVETLTKAMEVEAKKMRREVAAMEKEVSAMRVDNKGSDNRT  598



>ref|XP_006343174.1| PREDICTED: microtubule-associated protein 70-2-like isoform X2 
[Solanum tuberosum]
Length=622

 Score =   366 bits (940),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 272/527 (52%), Positives = 377/527 (72%), Gaps = 28/527 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  LEL  L+N++++K+REL  AQ+E K LR +E+L++KA+EEL +E+ R++
Sbjct  60    MTLLHGSDPVKLELNRLENEVRDKDRELSEAQAEIKALRLSERLREKAVEELTDELTRVD  119

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  120   EKLKLTESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  179

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++E A LQ+D +A++R  KSKEAALL+AER ++SAL +  +V+++QN+N EL 
Sbjct  180   EAELKLARHETAKLQDDNKALDRLTKSKEAALLDAERTVQSALAKASMVDDLQNKNQELM  239

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILD+ +RQKV EVE+L+Q++ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  240   KQIEICQEENKILDRMHRQKVAEVEKLTQSVRELEEAVLAGGAAANAVRDYQRKVQEMNE  299

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERRILQ EMQ+L+DKLAI
Sbjct  300   ERKTLDRELARAKVTANRVATVVANEWKDANDKVMPVKQWLEERRILQGEMQQLRDKLAI  359

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPK-VLSGFSKPEKANHLFGI-----  930
             +ERTAK+EA LKDK +LRLK LE+ L+ +  ++ N     S  + P +   L G      
Sbjct  360   TERTAKSEALLKDKYQLRLKVLEETLRPSSTSSRNTTDGRSSSNGPSRRQSLGGAESISK  419

Query  929   LSS----KKRSAS-QPRASMVNTTseqesssensgEYN----DQKKRHHGL----WYSRN  789
             L+S     KRS S Q R+S  +T  +    +  S +      D+ K+   +    + S  
Sbjct  420   LTSNGFLPKRSPSFQLRSSGSSTILKHAKGTSKSFDGGSRSLDRGKKLLNVTGPNFNSSK  479

Query  788   KID-----EKENAGMKENSD-KLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKE  627
              +D     E E+   K N D K TD        ED V G LYD LQKEV+ +RK    K+
Sbjct  480   SVDGAKDNETESTSWKSNQDEKRTDLP--VTETEDTVPGLLYDLLQKEVVALRKAGHEKD  537

Query  626   NDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
               L  KD+ I+ML KK+ETLTKA+EVE++K +RE +  EK+ + ++ 
Sbjct  538   QSLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVSAMEKEVAAMRV  584



>ref|XP_010273713.1| PREDICTED: microtubule-associated protein 70-1-like [Nelumbo 
nucifera]
Length=642

 Score =   367 bits (942),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 267/547 (49%), Positives = 377/547 (69%), Gaps = 32/547 (6%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             LLH +DP  +EL  L+N++++K+RELG AQ+E K L+ +E+L++KA+EEL  E+ ++E K
Sbjct  76    LLHGSDPVKVELNRLENEVRDKDRELGEAQAEIKALKLSERLREKAVEELTEELSKVEAK  135

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APLEA
Sbjct  136   LKLTESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEA  195

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+ + E+  LQ+D +A++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL +Q
Sbjct  196   ELKLARQEVTKLQDDNKALDRLTKSKEAALLEAERTVQVALAKASMVDDLQNKNQELMKQ  255

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILDK +RQKV EVE+LSQT+ ELEEA+LAGGAAAN +RDY+R++ E+ EER
Sbjct  256   IEICQEENKILDKMHRQKVAEVEKLSQTVRELEEAVLAGGAAANAVRDYQRKVQEMNEER  315

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             +TL+RELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI+E
Sbjct  316   KTLDRELARAKVTANRVAVVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLAITE  375

Query  1085  RTAKAEAQlkdklklrlktLEQGLKQTGNNN--VNPKVLSGFSKPEKANHLF--------  936
             RTAK+EAQLK+K  LRLK LE+ L+   N+    + +  S  + P +   L         
Sbjct  376   RTAKSEAQLKEKYHLRLKVLEESLRAPSNSGSRTSSEGRSVSNGPSRRQSLGGADNFSKL  435

Query  935   ---GILSSKKRSASQPRASMVNTTseqesssensgEYNDQKKR---------HHGLWYSR  792
                G LS +  S+    +    T++  + +   S  ++   +            G  Y+ 
Sbjct  436   TSNGFLSKRMPSSQLRSSISSGTSALLKHAKGTSKSFDGGTRSLDRGKVLLNGAGCNYAL  495

Query  791   NKIDEKEN------AGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMK  630
             NK  +  N         K N+D+  +    +   ED VSG LYD LQKEVI++RK    K
Sbjct  496   NKSSDGTNRDSGAVGDWKGNADEKPNEFPPTVETEDSVSGLLYDLLQKEVISLRKACHEK  555

Query  629   ENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY--KYDGNIRQTN  456
             +  L  KD+ I+ML KK++TLTKA+EVE++K +RE A  EK+ + ++   ++D   ++  
Sbjct  556   DQSLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREVAAMEKEVAAMRVEKEHDNRAKRLG  615

Query  455   SSLKSSI  435
             SS K S+
Sbjct  616   SS-KGSV  621



>ref|XP_006343175.1| PREDICTED: microtubule-associated protein 70-2-like isoform X3 
[Solanum tuberosum]
Length=619

 Score =   366 bits (940),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 272/527 (52%), Positives = 377/527 (72%), Gaps = 28/527 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  LEL  L+N++++K+REL  AQ+E K LR +E+L++KA+EEL +E+ R++
Sbjct  60    MTLLHGSDPVKLELNRLENEVRDKDRELSEAQAEIKALRLSERLREKAVEELTDELTRVD  119

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  120   EKLKLTESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  179

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++E A LQ+D +A++R  KSKEAALL+AER ++SAL +  +V+++QN+N EL 
Sbjct  180   EAELKLARHETAKLQDDNKALDRLTKSKEAALLDAERTVQSALAKASMVDDLQNKNQELM  239

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILD+ +RQKV EVE+L+Q++ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  240   KQIEICQEENKILDRMHRQKVAEVEKLTQSVRELEEAVLAGGAAANAVRDYQRKVQEMNE  299

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERRILQ EMQ+L+DKLAI
Sbjct  300   ERKTLDRELARAKVTANRVATVVANEWKDANDKVMPVKQWLEERRILQGEMQQLRDKLAI  359

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPK-VLSGFSKPEKANHLFGI-----  930
             +ERTAK+EA LKDK +LRLK LE+ L+ +  ++ N     S  + P +   L G      
Sbjct  360   TERTAKSEALLKDKYQLRLKVLEETLRPSSTSSRNTTDGRSSSNGPSRRQSLGGAESISK  419

Query  929   LSS----KKRSAS-QPRASMVNTTseqesssensgEYN----DQKKRHHGL----WYSRN  789
             L+S     KRS S Q R+S  +T  +    +  S +      D+ K+   +    + S  
Sbjct  420   LTSNGFLPKRSPSFQLRSSGSSTILKHAKGTSKSFDGGSRSLDRGKKLLNVTGPNFNSSK  479

Query  788   KID-----EKENAGMKENSD-KLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKE  627
              +D     E E+   K N D K TD        ED V G LYD LQKEV+ +RK    K+
Sbjct  480   SVDGAKDNETESTSWKSNQDEKRTDLP--VTETEDTVPGLLYDLLQKEVVALRKAGHEKD  537

Query  626   NDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
               L  KD+ I+ML KK+ETLTKA+EVE++K +RE +  EK+ + ++ 
Sbjct  538   QSLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVSAMEKEVAAMRV  584



>ref|XP_009404137.1| PREDICTED: microtubule-associated protein 70-1 [Musa acuminata 
subsp. malaccensis]
Length=621

 Score =   366 bits (940),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 263/525 (50%), Positives = 368/525 (70%), Gaps = 31/525 (6%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             +LH +DP  +EL  L+N++++++REL  AQ+E K LR +E+ ++KA+EEL  EV +++EK
Sbjct  64    MLHGSDPVRVELCRLENEVRDRDRELSEAQAEIKALRLSERAREKAVEELTEEVNKMDEK  123

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK++E+L+E +NLE KK+ +EKK AL AQ+AAEA LRRV+A QK+DD  PIE+++APLEA
Sbjct  124   LKLTESLLENRNLEIKKINDEKKAALAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEA  183

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+ + EIA LQ+D RA++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL +Q
Sbjct  184   ELKLARQEIAKLQDDNRALDRLTKSKEAALLEAERTVQIALAKASMVDDLQNKNQELMKQ  243

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILDK +RQKV EVE+LSQT+ ELEEA+LAGGAAAN +RDY+R++ E+ +E 
Sbjct  244   IEICQEENKILDKMHRQKVAEVEKLSQTVRELEEAVLAGGAAANAVRDYQRKVQEMNDEM  303

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             +TL+REL+R KVSANRVA +VANEWKD NDKVMPVKQWLEERR +Q EMQ+L+DKL I+E
Sbjct  304   KTLDRELSRAKVSANRVAVVVANEWKDSNDKVMPVKQWLEERRFMQGEMQQLRDKLVIAE  363

Query  1085  RTAKAEAQlkdklklrlktLEQGLKQTGNNNV-----NPKVLSGFSK----------PEK  951
             RTA++EAQLK+K +LRLK LE G + + +           V +G S+          P+ 
Sbjct  364   RTARSEAQLKEKFQLRLKVLEDGSRMSASGTYRTTIEGKSVSNGPSRRQSLGGADNVPKS  423

Query  950   ANHLFGILSSKKRSASQPRASMVNTTseqesssensg------EYNDQKKRHHGLWYSRN  789
              N   G LS  KR + Q R+S+ ++T  + +   +          +  K    G   S N
Sbjct  424   VN---GFLS--KRPSFQMRSSVSSSTVLKHAKGASKSFDGGTRSLDRSKVLLTGAGLSLN  478

Query  788   KIDEKENAGMKENS-DKLTD--SGNFSKND-EDMVSGFLYDRLQKEVINMRKCFDMKEND  621
             +  +    G+   S  K+ D  + +F   D +D VSG LYD LQKEVI +RK    K+  
Sbjct  479   RSSDATGDGVTHESWKKIPDEKTNDFPNVDSDDCVSGLLYDMLQKEVITLRKACHEKDQS  538

Query  620   LNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
             L  KD+ I+ML KK++ LTKA+EVE++K +RE A  EK+ + ++ 
Sbjct  539   LKDKDDAIEMLAKKVDMLTKAMEVEAKKMRREVAAMEKEVAAMRV  583



>ref|XP_002311531.1| hypothetical protein POPTR_0008s13450g [Populus trichocarpa]
 gb|EEE88898.1| hypothetical protein POPTR_0008s13450g [Populus trichocarpa]
Length=619

 Score =   366 bits (939),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 264/523 (50%), Positives = 369/523 (71%), Gaps = 23/523 (4%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+RELG AQ+E K LR +E+L++KA+EEL +E+ +++
Sbjct  57    MTLLHGSDPVKVELNRLENEVRDKDRELGEAQAEIKALRFSERLREKAVEELTDELSKVD  116

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK+ E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  117   EKLKLMESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  176

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAAL+EAER ++ AL +  +V+++QN+N EL 
Sbjct  177   EAELKLARQEIAKLQDDNKALDRLTKSKEAALIEAERTVQVALAKASMVDDLQNKNQELM  236

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  237   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  296

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  297   ERKTLDRELARAKVTANRVATVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLAI  356

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFS-KPEKANHLFGILSSKK  915
             +ERTAK+EAQLK+K +LRLK LE+ L+ + +NN +     G S  P +   L G  +  K
Sbjct  357   TERTAKSEAQLKEKYQLRLKVLEESLRGSSSNNRSTPEGRGISNGPSRRQSLGGADNISK  416

Query  914   RSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKI------DEKENAGMKE  753
              +++   +    + S   S+S          K   G   S ++          +N    +
Sbjct  417   LTSNGFLSKRTQSRSLSSSTSSVLKHAKGTSKSFDGGTRSLDRSRKLLLNGAGQNHSFNQ  476

Query  752   NSDKLTDS-------GN-------FSKND-EDMVSGFLYDRLQKEVINMRKCFDMKENDL  618
               D   D+       GN       F   D ED V G LY+ LQK+V+ +RK    K+  L
Sbjct  477   PCDGTKDTETPSPWKGNSDEKPNEFPLADTEDSVPGILYELLQKQVVALRKAGHEKDQSL  536

Query  617   NTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIK  489
               KD+ I+ML KK+ETLTKA+EVE++K +RE A+ EK+ + ++
Sbjct  537   KDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAVMEKEVAAMR  579



>ref|XP_010673027.1| PREDICTED: microtubule-associated protein 70-1-like [Beta vulgaris 
subsp. vulgaris]
Length=589

 Score =   365 bits (936),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 272/575 (47%), Positives = 391/575 (68%), Gaps = 26/575 (5%)
 Frame = -3

Query  2099  VVSPPSDTSLVACNN*AKREGIEIKMAAGYEEVGVAELCLLH-TDPFILELTSLQNQLKE  1923
             V + P+  +  A     K+ G   ++ +  E+V    +  LH +DP  +ELT L+N+++E
Sbjct  6     VTAAPARLTSSASFKYRKKSGGHSRVNSEVEDV----VHFLHGSDPVRVELTRLENEVRE  61

Query  1922  KERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKLKISENLVEQKNLETKKLINE  1743
             K+RELG   +E K LR +E+LK+KA+EEL  E+++++ KLK +E ++E KNLE KK+  E
Sbjct  62    KDRELGETHAEIKALRHSERLKEKAVEELDEELQKVDGKLKATEAVLESKNLEIKKINEE  121

Query  1742  KKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEIKMYKNEIAALQEDKRAMER  1563
             KK AL AQ+AAEA LRRV+A QK+DD  PIE+++APLEAE+K+ K EIA LQ+D RA++R
Sbjct  122   KKAALAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEAELKLAKQEIAKLQDDNRALDR  181

Query  1562  HNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIEICQEENKILDKTNRQKVLE  1383
               KSKEAALLEAE+ ++ A+ +  +V+++QN+N EL +QIEICQEENKI+DK +RQKV E
Sbjct  182   LTKSKEAALLEAEKTIEMAMAKASLVDDLQNKNQELMKQIEICQEENKIVDKMHRQKVAE  241

Query  1382  VERLSQTileleeailaggaaANTIRDYrrqiseiqeerrtlerelaRVKVSANRVATIV  1203
             VE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ EE++TL+RELAR KV+ANRVAT+V
Sbjct  242   VEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNEEKKTLDRELARAKVNANRVATVV  301

Query  1202  ANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktLE  1023
             ANEWKD NDKVMPVKQWLEER+  Q EMQ+L+DKLA++ERTAKAEAQLK+K +LR K LE
Sbjct  302   ANEWKDGNDKVMPVKQWLEERKYYQGEMQQLRDKLAVAERTAKAEAQLKEKYQLRFKVLE  361

Query  1022  QGLKQTGNNN---VNPKVLSGFSKPEKANHLFGI-----LSS---KKRSASQPRASMVNT  876
             + L+   + N   V P+  S  S   +   L G+     L+S    KR+   P  ++ + 
Sbjct  362   ERLRTPASVNPSRVTPERRSISSGRSRRQSLGGVENFSRLASNGTSKRTTISPSGTLRSN  421

Query  875   Tseq--esssensgEYNDQKKRHHG------LWYSRNKIDEKENAGMKENSDKLTDSGNF  720
             ++    +++  +S  ++   K   G         + N ID+ +N   KE+   L +    
Sbjct  422   SAVALLKNAKNSSLSFDGGDKSQGGKPCPTMAIATSNGIDKIQNGSQKEDDHNLVE--KT  479

Query  719   SKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESR  540
               N +D VSG LYD LQKEV+++RK    K   +  KD+ I+ML+KK+ETL KA+EVE++
Sbjct  480   KTNCDDYVSGALYDMLQKEVVSLRKACHEKAQSIKDKDDAIEMLSKKVETLNKAMEVEAK  539

Query  539   KTKREAAIREKDSSTIKYKYDGNIRQTNSSLKSSI  435
             K +RE A  EK+ S ++   + + R    S+   +
Sbjct  540   KMRREVAAMEKEVSAMRMNKENDQRNRRMSMARGV  574



>ref|NP_178284.1| microtubule-associated protein 70-3 [Arabidopsis thaliana]
 sp|Q9ZUA3.1|MP703_ARATH RecName: Full=Microtubule-associated protein 70-3; Short=AtMAP70-3; 
AltName: Full=70 kDa microtubule-associated protein 3 
[Arabidopsis thaliana]
 gb|AAD12697.1| putative myosin heavy chain-like protein [Arabidopsis thaliana]
 emb|CAJ31080.1| 70 kDa microtubule associated protein Type 3 [Arabidopsis thaliana]
 gb|AEC05492.1| microtubule-associated protein 70-3 [Arabidopsis thaliana]
Length=629

 Score =   366 bits (939),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 261/532 (49%), Positives = 369/532 (69%), Gaps = 22/532 (4%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N +++K+REL  +Q+E K LR +E+ ++KA+EEL  E+ ++ 
Sbjct  66    ITLLHGSDPVKVELNRLENDVRDKDRELSESQAEIKALRLSERQREKAVEELTEELGKMS  125

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++ENL++ KNLE KK+  EK+ ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  126   EKLKLTENLLDSKNLEIKKINEEKRASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  185

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQ+D RA++R  KSKEAALL+AER ++SAL +  +V+++QN+N EL 
Sbjct  186   EAELKLARHEIVKLQDDNRALDRLTKSKEAALLDAERTVQSALAKASMVDDLQNKNQELM  245

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEEN+ILDK +RQKV EVE+ +QT+ ELEEA+LAGG AAN +RDY+R+  E+ E
Sbjct  246   KQIEICQEENRILDKLHRQKVAEVEKFTQTVRELEEAVLAGGTAANAVRDYQRKFQEMNE  305

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ERR L+RELAR KVSA+RVAT+VANEWKD +DKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  306   ERRILDRELARAKVSASRVATVVANEWKDGSDKVMPVKQWLEERRFLQGEMQQLRDKLAI  365

Query  1091  SERTAKAEAQlkdklklrlktLEQGLK--QTGNNNVNPKVLSGFSKPEKANHLFGI----  930
             ++R AK+EAQLK+K +LRL+ LE+ L+   +  N   P+  S  + P +   L G     
Sbjct  366   ADRAAKSEAQLKEKFQLRLRVLEESLRGPSSSGNRSTPEGRSMSNGPSRRQSLGGADIIP  425

Query  929   ------LSSKKRSASQPRASMVNTTseqesssensgEYNDQKK---RHHGLW------YS  795
                     SK+  +SQ R+   +T++  + +   S  ++   +   R   L       + 
Sbjct  426   KLTSNGFFSKRSPSSQFRSLNASTSTILKHAKGTSRSFDGGSRSLDRSKVLTNEPRSKFP  485

Query  794   RNKIDEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLN  615
              N+  E  + G   NS K  DS   +  + D V G L+D LQKEVI +RK  + K+  L 
Sbjct  486   LNQSSEGTSGGGSPNSTKQGDSEKAAGTNNDSVPGVLHDLLQKEVITLRKAANDKDQSLR  545

Query  614   TKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQT  459
              KDE I+ML KK+ETLTKA+EVE++K +RE A  EK+ S ++    G+  +T
Sbjct  546   DKDEAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVSAMRVDNKGSDSRT  597



>ref|XP_009380076.1| PREDICTED: microtubule-associated protein 70-1-like [Musa acuminata 
subsp. malaccensis]
Length=621

 Score =   366 bits (939),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 261/525 (50%), Positives = 371/525 (71%), Gaps = 31/525 (6%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             LLH +DP  +EL  L+N++++K+REL  +Q+E K LR +E+ ++KA+EEL  E+ +++EK
Sbjct  64    LLHGSDPVKVELNRLENEVRDKDRELSESQAEIKALRLSERAREKAVEELTEELNKMDEK  123

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK++E+L+E +NLE K++ +EKK AL AQ+AAEA LRRV+A+QK+DD  PIE+++APLEA
Sbjct  124   LKLTESLLENRNLEIKRINDEKKAALAAQFAAEATLRRVHADQKDDDMPPIEAILAPLEA  183

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+ + EIA LQ+D RA++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL +Q
Sbjct  184   ELKLSRQEIAKLQDDNRALDRLTKSKEAALLEAERTVQIALAKASMVDDLQNKNQELMKQ  243

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILDK +RQKV EVE+LSQT+ ELEEA+LAGGAAAN +RDY+R++ E+ EE 
Sbjct  244   IEICQEENKILDKMHRQKVAEVEKLSQTVRELEEAVLAGGAAANAVRDYQRKVQEMSEEM  303

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             +TL+RELAR KV+ANRVA +VANEWKD +DKVMPVKQWLEERR +Q EMQ+L+DKLAI+E
Sbjct  304   KTLDRELARAKVTANRVAVVVANEWKDASDKVMPVKQWLEERRFMQGEMQQLRDKLAITE  363

Query  1085  RTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFS---KPEKANHLF-------  936
             RTA++EAQLK+K ++RLK LE+GL+ +   + N  ++ G S    P +   L        
Sbjct  364   RTARSEAQLKEKFQVRLKVLEEGLRMSAGGS-NRTIVEGKSVSNGPSRRQSLGGAENVPK  422

Query  935   ---GILSSKKRSASQPRASMVNTTseqesssensg------EYNDQKKRHHGLWYSRNKI  783
                G LS  KR + Q R+S+ ++   + +   +          +  K   +G   S N+ 
Sbjct  423   SVNGFLS--KRPSFQMRSSLSSSMVLKHAKGASKSFDGGTRSLDRSKALLNGASLSLNRS  480

Query  782   DEKENAGMKENS------DKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKEND  621
              +     +  NS      +K  +  N   + +D VSG LYD LQKEVI +RK    K+  
Sbjct  481   SDATAENISHNSWKEIPEEKTNELSNV--DSDDCVSGLLYDMLQKEVITLRKACHEKDQS  538

Query  620   LNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
             L  KD+ I+ML KK++TLTKA+EVE++K +RE A  EK+ + ++ 
Sbjct  539   LKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREVAAMEKEVAAMRV  583



>ref|XP_010243834.1| PREDICTED: microtubule-associated protein 70-1-like [Nelumbo 
nucifera]
Length=600

 Score =   365 bits (937),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 272/538 (51%), Positives = 379/538 (70%), Gaps = 30/538 (6%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             LLH +DP  +EL  L+N++++KERELG AQ+E K L+ +E+LK+KA+EEL +E+K++E K
Sbjct  46    LLHGSDPVKVELNRLENKVRDKERELGEAQAEIKVLKYSERLKEKAVEELTDELKKVEGK  105

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK ++ L+E KNLETKK+ +EKK AL AQ+AAEA LRRV+A QK+DD  PIE++I PLEA
Sbjct  106   LKATDILLENKNLETKKINDEKKAALAAQFAAEATLRRVHAAQKDDDMPPIEAIITPLEA  165

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+ + E+A +Q+D RA++R  KSKEAALLEAERI++ AL +  +VE +QN+N EL +Q
Sbjct  166   ELKLARLEVAKIQDDNRALDRLTKSKEAALLEAERIVQIALAKASLVENLQNKNQELMKQ  225

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILDK +RQKV EVE+LSQT+ ELEEA+LAGGAAAN +RDY+R++ E+ EER
Sbjct  226   IEICQEENKILDKMHRQKVAEVEKLSQTVHELEEAVLAGGAAANAVRDYQRKVQEMNEER  285

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             + L+RELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR  Q EMQ+L+DKLA++E
Sbjct  286   KILDRELARAKVTANRVAVVVANEWKDANDKVMPVKQWLEERRFFQGEMQQLRDKLAVAE  345

Query  1085  RTAKAEAQlkdklklrlktLEQGLKQTGNNN---VNPKVLSGFSKPEKANHLFGILS---  924
             R A++EAQLK++ +LRLK LE+GL+ + + N    + +++S  + P +   L G+ S   
Sbjct  346   RAARSEAQLKERYQLRLKVLEEGLRHSPSVNGRTTSERIIS--NGPSRRQSLGGVESFSR  403

Query  923   ------SKKRSASQPRASM-VNTTseqesssensgEYNDQKKR---HHGLWYSRNKIDEK  774
                   S +RS++   A++  N+ S    + + S    D   R      +   R+  D  
Sbjct  404   NYADGFSSRRSSNLRLATVSSNSASALLKNVKCSSRSFDGGSRSIDRSKVTSDRDGKDTT  463

Query  773   ENA---GMKEN----SDKLTDSG----NFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKE  627
             +N    G++ N    + K T +G    N   + ED VSG LYD LQKEVI +RK    K+
Sbjct  464   DNQTSDGIQSNETASTCKETSNGKPNENMKTDHEDYVSGLLYDMLQKEVITLRKACHEKD  523

Query  626   NDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQTNS  453
               L  KD+ I+ML KK++TL KA+EVE++K +RE A  EK+   ++   D   R+ ++
Sbjct  524   QSLKDKDDAIEMLAKKVDTLNKAMEVEAKKMRREVASMEKEVEAMRANNDPRGRRLSA  581



>ref|XP_006416965.1| hypothetical protein EUTSA_v10007120mg [Eutrema salsugineum]
 gb|ESQ35318.1| hypothetical protein EUTSA_v10007120mg [Eutrema salsugineum]
Length=606

 Score =   365 bits (937),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 265/547 (48%), Positives = 369/547 (67%), Gaps = 25/547 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+REL  +Q+E K LR +E+ ++KA+EEL  E+ ++ 
Sbjct  43    ITLLHGSDPVRIELNRLENEVRDKDRELSESQAEIKALRLSERQREKAVEELTEELGKMA  102

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
              KLK+SENL+E KNLE KK+  EKK ++ AQ+AAEA+LRRV+A QK+DD  PIE+++APL
Sbjct  103   AKLKLSENLLESKNLEIKKINEEKKASMAAQFAAEASLRRVHAAQKDDDMPPIEAILAPL  162

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D ++++R  KSKEAALLEAER ++SAL +  +V+++QN+N EL 
Sbjct  163   EAELKLARQEIAKLQDDNKSLDRLTKSKEAALLEAERTVQSALAKASMVDDLQNKNQELM  222

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKI+DK +RQKV EVE+L Q++ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  223   KQIEICQEENKIIDKMHRQKVAEVEKLMQSVGELEEAVLAGGAAANAVRDYQRKFQEMNE  282

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+ LERELAR KV+ANRVAT+VANEWKD ND+VMPV+QWLEERR LQ EMQ+L+DKLAI
Sbjct  283   ERKILERELARAKVNANRVATVVANEWKDSNDQVMPVRQWLEERRFLQGEMQQLRDKLAI  342

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQ--TGNNNVNPKVLSGFSKPEKANHLFGILSSK  918
             ++R AK+EAQLK+K  LRL+ LE+ LK+  + +N   P   S  + P +   L G  +S 
Sbjct  343   ADRAAKSEAQLKEKFVLRLRVLEESLKRPTSSSNRGTPGGRSSSNGPARRQSLGGAETSP  402

Query  917   K---------RSASQPRASMVNTTseqesssensgEYNDQKKR----------HHGLWYS  795
             K         R+ S    S+  + S     ++ +    D   R            GL   
Sbjct  403   KFTSNGSLTKRTPSTQSRSLTPSASTILKHAKGTSISFDGGTRSLDRNKVLINRPGLNIP  462

Query  794   RNKIDEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLN  615
              N    +   G +  S    +  +    + D VSG LYD LQKEVI +RK    K+  L 
Sbjct  463   LNHQSSEGTCGGESPSPIKGEESDGKSTNNDSVSGVLYDLLQKEVITLRKAAHEKDQSLR  522

Query  614   TKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTI---KYKYDGNIRQTNSSLK  444
              KDE I+ML KK+ETLTKA+EVE++K +RE A+  K+ + +   K + D   R+ +S  K
Sbjct  523   DKDEAIEMLAKKVETLTKAMEVEAKKMRREVAVMGKEVAAMRVDKGQQDSKSRRPSSISK  582

Query  443   SSIKVAK  423
              S   A+
Sbjct  583   GSSNTAQ  589



>ref|XP_003553384.1| PREDICTED: microtubule-associated protein 70-2-like [Glycine 
max]
Length=587

 Score =   364 bits (935),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 273/543 (50%), Positives = 369/543 (68%), Gaps = 33/543 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + L H +DP  +ELT LQN+L+EK+RELG A +E K LR +E+LK+K +EEL +E+ +++
Sbjct  29    ISLFHGSDPVRVELTRLQNELREKDRELGDALAEIKSLRNSERLKEKGVEELTDELIKVD  88

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK +E L+E KNLE KK+  EK+ AL AQ+AAEA LRRV+A QK+D+  PIE++IAPL
Sbjct  89    EKLKAAEALLESKNLEIKKINEEKRAALAAQFAAEATLRRVHAAQKDDEMPPIEAIIAPL  148

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + E+A LQ+D RA+ R  KSKEAALLEAER ++ AL +  +V+++QN+N EL 
Sbjct  149   EAELKLARMEVAKLQDDNRALGRLTKSKEAALLEAERTVQIALAKASLVDDLQNKNQELM  208

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK  RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ +
Sbjct  209   KQIEICQEENKILDKMLRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMND  268

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+ LERE+AR KV+ANRVAT+VANEWKD NDKVMPVKQWLEER+  Q EMQ+L+DKLAI
Sbjct  269   ERKILEREVARAKVTANRVATVVANEWKDANDKVMPVKQWLEERKFFQGEMQQLRDKLAI  328

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSG---FSKPEKANHLFGILS-  924
             +ERTAKAEAQ+K+K +LR K LE+ +K T N N    V  G    + P +     G  S 
Sbjct  329   AERTAKAEAQMKEKYQLRFKVLEERVK-TSNGNSKFTVSDGRNIATGPSRRQSFGGAESL  387

Query  923   ---------SKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKE  771
                      S+K S S+P +   N+ +     ++ S    D   R+  L   R   D   
Sbjct  388   SASSSNGYQSRKTSISRPGSLRSNSANVLLKHAKLSSRSFDGGSRN--LERERPTSDANG  445

Query  770   NAGMKENSDKLT----------DSGNFS------KNDEDMVSGFLYDRLQKEVINMRKCF  639
                M  NS+  T          +S N +        +ED VSG LYD LQKEVI++RK  
Sbjct  446   LDNMPRNSNIQTITSETITTHEESANGTPVKKSKSENEDYVSGMLYDMLQKEVISLRKAC  505

Query  638   DMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQT  459
               K+  L  KD+ I+ML KK++TL+KA+EVE+RK +RE A  EK+ + ++   + + R  
Sbjct  506   HEKDLTLKDKDDAIEMLAKKVDTLSKAMEVEARKMRREVASMEKEVAAMRISKEHDHRAR  565

Query  458   NSS  450
              +S
Sbjct  566   RAS  568



>ref|XP_008381751.1| PREDICTED: microtubule-associated protein 70-1-like [Malus domestica]
Length=619

 Score =   365 bits (937),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 273/559 (49%), Positives = 380/559 (68%), Gaps = 27/559 (5%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             LLH +DP  +EL  L+N++++K+RELG AQ++ K L+ +++ ++KA EEL +E+ ++EEK
Sbjct  62    LLHGSDPVKVELNRLENEVRDKDRELGEAQAQIKALKLSDRAREKACEELTDELSKVEEK  121

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APLEA
Sbjct  122   LKLTESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEA  181

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+ + EIA LQ+D +A++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL +Q
Sbjct  182   ELKLARQEIAKLQDDNKALDRLTKSKEAALLEAERTVQVALAKASMVDDLQNKNQELMKQ  241

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R+  E+ EER
Sbjct  242   IEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNEER  301

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             +TL+RELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI+E
Sbjct  302   KTLDRELARAKVTANRVAVVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLAITE  361

Query  1085  RTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFG------ILS  924
             R AK+EAQLK+K  +RLK LE+ ++    N    +  S  + P +   L G      + S
Sbjct  362   RAAKSEAQLKEKYHMRLKVLEESVRGNSLNRSTAEGRSTSNGPSRRQSLGGADNPPKLTS  421

Query  923   SKKRSASQPRASMVNTTseqesssensgEYNDQKKRH----------HGLWYSRNKIDEK  774
             +   S   P  S+ ++TS     ++ + +  D   R            G  +S N+  E 
Sbjct  422   NGFLSKRAPVRSLTSSTSSVLKHAKGTSKSFDGGTRSLDRGKVNLNGTGPSFSVNQSCEG  481

Query  773   ENAG-----MKENSDKLTDSGNFSKND-EDMVSGFLYDRLQKEVINMRKCFDMKENDLNT  612
                G      K NSD   D   FS  D ED V G LYD LQKEV+ +RK    K+  L  
Sbjct  482   TKDGEAQNNWKGNSD---DKPEFSTVDTEDSVPGVLYDLLQKEVVALRKAGHEKDQSLKD  538

Query  611   KDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY-KYDGNIRQTNSSLKSSI  435
             KD+ I+ML KK++TLTKA+EVE++K +RE A+ EK+ + ++  K   N  +     KSS+
Sbjct  539   KDDAIEMLAKKVDTLTKAMEVEAKKMRREVAVMEKEVAAMRVDKEHENRAKRFGHTKSSV  598

Query  434   KVAKT*DVKQVACSSFASS  378
               A+    + +A S    S
Sbjct  599   SSAQVLSGRGLARSGLTRS  617



>ref|XP_008812973.1| PREDICTED: microtubule-associated protein 70-2-like [Phoenix 
dactylifera]
Length=620

 Score =   365 bits (937),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 258/525 (49%), Positives = 374/525 (71%), Gaps = 29/525 (6%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             LLH +DP  +EL+ L+N++++KERELG   +E K L+ +E+ +++A+EEL  ++ ++EEK
Sbjct  58    LLHGSDPVRVELSRLENEVRDKERELGEVHAEIKALKLSERARERAVEELTEQLAKVEEK  117

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A Q++DD  P+E+++AP+EA
Sbjct  118   LKLTESLLENKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQRDDDIPPLEAILAPVEA  177

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+ + EI  +Q+D RA++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL +Q
Sbjct  178   ELKLARQEIVKIQDDNRALDRLTKSKEAALLEAERTVQIALAKASMVDDLQNKNQELMKQ  237

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILDK +RQKV EVE+LSQT+ ELEEA+LAGGAAAN +R+Y+R++ E+ EER
Sbjct  238   IEICQEENKILDKLHRQKVAEVEKLSQTVRELEEAVLAGGAAANAVRNYQRKVQEMNEER  297

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             +TL+RELAR KV+ANRVA +VANEWKD NDKVMPV+QWLEERR +Q EMQ+L+DKL+I+E
Sbjct  298   KTLDRELARAKVTANRVAVVVANEWKDANDKVMPVRQWLEERRFMQGEMQQLRDKLSIAE  357

Query  1085  RTAKAEAQlkdklklrlktLEQGLKQTG--NNNVNPKVLSGFSKPEKANHLFG--ILSSK  918
             RTA++EAQLK+K +LR+K LE+GL+ +   +++ N +  S  + P +   L G  I+S  
Sbjct  358   RTARSEAQLKEKFQLRIKVLEEGLRMSSSCSSHTNVEGKSASNDPSRRQSLAGAEIVSKS  417

Query  917   KRSASQPR--------ASMVNTTseqesssensgEYNDQKKRH--------HGLWYSRNK  786
               +   PR        +++  +TS     ++ + +  D   R         +G+ +S N+
Sbjct  418   TPNGFLPRRSPSFQLKSTLSRSTSTVLKHAKGTSKSFDGGTRSLDRCKVLANGIGHSLNR  477

Query  785   I-----DEKENAGMKENSD-KLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKEN  624
                   D   N   KEN D K     N   N  D VSG LYD LQKEVI +RK    K+ 
Sbjct  478   SSDGIRDSGTNNSWKENPDEKSVALANADTN--DTVSGLLYDMLQKEVITLRKACHEKDQ  535

Query  623   DLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIK  489
              L  KD+ ++ML KK++TLTKA+EVE++K +RE A+ EK+ + I+
Sbjct  536   CLKDKDDAVEMLAKKVDTLTKAMEVEAKKMRREVAVMEKEVAAIR  580



>ref|XP_010521011.1| PREDICTED: microtubule-associated protein 70-2 [Tarenaya hassleriana]
 ref|XP_010521012.1| PREDICTED: microtubule-associated protein 70-2 [Tarenaya hassleriana]
Length=627

 Score =   365 bits (937),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 269/537 (50%), Positives = 364/537 (68%), Gaps = 42/537 (8%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N+L++KERELG A +E K LR +E+ ++KA+EEL +E+ +LE
Sbjct  58    ITLLHGSDPVKVELNRLENELRDKERELGEAHAEIKALRLSERQREKAVEELTDELAKLE  117

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L++ KNLE KK+  EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  118   EKLKLTESLLDSKNLEIKKINEEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  177

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EI  LQ+D RA++R  K KEAALL+AER +++AL +  +V+++QN+N EL 
Sbjct  178   EAELKLARQEIGKLQDDNRALDRLTKQKEAALLDAERTVQAALAKAAMVDDLQNKNQELM  237

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  238   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  297

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DK AI
Sbjct  298   ERKTLDRELARAKVTANRVATVVANEWKDGNDKVMPVKQWLEERRFLQGEMQQLRDKFAI  357

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQT-------------------------GNNNVN  987
             +ER AK+EAQLK+K +LRLK LE  L+ T                         G +N+ 
Sbjct  358   AERAAKSEAQLKEKFQLRLKVLEDTLRGTSSSSTRNTTEGRSMSNGPSRRQSLGGADNIQ  417

Query  986   PKVLSGF---SKPEKANHLFGILSSKKRSASQPRASMVNTTseqesssensgEYNDQKKR  816
                 +GF     P  A  L   LSS   SA      + N     +S    +   +  K  
Sbjct  418   KLTSNGFLSKKTPAPAPQLRHSLSSNFTSA------LRNVKGTSKSFDGGTRSLDRGKAL  471

Query  815   HHGLW-YSRNKIDEKENAGMKENS------DKLTDSGNFSKNDEDMVSGFLYDRLQKEVI  657
              +G   YS NK  ++   G   NS      ++   S N +   ED V G LYD LQKEVI
Sbjct  472   LNGPGNYSFNKASDEAKEGESPNSWKENPEEEKPPSENPTPVTEDSVPGVLYDLLQKEVI  531

Query  656   NMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
              +RK    K+  L  KD+ I+ML KK+ETLTKA+EVE++K +RE +  EK+ + ++ 
Sbjct  532   ALRKASHEKDQSLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVSAMEKEVAAMRV  588



>ref|XP_007162092.1| hypothetical protein PHAVU_001G123200g [Phaseolus vulgaris]
 gb|ESW34086.1| hypothetical protein PHAVU_001G123200g [Phaseolus vulgaris]
Length=586

 Score =   364 bits (934),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 272/548 (50%), Positives = 371/548 (68%), Gaps = 33/548 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + L H +DP  +ELT LQN+L+EK+RELG A +E K LR +E+LK+K +EEL +E+ +++
Sbjct  29    ITLFHGSDPVRVELTRLQNELREKDRELGDALAEIKSLRNSERLKEKGVEELTDELNKVD  88

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK +E L+E KNLETKK+  EK+ AL AQ+AAEA LRRV+A QK+D+  PIE++IAPL
Sbjct  89    EKLKAAEVLLESKNLETKKINEEKRAALAAQFAAEATLRRVHAAQKDDEMPPIEAIIAPL  148

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + E+A LQ+D RA++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL 
Sbjct  149   EAELKLARMEVAKLQDDNRALDRLTKSKEAALLEAERTVQIALAKASLVDDLQNKNQELM  208

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEE KILDK  RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDYRR++ E+  
Sbjct  209   KQIEICQEEGKILDKMLRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYRRRVQEMNG  268

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+ LERE+AR KV+ANRVAT+VANEWKD NDKVMPVKQWLEER+  Q EMQ+L+DKLAI
Sbjct  269   ERKILEREVARAKVTANRVATVVANEWKDANDKVMPVKQWLEERKFFQGEMQQLRDKLAI  328

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSG---FSKPEKANHLFGI---  930
             +ERTAKAEAQ+K+K +LR K LE+ +K T N N    V  G    + P +     G    
Sbjct  329   AERTAKAEAQMKEKYQLRFKVLEERVK-TSNGNSKFTVSDGRNIATGPSRRQSFGGAESI  387

Query  929   -------LSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKE  771
                      S+K S S+  +   N+ +    +++ S    D   R+  L   R   D   
Sbjct  388   SSSSSNGYLSRKTSISRSGSLRSNSANVLLKNAKLSSRSYDGGSRN--LERERPTSDANR  445

Query  770   NAGMKENSDKLT----------DSGNF------SKNDEDMVSGFLYDRLQKEVINMRKCF  639
                M  N++  T          +S N          +ED VSG LYD LQKEVI++RK  
Sbjct  446   VDNMPTNTNNQTITSETITTHKESANGIPVKKSKAENEDCVSGMLYDMLQKEVISLRKAC  505

Query  638   DMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQT  459
               K+  L  KD+ I+ML KK++TL KA+EVE+RK +RE A  EK+ + ++   + N R  
Sbjct  506   HEKDQTLKDKDDAIEMLAKKVDTLNKAMEVEARKMRREVASMEKEVAAMRISKEHNHRAR  565

Query  458   NSSLKSSI  435
             +S+ ++++
Sbjct  566   SSAPRAAV  573



>ref|XP_010088195.1| hypothetical protein L484_005541 [Morus notabilis]
 gb|EXB32335.1| hypothetical protein L484_005541 [Morus notabilis]
Length=637

 Score =   365 bits (937),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 274/546 (50%), Positives = 379/546 (69%), Gaps = 31/546 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             L LLH +DP  +EL  L+N++++K+RELG AQ+E K LR +E+L++KA+EEL  E+ ++E
Sbjct  55    LNLLHGSDPVKVELNRLENEVRDKDRELGEAQAEIKALRLSERLREKAVEELTEELSKVE  114

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  115   EKLKLTESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  174

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL 
Sbjct  175   EAELKLARQEIAKLQDDNKALDRLTKSKEAALLEAERTVQVALAKASMVDDLQNKNQELM  234

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  235   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  294

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  295   ERKTLDRELARAKVTANRVAVVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLAI  354

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKV--LSGFSKPEKANHLFG-----  933
             +ER AK+EAQLKDK  LRLK LE+ L+ T N++    V   S  + P +   L G     
Sbjct  355   AERAAKSEAQLKDKFHLRLKVLEESLRGTSNSSKGSTVEGRSMSNGPSRRQSLGGADNIS  414

Query  932   -ILSSKKRSASQP--RASMVNTTseqesssensgEYNDQKKR---------HHGLWYSRN  789
              + S+   S   P  R+   +T+S  + +   S  ++   +            G +    
Sbjct  415   KLTSNGFLSKRTPPLRSVSSSTSSVLKHAKGTSKSFDGGTRSLDRGKVLLNGSGNFSFNQ  474

Query  788   KID-----EKENAGMKENSDKLTDSGNFSKND-EDMVSGFLYDRLQKEVINMRKCFDMKE  627
              ID     E  N     + DK T+   F   D ED V G LYD LQKEVI +RK    K+
Sbjct  475   SIDVTKDTEAPNNWKGTSDDKPTE---FPAVDTEDSVPGVLYDLLQKEVIALRKAGHEKD  531

Query  626   NDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY--KYDGNIRQTNS  453
               L  KD+ I+ML KK++TLTKA+EVE++K +RE A  EK+ + ++   +++   ++  S
Sbjct  532   QSLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREVAAMEKEVAAMRVEKEHENRAKRFGS  591

Query  452   SLKSSI  435
             + K S+
Sbjct  592   ATKGSV  597



>gb|AAG03117.1|AC004133_11 F5A9.19 [Arabidopsis thaliana]
Length=640

 Score =   365 bits (937),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 268/520 (52%), Positives = 369/520 (71%), Gaps = 37/520 (7%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+RELG A +E K LR +E+ ++KA+EEL  E+ +L+
Sbjct  67    ITLLHGSDPVKVELNRLENEVRDKDRELGEANAEIKALRLSERQREKAVEELTEELTKLD  126

Query  1811  EKLKISENLVEQK----------NLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDS  1662
             EKLK++E+++E K          NLE KK+  EKK ++ AQ+AAEA LRRV+A QK+DD 
Sbjct  127   EKLKLTESILESKVLHMISTLLQNLEIKKINEEKKASMAAQFAAEATLRRVHAAQKDDDM  186

Query  1661  IPIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVE  1482
              PIE+++APLEAE+K+ ++EI  LQED RA++R  KSKEAALLEAER +++A+ +  +V+
Sbjct  187   PPIEAILAPLEAELKLARSEIGKLQEDNRALDRLTKSKEAALLEAERTVEAAMAKAAMVD  246

Query  1481  EVQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRD  1302
             ++QN+N EL +QIEICQEENKILD+ +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RD
Sbjct  247   DLQNKNQELMKQIEICQEENKILDRMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRD  306

Query  1301  YrrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAE  1122
             Y+R+  E+ EER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ E
Sbjct  307   YQRKFQEMNEERKTLDRELARAKVTANRVATVVANEWKDGNDKVMPVKQWLEERRFLQGE  366

Query  1121  MQRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNV--NPKVLSGFSKPEKA  948
             MQ+L+DKLAI++R AK+EAQLK+K +LRLK LE+ L+ T ++     P+  S  + P + 
Sbjct  367   MQQLRDKLAITDRAAKSEAQLKEKFQLRLKVLEETLRGTSSSATRNTPEARSMSNGPSRR  426

Query  947   NHLFGILS----------SKKRSASQPRASM-VNTTseqesssensgEYNDQKK---RHH  810
               L G  +          SKK  ASQ R S+ +N+TS  +++   S  ++   +   R  
Sbjct  427   QSLGGAENLQKFTSNGALSKKAPASQMRHSLSINSTSVLKNAKGTSKSFDGGTRSVDRGK  486

Query  809   GLW-----YSRNKI--DEKE---NAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEV  660
              L      YS NK   D KE     G KENS++   S +     ED V G LYD LQKEV
Sbjct  487   ALLNGPGNYSFNKATDDSKEAESGNGWKENSEEKPQSEDPEAATEDSVPGVLYDLLQKEV  546

Query  659   INMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESR  540
             +++RK  + K+  L  KD+ I+ML KK+ETLTKA+EVE++
Sbjct  547   VSLRKASNEKDQSLKDKDDAIEMLAKKVETLTKAMEVEAK  586



>ref|XP_006448158.1| hypothetical protein CICLE_v10014625mg [Citrus clementina]
 gb|ESR61398.1| hypothetical protein CICLE_v10014625mg [Citrus clementina]
Length=618

 Score =   364 bits (935),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 260/524 (50%), Positives = 375/524 (72%), Gaps = 23/524 (4%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+REL  AQ+E K LR +E+L++KA+EEL  E+ ++E
Sbjct  62    MTLLHGSDPVKVELNRLENEVRDKDRELVEAQAEIKALRLSERLREKAVEELTEELSKVE  121

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++ENL+E KNLE KK+ +EK+ ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  122   EKLKLAENLIETKNLEIKKINDEKRASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  181

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL 
Sbjct  182   EAELKLARQEIAKLQDDNKALDRLTKSKEAALLEAERTVQVALAKASMVDDLQNKNQELM  241

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  242   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  301

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+D+LAI
Sbjct  302   ERKTLDRELARAKVTANRVATVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDRLAI  361

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNP-----KVLSGFSKPEK---ANHLF  936
             +ERTAK+EAQLK+K  LRLK LE+ L+ + N +         + +G S+ +    A+++ 
Sbjct  362   TERTAKSEAQLKEKYHLRLKVLEESLRGSSNGSGRSTSDGRSISNGSSRRQSLGGADNIS  421

Query  935   GILSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKENAGMK  756
              + S+   S   P +  +++++  + +   S  ++   +    L  S+  ++   N  + 
Sbjct  422   KLTSNGFISKRTPSSRSLSSSTVLKHAKGTSKSFDGGTR---SLDRSKVLLNGSPNQSID  478

Query  755   ENSDKLTDS---GNF--------SKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTK  609
                D  T +   GN         S + ED V G LYD LQKEV+ +RK    K+  L  K
Sbjct  479   ATKDSDTPNTWKGNLEDKPSEFQSTDTEDSVPGVLYDLLQKEVVALRKAGHEKDQSLKDK  538

Query  608   DEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYD  477
             D+ I++L KK++TLTKA+EVE++K +RE A  EK+ + ++ + D
Sbjct  539   DDAIEILAKKVDTLTKAMEVEAKKMRREVAAMEKEVAAMRVEKD  582



>ref|XP_010055945.1| PREDICTED: microtubule-associated protein 70-1-like [Eucalyptus 
grandis]
 gb|KCW90036.1| hypothetical protein EUGRSUZ_A02239 [Eucalyptus grandis]
Length=612

 Score =   363 bits (933),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 266/532 (50%), Positives = 365/532 (69%), Gaps = 25/532 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL+ L+N +++K+RELG A +E K L+ +E+LK+KA+EEL +E+K+++
Sbjct  57    ITLLHGSDPVRVELSRLENGVRDKDRELGDALAEIKALKYSERLKEKAVEELTDELKKVD  116

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
              KLK++E L+E KNLE KK+ +EKKEAL  Q+AAEA LRRV+A QK+D+  PIE++IAPL
Sbjct  117   GKLKVTETLLESKNLEIKKVNDEKKEALAGQFAAEATLRRVHAAQKDDEMPPIEAIIAPL  176

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + E A LQED RA++R  KSKEAALL+AER ++ AL +  +V+++QN+N EL 
Sbjct  177   EAELKLARLEAARLQEDNRALDRLTKSKEAALLDAERTIEIALAKAALVDDLQNKNQELM  236

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  237   KQIEICQEENKILDKMHRQKVSEVEKLMQTVRELEEAVLAGGAAANAVRDYQRRVQEMNE  296

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TLERE+AR KVSANRVAT+VANEWKD NDKVMPVKQWLEERR  Q EMQ+L+DKLA+
Sbjct  297   ERKTLEREVARAKVSANRVATVVANEWKDGNDKVMPVKQWLEERRFFQGEMQQLRDKLAV  356

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNN----------NVNPKVLSGFSKPEKANH  942
             +ERTAKAEAQLK+K +LR K LE+ LK +  N          N + + LS     E  + 
Sbjct  357   AERTAKAEAQLKEKYQLRFKVLEEKLKGSNGNARMHSEGKSTNGHARRLS-LGGLEHLSR  415

Query  941   LFGILSSKKRSASQP-------------RASMVNTTseqesssensgEYNDQKKRHHGLW  801
              +   S +K+++S P             R + V++ S    S        +     +   
Sbjct  416   QYSNGSLQKKASSAPTSLLRSNSASILMRHARVSSASFDGGSKSLDKLMPNSTDNDNATD  475

Query  800   YSRNKIDEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKEND  621
              +  +I   E  G  E       +G     DED VSG LYD LQKEVI +RK    K+  
Sbjct  476   SAGGQIKSTEMIGRVEEIANGNHNGKAQPEDEDFVSGTLYDILQKEVIALRKACQDKDQS  535

Query  620   LNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIR  465
             +  KD+ ++ML KK++TL KA+EVE+++ +RE A  EK+ S ++   + N R
Sbjct  536   IKEKDDAVEMLAKKVDTLNKAMEVEAKRMRREVASMEKEVSAMRVSKEQNSR  587



>ref|XP_004239261.1| PREDICTED: microtubule-associated protein 70-1 [Solanum lycopersicum]
Length=622

 Score =   363 bits (933),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 272/527 (52%), Positives = 374/527 (71%), Gaps = 28/527 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  LEL  L+N++++K+REL  AQ+E K LR +E+L++KA+EEL +E+ R++
Sbjct  60    MNLLHGSDPVKLELNRLENEVRDKDRELSEAQAEIKALRLSERLREKAVEELTDELTRVD  119

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  120   EKLKLTESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  179

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++E   LQ+D +A++R  KSKEAALL+AER ++SAL +  +V+++QN+N EL 
Sbjct  180   EAELKLARHETVKLQDDNKALDRLTKSKEAALLDAERTVQSALAKASMVDDLQNKNQELM  239

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILD+ +RQKV EVE+L+Q++ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  240   KQIEICQEENKILDRMHRQKVAEVEKLTQSVRELEEAVLAGGAAANAVRDYQRKVQEMNE  299

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERRILQ EMQ+L+DKLAI
Sbjct  300   ERKTLDRELARAKVTANRVATVVANEWKDANDKVMPVKQWLEERRILQGEMQQLRDKLAI  359

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPK-VLSGFSKPEKANHLFGI-----  930
             +ERTAK+EA LKDK  LRLK LE+ L+ +  ++ N     S  + P +   L G      
Sbjct  360   TERTAKSEALLKDKYLLRLKVLEETLRPSSASSRNTTDGRSSSNGPSRRQSLGGAESISK  419

Query  929   LSS----KKRSAS-QPRASMVNTTseqesssensgEYN----DQKKRHHGL----WYSRN  789
             L+S     KRS S Q R+S  +T  +    +  S +      D+ K+   +    + S  
Sbjct  420   LTSNGFLPKRSPSFQLRSSGSSTILKHAKGTSKSFDGGSRSLDRGKKLLNVTGPNFNSSK  479

Query  788   KID-----EKENAGMKENSD-KLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKE  627
              +D     E E    K N D K TD        ED V G LYD LQKEV+ +RK    K+
Sbjct  480   SVDGVKDNETETTSWKSNQDEKRTDLP--VTETEDTVPGLLYDLLQKEVVALRKAGHEKD  537

Query  626   NDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
               L  KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++ 
Sbjct  538   QSLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRV  584



>gb|KHN21612.1| Microtubule-associated protein 70-2 [Glycine soja]
Length=609

 Score =   363 bits (931),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 268/528 (51%), Positives = 374/528 (71%), Gaps = 30/528 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+REL  AQ+E K LR +E+L++KA+EEL  E+ R+E
Sbjct  44    MNLLHGSDPVKVELNRLENEVRDKDRELSEAQAEIKALRLSERLREKAVEELTEELSRVE  103

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
              KLK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  104   GKLKLTESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  163

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAAL+EAE+ ++ AL +  +V+++QN+N EL 
Sbjct  164   EAELKLARQEIAKLQDDNKALDRLTKSKEAALIEAEKTVQIALAKASMVDDLQNKNQELI  223

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +R KV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  224   KQIEICQEENKILDKMHRLKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  283

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  284   ERKTLDRELARAKVTANRVAVVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLAI  343

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSG---FSKPEKANHLFGI---  930
             +ERTAK+EAQLK+K +LRLK L+  L++T +N++N     G    + P +   L G    
Sbjct  344   TERTAKSEAQLKEKYQLRLKVLQDSLRET-SNSINRGTSEGRCVSNGPSRRQSLGGSDNI  402

Query  929   --LSSK---KRSASQPRASMVNTTseqesssensgEYNDQKK---RHHGLW------YSR  792
               L+S    KRS S    S V++++  + +   S  ++   +   R   L       YS 
Sbjct  403   SKLASNGFLKRSPSTQIRSSVSSSTVLKHAKGTSKSFDGGTRSLERSKILLNGKPPSYSF  462

Query  791   NKIDEKENAGMKENSDKLTDSGNFSKND------EDMVSGFLYDRLQKEVINMRKCFDMK  630
             N+  E    G  E +DK   + +   ND      ED V G LYD LQKEV+ +RK    K
Sbjct  463   NQSSEGTKDG--EENDKWKGNSDDKPNDLPTVDTEDSVPGVLYDLLQKEVLALRKAGHEK  520

Query  629   ENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
             +  L  KD+ I+ML KK++TLTKA+EVE++K +RE A  EK+ + ++ 
Sbjct  521   DQSLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREVASMEKEVAAMRV  568



>ref|XP_008389171.1| PREDICTED: microtubule-associated protein 70-1-like [Malus domestica]
Length=619

 Score =   363 bits (932),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 276/562 (49%), Positives = 383/562 (68%), Gaps = 33/562 (6%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             LLH +DP  +EL  L+N++++K+RELG AQ++ K L+ +++ ++KA EEL +E+ ++EEK
Sbjct  62    LLHGSDPVKVELNRLENEVRDKDRELGEAQAQIKALKLSDRAREKACEELTDELSKVEEK  121

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK++E+L+E +NLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APLEA
Sbjct  122   LKLTESLLESRNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEA  181

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+ + EIA LQ+D +A++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL +Q
Sbjct  182   ELKLARQEIAKLQDDNKALDRLTKSKEAALLEAERTVQVALAKASMVDDLQNKNQELMKQ  241

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+L+GGAAAN +RDY+R+  E+ EER
Sbjct  242   IEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLSGGAAANAVRDYQRKFQEMNEER  301

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             +TL+RELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI+E
Sbjct  302   KTLDRELARAKVTANRVAVVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLAITE  361

Query  1085  RTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFS---KPEKANHLFGI-----  930
             R AK+EAQLK+K  +RLK LE+ ++    N++N   + G S    P +   L G      
Sbjct  362   RAAKSEAQLKEKYHMRLKVLEESVR---GNSINRSTVEGRSTSNGPSRRQSLGGADNAPK  418

Query  929   -----LSSKK---RSASQPRASMVNTTseqesssensgEYNDQKKRH-HGL--WYSRNKI  783
                   SSK+   RS S   +S++        S +      D+ K H +G    +S N+ 
Sbjct  419   LSSNGFSSKRTPVRSLSSSTSSVLKHAKGTSKSFDGGTRSLDRGKVHLNGTSPSFSVNQS  478

Query  782   DEKENAG-----MKENSDKLTDSGNFSKND-EDMVSGFLYDRLQKEVINMRKCFDMKEND  621
              E    G      K NSD   D   FS  D ED V G LYD LQKEV+ +RK    K+  
Sbjct  479   CEGTKDGEAQTNWKGNSD---DKPEFSTVDTEDSVPGVLYDLLQKEVVALRKAGHEKDQS  535

Query  620   LNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY-KYDGNIRQTNSSLK  444
             L  KD+ I+ML KK++TLTKA+EVE++K +RE A  EK+ + ++  K   N  +     K
Sbjct  536   LKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREVASMEKEVAAMRVDKEHENRAKRFGHTK  595

Query  443   SSIKVAKT*DVKQVACSSFASS  378
             SS+  A+    + +A S    S
Sbjct  596   SSVSSAQVLSGRGLARSGLTRS  617



>ref|XP_010227783.1| PREDICTED: microtubule-associated protein 70-3 [Brachypodium 
distachyon]
Length=607

 Score =   363 bits (931),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 261/545 (48%), Positives = 375/545 (69%), Gaps = 38/545 (7%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + L+H +DP  +ELT L+N+L++KERELG A +E + LR +E+ ++KA+EE   E ++++
Sbjct  33    MALMHGSDPVRVELTRLENELRDKERELGEAHTEIRALRLSERAREKAVEEFREEWEKMD  92

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+ +E KNLE KK+ +EKK A+ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  93    EKLKLTESHLENKNLEVKKINDEKKAAMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  152

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EI  LQ+D RA++R  K KEAALLEAER ++ A+ +  +V+++QN+N +L 
Sbjct  153   EAELKLSRQEITKLQDDNRALDRLTKQKEAALLEAERTVEIAMAKAAMVDDLQNKNQDLM  212

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEIC EENKILDK +RQKV EVE+LSQT+ ELEEA+L GGAAAN +RDY+R++ E+ +
Sbjct  213   KQIEICHEENKILDKLHRQKVAEVEKLSQTVRELEEAVLKGGAAANAVRDYQRKVQEMND  272

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLA+
Sbjct  273   ERKTLDRELARAKVTANRVAVVVANEWKDSNDKVMPVKQWLEERRFLQGEMQQLRDKLAV  332

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLS-GFS-KPEKANHLF------  936
             +ERTA++EAQLK+K +LRLK LE GL+   + +  P +    FS  P +   L       
Sbjct  333   AERTARSEAQLKEKYQLRLKVLEDGLRGPPSGSSRPPMEGKSFSNGPSRRLSLGGADNMS  392

Query  935   -----GILSSKKRSASQPRASMVNTTseqesssensgEYN------DQKKRH----HGLW  801
                  G+L+ +  S     +   +++   + +   S  ++      D+ K H    H L 
Sbjct  393   KLSPNGLLTRRSPSFHSRSSLSSSSSLVLKHAKGTSKSFDGGTRSLDRGKIHGNGSHLLN  452

Query  800   YSRNKIDEKE-------------NAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEV  660
              S + + ++E             N     N+D+ T +G  + N  +MVSGFLY+ LQKEV
Sbjct  453   RSTDAVRDQEANDTWKGTVDESTNGSANSNADE-TSNGTMNSNSAEMVSGFLYNMLQKEV  511

Query  659   INMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKY  480
             I++RK    K+  L  KD+ I+ML KK++TLTKA+EVE++K +RE A  EK+ + ++   
Sbjct  512   ISLRKACHEKDQSLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREVAAMEKEVAAMRVDK  571

Query  479   DGNIR  465
             D  I+
Sbjct  572   DQEIK  576



>ref|XP_004510505.1| PREDICTED: microtubule-associated protein 70-2-like [Cicer arietinum]
Length=609

 Score =   363 bits (931),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 266/531 (50%), Positives = 374/531 (70%), Gaps = 37/531 (7%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++KEREL  AQ E K LR +E+L++KA+EEL  E+ +++
Sbjct  45    MNLLHGSDPVKVELNRLENEVRDKERELSDAQVEIKALRHSERLREKAVEELTEELSKVD  104

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
              KLK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  105   GKLKLTESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  164

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAALLEAE+ ++ AL +  +V+++QN+N EL 
Sbjct  165   EAELKLARQEIAKLQDDNKALDRLTKSKEAALLEAEKTVQVALVKASMVDDLQNKNQELM  224

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  225   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  284

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+T++RELAR KVSANRVA +VANEWKD NDKVMPV+QWLE+RR+LQ EMQ+L+DKLAI
Sbjct  285   ERKTIDRELARAKVSANRVAVVVANEWKDSNDKVMPVRQWLEDRRLLQGEMQQLRDKLAI  344

Query  1091  SERTAKAEAQlkdklklrlktLEQGLK--QTGNNNVNPKV----------LSG---FSKP  957
              +R AK+EAQLK+K +LRLK LE  L+    G+N   P+           L G   FSKP
Sbjct  345   VDRRAKSEAQLKEKYQLRLKVLEDSLRGNSNGSNRSTPEARSVSNSRRQSLGGVDNFSKP  404

Query  956   EKANHLFGILSSKKRSASQPRASMVNTTseqesssensgEYNDQK--KRHHGL------W  801
                  L     SK+  + Q R+S+ ++T  + +   +       +  +R   L       
Sbjct  405   TSNGFL-----SKRSPSFQLRSSLSSSTVLKHAKGTSKSFDGGTRSLERSKMLPNGAPQS  459

Query  800   YSRNKIDEKE-----NAGMKENSDKLTDSGNFSKND-EDMVSGFLYDRLQKEVINMRKCF  639
             YS N+  E+      +   K NSD    + +F K D ED VSG LY+ LQKEVI ++K  
Sbjct  460   YSFNQSLEESKEREADVNWKGNSD--DKANDFPKADTEDSVSGVLYEFLQKEVIALKKAG  517

Query  638   DMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
               K+  L  KD+ I+ML +K++TLTKA+EVE++K +RE A+ EK+ + ++ 
Sbjct  518   HEKDQSLKDKDDAIEMLARKVDTLTKAMEVEAKKMRREVAVMEKEVAAMRV  568



>gb|KHG10997.1| Microtubule-associated 70-4 -like protein [Gossypium arboreum]
Length=619

 Score =   363 bits (931),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 270/528 (51%), Positives = 369/528 (70%), Gaps = 37/528 (7%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+RELG AQ+E K LR +E+L++KA+EEL +++ ++ 
Sbjct  65    ITLLHGSDPVKVELNRLENEVRDKDRELGEAQAEIKALRMSERLREKAVEELTDDLSKMA  124

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  125   EKLKLTESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  184

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAAL++AER ++ AL +  +V+++QN+N EL 
Sbjct  185   EAELKLARQEIAKLQDDNKALDRLTKSKEAALIDAERTVEFALAKASMVDDLQNKNQELM  244

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  245   KQIEICQEENKILDKMHRQKVAEVEKLMQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  304

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KVSANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLA+
Sbjct  305   ERKTLDRELARAKVSANRVATVVANEWKDANDKVMPVKQWLEERRCLQGEMQQLRDKLAV  364

Query  1091  SERTAKAEAQlkdklklrlktLEQGL--------------KQTGNNNVNPKVLSG---FS  963
             +ERTAK+EAQLK+K  LRL+ LE  L              +   N     + L G   FS
Sbjct  365   TERTAKSEAQLKEKYLLRLRVLEDSLRGSSNSVSRSTSDGRSVSNGRSRRQSLGGADNFS  424

Query  962   K--PEKANHLFGILSSKKRSAS-QPRASMVNTTseqesssensgEYN-----DQKKRHHG  807
             K  P       G+LS  KRS S Q R+S +++T  + +   +          D  K    
Sbjct  425   KLTPN------GVLS--KRSPSFQLRSSFLSSTVLKHAKGTSKSFDGGTRSLDVTKVLLN  476

Query  806   LWYSRNKIDEKENAGMKENSDKLTDSGNFSKND-EDMVSGFLYDRLQKEVINMRKCFDMK  630
                S   +++      +  SD+  +  NF   D ED V G LYD LQKEVI +RK    K
Sbjct  477   GTDSNISLNQPSEGKAQAPSDEKPN--NFLAVDAEDNVPGVLYDLLQKEVIALRKAGHEK  534

Query  629   ENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
             +  L  KDE I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++ 
Sbjct  535   DLSLKDKDEAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRV  582



>gb|EPS64520.1| hypothetical protein M569_10261 [Genlisea aurea]
Length=627

 Score =   363 bits (932),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 266/554 (48%), Positives = 372/554 (67%), Gaps = 59/554 (11%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             LLH +DP  +EL  L+N++++KERELG AQS+ K L+ +E+L++KA+EEL  E+ +++EK
Sbjct  57    LLHGSDPVKVELNRLENEVRDKERELGEAQSQIKALKLSERLREKAVEELTEELSKVDEK  116

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK++E+L++ KNLE KKL +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APLEA
Sbjct  117   LKLTESLLQTKNLEIKKLNDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEA  176

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+ + EIA LQ+D +A++R  KSKEAALLEAE+ ++ AL +  +V+++QN+N EL +Q
Sbjct  177   ELKLSRQEIAKLQDDNKALDRLTKSKEAALLEAEKTVQLALAKASMVDDLQNKNQELMKQ  236

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ EER
Sbjct  237   IEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNEER  296

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             +TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKL+I+E
Sbjct  297   KTLDRELARAKVTANRVATVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLSIAE  356

Query  1085  RTAKAEAQlkdklklrlktLEQGLK-----------------------------------  1011
             RTAK+EAQLK+K +LRLK LE+ L+                                   
Sbjct  357   RTAKSEAQLKEKFQLRLKVLEETLRSPNAAPRGSTASDVKTAGNGGGGSSRRQSIGGADG  416

Query  1010  ---QTGNNNVNPKVLSGFS-KPEKAN-------HLFGILSS----KKRSASQPRASMVNT  876
                ++ +N + PK    F+ KP   +       H  G   S      RSA + RA+++N 
Sbjct  417   ASSKSSSNCILPKRTPSFAIKPSGGSSSSVLMKHAKGTSKSFDGGSSRSADRSRAALLNG  476

Query  875   TseqesssensgEYNDQKKRHHGLWYSRNKIDEKENAGMKENSDKLTDSGNFSKNDEDMV  696
             +      S++    N  K+    +  S +  D+      +E         N     ED V
Sbjct  477   SGPNFKQSQSCN--NGTKEAEESVISSSSTWDDDATTPREEK------PANDVHVPEDTV  528

Query  695   SGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAI  516
              G LYD LQKEV+ +RK  + K+  L  KD+ I+ML KK+ETLTKA++VE++K +RE A 
Sbjct  529   PGLLYDLLQKEVVALRKAGNEKDQSLKDKDDAIEMLAKKVETLTKAMDVEAKKMRREVAA  588

Query  515   REKDSSTIKYKYDG  474
              EK+ + ++   D 
Sbjct  589   MEKEVAAMRVDKDA  602



>ref|XP_003532520.1| PREDICTED: microtubule-associated protein 70-2-like [Glycine 
max]
Length=616

 Score =   362 bits (930),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 267/535 (50%), Positives = 378/535 (71%), Gaps = 30/535 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+REL  AQ+E K LR +E+L++KA+EEL  E+ R+E
Sbjct  51    MNLLHGSDPVKVELNRLENEVRDKDRELSEAQAEIKALRLSERLREKAVEELTEELSRVE  110

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
              KLK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  111   GKLKLTESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  170

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAAL+EAE+ ++ AL +  +V+++QN+N EL 
Sbjct  171   EAELKLARQEIAKLQDDNKALDRLTKSKEAALIEAEKTVQIALAKASMVDDLQNKNQELI  230

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +R KV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  231   KQIEICQEENKILDKMHRLKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNE  290

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  291   ERKTLDRELARAKVTANRVAVVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLAI  350

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSG---FSKPEKANHLFGI---  930
             +ERTAK+EAQLK+K +LRLK L++ L++T +N++N     G    + P +   L G    
Sbjct  351   TERTAKSEAQLKEKYQLRLKVLQESLRET-SNSINRGTSEGRCVSNGPSRRQSLGGADNI  409

Query  929   --LSSK---KRSASQPRASMVNTTseqesssensgEYNDQKK---RHHGLW------YSR  792
               L+S    KRS S    S V++++  + +   S  ++   +   R   L       YS 
Sbjct  410   SKLTSNGFLKRSPSTQIRSSVSSSTVLKHAKGTSKSFDGGTRSLERSKILLNGKPPSYSF  469

Query  791   NKIDEKENAGMKENSDKLTDSGNFSKND------EDMVSGFLYDRLQKEVINMRKCFDMK  630
             N+    E   ++E  DK   + +   ND      +D V G LYD LQKEV+ +RK    K
Sbjct  470   NQ--SSEGTKVREEKDKWKGNSDDKPNDFPTVDTDDSVPGVLYDLLQKEVLALRKVGHEK  527

Query  629   ENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIR  465
             +  L  KD+ I+ML KK++TLTKA+EVE++K +RE A  EK+ + ++ + + + R
Sbjct  528   DQSLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREVASMEKEVAAMRVEKEQDTR  582



>ref|XP_003525226.1| PREDICTED: microtubule-associated protein 70-2-like [Glycine 
max]
Length=616

 Score =   362 bits (929),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 268/528 (51%), Positives = 374/528 (71%), Gaps = 30/528 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+REL  AQ+E K LR +E+L++KA+EEL  E+ R+E
Sbjct  51    MNLLHGSDPVKVELNRLENEVRDKDRELSEAQAEIKALRLSERLREKAVEELTEELSRVE  110

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
              KLK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  111   GKLKLTESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  170

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAAL+EAE+ ++ AL +  +V+++QN+N EL 
Sbjct  171   EAELKLARQEIAKLQDDNKALDRLTKSKEAALIEAEKTVQIALAKASMVDDLQNKNQELI  230

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +R KV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  231   KQIEICQEENKILDKMHRLKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  290

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  291   ERKTLDRELARAKVTANRVAVVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLAI  350

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSG---FSKPEKANHLFGI---  930
             +ERTAK+EAQLK+K +LRLK L+  L++T +N++N     G    + P +   L G    
Sbjct  351   TERTAKSEAQLKEKYQLRLKVLQDSLRET-SNSINRGTSEGRCVSNGPSRRQSLGGSDNI  409

Query  929   --LSSK---KRSASQPRASMVNTTseqesssensgEYNDQKK---RHHGLW------YSR  792
               L+S    KRS S    S V++++  + +   S  ++   +   R   L       YS 
Sbjct  410   SKLASNGFLKRSPSTQIRSSVSSSTVLKHAKGTSKSFDGGTRSLERSKILLNGKPPSYSF  469

Query  791   NKIDEKENAGMKENSDKLTDSGNFSKND------EDMVSGFLYDRLQKEVINMRKCFDMK  630
             N+  E    G  E +DK   + +   ND      ED V G LYD LQKEV+ +RK    K
Sbjct  470   NQSSEGTKDG--EENDKWKGNSDDKPNDLPTVDTEDSVPGVLYDLLQKEVLALRKAGHEK  527

Query  629   ENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
             +  L  KD+ I+ML KK++TLTKA+EVE++K +RE A  EK+ + ++ 
Sbjct  528   DQSLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREVASMEKEVAAMRV  575



>ref|XP_010502169.1| PREDICTED: microtubule-associated protein 70-3-like [Camelina 
sativa]
Length=627

 Score =   362 bits (930),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 257/532 (48%), Positives = 368/532 (69%), Gaps = 22/532 (4%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N +++K+REL  +Q+E K LR +E+ ++KA+EEL  E+ ++ 
Sbjct  64    ITLLHGSDPVKIELNRLENDVRDKDRELSESQAEIKALRLSERQREKAVEELTEELGKMS  123

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++ENL++ KNLE KK+  EK+ ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  124   EKLKLTENLLDSKNLEIKKINEEKRASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  183

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQ+D RA++R  KSKEAALL+AER ++SAL +  +V+++QN+N EL 
Sbjct  184   EAELKLARHEIVKLQDDNRALDRLTKSKEAALLDAERTVQSALAKASMVDDLQNKNQELM  243

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEEN+ILD+ +RQKV EVE+ +QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  244   KQIEICQEENRILDRMHRQKVAEVEKFTQTVRELEEAVLAGGAAANAVRDYQRKFPEMNE  303

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ERR L+RELAR KVSA+RVAT+VA EWKD +DKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  304   ERRVLDRELARAKVSASRVATVVAYEWKDGSDKVMPVKQWLEERRFLQGEMQQLRDKLAI  363

Query  1091  SERTAKAEAQlkdklklrlktLEQGLK--QTGNNNVNPKVLSGFSKPEKANHLFGI----  930
             S+R AK+EAQLK+K +LRL+ LE+ L+   +G N    +  S  + P +   + G     
Sbjct  364   SDRAAKSEAQLKEKFQLRLRVLEESLRGPPSGGNRSTLEGRSISNGPSRRQSIGGADIIP  423

Query  929   ------LSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHG---------LWYS  795
                     SK+  +SQ R+   +T++  + +   S  ++   +   G           + 
Sbjct  424   KLTSNGFFSKRTPSSQFRSLNASTSTILKHAKGTSRSFDGGSRSLDGSKLLTNEPRSKFP  483

Query  794   RNKIDEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLN  615
              N+  E ++     NS K  +S   +  + D V G L+D LQKEVI +RK    K+  L 
Sbjct  484   VNQSSEGKSGDESPNSTKQGESDKAAATNNDSVPGVLHDLLQKEVITLRKASHDKDQSLR  543

Query  614   TKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQT  459
              KDE I+ML KK+ETLTKA+EVE++K +RE A  EK+ S ++ +  G+  +T
Sbjct  544   DKDEAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVSAMRVENKGSDSRT  595



>emb|CDX81676.1| BnaC08g39250D [Brassica napus]
Length=592

 Score =   361 bits (927),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 261/539 (48%), Positives = 370/539 (69%), Gaps = 23/539 (4%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+REL  AQ+E K L+ +E+ ++KA+EEL  E+ ++ 
Sbjct  40    ITLLHGSDPVRIELNRLENEVRDKDRELSEAQAEIKALKLSERQREKAVEELTEELGKMS  99

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
              KLK+ ENL+E KNL+ KK+  EKK +  AQ+AAEA+LRRV+A QK+DD  PIE+++APL
Sbjct  100   AKLKLIENLLESKNLDIKKINEEKKASTAAQFAAEASLRRVHAAQKDDDMPPIEAILAPL  159

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D ++++R  KSKEAALL+AER ++SAL +  +V+++QN+N EL 
Sbjct  160   EAELKLARQEIANLQDDNKSLDRLTKSKEAALLDAERTVQSALAKASMVDDLQNKNQELM  219

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEEN+I+DK +RQKV EVE+L Q++ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  220   KQIEICQEENRIIDKMHRQKVAEVEKLMQSVRELEEAVLAGGAAANVVRDYQRKFQEMNE  279

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+ LERELAR KV+ANRVAT+VANEWKD ND+VMPV+QWLEERR LQ EMQ+L+DKLAI
Sbjct  280   ERKVLERELARAKVNANRVATVVANEWKDSNDQVMPVRQWLEERRFLQGEMQQLRDKLAI  339

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILSSKKR  912
             ++R AK+EAQLK+K  LRL+ LE+ LK+  +N   P V S  + P +   L G  +S K 
Sbjct  340   ADRAAKSEAQLKEKFLLRLRVLEESLKRPTSNRGTPVVRSSSNGPSRRQSLGGTETSPKY  399

Query  911   S----------ASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKENAG  762
             S          +SQ R+   + ++  + +   S  ++   +         N+   K N  
Sbjct  400   SSNGSLTKRTPSSQSRSLTASASTALKHAKGTSISFDGGTRSLDRNKVLMNRPGSKFNHQ  459

Query  761   MKENSDKLTDSGNFSKNDE--------DMVSGFLYDRLQKEVINMRKCFDMKENDLNTKD  606
               E + ++ +S +  K +E        D V G LYD LQKEVI +RK    K+  L  KD
Sbjct  460   SSEETSRV-ESLSSVKGEESDDKSTVNDSVPGVLYDLLQKEVITLRKAAHEKDQSLRDKD  518

Query  605   EEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTI---KYKYDGNIRQTNSSLKSS  438
             E I+ML KK+ETLTKA+EVE++K +RE A+  K+ + +   K + D   R  +S  K S
Sbjct  519   EAIEMLAKKVETLTKAMEVEAKKMRREVAVMGKEVAAMRVDKGQQDSKTRGLSSISKGS  577



>ref|NP_176973.1| microtubule-associated protein 70-1 [Arabidopsis thaliana]
 sp|Q9C9X0.1|MP701_ARATH RecName: Full=Microtubule-associated protein 70-1; Short=AtMAP70-1; 
AltName: Full=70 kDa microtubule-associated protein 1 
[Arabidopsis thaliana]
 gb|AAG52019.1|AC012563_29 unknown protein; 30164-32998 [Arabidopsis thaliana]
 gb|AAL67000.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20292.1| unknown protein [Arabidopsis thaliana]
 emb|CAJ31078.1| 70 kDa microtubule associated protein Type 1 [Arabidopsis thaliana]
 gb|AEE34742.1| microtubule-associated protein 70-1 [Arabidopsis thaliana]
Length=622

 Score =   362 bits (929),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 270/537 (50%), Positives = 377/537 (70%), Gaps = 24/537 (4%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+REL  A +E K LR +E+ ++KA EEL +E+ +L+
Sbjct  59    ITLLHGSDPVKVELNRLENEVRDKDRELSEANAEIKALRLSERQREKACEELTDELAKLD  118

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
              KLK++E+L++ KNLE KK+  EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  119   GKLKLTESLLQSKNLEIKKINEEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  178

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQED RA++R  KSKEAALL+AER +++AL +  +V+++QN+N EL 
Sbjct  179   EAELKLARSEIGKLQEDNRALDRLTKSKEAALLDAERTVETALAKAALVDDLQNKNQELM  238

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILD+ +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  239   KQIEICQEENKILDRMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNE  298

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  299   ERKTLDRELARAKVTANRVATVVANEWKDGNDKVMPVKQWLEERRFLQGEMQQLRDKLAI  358

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNV--NPKVLSGFSKPEKANHLFG-----  933
             S+R AK+EAQLKDK +LRL+ LE+ L+ T + ++   P+  S  + P +   + G     
Sbjct  359   SDRAAKSEAQLKDKFQLRLRVLEETLRGTSSISIRNTPEGRSMSNGPSRRQSIGGSDNLQ  418

Query  932   -ILSSKKRSASQP-RASMV-NTTseqesssensgEYNDQKK---RHHGLW-----YSRNK  786
                S+   S   P R S   N+TS  +++   S  ++   +   R   L      YS NK
Sbjct  419   KFASNGFLSKKTPMRNSFTSNSTSVLKNAKGTSKSFDGGTRSLDRGKALLKGPGNYSFNK  478

Query  785   -IDEKENA----GMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKEND  621
               DE + +      KE+S++   S   +   ED V G LYD LQKEV+ +RK    K+  
Sbjct  479   ACDETKESESPNTWKEDSEEKPPSELPAPATEDNVPGVLYDLLQKEVVALRKSSHEKDQS  538

Query  620   LNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQTNSS  450
             L  KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++   D + R   SS
Sbjct  539   LKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRVDKDQDNRAKRSS  595



>ref|XP_006303938.1| hypothetical protein CARUB_v10008632mg [Capsella rubella]
 gb|EOA36836.1| hypothetical protein CARUB_v10008632mg [Capsella rubella]
Length=601

 Score =   361 bits (926),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 261/545 (48%), Positives = 373/545 (68%), Gaps = 31/545 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N +++K+REL  AQ+E K LR +E+ ++KA+EEL +E+ ++ 
Sbjct  39    MTLLHGSDPVRIELNRLENDVRDKDRELSEAQAEIKALRLSERQREKAVEELTDELGKMT  98

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
              KLK+ ENL+E KNLE KK+  EKK ++ AQ+AAEA+LRRV+A QK+DD  PIE+++APL
Sbjct  99    GKLKLVENLLESKNLEIKKINEEKKASMAAQFAAEASLRRVHAAQKDDDMPPIEAILAPL  158

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + E+A LQ+D R+++R  KSKEAALLEAER ++SAL +  +V+++QN+N EL 
Sbjct  159   EAELKLSRQEVAKLQDDNRSLDRLTKSKEAALLEAERTVQSALAKASMVDDLQNKNQELM  218

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEEN+I+D+ +RQKV EVE+L Q++ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  219   KQIEICQEENRIIDRMHRQKVAEVEKLMQSVRELEEAVLAGGAAANAVRDYQRKFQEMNE  278

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+ LERELAR KV+ANRVAT+VANEWKD +DKVMPV+QWLEERR LQ EMQ+L+DKLAI
Sbjct  279   ERKILERELARAKVNANRVATVVANEWKDASDKVMPVRQWLEERRFLQGEMQQLRDKLAI  338

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQ-TGNNNVNPKVLSGFSKPEKANHLFGILSS--  921
             ++R AK+EAQLK+K  LRL+ LE+ LK+ T +N       S  + P +   L G  +S  
Sbjct  339   ADRAAKSEAQLKEKFLLRLRVLEESLKRPTSSNRGTSGGRSASNGPSRRQSLSGAETSPK  398

Query  920   --------KKRSASQPRASMVNTTseqesssensgEYN-------------DQKKRHHGL  804
                     K+  +SQ R+   + ++  + +   S  ++             +  + +H L
Sbjct  399   VTSNGSLTKRTPSSQLRSLTASASTVLKHAKGTSISFDGGTRSLDRSKLLINGPRSNHPL  458

Query  803   WYSRNKIDEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKEN  624
              +  +   E  N G   +S K  +  +    + D V G LYD LQKEVI +RK    K+ 
Sbjct  459   NHQSS---EGTNKGESPSSIKGEEEPDDKSTNNDSVPGVLYDLLQKEVITLRKAAHEKDQ  515

Query  623   DLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTI---KYKYDGNIRQTNS  453
              L  KDE I+ML KK+ETLTKA+EVE++K +RE A+  K+ + +   K + D   R+ ++
Sbjct  516   SLRDKDEAIEMLAKKVETLTKAMEVEAKKMRREVAVMGKEVAAMRVDKGQQDSKTRRPSA  575

Query  452   SLKSS  438
             S  SS
Sbjct  576   SKGSS  580



>ref|XP_006647855.1| PREDICTED: microtubule-associated protein 70-2-like [Oryza brachyantha]
Length=598

 Score =   361 bits (926),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 262/526 (50%), Positives = 360/526 (68%), Gaps = 27/526 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             L L+H +DP  +EL  L+N++++K+RELG A +E K LR +E+ ++KA+EEL  E ++L+
Sbjct  36    LTLMHGSDPVKVELNRLENEVRDKDRELGDAHAEIKALRLSERAREKAVEELTAEYEKLD  95

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L+E KNLE KK  +EKK A+ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  96    EKLKLTESLLESKNLELKKTNDEKKAAMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  155

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D RA++R  K KEAALLEAER ++ AL +  +V+++QN+N EL 
Sbjct  156   EAELKIARQEIAKLQDDNRALDRLTKQKEAALLEAERTVEIALAKAAMVDDMQNKNQELM  215

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILD+ +RQKV EVE+LSQT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  216   KQIEICQEENKILDRLHRQKVAEVEKLSQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  275

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+ L+RELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  276   ERKILDRELARAKVTANRVAVVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLAI  335

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILSSKKR  912
             +ERTA++EAQLK+K +LRLK LE GL+  G  + + ++  G S     +    +  +   
Sbjct  336   AERTARSEAQLKEKYQLRLKVLEDGLR--GPPSGSNRLTEGKSISNGLSRRLSLGGADNM  393

Query  911   SASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYS---------RNKIDEKENAGM  759
             S   P   +   +    S S  S   +   K   G   S         R K+       +
Sbjct  394   SKISPNGMLARRSPSFNSRSSLSTSSSLVIKHAKGTSRSFDGGTRSLDRGKVLRNGPHLL  453

Query  758   KENSDKLTDSG---------------NFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKEN  624
               ++D +TD G                 + N  D VSG LYD LQKEVI++RK    K+ 
Sbjct  454   NRSTDAVTDCGTTHDWKASTEEKSNETTNSNATDTVSGVLYDMLQKEVISLRKSCHEKDQ  513

Query  623   DLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
              L  KD+ I+ML KK++TLTKA+EVE++K +RE A  EK+ + ++ 
Sbjct  514   SLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREVAAMEKEVAAMRL  559



>ref|XP_002307974.2| hypothetical protein POPTR_0006s03740g [Populus trichocarpa]
 gb|EEE91497.2| hypothetical protein POPTR_0006s03740g [Populus trichocarpa]
Length=622

 Score =   362 bits (928),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 268/537 (50%), Positives = 363/537 (68%), Gaps = 24/537 (4%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N+L++K+RELG A +E K L+ +E+ K+KA+EEL +E+ +++
Sbjct  61    ITLLHGSDPVRVELNRLENELRDKDRELGEALAEIKSLKNSERSKEKAVEELTDELDKVD  120

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK +E L+E KNLE KK+ +EKK AL AQ+AAEA LRRV+A QK+D+  PIE++I PL
Sbjct  121   EKLKATEALLESKNLEIKKINDEKKAALAAQFAAEATLRRVHAAQKDDEMPPIEAIITPL  180

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + E+A LQ+D RA++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL 
Sbjct  181   EAELKLARLEVAKLQDDNRALDRLTKSKEAALLEAERTVQIALAKASLVDDLQNKNQELM  240

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  241   KQIEICQEENKILDKMHRQKVAEVEKLMQTVHELEEAVLAGGAAANAVRDYQRKVQEMNE  300

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             E++TLERE+AR KVSANRVAT+VANEWKD NDKVMPVKQWLEERR  Q EMQ+L+DKLA+
Sbjct  301   EKKTLEREVARAKVSANRVATVVANEWKDGNDKVMPVKQWLEERRFFQGEMQQLRDKLAV  360

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQT-GNNNVNPKVLSGFSKPEKANHLFGI-----  930
             +ER AKAEAQLKDK +LR K LE+ LK + GN+   P+  +  + P +   L G      
Sbjct  361   AERAAKAEAQLKDKYQLRFKVLEERLKASNGNSRATPEGKNTSNGPSRRQSLGGAENFSR  420

Query  929   -----LSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRH--HGLWYSRNKIDEKE  771
                    S+K S SQ  +   N  +     ++ S    D   R     L       D   
Sbjct  421   SSFNGYLSRKASNSQAGSLRSNGAATLLRHAKMSSRSFDGGSRSLDDKLLVGGTGKDNAP  480

Query  770   NAGMKENSDKL----------TDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKEND  621
              A   +  +            T + N     ED VSGFLYD LQK+VI +RK    K+  
Sbjct  481   AAASDQTQNTERIETEEIENGTSTENSKSEQEDQVSGFLYDMLQKDVIALRKACHEKDQS  540

Query  620   LNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQTNSS  450
             L  K + I+ML KK++TL KA+EVE++K +RE A REK+ + ++   + + R   SS
Sbjct  541   LKDKADAIEMLAKKVDTLNKAMEVEAKKMRREVAAREKEVAAMRVNKEHDHRTQRSS  597



>emb|CDY45293.1| BnaA06g09630D [Brassica napus]
Length=601

 Score =   361 bits (926),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 261/554 (47%), Positives = 370/554 (67%), Gaps = 41/554 (7%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N+L++K+REL  AQ+E K L+ +E+ ++KA+EEL +E+ ++ 
Sbjct  41    ITLLHGSDPVRIELNRLENELRDKDRELSEAQAEIKALKLSERQREKAVEELTDELGKMS  100

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
              KLK+ ENL+E KNLE +K+  EKK ++ AQ+AAEA+LRRV+A QK+DD  PIE+++APL
Sbjct  101   AKLKLIENLLETKNLEIRKINEEKKASMAAQFAAEASLRRVHAAQKDDDMPPIEAILAPL  160

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D ++++R  KSKEAALL+AER ++SAL +  +V+++QN+N EL 
Sbjct  161   EAELKLARQEIAKLQDDNKSLDRLTKSKEAALLDAERTVQSALAKASMVDDLQNKNQELM  220

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEEN+I+DK +RQKV EVE+L Q++ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  221   KQIEICQEENRIIDKMHRQKVAEVEKLMQSVRELEEAVLAGGAAANAVRDYQRKFQEMNE  280

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+ LERELAR KV+ANRVAT+VANEWKD ND+VMPV+QWLEERR +Q EMQ+L+DKLAI
Sbjct  281   ERKILERELARAKVNANRVATVVANEWKDSNDQVMPVRQWLEERRFMQGEMQQLRDKLAI  340

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILSSKKR  912
             ++R AK+EAQLK+K  LRL+ LE+ LK+  N    P V S  + P +   L G  +S K 
Sbjct  341   ADRAAKSEAQLKEKFLLRLRVLEESLKKPSNRGT-PGVRSSSNGPTRRQSLVGAETSPKY  399

Query  911   SASQ----------------PRASMV------------NTTseqesssensgEYNDQKKR  816
             S+S                   AS V              T   + +         +   
Sbjct  400   SSSNGSVAKSRPSSQPRSSTASASTVLKNARGTSSSFDGGTRSLDRNKVLMNRPGSKFPS  459

Query  815   HHGLWYSRNKIDEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFD  636
             +H      ++++   +  ++E+ DK TD+        D V G LYD LQKEVI +RK   
Sbjct  460   NHQSSEGASRVESPSSIKVEESDDKSTDN--------DSVPGVLYDLLQKEVITLRKAAH  511

Query  635   MKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTI---KYKYDGNIR  465
              K+  L  KD+ I+ML KK+ETLTKA+EVE++K +RE A+  K+ + +   K   D   R
Sbjct  512   EKDQSLRDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAVMGKEVAAMRVDKGHQDSKTR  571

Query  464   QTNSSLKSSIKVAK  423
             + +S  K S   A+
Sbjct  572   RPSSISKGSSNTAQ  585



>ref|XP_004965147.1| PREDICTED: microtubule-associated protein 70-3-like isoform X2 
[Setaria italica]
Length=606

 Score =   361 bits (926),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 260/537 (48%), Positives = 374/537 (70%), Gaps = 38/537 (7%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + L+H +DP  +ELT L+N+L++KERELG AQ+E + LR +E+ ++KA+EEL +E+++++
Sbjct  33    IALMHGSDPVRVELTRLENELRDKERELGEAQAEIRALRLSERAREKAVEELTDELEKMD  92

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L++ KNLE K++ +EKK A+ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  93    EKLKLTESLLDSKNLEVKRINDEKKAAMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  152

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EI+ LQ+D RA++R  K KEAALLEAER ++ A+ +  +V+++QN+N EL 
Sbjct  153   EAELKLSRQEISKLQDDNRALDRLTKQKEAALLEAERTVQIAMAKAAMVDDLQNKNQELI  212

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEIC EENKILDK +RQK+ EVE+LSQT+ +LEEA+L GG  AN +RDY R+  E+ E
Sbjct  213   KQIEICHEENKILDKLHRQKIAEVEKLSQTVGDLEEALLQGGRNANVVRDYERRFQEMSE  272

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             E+RTL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLA+
Sbjct  273   EKRTLDRELARAKVTANRVATVVANEWKDSNDKVMPVKQWLEERRFLQGEMQQLRDKLAV  332

Query  1091  SERTAKAEAQlkdklklrlktLEQGLK--QTGNNNVNPKVLSGFSKPEKANHLF------  936
             +ERTA++EAQLK+K +LRLK LE GL+   +G+N    +  S  + P +   L       
Sbjct  333   AERTARSEAQLKEKYQLRLKVLEDGLRGLPSGSNRPPTEGKSFSNGPSRRLSLGGADNMS  392

Query  935   -----GILSSKKRSASQPRASMVNTTseqesssensgEYNDQKKR----------HHGLW  801
                  G+LS +  S     + + +++   + +   S  ++   +            H L 
Sbjct  393   KLSPNGLLSRRSPSFHSRSSLLSSSSLVLKHAKGTSKSFDGGTRSLDRGKVRVNGAHLLN  452

Query  800   YSRNKIDEKENA-GMKENSDKLTDSGNFSKNDE-----------DMVSGFLYDRLQKEVI  657
              S + + +KE+    K N D+ T     S  DE           + VSGFLYD LQKEVI
Sbjct  453   RSTDAVRDKESTDNWKGNVDERTSESADSTADEKRNETTNNNLAETVSGFLYDMLQKEVI  512

Query  656   NMRK-CFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIK  489
             ++RK C++ K+  L  KDE I++L KKI+TL KA+EVE++K +R+ A  EKD + ++
Sbjct  513   SLRKSCYE-KDQILKDKDENIEILEKKIDTLNKAMEVEAKKMRRQVAAMEKDVAAMR  568



>ref|XP_007204220.1| hypothetical protein PRUPE_ppa003030mg [Prunus persica]
 gb|EMJ05419.1| hypothetical protein PRUPE_ppa003030mg [Prunus persica]
Length=610

 Score =   361 bits (926),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 267/555 (48%), Positives = 375/555 (68%), Gaps = 49/555 (9%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + L+H +DP  +EL  L+N L++K+RELG A  E K LR +E+LK+KA+EEL +E+ R++
Sbjct  52    ITLMHGSDPVRVELNRLENDLRDKDRELGDAVGEIKSLRNSERLKEKAVEELTDELNRVD  111

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK +E L+E KNLE KK+ +EKK AL AQ+AAEA LRRV+A QK+D+  PIE++IAPL
Sbjct  112   EKLKATEALLESKNLEIKKINDEKKAALAAQFAAEATLRRVHAAQKDDEMPPIEAIIAPL  171

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + E+A LQ+D RA++R  KSKEAAL+EAER ++ A+ +  +V+++QN+N EL 
Sbjct  172   EAELKLARQEVAKLQDDNRALDRLTKSKEAALVEAERTVQIAMVKASLVDDLQNKNQELM  231

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  232   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  291

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             E++ LERE+AR KVSANRVAT+VANEWKD +DKVMPVKQWL+ERR  Q EMQ+L+DKLA+
Sbjct  292   EKKLLEREVARAKVSANRVATVVANEWKDSSDKVMPVKQWLDERRFFQGEMQQLRDKLAV  351

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNP--------------KVLSG---FS  963
             +ERTAKAEAQLK+K +LR K LE+  K + N    P              + L G   FS
Sbjct  352   AERTAKAEAQLKEKYQLRFKVLEEKFKAS-NGKFRPSSDARIISNGPSRRQSLGGAENFS  410

Query  962   KPEKANHLFGILSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKI  783
             +     +L     S+ +S  Q   ++ NT +     +++S    D   R       R+K+
Sbjct  411   RASSNGYL-----SRTKSNLQSGFNLSNTATAILKQAKSSSRSFDGGSR----LLDRDKL  461

Query  782   DEKENAGMKENSDKLTD---------------SGNFSKND----EDMVSGFLYDRLQKEV  660
                 +A  K+N++  +D               +G+ ++      ED VSG LYD LQKEV
Sbjct  462   --LPDATGKDNTNSASDQTQMDETIGRHEERANGSLAEQSRTEHEDYVSGVLYDMLQKEV  519

Query  659   INMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKY  480
             +++RK    K+  L  KD+ I+ML KK++TL KA+EVE++K +RE A  EK+ S ++   
Sbjct  520   VSLRKACHEKDQTLKDKDDAIEMLAKKVDTLNKAMEVEAKKMRREVAAMEKEVSAMRVTK  579

Query  479   DGNIRQTNSSLKSSI  435
             + + R   SS    +
Sbjct  580   EPDQRARRSSAPRGV  594



>emb|CDY40783.1| BnaAnng06460D [Brassica napus]
Length=613

 Score =   360 bits (925),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 269/567 (47%), Positives = 384/567 (68%), Gaps = 36/567 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + +LH +DP  +EL  L+N++++K+RELG A +E + LR +E+ ++KA+EEL  E+ +L+
Sbjct  51    ITMLHGSDPVKVELNRLENEVRDKDRELGEAHAEIRALRLSERQREKAVEELTEELAKLD  110

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E++++ KNLE KK+  EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  111   EKLKLTESILQSKNLEIKKINEEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  170

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQED RA++R  KSKEAALL+A+R ++ AL +  +V+++QN+N EL 
Sbjct  171   EAELKLARSEIGKLQEDNRALDRLTKSKEAALLDADRTVEGALAKAAMVDDLQNKNQELM  230

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGA ANT+RDY+R++ EI E
Sbjct  231   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGATANTVRDYQRKVQEINE  290

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  291   ERKTLDRELARAKVTANRVATVVANEWKDGNDKVMPVKQWLEERRFLQGEMQQLRDKLAI  350

Query  1091  SERTAKAEAQlkdklklrlktLEQGLK-----------------QTGNNNVNPKVLSGFS  963
             ++R AK+EA LK+K + RLK LE+ LK                    N     + L G  
Sbjct  351   TDRAAKSEALLKEKFQQRLKVLEETLKGTSSSSSTTTRNLSETRSMSNGPSRRQSLGGSD  410

Query  962   KPEK--ANHLFGILSSKKRSASQPRASM-VNTTseqesssensgEYNDQKK---RHHGLW  801
               ++  +N  F    SKK  + Q R S+ +N+TS  +++   S  ++   +   R   L 
Sbjct  411   NLQRLPSNGSF----SKKAPSFQMRHSLSINSTSVLKNAKGTSKSFDGGTRSLDRGKALL  466

Query  800   -----YSRNKIDEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFD  636
                  YS NK    ++   +E + +   +   +   ED V G LYD LQKEV+++RK   
Sbjct  467   NGPGNYSFNKASSDDSKDTEEKAQREDHAAAAAT--EDSVPGVLYDLLQKEVVSLRKASH  524

Query  635   MKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQTN  456
              K+  L  KD+ I+ML +K+ETLTKA+EVE++K +RE A  EK+ + ++ + D + R   
Sbjct  525   EKDQSLKDKDDAIEMLARKVETLTKAMEVEAKKMRRELAAMEKEVAAMRVEKDQDNRAKR  584

Query  455   -SSLKSSIKVAKT*DVKQVACSSFASS  378
              S+ KSS   A+    +    SS   S
Sbjct  585   FSNSKSSSNTAQILAARAAGRSSLTKS  611



>ref|XP_002887159.1| atmap70-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63418.1| atmap70-1 [Arabidopsis lyrata subsp. lyrata]
Length=622

 Score =   360 bits (925),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 268/537 (50%), Positives = 374/537 (70%), Gaps = 24/537 (4%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+REL  A +E K LR +E+ ++KA EEL +E+ +L+
Sbjct  59    MTLLHGSDPVKVELNRLENEVRDKDRELSEAHAEIKALRLSERQREKACEELTDELAKLD  118

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
              KLK++E+L++ KNLE KK+  EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  119   GKLKLTESLLQSKNLEIKKINEEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  178

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EI  LQED RA++R  KSKEAALL+AER +++AL +  +V+++QN+N EL 
Sbjct  179   EAELKLARSEIGKLQEDNRALDRLTKSKEAALLDAERTVETALAKAALVDDLQNKNQELM  238

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILD+ +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  239   KQIEICQEENKILDRMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNE  298

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  299   ERKTLDRELARAKVTANRVATVVANEWKDGNDKVMPVKQWLEERRFLQGEMQQLRDKLAI  358

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNV--NPKVLSGFSKPEKANHLFG-----  933
             S+R AK+EAQLKDK +LRLK LE+ L+ T + ++   P+  S  + P +   + G     
Sbjct  359   SDRAAKSEAQLKDKFQLRLKVLEETLRGTSSISIRSTPEGRSMSNGPSRRQSIGGSDNLQ  418

Query  932   -ILSSKKRSASQP-RASMVNTTseqesssensgEYNDQKKRH--------HGLW-YSRNK  786
                S+   S   P R S  + +     +++ + +  D   R         +G   YS NK
Sbjct  419   KFASNGFLSKKTPMRNSFTSNSISVLKNAKGTSKSFDGGTRSLDRGKALLNGPGNYSFNK  478

Query  785   ----IDEKENAGM-KENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKEND  621
                   E E+    KE+S++   S   +   ED V G LYD LQKEV+ +RK    K+  
Sbjct  479   TCDETKEPESPNTWKEDSEEKPPSELPAPATEDNVPGVLYDLLQKEVVALRKSSHEKDQS  538

Query  620   LNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQTNSS  450
             L  KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++   D + R   SS
Sbjct  539   LKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRVDKDQDNRAKRSS  595



>ref|XP_009148871.1| PREDICTED: microtubule-associated protein 70-4 [Brassica rapa]
Length=601

 Score =   360 bits (923),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 261/554 (47%), Positives = 370/554 (67%), Gaps = 41/554 (7%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N+L++K+REL  AQ+E K L+ +E+ ++KA+EEL +E+ ++ 
Sbjct  41    ITLLHGSDPVRIELNRLENELRDKDRELSEAQAEIKALKLSERQREKAVEELTDELGKMS  100

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
              KLK+ ENL+E KNLE +K+  EKK ++ AQ+AAEA+LRRV+A QK+DD  PIE+++APL
Sbjct  101   AKLKLIENLLETKNLEIRKINEEKKASMAAQFAAEASLRRVHAAQKDDDMPPIEAILAPL  160

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D ++++R  KSKEAALL+AER ++SAL +  +V+++QN+N EL 
Sbjct  161   EAELKLARQEIAKLQDDNKSLDRLTKSKEAALLDAERTVQSALAKASMVDDLQNKNQELM  220

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEEN+I+DK +RQKV EVE+L Q++ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  221   KQIEICQEENRIIDKMHRQKVAEVEKLMQSVRELEEAVLAGGAAANAVRDYQRKFQEMNE  280

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+ LERELAR KV+ANRVAT+VANEWKD ND+VMPV+QWLEERR +Q EMQ+L+DKLAI
Sbjct  281   ERKILERELARAKVNANRVATVVANEWKDSNDQVMPVRQWLEERRFMQGEMQQLRDKLAI  340

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILSSKKR  912
             ++R AK+EAQLK+K  LRL+ LE+ LK+  N    P V S  + P +   L G  +S K 
Sbjct  341   ADRAAKSEAQLKEKFLLRLRVLEESLKKPSNRGT-PGVRSSSNGPTRRQSLVGAETSPKY  399

Query  911   SASQ----------------PRASMV------------NTTseqesssensgEYNDQKKR  816
             S+S                   AS V              T   + +         +   
Sbjct  400   SSSNGSVAKSRPSSQPRSSTASASTVLKNARGTSSSFDGGTRSLDRNKVLMNRPGSKFPS  459

Query  815   HHGLWYSRNKIDEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFD  636
             +H      ++++   +  ++E+ DK TD+        D V G LYD LQKEVI +RK   
Sbjct  460   NHQSSEGASRVESPSSIKVEESDDKSTDN--------DSVPGVLYDLLQKEVITLRKAAH  511

Query  635   MKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTI---KYKYDGNIR  465
              K+  L  KD+ I+ML KK+ETLTKA+EVE++K +RE A+  K+ + +   K   D   R
Sbjct  512   EKDQSLRDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAVMGKEVAAMRVDKGHQDTKTR  571

Query  464   QTNSSLKSSIKVAK  423
             + +S  K S   A+
Sbjct  572   RPSSISKGSSNTAQ  585



>gb|EYU30134.1| hypothetical protein MIMGU_mgv1a002946mg [Erythranthe guttata]
Length=623

 Score =   360 bits (925),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 260/522 (50%), Positives = 367/522 (70%), Gaps = 24/522 (5%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             LLH +DP  LEL  L+N++++K+RELG AQS+ + L+ +E+L++KA+EEL  E+ +++EK
Sbjct  64    LLHGSDPVKLELNRLENEVRDKDRELGEAQSQIRALKLSERLREKAVEELTEELTKVDEK  123

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK++E+L+E KNLE K++ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APLEA
Sbjct  124   LKLTESLLESKNLEIKRINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEA  183

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+ + EIA LQ+D +A++R  KSKEAALLEAER ++ A+ +  +V+++QN+N EL +Q
Sbjct  184   ELKLARQEIAKLQDDNKALDRLTKSKEAALLEAERTVQVAMAKASMVDDLQNKNQELMKQ  243

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ EER
Sbjct  244   IEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNEER  303

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             +TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKL I+E
Sbjct  304   KTLDRELARAKVTANRVATVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLTITE  363

Query  1085  RTAKAEAQlkdklklrlktLEQGLK--QTGNNNVNPKVLSGFSKPEKANHLFGI-----L  927
             RTA++EAQ+K+K +LRL+ LE+ L+   T    V P   S  + P +   L G      L
Sbjct  364   RTARSEAQMKEKYQLRLRVLEETLRSPSTATRGV-PDARSSSNGPSRRQSLGGAENISKL  422

Query  926   SS----KKRSAS-QPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKENAG  762
             +S     KRS S Q R+S  +T  +    +  S +   +      +  +    + K++  
Sbjct  423   TSNGFLPKRSPSFQLRSSSSSTVLKHAKGTSKSFDGGSRSSDRSKVLLNGLGPNFKQSQS  482

Query  761   MKENSDKLTDSGNFSK----------NDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNT  612
                  +  T S  +            + ED V G LYD LQKEV+ +RK    K+  L  
Sbjct  483   CDGTKETETQSSTWKAEEKGSDIQVTDTEDTVPGLLYDLLQKEVVALRKAGHEKDQGLKD  542

Query  611   KDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
             KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++ 
Sbjct  543   KDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRV  584



>ref|XP_010553646.1| PREDICTED: microtubule-associated protein 70-3-like [Tarenaya 
hassleriana]
 ref|XP_010553654.1| PREDICTED: microtubule-associated protein 70-3-like [Tarenaya 
hassleriana]
Length=627

 Score =   360 bits (925),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 260/526 (49%), Positives = 365/526 (69%), Gaps = 27/526 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N +++K+RE+  AQ+E K LR +E+ ++KA+EEL  E+ ++E
Sbjct  68    ITLLHGSDPVKIELNRLENDVRDKDREVCEAQAEIKALRLSERQREKAVEELTEELGKME  127

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E L+E KNLE KK+  EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  128   EKLKLTEALLESKNLEIKKINEEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  187

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAALLEAER +++A+ +  +V+++QN+N EL 
Sbjct  188   EAELKLARQEIAKLQDDNKALDRLTKSKEAALLEAERTVQTAMAKASMVDDLQNKNQELM  247

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  248   KQIEICQEENKILDKLHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  307

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+ L+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  308   ERKVLDRELARAKVTANRVATVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLAI  367

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSG---FSKPEKANHLFGI---  930
             +ER AK+EAQLK+K ++RLK LE  L+ + +   N     G    + P +   L G    
Sbjct  368   AERAAKSEAQLKEKFQMRLKVLEDSLRGSSSGG-NRGAFDGRNVTNGPSRRQSLGGADNM  426

Query  929   -------LSSKKRSASQPRASMVNTTseqesssensgEYNDQKK------------RHHG  807
                      SK+  +SQ R+S    ++  + +   S  ++   +            R + 
Sbjct  427   SKFSSNGFLSKRTPSSQLRSSSSGISTVLKHAKGTSRSFDGGTRSLDRGKVLTNGSRSNF  486

Query  806   LWYSRNKIDEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKE  627
             L+   +   E  +A    +SD+       + N+ED V G LYD LQKEVI +RK    K+
Sbjct  487   LFNQSSGEGETSSAAKDGDSDEKPKEKPATINNEDSVPGILYDLLQKEVITLRKASQEKD  546

Query  626   NDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIK  489
               +  KDE I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++
Sbjct  547   QSIKDKDEAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMR  592



>ref|XP_009101312.1| PREDICTED: microtubule-associated protein 70-3 isoform X2 [Brassica 
rapa]
Length=630

 Score =   360 bits (923),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 263/531 (50%), Positives = 367/531 (69%), Gaps = 29/531 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL+ L+N++++K+REL  +Q+E K LR +E+ ++KA+EEL  E+ ++ 
Sbjct  62    ITLLHGSDPVRVELSRLENEVRDKDRELSESQAEIKALRLSERQREKAVEELTEELGKMS  121

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++ENLV+ KNLE KK+  EK+ ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  122   EKLKLAENLVQSKNLEIKKINEEKRASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  181

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EIA LQ+D RA++R  KSKEAALL+AER +++AL +  +V+++QN+N EL 
Sbjct  182   EAELKLARHEIAKLQDDNRALDRLTKSKEAALLDAERTVETALAKASMVDDLQNKNQELM  241

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEEN+ILD+ +RQKV EVE+ +QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  242   KQIEICQEENRILDRMHRQKVAEVEKFTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNE  301

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ERR L+RELAR KVSA+RVAT+VANEWKD +DKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  302   ERRVLDRELARAKVSASRVATVVANEWKDGSDKVMPVKQWLEERRFLQGEMQQLRDKLAI  361

Query  1091  SERTAKAEAQlkdklklrlktLEQGLK--QTGNNNVNPKVLSGFSKPEKANHLFGI----  930
             ++R AK+EAQLK+K +LRLK LE+ L+   +G N   P+  S  + P +   L G     
Sbjct  362   ADRAAKSEAQLKEKFQLRLKVLEESLRGPPSGGNRTTPEGRSISNGPSRRQSLGGADVIP  421

Query  929   -LSS----KKRSASQPRASMVNTTseqesssensgEYNDQKKRH----------HGLWYS  795
              L+S     KR+ S    S+ ++ S     +  + +  D   R               + 
Sbjct  422   KLTSNGFFSKRTPSSQFRSLSSSASTVLKHARGTSKSFDGGSRSLDRSKLLTNERSAKFP  481

Query  794   RNKIDEKENAGMKENSDKLTDS----GNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKE  627
              N+  E  + G   NS K  +S    G  S    D V G L+D LQKEVI +RK    K+
Sbjct  482   LNQSSEGTSEGDSPNSTKQEESEKPAGGTSN---DSVPGVLHDLLQKEVITLRKAAHDKD  538

Query  626   NDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDG  474
               +  KDE I+ML KK+ETLTKA+EVE++K +RE A  EK+ S ++    G
Sbjct  539   QSIRDKDEAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVSAMRVDNKG  589



>ref|XP_009101310.1| PREDICTED: microtubule-associated protein 70-3 isoform X1 [Brassica 
rapa]
 ref|XP_009101311.1| PREDICTED: microtubule-associated protein 70-3 isoform X1 [Brassica 
rapa]
Length=631

 Score =   360 bits (923),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 263/531 (50%), Positives = 367/531 (69%), Gaps = 29/531 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL+ L+N++++K+REL  +Q+E K LR +E+ ++KA+EEL  E+ ++ 
Sbjct  62    ITLLHGSDPVRVELSRLENEVRDKDRELSESQAEIKALRLSERQREKAVEELTEELGKMS  121

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++ENLV+ KNLE KK+  EK+ ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  122   EKLKLAENLVQSKNLEIKKINEEKRASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  181

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EIA LQ+D RA++R  KSKEAALL+AER +++AL +  +V+++QN+N EL 
Sbjct  182   EAELKLARHEIAKLQDDNRALDRLTKSKEAALLDAERTVETALAKASMVDDLQNKNQELM  241

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEEN+ILD+ +RQKV EVE+ +QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  242   KQIEICQEENRILDRMHRQKVAEVEKFTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNE  301

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ERR L+RELAR KVSA+RVAT+VANEWKD +DKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  302   ERRVLDRELARAKVSASRVATVVANEWKDGSDKVMPVKQWLEERRFLQGEMQQLRDKLAI  361

Query  1091  SERTAKAEAQlkdklklrlktLEQGLK--QTGNNNVNPKVLSGFSKPEKANHLFGI----  930
             ++R AK+EAQLK+K +LRLK LE+ L+   +G N   P+  S  + P +   L G     
Sbjct  362   ADRAAKSEAQLKEKFQLRLKVLEESLRGPPSGGNRTTPEGRSISNGPSRRQSLGGADVIP  421

Query  929   -LSS----KKRSASQPRASMVNTTseqesssensgEYNDQKKRH----------HGLWYS  795
              L+S     KR+ S    S+ ++ S     +  + +  D   R               + 
Sbjct  422   KLTSNGFFSKRTPSSQFRSLSSSASTVLKHARGTSKSFDGGSRSLDRSKLLTNERSAKFP  481

Query  794   RNKIDEKENAGMKENSDKLTDS----GNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKE  627
              N+  E  + G   NS K  +S    G  S    D V G L+D LQKEVI +RK    K+
Sbjct  482   LNQSSEGTSEGDSPNSTKQEESEKPAGGTSN---DSVPGVLHDLLQKEVITLRKAAHDKD  538

Query  626   NDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDG  474
               +  KDE I+ML KK+ETLTKA+EVE++K +RE A  EK+ S ++    G
Sbjct  539   QSIRDKDEAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVSAMRVDNKG  589



>ref|XP_008240691.1| PREDICTED: microtubule-associated protein 70-2-like [Prunus mume]
Length=610

 Score =   359 bits (921),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 265/534 (50%), Positives = 369/534 (69%), Gaps = 43/534 (8%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + L+H +DP  +EL  L+N L++K+RELG A  E K LR +E+LK+KA+EEL +E+ R++
Sbjct  52    ITLMHGSDPVRVELNRLENDLRDKDRELGDAVGEIKSLRNSERLKEKAVEELTDELNRVD  111

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK +E L+E KNLE KK+ +EKK AL AQ+AAEA LRRV+A QK+D+  PIE++IAPL
Sbjct  112   EKLKATEALLESKNLEIKKINDEKKAALAAQFAAEATLRRVHAAQKDDEMPPIEAIIAPL  171

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + E+A LQ+D RA++R  KSKEAAL+EAER ++ A+ +  +V+++QN+N EL 
Sbjct  172   EAELKLARQEVAKLQDDNRALDRLTKSKEAALVEAERTVQIAMVKASLVDDLQNKNQELM  231

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  232   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  291

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             E++ LERE+AR KVSANRVAT+VANEWKD +DKVMPVKQWLEERR  Q EMQ+L+DKLA+
Sbjct  292   EKKLLEREVARAKVSANRVATVVANEWKDSSDKVMPVKQWLEERRFFQGEMQQLRDKLAV  351

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNP----KVLSGFSKPEKANHLFGI--  930
             +ERTAKAEAQLK+K +LR K LE+  K T N    P    +++S  + P +   L G   
Sbjct  352   AERTAKAEAQLKEKYQLRFKVLEEKFKAT-NGKSRPSSDARIIS--NGPSRRQSLGGAEN  408

Query  929   --------LSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEK  774
                       S+ +S  Q   +  NT +     +++S    D   R       R+K+   
Sbjct  409   FCRASSNGYLSRTKSNLQSGFNRSNTATAILKQAKSSSRSFDGGSR----LLDRDKL--V  462

Query  773   ENAGMKENSDKLTD---------------SGNFSKND----EDMVSGFLYDRLQKEVINM  651
              +A  K+N++  +D               +G+ ++      ED VSG LYD LQKEV+++
Sbjct  463   PDATGKDNTNSASDQTQMDETIGRHEERANGSLAEQSRTEHEDYVSGVLYDMLQKEVVSL  522

Query  650   RKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIK  489
             RK    K+  L  KD+ I+ML KK++TL KA+EVE++K +RE A  EK+ S ++
Sbjct  523   RKACHEKDQTLKDKDDAIEMLAKKVDTLNKAMEVEAKKMRREVAAMEKEVSAMR  576



>ref|XP_004965146.1| PREDICTED: microtubule-associated protein 70-3-like isoform X1 
[Setaria italica]
Length=612

 Score =   359 bits (921),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 260/537 (48%), Positives = 374/537 (70%), Gaps = 38/537 (7%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + L+H +DP  +ELT L+N+L++KERELG AQ+E + LR +E+ ++KA+EEL +E+++++
Sbjct  33    IALMHGSDPVRVELTRLENELRDKERELGEAQAEIRALRLSERAREKAVEELTDELEKMD  92

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L++ KNLE K++ +EKK A+ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  93    EKLKLTESLLDSKNLEVKRINDEKKAAMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  152

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EI+ LQ+D RA++R  K KEAALLEAER ++ A+ +  +V+++QN+N EL 
Sbjct  153   EAELKLSRQEISKLQDDNRALDRLTKQKEAALLEAERTVQIAMAKAAMVDDLQNKNQELI  212

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEIC EENKILDK +RQK+ EVE+LSQT+ +LEEA+L GG  AN +RDY R+  E+ E
Sbjct  213   KQIEICHEENKILDKLHRQKIAEVEKLSQTVGDLEEALLQGGRNANVVRDYERRFQEMSE  272

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             E+RTL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLA+
Sbjct  273   EKRTLDRELARAKVTANRVATVVANEWKDSNDKVMPVKQWLEERRFLQGEMQQLRDKLAV  332

Query  1091  SERTAKAEAQlkdklklrlktLEQGLK--QTGNNNVNPKVLSGFSKPEKANHLF------  936
             +ERTA++EAQLK+K +LRLK LE GL+   +G+N    +  S  + P +   L       
Sbjct  333   AERTARSEAQLKEKYQLRLKVLEDGLRGLPSGSNRPPTEGKSFSNGPSRRLSLGGADNMS  392

Query  935   -----GILSSKKRSASQPRASMVNTTseqesssensgEYNDQKKR----------HHGLW  801
                  G+LS +  S     + + +++   + +   S  ++   +            H L 
Sbjct  393   KLSPNGLLSRRSPSFHSRSSLLSSSSLVLKHAKGTSKSFDGGTRSLDRGKVRVNGAHLLN  452

Query  800   YSRNKIDEKENA-GMKENSDKLTDSGNFSKNDE-----------DMVSGFLYDRLQKEVI  657
              S + + +KE+    K N D+ T     S  DE           + VSGFLYD LQKEVI
Sbjct  453   RSTDAVRDKESTDNWKGNVDERTSESADSTADEKRNETTNNNLAETVSGFLYDMLQKEVI  512

Query  656   NMRK-CFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIK  489
             ++RK C++ K+  L  KDE I++L KKI+TL KA+EVE++K +R+ A  EKD + ++
Sbjct  513   SLRKSCYE-KDQILKDKDENIEILEKKIDTLNKAMEVEAKKMRRQVAAMEKDVAAMR  568



>ref|XP_009117870.1| PREDICTED: microtubule-associated protein 70-4-like [Brassica 
rapa]
Length=601

 Score =   358 bits (920),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 260/545 (48%), Positives = 370/545 (68%), Gaps = 23/545 (4%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++KEREL  AQ+E K L+ +E+ ++KA+EEL  E+ ++ 
Sbjct  40    ITLLHGSDPVRIELNRLENEVRDKERELSEAQAEIKALKLSERQREKAVEELTEELGKMS  99

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
              KLK+ ENL+E KNLE KK+  EKK +  AQ+AAEA+LRRV+A QK+DD  PIE+++APL
Sbjct  100   AKLKLIENLLESKNLEIKKINEEKKASTAAQFAAEASLRRVHAAQKDDDMPPIEAILAPL  159

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D ++++R  KSKEAALL+AER ++SAL +  +V+++QN+N EL 
Sbjct  160   EAELKLARQEIANLQDDNKSLDRLTKSKEAALLDAERTVQSALAKASMVDDLQNKNQELM  219

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +Q EICQEENKI+DK +RQKV EVE+L Q++ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  220   KQTEICQEENKIIDKMHRQKVAEVEKLMQSVRELEEAVLAGGAAANAVRDYQRKFQEMNE  279

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+ LERELAR KV+ANRVAT+VANEWKD ND+VMPV+QWL+ERR LQ EMQ+L+DKLAI
Sbjct  280   ERKILERELARAKVNANRVATVVANEWKDSNDQVMPVRQWLDERRFLQGEMQQLRDKLAI  339

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQ-TGNNN-VNPKVLSGFSKPEKANHLFGILSSK  918
             ++R AK+EAQLK+K  LRL+ LE+ LK+ T N+N   P V S  + P +   L G  +S 
Sbjct  340   ADRAAKSEAQLKEKFLLRLRVLEESLKRPTSNSNRGTPGVRSSSNGPSRRQSLGGTETSP  399

Query  917   KRS----------ASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKEN  768
             K S          +SQ R+   + ++  + +   S  ++   +         N+     N
Sbjct  400   KYSSNGSLTKRTPSSQSRSLTASASTVLKHAKGTSISFDGGTRSLDINKVLMNRPGSNFN  459

Query  767   AGMKENSDKLTDSGNFS-------KNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTK  609
                 E + ++  + +           D D V G LYD LQK+VI +RK    K+  L  K
Sbjct  460   HQSSEGASRVESASSIQGEESDEKSKDYDSVPGVLYDLLQKDVITLRKAAHEKDQSLRDK  519

Query  608   DEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTI---KYKYDGNIRQTNSSLKSS  438
             DE I+ML KK+ETLTKA+E+E++K +RE A+  K+ + +   K + D   R+ +S  K S
Sbjct  520   DEAIEMLAKKVETLTKAMEIEAKKMRREVAVMGKEVAAMRVDKGQQDSKTRRISSISKGS  579

Query  437   IKVAK  423
                A+
Sbjct  580   SNTAQ  584



>ref|XP_004228735.1| PREDICTED: microtubule-associated protein 70-2-like [Solanum 
lycopersicum]
Length=622

 Score =   359 bits (921),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 262/527 (50%), Positives = 367/527 (70%), Gaps = 26/527 (5%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             LLH +DP  LEL  L+N++++K+REL  AQ+E K L+ +E+L++KA+EEL +E+ R++EK
Sbjct  61    LLHGSDPVKLELNRLENEVRDKDRELTEAQAEIKALKLSERLREKAVEELTDELSRVDEK  120

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APLEA
Sbjct  121   LKLTESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEA  180

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+ + EIA LQ+D +A++R  KSKEAALLEAER ++SAL +  +V+++QN+N EL +Q
Sbjct  181   ELKLARQEIAKLQDDNKALDRLTKSKEAALLEAERTVQSALAKASMVDDLQNKNQELMKQ  240

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILD+ +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ EER
Sbjct  241   IEICQEENKILDRMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNEER  300

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             +TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ L+DKL ++E
Sbjct  301   KTLDRELARAKVTANRVATVVANEWKDANDKVMPVKQWLEERRFLQGEMQTLRDKLTVTE  360

Query  1085  RTAKAEAQlkdklklrlktLEQGL-KQTGNNNVNPKVLSGFSKPEKANHLFGI-------  930
             R AK+EA LK++ +LRLK LE+ L   +      P   S  + P +   L G        
Sbjct  361   RAAKSEAMLKERYQLRLKVLEETLRSSSSATRSTPDGRSSSNGPSRRQSLGGAENISKLT  420

Query  929   ---LSSKKRSASQPRAS-----MVNTTseqesssensgEYNDQKKRHHGLWYSRN-----  789
                   K+  + Q R+S     + N     +S    S   +  K   +G   + N     
Sbjct  421   YNGFLPKRSPSFQLRSSGSSTVLKNAKGTSKSFDGGSRSLDRGKNLLNGTGPNFNSSKSC  480

Query  788   ---KIDEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDL  618
                K +E EN+  K +  + ++    ++  ED + G LYD LQKEV+ +RK    K+  L
Sbjct  481   DGTKDNETENSSWKASQVEKSNDTQVTET-EDTIPGILYDLLQKEVVALRKAGHEKDQSL  539

Query  617   NTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYD  477
               KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ S ++ + D
Sbjct  540   KDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVSAMRVEKD  586



>ref|XP_009149575.1| PREDICTED: microtubule-associated protein 70-4-like [Brassica 
rapa]
Length=601

 Score =   358 bits (920),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 260/545 (48%), Positives = 370/545 (68%), Gaps = 23/545 (4%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++KEREL  AQ+E K L+ +E+ ++KA+EEL  E+ ++ 
Sbjct  40    ITLLHGSDPVRIELNRLENEVRDKERELSEAQAEIKALKLSERQREKAVEELTEELGKMS  99

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
              KLK+ ENL+E KNLE KK+  EKK +  AQ+AAEA+LRRV+A QK+DD  PIE+++APL
Sbjct  100   AKLKLIENLLESKNLEIKKINEEKKASTAAQFAAEASLRRVHAAQKDDDMPPIEAILAPL  159

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D ++++R  KSKEAALL+AER ++SAL +  +V+++QN+N EL 
Sbjct  160   EAELKLARQEIANLQDDNKSLDRLTKSKEAALLDAERTVQSALAKASMVDDLQNKNQELM  219

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +Q EICQEENKI+DK +RQKV EVE+L Q++ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  220   KQTEICQEENKIIDKMHRQKVAEVEKLMQSVRELEEAVLAGGAAANAVRDYQRKFQEMNE  279

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+ LERELAR KV+ANRVAT+VANEWKD ND+VMPV+QWL+ERR LQ EMQ+L+DKL+I
Sbjct  280   ERKILERELARAKVNANRVATVVANEWKDSNDQVMPVRQWLDERRFLQGEMQQLRDKLSI  339

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQ-TGNNN-VNPKVLSGFSKPEKANHLFGILSSK  918
             S+R AK+EAQLK+K  LRL+ LE+ LK+ T N+N   P V S  + P +   L G  +S 
Sbjct  340   SDRAAKSEAQLKEKFLLRLRVLEESLKRPTSNSNRGTPGVRSSSNGPSRRQSLGGTETSP  399

Query  917   KRS----------ASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKEN  768
             K S          +SQ R+   + ++  + +   S  ++   +         N+     N
Sbjct  400   KYSSNGSLTKRTPSSQSRSLTASASTVLKHAKGTSISFDGGTRSLDINKVLMNRPGSNFN  459

Query  767   AGMKENSDKLTDSGNFS-------KNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTK  609
                 E + ++  + +           D D V G LYD LQK+VI +RK    K+  L  K
Sbjct  460   HQSSEGASRVESASSIQGEESDEKSKDYDSVPGVLYDLLQKDVITLRKAAHEKDQSLRDK  519

Query  608   DEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTI---KYKYDGNIRQTNSSLKSS  438
             DE I+ML KK+ETLTKA+E+E++K +RE A+  K+ + +   K + D   R+ +S  K S
Sbjct  520   DEAIEMLAKKVETLTKAMEIEAKKMRREVAVMGKEVAAMRVDKGQQDSKTRRISSISKGS  579

Query  437   IKVAK  423
                A+
Sbjct  580   SNTAQ  584



>ref|XP_010476557.1| PREDICTED: microtubule-associated protein 70-4-like [Camelina 
sativa]
Length=606

 Score =   358 bits (920),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 264/546 (48%), Positives = 374/546 (68%), Gaps = 32/546 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+REL  AQ+E K LR +E+ ++KA+EEL  E+ ++ 
Sbjct  43    MTLLHGSDPVRIELNRLENEVRDKDRELSEAQAEIKALRLSERQREKAVEELTEELGKMV  102

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK+ ENL+E KNLE KK+  EKK ++ AQ+AAEA+LRRV+A QK+DD  PIE+++APL
Sbjct  103   EKLKLVENLLESKNLEIKKINEEKKASMAAQFAAEASLRRVHAAQKDDDMPPIEAILAPL  162

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + E+A LQ+D R+++R  KSKEAALLEAER ++SAL +  +V+++QN+N EL 
Sbjct  163   EAELKLSRLEVAKLQDDNRSLDRLTKSKEAALLEAERTVQSALAKASMVDDLQNKNQELM  222

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEEN+I+DK +RQKV EVE+L Q++ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  223   KQIEICQEENRIIDKMHRQKVAEVEKLMQSVRELEEAVLAGGAAANAVRDYQRKFQEMNE  282

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+ LERELAR KV+ANRVAT+VANEWKD +DKVMPV+QWLEERR LQ EMQ+L+DKLAI
Sbjct  283   ERKILERELARAKVNANRVATVVANEWKDASDKVMPVRQWLEERRFLQGEMQQLRDKLAI  342

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQ--TGNNNVNPKVLSGFSKPEKANHLFGILSS-  921
             ++R AK+EAQLK+K  LRL+ LE+ LK+  + +N     V S  + P +   L G  +S 
Sbjct  343   ADRAAKSEAQLKEKFLLRLRVLEESLKRPTSSSNRGTSIVRSASNGPTRRQSLSGAETSP  402

Query  920   ---------KKRSASQPRASMVNTTseqesssensgEYN-------------DQKKRHHG  807
                      K+  +SQ R+   + +S  + +   S  ++             +  + +H 
Sbjct  403   KVTSNGSLTKRTPSSQLRSLTPSASSVLKHAKGTSRSFDGGTRPLDRSKLLINGPRSNHP  462

Query  806   LWYSRNKIDEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKE  627
             L +   +  E  N G   +S K  +  +    + D V G LYD LQKEVI +RK    K+
Sbjct  463   LNH---QSAEGTNRGESPSSVKGEEEPDDKSTNNDSVPGVLYDLLQKEVITLRKAAHEKD  519

Query  626   NDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTI---KYKYDGNIRQTN  456
               L  KDE I+ML KK+ETLTKA+EVE++K +RE A+  K+ + +   K + D   R+ +
Sbjct  520   QSLRDKDEAIEMLAKKVETLTKAMEVEAKKMRREVAVMGKEVAAMRVDKGQQDSKTRRPS  579

Query  455   SSLKSS  438
              S  SS
Sbjct  580   VSKGSS  585



>ref|XP_006364039.1| PREDICTED: microtubule-associated protein 70-2-like [Solanum 
tuberosum]
Length=624

 Score =   359 bits (921),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 262/527 (50%), Positives = 369/527 (70%), Gaps = 26/527 (5%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             LLH +DP  LEL  L+N++++K+REL  AQ+E K L+ +E+L++KA+EEL +E+ R++EK
Sbjct  63    LLHGSDPVKLELNRLENEVRDKDRELTEAQAEIKALKLSERLREKAVEELTDELSRVDEK  122

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APLEA
Sbjct  123   LKLTESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEA  182

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+ + EIA LQ+D +A++R  KSKEAALL+AER ++SAL +  +V+++QN+N EL +Q
Sbjct  183   ELKLARQEIAKLQDDNKALDRLTKSKEAALLDAERTVQSALAKASMVDDLQNKNQELMKQ  242

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILD+ +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ EER
Sbjct  243   IEICQEENKILDRMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNEER  302

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             +TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ L+DKLA++E
Sbjct  303   KTLDRELARAKVTANRVATVVANEWKDANDKVMPVKQWLEERRFLQGEMQTLRDKLAVTE  362

Query  1085  RTAKAEAQlkdklklrlktLEQGL-KQTGNNNVNPKVLSGFSKPEKANHLFGI-------  930
             R AK+EA LK++ +LRLK LE+ L   +      P   S  + P +   L G        
Sbjct  363   RAAKSEAMLKERYQLRLKVLEETLRSSSSATRSTPDGRSSSNGPSRRQSLGGAENISKLT  422

Query  929   ---LSSKKRSASQPRAS-----MVNTTseqesssensgEYNDQKKRHHGLWYSRN-----  789
                   K+  + Q R+S     + N     +S    S   +  K   +G   + N     
Sbjct  423   YNGFLPKRSPSFQLRSSGSSTVLKNAKGTSKSFDGGSRSLDRGKNLLNGTGPNFNSSKSC  482

Query  788   ---KIDEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDL  618
                K +E EN+  K +  + ++    ++ + D + G LYD LQKEVI +RK  + K+  L
Sbjct  483   DGTKDNETENSSWKASQVEKSNDTPVTERE-DTIPGILYDLLQKEVIALRKAGNEKDQSL  541

Query  617   NTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYD  477
               KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ S ++ + D
Sbjct  542   KDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVSAMRVEKD  588



>ref|XP_010093577.1| Microtubule-associated protein 70-2 [Morus notabilis]
 gb|EXB54299.1| Microtubule-associated protein 70-2 [Morus notabilis]
Length=903

 Score =   366 bits (940),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 265/520 (51%), Positives = 362/520 (70%), Gaps = 20/520 (4%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N+ ++K+RELG A +E K LR +E+LK+KA+EEL +E+ +++
Sbjct  68    ITLLHGSDPVRVELNRLENEFRDKDRELGDALAEIKSLRNSERLKEKAVEELTDELNKVD  127

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
              KLK SE L+E KNLE KK+ +EKK AL AQ+AAEA LRRV+A QK+D+  PIE++I PL
Sbjct  128   GKLKASEALLESKNLEIKKINDEKKAALAAQFAAEATLRRVHAAQKDDEMPPIEAIITPL  187

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + E+A LQ+D RA++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL 
Sbjct  188   EAELKLARQEVAKLQDDNRALDRLTKSKEAALLEAERTVEIALAKASLVDDLQNKNQELL  247

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  248   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  307

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TLERE+AR KVSANRVAT+VANEWKD NDKVMPVKQWLEER+  Q EMQ+L+DKLAI
Sbjct  308   ERKTLEREVARAKVSANRVATVVANEWKDANDKVMPVKQWLEERKFFQGEMQQLRDKLAI  367

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQ-------------TGNNNVNPKVLSG---FSK  960
             +ERTAKAEAQLK+K  +R K LE+ LK+             T N +   + L G   FS+
Sbjct  368   AERTAKAEAQLKEKYLMRFKVLEERLKRSNAGSRTASEARSTSNGSSRRQSLGGAENFSR  427

Query  959   PEKANHLFGILSSKKRSASQPRASMV---NTTseqesssensgEYNDQKKRHHGLWYSRN  789
                  +L   +S+ +    +  ++ V   N      S    S      K + +      +
Sbjct  428   LSANGYLSKRISNPQAGLQRSNSAAVLLKNAKVSSGSFDGGSRSVETDKLKDNVPSNVSD  487

Query  788   KIDEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTK  609
             + +     G K++    T +GN     ED VSG LYD LQKEVI +RK  + K+  L  K
Sbjct  488   QTEMTGTNGRKDDGPNATPTGNSRTEREDYVSGMLYDMLQKEVITLRKACNEKDQTLKDK  547

Query  608   DEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIK  489
             D+ I+MLTKK++TL KA+EVE++K +RE A  EK+ + ++
Sbjct  548   DDAIEMLTKKVDTLNKAMEVEAKKMRREVATMEKEVAAMR  587



>emb|CDY33736.1| BnaA09g45420D [Brassica napus]
Length=605

 Score =   358 bits (918),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 261/545 (48%), Positives = 369/545 (68%), Gaps = 23/545 (4%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             L LLH +DP  +EL  L+N++++K REL  AQ+E K LR +E+ ++KA+EEL  E+ ++ 
Sbjct  44    LTLLHGSDPVRVELNRLENEVRDKGRELSEAQAEIKALRLSERQREKAVEELTEELGKMS  103

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
              KLK+ ENL+E KNLE KK+  EKK +  AQ+AAEA+LRRV+A QK+DD  PIE+++APL
Sbjct  104   AKLKLIENLLESKNLEIKKINEEKKASTAAQFAAEASLRRVHAAQKDDDMPPIEAILAPL  163

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D ++++R  KSKEAALL+AER ++SAL +  +V+++QN+N EL 
Sbjct  164   EAELKLARQEIANLQDDNKSLDRLTKSKEAALLDAERTVQSALAKASMVDDLQNKNQELM  223

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +Q EICQEENKI+DK +RQKV EVE+L Q++ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  224   KQTEICQEENKIIDKMHRQKVAEVEKLMQSVRELEEAVLAGGAAANAVRDYQRKFQEMNE  283

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+ LERELAR KV+ANRVAT+VANEWKD ND+VMPV+QWL+ERR LQ EMQ+L+DKL+I
Sbjct  284   ERKILERELARAKVNANRVATVVANEWKDSNDQVMPVRQWLDERRFLQGEMQQLRDKLSI  343

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQ-TGNNN-VNPKVLSGFSKPEKANHLFGILSSK  918
             S+R AK+EAQLK+K  LRL+ LE+ LK+ T N+N   P V S  + P +   L G  +S 
Sbjct  344   SDRAAKSEAQLKEKFLLRLRVLEESLKRPTSNSNRGTPGVRSSSNGPSRRQSLGGTETSP  403

Query  917   KRS----------ASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKEN  768
             K S          +SQ R+   + ++  + +   S  ++   +         N+     N
Sbjct  404   KYSSNGSLTKRTPSSQSRSLTASASTVLKHAKGTSISFDGGTRSLDINKVLMNRPGSNFN  463

Query  767   AGMKENSDKLTDSGNFS-------KNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTK  609
                 E + ++  + +           D D V G LYD LQK+VI +RK    K+  L  K
Sbjct  464   HQSSEGASRVESASSIQGEESDEKSKDYDSVPGVLYDLLQKDVITLRKAAHEKDQSLRDK  523

Query  608   DEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTI---KYKYDGNIRQTNSSLKSS  438
             DE I+ML KK+ETLTKA+E+E++K +RE A+  K+ + +   K + D   R+ +S  K S
Sbjct  524   DEAIEMLAKKVETLTKAMEIEAKKMRREVAVMGKEVAAMRVDKGQQDSKTRRISSISKGS  583

Query  437   IKVAK  423
                A+
Sbjct  584   SNTAQ  588



>ref|XP_009603020.1| PREDICTED: microtubule-associated protein 70-2-like [Nicotiana 
tomentosiformis]
Length=618

 Score =   358 bits (919),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 268/540 (50%), Positives = 364/540 (67%), Gaps = 48/540 (9%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             L LLH +DP  LEL  L+N++++K+REL  AQ+E K LR +E+L++KA+EEL +E+ R++
Sbjct  55    LNLLHGSDPVKLELNRLENEVRDKDRELTEAQAEIKALRLSERLREKAVEELTDELSRVD  114

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  115   EKLKLTESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  174

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAALL+AER ++SAL +  +V+++QN+N EL 
Sbjct  175   EAELKLARQEIAKLQDDNKALDRLTKSKEAALLDAERTVQSALAKASMVDDLQNKNQELM  234

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILD+ +RQKV EVE+L+Q++ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  235   KQIEICQEENKILDRMHRQKVAEVEKLTQSVRELEEAVLAGGAAANAVRDYQRKVQEMNE  294

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ L+DKL +
Sbjct  295   ERKTLDRELARAKVTANRVATVVANEWKDANDKVMPVKQWLEERRFLQGEMQTLRDKLTV  354

Query  1091  SERTAKAEAQlkdklklrlktLEQGL-KQTGNNNVNPKVLSGFSKPEKANHLFGI-----  930
             +ER AK+EA LK+K +LRLK LE+ L   +      P   S  + P +   L G      
Sbjct  355   TERAAKSEAMLKEKYQLRLKVLEETLRSSSSATRSTPDGRSSSNGPARRQSLGGAENISK  414

Query  929   LSS----KKRSAS-QPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKEN-  768
             L+S     KRS S Q R+S  +T               + K            +D  +N 
Sbjct  415   LTSNGFLPKRSPSFQLRSSGSSTV------------LKNAKGTSKSFDGGSRSLDRGKNL  462

Query  767   ---AGMKENSDKLTD-------------SGNFSKND-------EDMVSGFLYDRLQKEVI  657
                 G   NS K  D             +    KN        ED + G LYD LQKEVI
Sbjct  463   LNGTGPNFNSSKSCDVAKDNETENNSWKASQVEKNSDTQVTEREDSIPGILYDLLQKEVI  522

Query  656   NMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYD  477
              +RK    K+  L  KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++ + D
Sbjct  523   ALRKAGHEKDQSLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRVEKD  582



>ref|NP_001057297.1| Os06g0251700 [Oryza sativa Japonica Group]
 sp|Q653N3.1|MP703_ORYSJ RecName: Full=Microtubule-associated protein 70-3; Short=AtMAP70-3; 
AltName: Full=70 kDa microtubule-associated protein 3 
[Oryza sativa Japonica Group]
 dbj|BAD45984.1| myosin II heavy chain-like [Oryza sativa Japonica Group]
 dbj|BAF19211.1| Os06g0251700 [Oryza sativa Japonica Group]
 dbj|BAG90017.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80331.1| hypothetical protein OsI_22392 [Oryza sativa Indica Group]
Length=608

 Score =   358 bits (918),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 268/560 (48%), Positives = 375/560 (67%), Gaps = 50/560 (9%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + L+H +DP  +ELT L+N+L++KERELG AQ+E + LR +E+ ++KA+EEL +E++++ 
Sbjct  33    IALMHGSDPVRVELTRLENELRDKERELGEAQTEIRALRLSERAREKAVEELTDELEKMF  92

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L++ KNLE KK+ +EKK A+ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  93    EKLKLTESLLDSKNLEVKKINDEKKAAMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  152

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D RA++R  K KEAALL+AER ++ A+ +  +V+++QN+N EL 
Sbjct  153   EAELKLARQEIAKLQDDNRALDRLTKQKEAALLDAERTVEIAMAKAAMVDDLQNKNQELM  212

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEIC EENKILDK  RQKV EV++LS T+ ELEEA+L GGA AN +RDY+RQ+ E+ +
Sbjct  213   KQIEICHEENKILDKLQRQKVAEVKKLSLTVKELEEAVLRGGATANVVRDYQRQVQEVND  272

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             +++TLE ELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLA+
Sbjct  273   QKKTLECELARAKVTANRVAVVVANEWKDSNDKVMPVKQWLEERRFLQGEMQQLRDKLAV  332

Query  1091  SERTAKAEAQlkdklklrlktLEQGLK--QTGNNNVNPKVLSGFSKPEKANHLFGILSSK  918
             +ERTA++EAQLK+K +LRLK LE GL+   +G++ +  +  S  + P +   L G  +  
Sbjct  333   AERTARSEAQLKEKYQLRLKVLEDGLRGPPSGSSRLPTEGKSFSNGPSRRLSLGGADNMS  392

Query  917   KRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYS---------RNKI------  783
             K S   P   +   +    S S  S   +   K   G   S         R+KI      
Sbjct  393   KLS---PNGLLARRSPSFHSRSSLSSSSSLVLKHAKGTSKSFDGGTRSLDRSKINGNGAH  449

Query  782   ----------DEKENAGMKENSDKLTDSGNFSKNDE-----------DMVSGFLYDRLQK  666
                       D + N   K N+D+ T     S  DE           +MVSGFLYD LQK
Sbjct  450   LLNRSTDAVRDCETNDSWKGNADEGTIENTNSNTDESNKETANNKSAEMVSGFLYDMLQK  509

Query  665   EVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSST---  495
             EVI++RK    K+  L  KD+ I+ML KK++TLTKA+EVE++K +RE A  EK+ +    
Sbjct  510   EVISLRKACHEKDQSLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREVAAMEKEVAAMRV  569

Query  494   -----IKYKYDGNIRQTNSS  450
                  +K +  G+ + T SS
Sbjct  570   DKEQEVKARRLGSSKGTGSS  589



>ref|XP_010695899.1| PREDICTED: microtubule-associated protein 70-2-like [Beta vulgaris 
subsp. vulgaris]
Length=635

 Score =   358 bits (920),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 265/530 (50%), Positives = 362/530 (68%), Gaps = 35/530 (7%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             L LLH +DP  +EL  L+N++++K+REL  AQ+E + LR +E+L++KA+EEL  E+ +++
Sbjct  73    LNLLHGSDPVKVELNRLENEVRDKDRELAEAQAEIRALRLSERLREKAVEELTEELAKVD  132

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
              KLK++ENL+E KNLE KK+  EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  133   GKLKLTENLLESKNLEIKKINEEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  192

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EI  LQ+D +A++R  KSKEAALLEAER +++AL +  +V+++QN+N EL 
Sbjct  193   EAELKLARQEIGKLQDDNKALDRLTKSKEAALLEAERTVQAALAKASMVDDLQNKNQELM  252

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  253   KQIEICQEENKILDKMHRQKVSEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKMQEMNE  312

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  313   ERKTLDRELARAKVTANRVATVVANEWKDSNDKVMPVKQWLEERRCLQGEMQQLRDKLAI  372

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNN------------NVNPKVLSGFSKPEKA  948
             +ER AK EAQLK+K +LRLK LE+ L+ T  N            N   + L G     KA
Sbjct  373   TERAAKTEAQLKEKFQLRLKVLEENLRGTSTNSNRSTPEGRSISNGRRQSLGGADTMSKA  432

Query  947   NHLFGILSSKKRSAS--------QPRASMVNTTseqesssensgEYNDQKK---RHHGLW  801
             N         KRS +           + M+        S +      D+ K         
Sbjct  433   NGFL-----PKRSPTLQSRSSLTSSASMMLRHAKGVSKSFDGGTRSLDRGKIMLNGSSTN  487

Query  800   YSRNKIDE-----KENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFD  636
             Y+ N+  E     +  +  KE+SD+  +    +   ED V G LYD LQKEV+ +RK   
Sbjct  488   YAVNQSSEGSKECEAQSTCKEDSDEKPNDAEIAVK-EDSVPGVLYDLLQKEVVALRKAGL  546

Query  635   MKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
              K+  L  KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++ 
Sbjct  547   EKDQSLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRL  596



>gb|EEE57764.1| hypothetical protein OsJ_08300 [Oryza sativa Japonica Group]
Length=599

 Score =   357 bits (916),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 263/534 (49%), Positives = 366/534 (69%), Gaps = 36/534 (7%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             L L+H +DP  +EL  L+N++++K+RELG A +E K LR +E+ ++KA+EEL  E ++L+
Sbjct  36    LTLMHGSDPVKVELNRLENEVRDKDRELGDAHAEIKALRLSERAREKAVEELTAEYEKLD  95

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L+E KNLE KK  +EKK A+ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  96    EKLKLTESLLESKNLELKKTNDEKKAAMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  155

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D RA++R  K KEAALLEAER ++ AL +  +V+++QN+N EL 
Sbjct  156   EAELKLARQEIAKLQDDNRALDRLTKQKEAALLEAERTVEIALAKAAMVDDMQNKNQELM  215

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILD+ +RQKV EVE+LSQT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  216   KQIEICQEENKILDRLHRQKVAEVEKLSQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  275

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+ L+RELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  276   ERKILDRELARAKVTANRVAVVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLAI  335

Query  1091  SERTAKAEAQlkdklklrlktLEQGL-------------KQTGNNNVNPKVLSGFSKPEK  951
             +ERTA++EAQLK+K +LRLK LE GL             K  GN       L G     K
Sbjct  336   AERTARSEAQLKEKYQLRLKVLEDGLRGPPSGSSRPTEGKSIGNGPSRRLSLGGADNMSK  395

Query  950   ANHLFGILSSKKRSASQPRASMVNTTseqesssensgEYNDQKKR----------HHGLW  801
              +   G+L+ +  S +   +   +++   + +   S  ++   +            H L 
Sbjct  396   ISP-NGMLARRSPSFNSRSSLSTSSSLVIKHAKGTSRSFDGGTRSLDRGKVLGNGPHLLN  454

Query  800   YSRNKI------DEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCF  639
              S + +      D+ + A  +E   + T+S +      D VSG LYD LQKEVI++RK  
Sbjct  455   RSTDAVRDCETTDDWKAANTEEKGSEATNSSST-----DTVSGVLYDMLQKEVISLRKAC  509

Query  638   DMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYD  477
               K+  L  KD+ I+ML KK++TLTKA+EVE++K +RE A  EK+ + ++   D
Sbjct  510   HEKDQSLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREVAAMEKEVAAMRLDKD  563



>ref|XP_010496581.1| PREDICTED: microtubule-associated protein 70-4-like [Camelina 
sativa]
Length=606

 Score =   357 bits (916),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 265/546 (49%), Positives = 375/546 (69%), Gaps = 32/546 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+REL  AQ+E K LR +E+ ++KA+EEL  E+ ++ 
Sbjct  43    MTLLHGSDPVRIELNRLENEVRDKDRELSEAQAEIKALRLSERQREKAVEELTEELGKMV  102

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK+ ENL+E KNLE KK+  EKK ++ AQ+AAEA+LRRV+A QK+DD  PIE+++APL
Sbjct  103   EKLKLVENLLESKNLEIKKINEEKKASMAAQFAAEASLRRVHAAQKDDDMPPIEAILAPL  162

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + E+A LQ+D R+++R  KSKEAALLEAER ++SAL +  +V+++QN+N EL 
Sbjct  163   EAELKLSRLEVAKLQDDNRSLDRLTKSKEAALLEAERTVQSALAKASMVDDLQNKNQELM  222

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEEN+I+DK +RQKV EVE+L Q++ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  223   KQIEICQEENRIIDKMHRQKVAEVEKLMQSVRELEEAVLAGGAAANAVRDYQRKFQEMNE  282

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+ LERELAR KV+ANRVAT+VANEWKD +DKVMPV+QWLEERR LQ EMQ+L+DKLAI
Sbjct  283   ERKILERELARAKVNANRVATVVANEWKDASDKVMPVRQWLEERRFLQGEMQQLRDKLAI  342

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQ-TGNNNVNPKV-LSGFSKPEKANHLFGILSS-  921
             ++R AK+EAQLK+K  LRL+ LE+ LK+ T ++N    +  S  + P +   L G  +S 
Sbjct  343   ADRAAKSEAQLKEKFLLRLRVLEESLKRPTSSSNRGTSIGRSASNGPTRRQSLSGAETSP  402

Query  920   ---------KKRSASQPRASMVNTTseqesssensgEYN-------------DQKKRHHG  807
                      K+  +SQ R+   + +S  + +   S  ++             +  + +H 
Sbjct  403   KITSNGSLTKRTPSSQLRSLTPSASSVLKHAKGTSRSFDGGTRSLDRSKLLINGPRSNHP  462

Query  806   LWYSRNKIDEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKE  627
             L    N+  E  N G   +S K  +  +    + D V G LYD LQKEVI +RK    K+
Sbjct  463   L---NNQSAEGTNRGESPSSVKGEEEPDDKSTNNDSVPGVLYDLLQKEVITLRKAAHEKD  519

Query  626   NDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTI---KYKYDGNIRQTN  456
               L  KDE I+ML KK+ETLTKA+EVE++K +RE A+  K+ + +   K + D   R+ +
Sbjct  520   LSLRDKDEAIEMLAKKVETLTKAMEVEAKKMRREVAVMGKEVAAMRVDKGQQDSKTRRPS  579

Query  455   SSLKSS  438
              S  SS
Sbjct  580   VSKGSS  585



>ref|NP_001048050.1| Os02g0736100 [Oryza sativa Japonica Group]
 sp|Q6Z746.1|MP702_ORYSJ RecName: Full=Microtubule-associated protein 70-2; Short=AtMAP70-2; 
AltName: Full=70 kDa microtubule-associated protein 2 
[Oryza sativa Japonica Group]
 dbj|BAD15899.1| putative myosin II heavy chain [Oryza sativa Japonica Group]
 dbj|BAF09964.1| Os02g0736100 [Oryza sativa Japonica Group]
 dbj|BAG95529.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73957.1| hypothetical protein OsI_08848 [Oryza sativa Indica Group]
Length=599

 Score =   357 bits (916),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 263/534 (49%), Positives = 366/534 (69%), Gaps = 36/534 (7%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             L L+H +DP  +EL  L+N++++K+RELG A +E K LR +E+ ++KA+EEL  E ++L+
Sbjct  36    LTLMHGSDPVKVELNRLENEVRDKDRELGDAHAEIKALRLSERAREKAVEELTAEYEKLD  95

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L+E KNLE KK  +EKK A+ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  96    EKLKLTESLLESKNLELKKTNDEKKAAMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  155

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D RA++R  K KEAALLEAER ++ AL +  +V+++QN+N EL 
Sbjct  156   EAELKLARQEIAKLQDDNRALDRLTKQKEAALLEAERTVEIALAKAAMVDDMQNKNQELM  215

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILD+ +RQKV EVE+LSQT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  216   KQIEICQEENKILDRLHRQKVAEVEKLSQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  275

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+ L+RELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  276   ERKILDRELARAKVTANRVAVVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLAI  335

Query  1091  SERTAKAEAQlkdklklrlktLEQGL-------------KQTGNNNVNPKVLSGFSKPEK  951
             +ERTA++EAQLK+K +LRLK LE GL             K  GN       L G     K
Sbjct  336   AERTARSEAQLKEKYQLRLKVLEDGLRGPPSGSSRPTEGKSIGNGPSRRLSLGGADNMSK  395

Query  950   ANHLFGILSSKKRSASQPRASMVNTTseqesssensgEYNDQKKR----------HHGLW  801
              +   G+L+ +  S +   +   +++   + +   S  ++   +            H L 
Sbjct  396   ISP-NGMLARRSPSFNSRSSLSTSSSLVIKHAKGTSRSFDGGTRSLDRGKVLGNGPHLLN  454

Query  800   YSRNKI------DEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCF  639
              S + +      D+ + A  +E   + T+S +      D VSG LYD LQKEVI++RK  
Sbjct  455   RSTDAVRDCETTDDWKAANTEEKGSEATNSSST-----DTVSGVLYDMLQKEVISLRKAC  509

Query  638   DMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYD  477
               K+  L  KD+ I+ML KK++TLTKA+EVE++K +RE A  EK+ + ++   D
Sbjct  510   HEKDQSLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREVAAMEKEVAAMRLDKD  563



>ref|XP_007028366.1| Microtubule-associated proteins 70-2 isoform 1 [Theobroma cacao]
 gb|EOY08868.1| Microtubule-associated proteins 70-2 isoform 1 [Theobroma cacao]
Length=610

 Score =   357 bits (916),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 268/528 (51%), Positives = 362/528 (69%), Gaps = 32/528 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+REL  A +E K LR +E+LK+KA+EEL +E+K+++
Sbjct  55    ITLLHGSDPVRVELNRLENEVRDKDRELADANAEIKSLRNSERLKEKAVEELTDELKKVD  114

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E L+E KNLE KK+ +EKK AL AQ+AAEA LRRV+A QK+D+  PIE++I PL
Sbjct  115   EKLKVTEALLESKNLEIKKINDEKKAALAAQFAAEATLRRVHAAQKDDEMPPIEAIITPL  174

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + E A LQED RA++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL 
Sbjct  175   EAELKLTRLEAAKLQEDNRALDRLTKSKEAALLEAERTVQIALAKASLVDDLQNKNQELM  234

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +R+Y+R++ E+ E
Sbjct  235   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVREYQRKVQEMNE  294

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             E++TLERE+AR KVSANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLA+
Sbjct  295   EKKTLEREVARAKVSANRVATVVANEWKDGNDKVMPVKQWLEERRFLQGEMQQLRDKLAV  354

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFG-------  933
             +ER AKAEA LK+K +LR K LE+ LK +  N+       G S  +      G       
Sbjct  355   AERAAKAEAHLKEKYQLRFKVLEERLKASTGNSRTASEGRGMSNGQSRRQSIGGAEIFLK  414

Query  932   ----ILSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKI--DEKE  771
                 I  S++    Q  +   N+ S    +++ S    D   R       R K+  D  E
Sbjct  415   SSSNIYLSRRSLNPQSGSLRSNSASALLRNAKMSSRSFDGGSRS----LDRGKMIPDAAE  470

Query  770   -NAGMKENSDKLTDS----------GNFSKN---DEDMVSGFLYDRLQKEVINMRKCFDM  633
              N  +  N D++  S          G   K+    ED VSG LYD LQKEVI +RK    
Sbjct  471   KNRMLPSNGDQILGSDIVRCEESSNGITEKSKAEHEDYVSGMLYDMLQKEVITLRKACHE  530

Query  632   KENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIK  489
             K+  L  KD+ I+ML KK+ETL KA++VE++K +RE A  EK+ + +K
Sbjct  531   KDQSLKDKDDAIEMLAKKVETLNKAMDVEAKKMRREVAAMEKEVAAMK  578



>ref|XP_010459001.1| PREDICTED: microtubule-associated protein 70-4 [Camelina sativa]
Length=606

 Score =   357 bits (915),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 263/546 (48%), Positives = 374/546 (68%), Gaps = 32/546 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+REL  AQ+E K LR +E+ ++KA+EEL  E+ ++ 
Sbjct  43    MTLLHGSDPVRIELNRLENEVRDKDRELSEAQAEIKALRLSERQREKAVEELTEELGKMV  102

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK+ ENL+E KNLE +K+  EKK ++ AQ+ AEA+LRRV+A QK+DD  PIE+++APL
Sbjct  103   EKLKLVENLLESKNLEIRKINEEKKASMAAQFVAEASLRRVHAAQKDDDMPPIEAILAPL  162

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + E+A LQ+D R+++R  KSKEAALLEAER ++SAL +  +V+++QN+N EL 
Sbjct  163   EAELKLSRLEVAKLQDDNRSLDRLTKSKEAALLEAERTVQSALAKASMVDDLQNKNQELM  222

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEEN+I+DK +RQKV EVE+L Q++ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  223   KQIEICQEENRIIDKMHRQKVAEVEKLMQSVRELEEAVLAGGAAANAVRDYQRKFQEMNE  282

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+ LERELAR KV+ANRVATIVANEWKD +DKVMPV+QWLEERR LQ EMQ+L+DKLAI
Sbjct  283   ERKILERELARAKVNANRVATIVANEWKDASDKVMPVRQWLEERRFLQGEMQQLRDKLAI  342

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQ-TGNNNVNPKV-LSGFSKPEKANHLFGILSS-  921
             ++R AK+EAQLK+K  LRL+ LE+ LK+ T ++N    +  S  + P +   L G  +S 
Sbjct  343   ADRAAKSEAQLKEKFLLRLRVLEESLKRPTSSSNRGTSIGRSASNGPTRRQSLSGAETSP  402

Query  920   ---------KKRSASQPRASMVNTTseqesssensgEYN-------------DQKKRHHG  807
                      K+  +SQ R+   + +S  + +   S  ++             +  + +H 
Sbjct  403   KVTSNGSLTKRTPSSQLRSLTPSASSVLKHAKGTSRSFDGGTRSLDRSKLLINGPRSNHP  462

Query  806   LWYSRNKIDEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKE  627
             L +   +  E  N G   +S K  +  +    + D V G LYD LQKEVI +RK    K+
Sbjct  463   LNH---QSAEGTNRGESPSSVKGEEESDDKSTNNDSVPGVLYDLLQKEVITLRKAAHEKD  519

Query  626   NDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTI---KYKYDGNIRQTN  456
               L  KDE I+ML KK+ETLTKA+EVE++K +RE A+  K+ + +   K + D   R+ +
Sbjct  520   QSLRDKDEAIEMLAKKVETLTKAMEVEAKKMRREVAVMGKEVAAMRVDKGQQDSKTRRPS  579

Query  455   SSLKSS  438
              S  SS
Sbjct  580   VSKGSS  585



>ref|XP_009382991.1| PREDICTED: microtubule-associated protein 70-1 [Musa acuminata 
subsp. malaccensis]
Length=617

 Score =   357 bits (916),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 267/544 (49%), Positives = 373/544 (69%), Gaps = 36/544 (7%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             LLH +DP  +EL  L+N++++K+REL  AQSE K LR +E+ ++KA+EEL  E+ +++EK
Sbjct  60    LLHGSDPVRVELNRLENEVRDKDRELSEAQSEIKALRLSERAREKAVEELTEELTKMDEK  119

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK++E+L+E +NLE KK+ +EK+EAL AQ+AAEA LRRV++ QK+DD  PIE+++APLEA
Sbjct  120   LKLTESLLENRNLEIKKINDEKREALAAQFAAEATLRRVHSAQKDDDMPPIEAILAPLEA  179

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+ ++E   LQ+D RA++R  KSKE ALLEAER ++ AL +  +V+++QN+N +L +Q
Sbjct  180   ELKLTRHENVKLQDDNRALDRLTKSKEVALLEAERTVQIALAKASLVDDLQNKNQDLMKQ  239

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILDK +RQKV EVE+LSQT+ ELEEA+LAGGAAAN +RDY+R++ E+ EE 
Sbjct  240   IEICQEENKILDKMHRQKVAEVEKLSQTVRELEEAVLAGGAAANAVRDYQRKVQEMSEEM  299

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             + L+RELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR +Q EMQ+L+DKLAI+E
Sbjct  300   KILDRELARAKVTANRVAVVVANEWKDANDKVMPVKQWLEERRFMQGEMQQLRDKLAIAE  359

Query  1085  RTAKAEAQlkdklklrlktLEQGLK--QTGNNNVNPKVLSGFSKPEKANHLF--------  936
             RTA++EAQLK+K +LRLK LE+GL+   +G N  +    S  + P     L         
Sbjct  360   RTARSEAQLKEKFQLRLKVLEEGLRISASGTNRTSVDGKSTSNSPSGRQSLCGADNVTKS  419

Query  935   --GILSSKKRSASQPRASMVNTTseqesssensg------EYNDQKKRHHGLWYSRNKID  780
               G LS  KR + Q R S+  +T  + +   +          +  K   +    S N+  
Sbjct  420   VDGFLS--KRPSFQMRYSISGSTVLKHAKGASKSFDGGTRSLDRSKVLVNAAGLSMNESS  477

Query  779   EKENAGM-----KENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLN  615
             +   + +     KEN DK T S     +  D VSG LYD LQ+EVI +RK    K+  L 
Sbjct  478   DATESDVSRNSWKENPDKRT-SELPDVDSVDCVSGLLYDILQREVITLRKACYEKDQSLK  536

Query  614   TKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY---------KYDGNIRQ  462
              KD+ I+ML KK++TLTKA+EVE++K +RE A+ EK+ + ++          +  G+   
Sbjct  537   DKDDAIEMLAKKVDTLTKAMEVEAKKMRREVALMEKEVAAMRVEKEQDNKSKRLGGSKGP  596

Query  461   TNSS  450
             TNSS
Sbjct  597   TNSS  600



>gb|EMT16813.1| hypothetical protein F775_18335 [Aegilops tauschii]
Length=556

 Score =   354 bits (909),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 256/491 (52%), Positives = 348/491 (71%), Gaps = 18/491 (4%)
 Frame = -3

Query  1925  EKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKLKISENLVEQKNLETKKLIN  1746
             +KE+ELG AQ+E K LR +E+ ++KA+E+L  E+ +++ KLK++E+L+E KNLE KK+ +
Sbjct  28    DKEKELGDAQAEIKALRLSERAREKAVEDLTEELAKVDGKLKLTESLLESKNLEAKKIND  87

Query  1745  EKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEIKMYKNEIAALQEDKRAME  1566
             EKK AL AQ+AAEA LRRV+A QK+DD  PIE+++APLEAE+K+ + EIA LQ+D RA++
Sbjct  88    EKKAALAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEAELKLARQEIAKLQDDNRALD  147

Query  1565  RHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIEICQEENKILDKTNRQKVL  1386
             R  KSKEAALLEAER ++ AL +  +V+++QN+N EL +QIEICQEENKILD+ +RQKV 
Sbjct  148   RLTKSKEAALLEAERTVQIALAKASLVDDLQNKNQELMKQIEICQEENKILDRMHRQKVA  207

Query  1385  EVERLSQTileleeailaggaaANTIRDYrrqiseiqeerrtlerelaRVKVSANRVATI  1206
             EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ EE +TL+RELAR KVSANRVA +
Sbjct  208   EVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNEEMKTLDRELARAKVSANRVAVV  267

Query  1205  VANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktL  1026
             VANEWKD NDKVMPVKQWLEERR+LQ EMQ+L+DKLAI+ER A++EAQLKDK +LRLK L
Sbjct  268   VANEWKDGNDKVMPVKQWLEERRLLQGEMQQLRDKLAIAERAARSEAQLKDKFQLRLKVL  327

Query  1025  EQGLK-QTGNNNVNPKVLSGFSKPEKANHLFGILSSKKRSASQPR-------ASMVNTTs  870
             E+GL+  T   N +          E A+   G LS  KR + Q R        ++VN   
Sbjct  328   EEGLRMSTSRTNASAARRQSIGGAESASKTNGFLS--KRPSFQMRTSVSTTTTTLVNHAK  385

Query  869   eqesssensgEYNDQKKRH---HGLWYSRNKIDEKENAGMKENSDKLTDSGNFSKNDEDM  699
                 S +      D+ K H    G+  S +  ++KE+    E   + T     S   ED 
Sbjct  386   GASKSFDGGCRSLDRYKGHVNGVGMNVSTDSSEDKESNNSDEKPSEFT-----SVESEDT  440

Query  698   VSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAA  519
             VSG LYD LQKEV+ +RK    K+  L  KD+ ++ML KK++TLTKA+E E++K +R+ A
Sbjct  441   VSGMLYDMLQKEVVALRKACHEKDQSLKDKDDAVEMLAKKVDTLTKAMESEAKKMRRDVA  500

Query  518   IREKDSSTIKY  486
               EK+   ++ 
Sbjct  501   AMEKEVVAMRL  511



>ref|XP_004953846.1| PREDICTED: microtubule-associated protein 70-2-like [Setaria 
italica]
Length=598

 Score =   355 bits (912),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 259/546 (47%), Positives = 364/546 (67%), Gaps = 34/546 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             L L+H +DP  +EL  L+N++++K+RELG A +E K LR +E+ ++KA+EEL  E+++++
Sbjct  35    LTLMHGSDPVKVELNRLENEVRDKDRELGEAHAEIKALRLSERAREKAVEELTAELEKVD  94

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L+E KNLE KK  +EKK AL AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  95    EKLKLTESLLETKNLELKKTNDEKKAALAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  154

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D RA++R  K KEAALLEAER ++ A+ +  +V+++QN+N EL 
Sbjct  155   EAELKLSRQEIAKLQDDNRALDRLTKQKEAALLEAERTVQIAMAKAAMVDDMQNKNQELM  214

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILD+ +RQKV EVE+LSQT+ ELEEA+L GGAAAN +RDY+R+  E+ E
Sbjct  215   KQIEICQEENKILDRLHRQKVAEVEKLSQTVRELEEAVLQGGAAANAVRDYQRKFQEMNE  274

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             E++ L+RELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR +Q EMQ+L+DKLAI
Sbjct  275   EKKILDRELARAKVTANRVAVVVANEWKDANDKVMPVKQWLEERRFMQGEMQQLRDKLAI  334

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILSSKKR  912
             +ERTA++EAQLK+K +LRLK LE GL+   + +  P    G S          +  +   
Sbjct  335   AERTARSEAQLKEKYQLRLKVLEDGLRGPPSGSSRPPT-EGKSISNGPPRRLSLGGADSM  393

Query  911   SASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYS---------RNKIDEKENAGM  759
             S + P   ++  +    S S  +   +   K   G   S         R K+       +
Sbjct  394   SKASPNGVLMRRSPSFNSRSSLTTSSSLVLKHAKGTSRSFDGGTRSLDRGKVLGNGPHSL  453

Query  758   KENSDKLTD--------------SGNFSKND-EDMVSGFLYDRLQKEVINMRKCFDMKEN  624
               ++D + D              +   +KND  DMVS   YD LQKEV+++RK    K+ 
Sbjct  454   NRSTDAVKDRETDDNWKADAEEKNNETTKNDSSDMVSSVFYDMLQKEVVSLRKACHEKDQ  513

Query  623   DLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTI--------KYKYDGNI  468
              L  KD+ I+ML KK++TL KA+EVE++K +RE A  EK+ + +        K K  GN+
Sbjct  514   SLKDKDDAIEMLAKKVDTLNKAMEVEAKKMRREIAAMEKEFAAVRLEKEQDNKAKRLGNL  573

Query  467   RQTNSS  450
             +   +S
Sbjct  574   KGPGTS  579



>ref|XP_009777395.1| PREDICTED: microtubule-associated protein 70-2-like [Nicotiana 
sylvestris]
Length=618

 Score =   356 bits (914),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 268/540 (50%), Positives = 364/540 (67%), Gaps = 48/540 (9%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             L LLH +DP  LEL  L+N++++K+REL  AQ+E K LR +E+L++KA+EEL +E+ R++
Sbjct  55    LNLLHGSDPVKLELNRLENEVRDKDRELTEAQAEIKALRLSERLREKAVEELTDELSRVD  114

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  115   EKLKLTESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  174

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAALL+AER ++SAL +  +V+++QN+N EL 
Sbjct  175   EAELKLARQEIAKLQDDNKALDRLTKSKEAALLDAERTVQSALAKASMVDDLQNKNQELM  234

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEIC EENKILD+ +RQKV EVE+L+Q++ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  235   KQIEICLEENKILDRMHRQKVAEVEKLTQSVRELEEAVLAGGAAANAVRDYQRKVQEMNE  294

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ L+DKLA+
Sbjct  295   ERKTLDRELARAKVTANRVATVVANEWKDANDKVMPVKQWLEERRFLQGEMQTLRDKLAV  354

Query  1091  SERTAKAEAQlkdklklrlktLEQGL-KQTGNNNVNPKVLSGFSKPEKANHLFGI-----  930
             +ER AK+EA LK+K +LRLK LE+ L   +      P   S  + P +   L G      
Sbjct  355   TERAAKSEAMLKEKYQLRLKVLEETLRSSSSATRSTPDGRSSSNGPARRQSLGGAENISK  414

Query  929   LSS----KKRSAS-QPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKEN-  768
             L+S     KRS S Q R+S  +T               + K            +D  +N 
Sbjct  415   LTSNGFLPKRSPSFQLRSSGSSTV------------LKNAKGTSKSFDGGSRSLDRGKNL  462

Query  767   ---AGMKENSDKLTD-------------SGNFSKND-------EDMVSGFLYDRLQKEVI  657
                 G   NS K  D             +    KN        ED + G LYD LQKEVI
Sbjct  463   LNGTGPNFNSSKSCDVAKDNETENNSWKASQVEKNSDTQVTEREDSIPGILYDLLQKEVI  522

Query  656   NMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYD  477
              +RK    K+  L  KD+ I+ML KK+ETLTKA+EVE++K +RE A  EK+ + ++ + D
Sbjct  523   ALRKAGHEKDQSLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRVEKD  582



>ref|XP_007160432.1| hypothetical protein PHAVU_002G321500g [Phaseolus vulgaris]
 gb|ESW32426.1| hypothetical protein PHAVU_002G321500g [Phaseolus vulgaris]
Length=616

 Score =   356 bits (913),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 269/528 (51%), Positives = 378/528 (72%), Gaps = 30/528 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+REL  AQ+E K LR +E+L++KA+E L  E+ ++E
Sbjct  51    MNLLHGSDPVKVELNRLENEVRDKDRELSEAQAEIKALRFSERLREKAVEVLNEELSKVE  110

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
              KLK++E+L+E KNLE KK+ ++KK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  111   GKLKLTESLLESKNLEIKKINDDKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  170

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAALLEAE+ ++ AL +  +V+++QN+N EL 
Sbjct  171   EAELKLARQEIAKLQDDNKALDRLTKSKEAALLEAEKTVQIALAKASMVDDLQNKNQELI  230

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +R KV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  231   KQIEICQEENKILDKMHRLKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  290

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  291   ERKTLDRELARAKVTANRVAVVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLAI  350

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSG---FSKPEKANHLFGI---  930
             +ERTAK+EAQLK+K +LRLK L++ L++T +N++N     G    + P +   L G    
Sbjct  351   TERTAKSEAQLKEKYQLRLKVLQESLRET-SNSINRGTSEGRCISNGPSRRQSLGGADNI  409

Query  929   --LSSK---KRSASQPRASMVNTTseqesssensgEYNDQKK---RHHGLW------YSR  792
               L+S    KRS S    S V++++  + +   S  ++   +   R   L       YS 
Sbjct  410   SKLTSNGFLKRSPSTQVRSSVSSSAVLKHAKGTSKSFDGGTRSLERSKILLNGKPPSYSF  469

Query  791   NKI-----DEKENAGMKENSDKLTDSGNFSKND-EDMVSGFLYDRLQKEVINMRKCFDMK  630
             N+      D +EN   K NSD   +  +F   D ED VSG LYD LQKEV+++RK    K
Sbjct  470   NQSSEGTKDREENDNWKGNSDDKPN--DFPTVDTEDSVSGVLYDLLQKEVLSLRKAGHEK  527

Query  629   ENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
             +  L  KD+ I+ML KK++TLTKA+EVE++K +RE A  EK+ + ++ 
Sbjct  528   DQSLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREVASMEKEVAAMRV  575



>gb|EEE65458.1| hypothetical protein OsJ_20834 [Oryza sativa Japonica Group]
Length=615

 Score =   355 bits (912),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 266/554 (48%), Positives = 371/554 (67%), Gaps = 49/554 (9%)
 Frame = -3

Query  1973  TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEKLKIS  1794
             +DP  +ELT L+N+L++KERELG AQ+E + LR +E+ ++KA+EEL +E++++ EKLK++
Sbjct  4     SDPVRVELTRLENELRDKERELGEAQTEIRALRLSERAREKAVEELTDELEKMFEKLKLT  63

Query  1793  ENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEIKM  1614
             E+L++ KNLE KK+ +EKK A+ AQ+AAEA LRRV+A QK+DD  PIE+++APLEAE+K+
Sbjct  64    ESLLDSKNLEVKKINDEKKAAMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEAELKL  123

Query  1613  YKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQIEIC  1434
              + EIA LQ+D RA++R  K KEAALL+AER ++ A+ +  +V+++QN+N EL +QIEIC
Sbjct  124   ARQEIAKLQDDNRALDRLTKQKEAALLDAERTVEIAMAKAAMVDDLQNKNQELMKQIEIC  183

Query  1433  QEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeerrtle  1254
              EENKILDK  RQKV EV++LS T+ ELEEA+L GGA AN +RDY+RQ+ E+ ++++TLE
Sbjct  184   HEENKILDKLQRQKVAEVKKLSLTVKELEEAVLRGGATANVVRDYQRQVQEVNDQKKTLE  243

Query  1253  relaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTAK  1074
              ELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLA++ERTA+
Sbjct  244   CELARAKVTANRVAVVVANEWKDSNDKVMPVKQWLEERRFLQGEMQQLRDKLAVAERTAR  303

Query  1073  AEAQlkdklklrlktLEQGLK--QTGNNNVNPKVLSGFSKPEKANHLFGILSSKKRSASQ  900
             +EAQLK+K +LRLK LE GL+   +G++ +  +  S  + P +   L G  +  K S   
Sbjct  304   SEAQLKEKYQLRLKVLEDGLRGPPSGSSRLPTEGKSFSNGPSRRLSLGGADNMSKLS---  360

Query  899   PRASMVNTTseqesssensgEYNDQKKRHHGLWYS---------RNKI------------  783
             P   +   +    S S  S   +   K   G   S         R+KI            
Sbjct  361   PNGLLARRSPSFHSRSSLSSSSSLVLKHAKGTSKSFDGGTRSLDRSKINGNGAHLLNRST  420

Query  782   ----DEKENAGMKENSDKLTDSGNFSKNDE-----------DMVSGFLYDRLQKEVINMR  648
                 D + N   K N+D+ T     S  DE           +MVSGFLYD LQKEVI++R
Sbjct  421   DAVRDCETNDSWKGNADEGTIENTNSNTDESNKETANNKSAEMVSGFLYDMLQKEVISLR  480

Query  647   KCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSST--------I  492
             K    K+  L  KD+ I+ML KK++TLTKA+EVE++K +RE A  EK+ +         +
Sbjct  481   KACHEKDQSLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREVAAMEKEVAAMRVDKEQEV  540

Query  491   KYKYDGNIRQTNSS  450
             K +  G+ + T SS
Sbjct  541   KARRLGSSKGTGSS  554



>ref|XP_008455712.1| PREDICTED: microtubule-associated protein 70-2-like [Cucumis 
melo]
Length=612

 Score =   355 bits (912),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 270/544 (50%), Positives = 378/544 (69%), Gaps = 47/544 (9%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+RELG A +E K L+ +E+LK+KA+EEL +E+K+++
Sbjct  55    ITLLHGSDPVRVELNRLENEVRDKDRELGEALAEVKSLKNSERLKEKAVEELTDELKKVD  114

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK +E L+E KNLE KK+ +EKK AL AQ+AAEA LRRV+A QK+D+  PIE++IAPL
Sbjct  115   EKLKATEALLESKNLEIKKINDEKKAALAAQFAAEATLRRVHAAQKDDEMPPIEAIIAPL  174

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + E+A LQ+D RA++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL 
Sbjct  175   EAELKLARLEVAKLQDDNRALDRLTKSKEAALLEAERTVQIALAKASLVDDLQNKNQELM  234

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILD+ +RQKV EVE+L QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  235   KQIEICQEENKILDRLHRQKVAEVEKLMQTVRELEEAVLAGGAAANAVRDYQRKVQEMSE  294

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ERRTLERE+AR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR  Q EMQ+L++KLA+
Sbjct  295   ERRTLEREVARAKVTANRVATVVANEWKDANDKVMPVKQWLEERRFFQGEMQQLREKLAV  354

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPK-------VLSGFSKPEKANHL--  939
             +ERTAKAEAQ+K+K +LR K LE+ L+   ++N NPK       + +G S+ +       
Sbjct  355   AERTAKAEAQMKEKYQLRFKVLEEKLR---SSNGNPKLALEGRGISTGVSRRQSLGGAEL  411

Query  938   -----FGILSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEK  774
                   G L S++ + S   +   N+ S    +++ S    D   R       R+K+   
Sbjct  412   TRQTSNGYL-SRRNTNSHTGSLQSNSASALLKTTKISSRSFDGGSRS----LERDKL--V  464

Query  773   ENAGMKENSDKLTDSG--NFSKN-------------------DEDMVSGFLYDRLQKEVI  657
             ++  +K NS K+T SG   FS+                     ED+VSG LYD LQKEVI
Sbjct  465   QDVVVKNNSTKIT-SGEIQFSETTAPYEENEDGIGIEKTKTEQEDLVSGALYDMLQKEVI  523

Query  656   NMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYD  477
             ++RK  + K+  L  KD+ I+ML KK++TL KA+EVE +K +RE    EK+ + ++   +
Sbjct  524   SLRKACNEKDVTLKDKDDAIEMLAKKVDTLNKAMEVEGKKMRREVVAMEKELAALRVSRE  583

Query  476   GNIR  465
              + R
Sbjct  584   SDQR  587



>gb|KHN15454.1| Microtubule-associated protein 70-2 [Glycine soja]
Length=573

 Score =   354 bits (908),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 266/548 (49%), Positives = 370/548 (68%), Gaps = 26/548 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+REL  AQ+E K LR +E+L++KA+EEL  E+ +++
Sbjct  7     MNLLHGSDPVKVELNRLENEVRDKDRELSEAQAEIKALRLSERLREKAVEELTEELSKVD  66

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  67    EKLKLTESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  126

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL 
Sbjct  127   EAELKLARQEIAKLQDDNKALDRLTKSKEAALLEAERTVQVALAKASMVDDLQNKNQELI  186

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  187   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  246

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  247   ERKTLDRELARAKVTANRVAVVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLAI  306

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGN--NNVNPKVLSGFSKPEKANHLF------  936
              ER AK EAQLK+K  LRLK LE+GL+   N  N   P+  S  + P +   L       
Sbjct  307   VERAAKYEAQLKEKYHLRLKVLEEGLRGNSNSSNRGTPEGRSMSNGPSRRQSLGGADNFS  366

Query  935   -----GILSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKE  771
                  G LS +  S+    +   +T  +    +  S +   +      +  +        
Sbjct  367   KLTSNGFLSKRSPSSQLRSSLSSSTVLKHAKGTSKSFDGGTRSLERSKMLLNGTPPSYSF  426

Query  770   NAGM-----KENSDKLTDSGNFSKND------EDMVSGFLYDRLQKEVINMRKCFDMKEN  624
             N  M     +E SD    + +   ND       D V   LYD LQKEVI +RK    K+ 
Sbjct  427   NQSMEETKEREASDNWKGNSDDKPNDFPTVDSVDSVPSVLYDFLQKEVIALRKAGHEKDQ  486

Query  623   DLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY-KYDGNIRQTNSSL  447
              L  KD+ I+ML KK++TLTKA+EVE++K +RE A  EK+ + ++  K   N  +  S++
Sbjct  487   SLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREVAAMEKEVAAMRVEKEHENRAKRFSNI  546

Query  446   KSSIKVAK  423
             K  + +A+
Sbjct  547   KGPVNIAQ  554



>ref|XP_009417688.1| PREDICTED: microtubule-associated protein 70-2-like [Musa acuminata 
subsp. malaccensis]
Length=642

 Score =   356 bits (914),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 262/530 (49%), Positives = 373/530 (70%), Gaps = 39/530 (7%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             LLH +DP  +EL  L+N++++K+RELG AQ+E K L+ +E+ ++KA+EEL  E+ +++ K
Sbjct  46    LLHGSDPVKVELNRLENEVRDKDRELGEAQAEIKALKLSERAREKAVEELTEELTKVDGK  105

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK++E+++E KNLE KKL +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APLEA
Sbjct  106   LKLTESILESKNLEIKKLNDEKKSSMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEA  165

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             EIK+ + EIA LQ+D RA++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL +Q
Sbjct  166   EIKLARQEIAKLQDDNRALDRLTKSKEAALLEAERTIEIALAKASMVDDLQNKNQELMKQ  225

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKI DK +RQKV EVE+LS T+ ELEEA+LAGGAAAN +RDY+R++ E+ EER
Sbjct  226   IEICQEENKIFDKLHRQKVFEVEKLSLTVRELEEAVLAGGAAANAVRDYQRKVQEMNEER  285

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             +TL+RELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR +Q EMQ+L+DKLAI++
Sbjct  286   KTLDRELARAKVTANRVAVVVANEWKDANDKVMPVKQWLEERRFMQGEMQQLRDKLAIAD  345

Query  1085  RTAKAEAQlkdklklrlktLEQGLKQTG--------------NNNVNPKVLSG---FSKP  957
             RTA+ EAQLK+K +LRLK +E+GL+ +               N +   + + G    SKP
Sbjct  346   RTARYEAQLKEKYQLRLKVVEEGLRMSSSGSSRTNIEGKSVTNGSTRRQSIGGAENLSKP  405

Query  956   EKANHLFGILSSKKRSASQPRASMVNTTseqesssensgEYNDQKKR------------H  813
                  LFG    ++  + Q R+S+ ++TS     ++ + +  D   R             
Sbjct  406   -----LFGGSVVRRSPSFQLRSSLSSSTSAVLKHAKGTSKSFDGGTRSLDRGKVLAIGMS  460

Query  812   HGLWYSRNKIDEKENAGMKEN--SDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCF  639
             H L  S + I + + +   E   ++KL +  + S + +D VSG LYD LQKEVI +RK  
Sbjct  461   HSLDRSSDGIKDIDASNTCEGIPNEKLCE--HNSADSDDTVSGLLYDMLQKEVITLRKAC  518

Query  638   DMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIK  489
               K+  L  KD+ I++L KK++TLTKA+EVE++K +RE A  EK+ + ++
Sbjct  519   HEKDQSLKDKDDAIEILAKKVDTLTKAMEVEAKKMRREVATMEKEVAAMR  568



>ref|XP_004297434.1| PREDICTED: microtubule-associated protein 70-1-like [Fragaria 
vesca subsp. vesca]
Length=623

 Score =   355 bits (911),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 263/525 (50%), Positives = 370/525 (70%), Gaps = 29/525 (6%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             LLH +DP  +EL  L+N++++K+RELG AQ++ K L+ +E+ ++KA+EEL +E+ +++EK
Sbjct  63    LLHGSDPVKVELNRLENEVRDKDRELGEAQAQIKALKLSERAREKAVEELSDELSKVDEK  122

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APLEA
Sbjct  123   LKLTESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEA  182

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+ + EIA LQ+D +A++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL +Q
Sbjct  183   ELKLARQEIAKLQDDNKALDRLTKSKEAALLEAERTVEVALVKASMVDDLQNKNQELMKQ  242

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEEN+ILD+ +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R+  E+ EER
Sbjct  243   IEICQEENRILDRMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNEER  302

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             +TL+RELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI+E
Sbjct  303   KTLDRELARAKVTANRVAVVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLAITE  362

Query  1085  RTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGILSSKKRSA  906
             R AK+EAQLK+K  +RLK LE+ ++ + N + +    S  + P +   L G  +  K S+
Sbjct  363   RAAKSEAQLKEKYHMRLKVLEESVRGSSNISRSTAERSTSNGPSRRQSLGGADNIPKLSS  422

Query  905   -------SQPRASMVNTTseqesssensgEYNDQKK---RHHG--------LWYSRNKID  780
                    +  R+   +T+S  + +   S  ++   +   R  G          +S N+  
Sbjct  423   NGFLSKRTPVRSLSSSTSSVLKHAKGTSKSFDGGTRSLDRDRGKVLLNGPSPTFSVNQSC  482

Query  779   EKENAG-----MKENSDKLTDSGN-FSKND-EDMVSGFLYDRLQKEVINMRKCFDMKEND  621
             E    G      K NSD   D  N FS  D ED V G LYD LQKEV+ +RK    K+  
Sbjct  483   EGTKDGEAQNNWKGNSD---DKPNEFSTVDTEDNVPGVLYDLLQKEVVALRKAGHEKDQS  539

Query  620   LNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
             L  KD+ I+ML KK++TLTKA+EVE+RK +RE A  EK+ + ++ 
Sbjct  540   LKDKDDAIEMLAKKVDTLTKAMEVEARKMRREVAAMEKEVAAMRV  584



>ref|XP_004144334.1| PREDICTED: microtubule-associated protein 70-2-like [Cucumis 
sativus]
Length=612

 Score =   354 bits (909),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 268/543 (49%), Positives = 374/543 (69%), Gaps = 45/543 (8%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++KERELG A +E K L+ +E+LK+K +EEL +E+K+++
Sbjct  55    ITLLHGSDPVRVELNRLENEVRDKERELGEALAEVKSLKNSERLKEKGVEELTDELKKVD  114

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK +E L+E KNLE KK+ +EKK AL AQ+AAEA LRRV+A QK+D+  PIE++IAPL
Sbjct  115   EKLKATEALLESKNLEIKKINDEKKAALAAQFAAEATLRRVHAAQKDDEMPPIEAIIAPL  174

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + E+A LQ+D RA++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL 
Sbjct  175   EAELKLARLEVAKLQDDNRALDRLTKSKEAALLEAERTVQIALAKASLVDDLQNKNQELM  234

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILD+ +RQKV EVE+L QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  235   KQIEICQEENKILDRLHRQKVAEVEKLMQTVRELEEAVLAGGAAANAVRDYQRKVQEMSE  294

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ERRTLERE+AR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR  Q EMQ+L++KLA+
Sbjct  295   ERRTLEREVARAKVTANRVATVVANEWKDANDKVMPVKQWLEERRFFQGEMQQLREKLAV  354

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKV---LSGFSKPEKANHLFGILS-  924
             +ERTAKAEAQ+K+K +LR K LE+ L+   ++N NPK+   + G S         G    
Sbjct  355   AERTAKAEAQMKEKYQLRFKVLEEKLR---SSNGNPKLALEVRGISTGVSRRQSLGGAEL  411

Query  923   ---------SKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKE  771
                      S++ + S   +   N+ S    +++ S    D   R       R+K+   +
Sbjct  412   TRQTSNGYLSRRHTNSHTGSLQSNSASALLKTTKISSRSFDGGSRS----LERDKL--VQ  465

Query  770   NAGMKENSDKLTDSG--NFSKN-------------------DEDMVSGFLYDRLQKEVIN  654
             +  +K NS K+  SG   FS+                     ED+VSG LYD LQKEVI 
Sbjct  466   DVVVKNNSTKIV-SGEIQFSETTAPYEENEDGIGIEKTKTEQEDLVSGALYDMLQKEVIT  524

Query  653   MRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDG  474
             +RK  + K+  L  KD+ I+ML +K++TL KA+EVE++K +RE A  EK+ + ++   + 
Sbjct  525   LRKACNEKDVTLKDKDDAIEMLARKVDTLNKAMEVEAKKMRREVASMEKELAALRVSRES  584

Query  473   NIR  465
             + R
Sbjct  585   DQR  587



>ref|XP_003520494.1| PREDICTED: microtubule-associated protein 70-2-like [Glycine 
max]
Length=587

 Score =   353 bits (905),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 267/542 (49%), Positives = 363/542 (67%), Gaps = 31/542 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + L H +DP  +ELT LQN+L+EK+RELG A +E K LR +E+LK++ +EEL +E+ +++
Sbjct  29    ISLFHGSDPVRVELTRLQNELREKDRELGDALAEIKSLRNSERLKERGVEELTDELIKVD  88

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK +E L+E KNLE  K+  EK+  L AQ+AAEA LR V A QK+D+  PIE++IAPL
Sbjct  89    EKLKAAEALLESKNLELNKINEEKRATLAAQFAAEATLRTVRAAQKDDEMPPIEAIIAPL  148

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + E+A LQ+D RA++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL 
Sbjct  149   EAELKLARMEVAKLQDDNRALDRLTKSKEAALLEAERTVQIALAKASLVDDLQNKNQELM  208

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK  RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  209   KQIEICQEENKILDKILRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  268

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+ LERE+AR KV+ANRVAT+VANEWKD NDKVMPVKQWLEER+  Q EMQ+L+DKLAI
Sbjct  269   ERKILEREVARAKVTANRVATVVANEWKDANDKVMPVKQWLEERKFFQGEMQQLRDKLAI  328

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSG---FSKPEKANHLFGI---  930
             +ERTAKAEAQ+K+K +LR K LE+ +K T N N    V  G    + P +    FG    
Sbjct  329   AERTAKAEAQMKEKYQLRFKVLEERVK-TSNGNSKFTVSDGRNIGTGPSR-RQSFGEAES  386

Query  929   --------LSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRH----------HGL  804
                       S+K S S+  +   N+ +     ++ S    D   R+          +GL
Sbjct  387   LSASSSNGYQSRKNSISRSGSLRSNSANVLLKHAKLSSRSFDGGSRNLERERPTSDANGL  446

Query  803   ----WYSRNKIDEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFD  636
                     N+   +E     E S   T        +ED VSG LYD LQKEVI++RK   
Sbjct  447   DNMPTNYNNQTITRETITTHEESANGTPVEKSKSENEDYVSGMLYDMLQKEVISLRKACH  506

Query  635   MKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQTN  456
              K+  L  KD+ I+ML KK++TL+KA+EVE+RK +RE A  EK+ + ++   + + R   
Sbjct  507   EKDQTLKDKDDAIEMLAKKVDTLSKAMEVEARKMRREVASMEKEVAAMRISKEHDHRAWQ  566

Query  455   SS  450
             +S
Sbjct  567   AS  568



>ref|XP_003627322.1| microtubule associated protein Type 2 [Medicago truncatula]
 gb|AET01798.1| microtubule-associated protein 70-1 [Medicago truncatula]
Length=614

 Score =   353 bits (907),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 269/527 (51%), Positives = 371/527 (70%), Gaps = 29/527 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+REL  AQ+E K LR +E+L++KA+EEL +E+ +++
Sbjct  46    MNLLHGSDPVKVELNRLENEVRDKDRELSEAQAEIKALRHSERLREKAVEELTDELSKVD  105

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
              KLK++E+L+E KNLE KK+ +EKK A+ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  106   GKLKLTESLLESKNLEIKKINDEKKAAMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  165

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAAL+EAE+ ++ AL +  +V+++QN+N EL 
Sbjct  166   EAELKLARQEIAKLQDDNKALDRLTKSKEAALIEAEKTVQVALVKASMVDDLQNKNQELM  225

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILD+ +R KV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  226   KQIEICQEENKILDRMHRLKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  285

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVAT+VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  286   ERKTLDRELARAKVTANRVATVVANEWKDSNDKVMPVKQWLEERRFLQGEMQQLRDKLAI  345

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGN------------NNVNPKVLSG---FSKP  957
              ER AK+EAQLK+K +LRLK LE+ L+   N            +N   + L G   FSKP
Sbjct  346   VERAAKSEAQLKEKYQLRLKVLEESLRGNSNGSSRSTPEGRSVSNSRRQSLGGADNFSKP  405

Query  956   EKANHLFGILSS-KKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGL--WYSRNK  786
                  L   L S + RS+    + + N     +S    +      K + +G    YS N+
Sbjct  406   TSNGFLPKRLPSFQLRSSPSSSSVLKNAKGTSKSFDGGTRSLERNKMQLNGAPQSYSFNQ  465

Query  785   ----IDEKE-NAGMKENSDKLTDSGN-FSKND-EDMVSGFLYDRLQKEVINMRKCFDMKE  627
                   E+E +   K NSD   D  N F   D ED V G LYD LQKEV+ +RK  + K+
Sbjct  466   SLEETKERETDVNWKGNSD---DKANDFPTVDTEDSVPGILYDLLQKEVMTLRKAGNEKD  522

Query  626   NDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
               L  KD+ I+ML KK++TLTKA+EVE++K +RE A  EK+ + ++ 
Sbjct  523   QSLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREVANMEKEVAAMRV  569



>emb|CDY17639.1| BnaA06g34580D [Brassica napus]
Length=623

 Score =   353 bits (907),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 260/528 (49%), Positives = 363/528 (69%), Gaps = 31/528 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL+ L+N++++K+REL  +Q+E K LR +E+ ++KA+EEL  E+ ++ 
Sbjct  62    ITLLHGSDPVRVELSRLENEVRDKDRELSESQAEIKALRLSERQREKAVEELTEELGKMS  121

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++ENLV+ KNLE KK+  EK+ ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  122   EKLKLAENLVQSKNLEIKKINEEKRASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  181

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EIA LQ+D RA++R  KSKEAALL+AER +++AL +  +V+++QN+N EL 
Sbjct  182   EAELKLARHEIAKLQDDNRALDRLTKSKEAALLDAERTVETALAKASMVDDLQNKNQELM  241

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEEN+ILD+ +RQKV EVE+ +QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  242   KQIEICQEENRILDRMHRQKVAEVEKFTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNE  301

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ERR L+RELAR KVSA+RVAT+VANEWKD +DKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  302   ERRVLDRELARAKVSASRVATVVANEWKDGSDKVMPVKQWLEERRFLQGEMQQLRDKLAI  361

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQT----------------GNNNVNPKVLSG--F  966
             ++R AK+EAQLK+K +LRLK LE+ L+                  G  +V PK+ S   F
Sbjct  362   ADRAAKSEAQLKEKFQLRLKVLEESLRGPPSGRSISNGPSRRQSLGGADVIPKLTSNGFF  421

Query  965   SKPEKANHLFGILSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNK  786
             SK   ++    + SS        R +  +      S   +    N++  +     +  N+
Sbjct  422   SKRTPSSQFRSLSSSASTVLKHARGTSKSFDGGSRSLDRSKLLTNERSAK-----FPLNQ  476

Query  785   IDEKENAGMKENSDKLTDS----GNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDL  618
               E  + G   NS K  +S    G  S    D V G L+D LQKEVI +RK    K+  +
Sbjct  477   SSEGTSEGDSPNSTKQEESEKPAGGTSN---DSVPGVLHDLLQKEVITLRKAAHDKDQSI  533

Query  617   NTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDG  474
               KDE I+ML KK+ETLTKA+EVE++K +RE A  EK+ S ++    G
Sbjct  534   RDKDEAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVSAMRVDNKG  581



>ref|XP_011075430.1| PREDICTED: microtubule-associated protein 70-2-like [Sesamum 
indicum]
Length=600

 Score =   353 bits (905),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 267/538 (50%), Positives = 364/538 (68%), Gaps = 26/538 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +ELT L+N+++EK+RELG A +E K L+ +E+LK+KA+EEL +E+ +++
Sbjct  44    ITLLHGSDPVRVELTRLENEVREKDRELGEAHAEIKALKFSERLKEKAVEELTDELMKVD  103

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK +E+ ++ KNLE KK+  EKK AL AQ+AAEA LRRV+A QK+D+  PIE++I PL
Sbjct  104   EKLKATESQLQSKNLEIKKINEEKKAALAAQFAAEATLRRVHAAQKDDEMPPIEAIITPL  163

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + E+A LQ+D RA++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL 
Sbjct  164   EAELKLARLEVAKLQDDNRALDRLTKSKEAALLEAERAVQMALAKASLVDDLQNKNQELN  223

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKI+DK +RQKVLEVE+L+Q++ ELEEA+LAGGAAAN +RDY+R++ EI E
Sbjct  224   KQIEICQEENKIMDKMHRQKVLEVEKLTQSVRELEEAVLAGGAAANAVRDYQRKVQEINE  283

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             E+R L+RELAR KVSANRVA +VAN+WKD NDKVMPVKQWLEER+  Q EMQ+LKDKLAI
Sbjct  284   EKRILDRELARAKVSANRVAVVVANDWKDANDKVMPVKQWLEERKFYQGEMQQLKDKLAI  343

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQT--------------GNNNVNPKVLSGFSKPE  954
             +ER AKAEAQLK+K  LR K LE+ LK                GN     + L G     
Sbjct  344   AERAAKAEAQLKEKYLLRFKVLEERLKACPNTITRVSSQGRSMGNGTSRRQSLGGSENLS  403

Query  953   KANHLFGILSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKID--  780
             +++   G LS K   +   R    ++  +Q  +  +S + ++       +    N+ D  
Sbjct  404   RSSS-NGFLSRKINLSVSSRTISASSLLKQAKNLSSSFDGDNTLINSDKVVPDTNEKDNR  462

Query  779   -----EKENAG---MKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKEN  624
                  E  N G   + EN D           +ED VSG LYD LQKEVI +RK    K+ 
Sbjct  463   ATHDEENPNNGIINLCENGDGHILPAKTKNENEDCVSGMLYDMLQKEVITLRKACHEKDQ  522

Query  623   DLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQTNSS  450
              L  KD+ I+ML KK+ETL KA+EVE++K +RE A  EK+ +T++   D + R    S
Sbjct  523   TLKDKDDAIEMLAKKVETLNKAMEVEAKKMRREVAAMEKEVATMRNGKDHDQRNRRPS  580



>emb|CDY36256.1| BnaC07g21100D [Brassica napus]
Length=622

 Score =   353 bits (906),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 258/525 (49%), Positives = 361/525 (69%), Gaps = 25/525 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL+ L+N++++K+REL  +Q+E K LR +E+ + KA+EEL  E+ ++ 
Sbjct  61    ITLLHGSDPVRVELSRLENEVRDKDRELSESQAEIKALRLSERQRKKAVEELTEELGKMS  120

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++ENLV+ KNLE KK+  EK+ ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  121   EKLKLAENLVQSKNLEIKKINEEKRASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  180

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ ++EIA LQ+D RA++R  KSKEAALL+AER +++AL +  +V+++QN+N EL 
Sbjct  181   EAELKLARHEIAKLQDDNRALDRLTKSKEAALLDAERTVETALAKASMVDDLQNKNQELM  240

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEEN+ILD+ +RQKV EVE+ +QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  241   KQIEICQEENRILDRMHRQKVAEVEKFTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNE  300

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ERR L+RELAR KVSA+RVAT+VANEWKD +DKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  301   ERRVLDRELARAKVSASRVATVVANEWKDGSDKVMPVKQWLEERRFLQGEMQQLRDKLAI  360

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQT----------------GNNNVNPKVLSG--F  966
             ++R AK+EAQLK+K +LRLK LE+ L+                  G  +V PK+ S   F
Sbjct  361   ADRAAKSEAQLKEKFQLRLKVLEESLRGPPSGRSISNGPSRRQSLGGADVIPKLTSNGFF  420

Query  965   SKPEKANHLFGILSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNK  786
             SK   ++    + SS        R +  +      S   +    N++  +     +  N+
Sbjct  421   SKRTPSSQFRSLSSSASTVLKHARGTSKSFDGGSRSLDRSKLLTNERSSK-----FPLNQ  475

Query  785   IDEKENAGMKENSDKLTDS-GNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTK  609
               E  + G   NS K  +S       + D V G L+D LQKEVI +RK    K+  +  K
Sbjct  476   SSEGTSEGDSPNSTKQEESEKPAGGTNNDSVPGVLHDLLQKEVITLRKAAHDKDQSIRDK  535

Query  608   DEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDG  474
             DE I+ML KK+ETLTKA+EVE++K +RE A  EK+ S ++    G
Sbjct  536   DEAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVSAMRVDNKG  580



>ref|XP_009348833.1| PREDICTED: microtubule-associated protein 70-2-like [Pyrus x 
bretschneideri]
 ref|XP_009348834.1| PREDICTED: microtubule-associated protein 70-2-like [Pyrus x 
bretschneideri]
Length=609

 Score =   352 bits (904),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 257/526 (49%), Positives = 360/526 (68%), Gaps = 26/526 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + L+H +DP  +EL  L+N L++K+RELG A +E K LR +E+LK+KA+EEL +E+ +++
Sbjct  51    VTLMHGSDPVRVELNRLENDLRDKDRELGDAVAEIKSLRNSERLKEKAVEELTDELNKVD  110

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK +E L+E KNLE KK+ +EKK AL AQ+AAEA LRRV+A QK+D+  PIE++IAPL
Sbjct  111   EKLKATEALLESKNLEIKKINDEKKAALAAQFAAEATLRRVHAAQKDDEMPPIEAIIAPL  170

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + E+  LQ+D RA++R  KSKEAALL+ ER ++ AL +  +V+++QN+N EL 
Sbjct  171   EAELKLARQEVTKLQDDNRALDRLTKSKEAALLDTERTVQIALAKASLVDDLQNKNQELM  230

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  231   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  290

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             E++ LERE+AR KVSANRVAT+VAN+WKD +DKVMPVKQWLEER+  Q EMQ+L+DKLA+
Sbjct  291   EKKLLEREVARAKVSANRVATVVANDWKDSSDKVMPVKQWLEERKFFQGEMQQLRDKLAV  350

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQT------------------------GNNNVNP  984
             +ERTAKAEAQLK+K +LR K LE  LK +                        G  N++ 
Sbjct  351   AERTAKAEAQLKEKYQLRFKVLEDKLKASNGKLRAAPDAKIISNRPSRRQSLGGAENISK  410

Query  983   KVLSGFSKPEKANHLFGILSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGL  804
                +G+    K+N   G   S   +A   +A++ + + +  S   +  +          +
Sbjct  411   SSSNGYLSRTKSNLQSGFNRSNSATAILKQATVSSRSFDGGSRLLDRDKLIPDATGKDCM  470

Query  803   WYSRN-KIDEKENAGMKENSDKLTDSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKE  627
               S N +    E  G  E S   T +    +  ED VSG LYD LQKEV+++RK    K+
Sbjct  471   PNSANDQTRMNEVVGRHEESSNGTLAEQSRREHEDYVSGVLYDMLQKEVVSLRKACHEKD  530

Query  626   NDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIK  489
               L  KD+ I+ML KK++TL KA+EVE++K +RE A  EK+ S+++
Sbjct  531   QTLKDKDDAIEMLAKKVDTLNKAMEVEAKKMRREVAAMEKEVSSMR  576



>ref|XP_006574818.1| PREDICTED: microtubule-associated protein 70-2-like [Glycine 
max]
Length=612

 Score =   352 bits (902),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 264/549 (48%), Positives = 371/549 (68%), Gaps = 28/549 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+REL  AQ+E K LR +E+L++KA+EEL  E+ +++
Sbjct  46    MNLLHGSDPVKVELNRLENEVRDKDRELSEAQAEIKALRLSERLREKAVEELTEELSKVD  105

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  106   EKLKLTESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  165

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL 
Sbjct  166   EAELKLARQEIAKLQDDNKALDRLTKSKEAALLEAERTVQVALAKASMVDDLQNKNQELI  225

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  226   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  285

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  286   ERKTLDRELARAKVTANRVAVVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLAI  345

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGN--NNVNPKVLSGFSKPEKANHLF------  936
              ER AK EAQLK+K  LRLK LE+ L+   N  N   P+  S  + P +   L       
Sbjct  346   VERAAKYEAQLKEKYHLRLKVLEESLRGNSNSSNRGTPEGRSMSNGPSRRQSLGGADNFS  405

Query  935   -----GILSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKE  771
                  G LS +  S+    +   +T  +    +  S +   +      +  +        
Sbjct  406   KLTSNGFLSKRSPSSQLRSSLSSSTVLKHAKGTSKSFDGGTRSLERSKMLLNGTPPSYSF  465

Query  770   NAGMKENSDKLTDSGNFSKNDEDMVSGF------------LYDRLQKEVINMRKCFDMKE  627
             N  M+E  ++   S N+  N +D  + F            LYD LQKEVI +RK    K+
Sbjct  466   NQSMEETKEREA-SDNWKGNSDDKPNDFPTVDSVDSVPSVLYDFLQKEVIALRKAGHEKD  524

Query  626   NDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY-KYDGNIRQTNSS  450
               L  KD+ I+ML KK++TLTKA+EVE++K +RE A  EK+ + ++  K   N  +  S+
Sbjct  525   QSLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREVAAMEKEVAAMRVEKEHENRAKRFSN  584

Query  449   LKSSIKVAK  423
             +K  + +A+
Sbjct  585   IKGPVNIAQ  593



>ref|XP_010271765.1| PREDICTED: microtubule-associated protein 70-2-like isoform X1 
[Nelumbo nucifera]
Length=605

 Score =   351 bits (901),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 277/543 (51%), Positives = 367/543 (68%), Gaps = 39/543 (7%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             LLH +DP  +EL  L+N+ ++KERELG AQ+E K L+ +E+LK+KA+EEL +E+K+++ K
Sbjct  50    LLHGSDPVKVELNRLENEARDKERELGEAQAEIKALKYSERLKEKAVEELTDELKKVDGK  109

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK +E L+E KNLE KK+ +EKK AL AQ+AAEA LRRV+A QK+DD  PIE++I PLEA
Sbjct  110   LKATEVLLENKNLEIKKINDEKKAALAAQFAAEATLRRVHAAQKDDDMPPIEAIITPLEA  169

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+ K E+A LQ+D RA++R  KSKEAALLEAER ++ AL +  +VE+VQN+N EL +Q
Sbjct  170   ELKLAKLEVAKLQDDNRALDRLTKSKEAALLEAERTVQIALAKASLVEDVQNKNQELMKQ  229

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILDK +RQKV EVE+LSQT+ ELEEA+LAGGAAAN +RDY+R++ E+ EER
Sbjct  230   IEICQEENKILDKMHRQKVAEVEKLSQTVRELEEAVLAGGAAANAVRDYQRKVQEMNEER  289

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             +TL+RELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR  Q EMQ+L+DKLA++E
Sbjct  290   KTLDRELARAKVTANRVAVVVANEWKDANDKVMPVKQWLEERRFFQGEMQQLRDKLAVAE  349

Query  1085  RTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFS---KPEKANHLFGI-----  930
             R A+AEAQLK+K +LRLK LE+GL+   + N     L G S    P +   L G      
Sbjct  350   RAARAEAQLKEKYQLRLKVLEEGLRHPPSVN-GRTTLEGRSISNGPSRRQSLGGAENLSR  408

Query  929   -----LSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKENA  765
                   SS++ S SQ  +   N+ S     ++ S    D   R       RNK+      
Sbjct  409   PSSNGFSSRRSSNSQLGSVASNSASVLLKQAKCSSRSFDGGSRS----VDRNKVTSG-GT  463

Query  764   GMKENSDKLTD-------------------SGNFSKNDEDMVSGFLYDRLQKEVINMRKC  642
             G     +K+TD                   S N     E+ VSG LYD LQKEVI +RK 
Sbjct  464   GKVTTPNKVTDGMQNTETTTTCKDTSDGKPSENTKAGHEEYVSGLLYDILQKEVIILRKA  523

Query  641   FDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDGNIRQ  462
                K+  L  KD+ I+ML KK++TL KA+EVE++K +RE A  EK+ + ++   D   R+
Sbjct  524   CHEKDQSLKDKDDAIEMLAKKVDTLNKAMEVEAKKMRREVAAMEKEVAAMRANNDPRARR  583

Query  461   TNS  453
              ++
Sbjct  584   LSA  586



>gb|KHN23795.1| Microtubule-associated protein 70-2 [Glycine soja]
Length=573

 Score =   350 bits (897),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 258/526 (49%), Positives = 359/526 (68%), Gaps = 25/526 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+REL  AQ+E K LR +E+L++KA+EEL  E+ +++
Sbjct  7     MNLLHGSDPVKVELNRLENEVRDKDRELSEAQAEIKALRLSERLREKAVEELTEELSKVD  66

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
              KLK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  67    GKLKLTESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  126

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL 
Sbjct  127   EAELKLARQEIAKLQDDNKALDRLTKSKEAALLEAERTVQVALAKASMVDDLQNKNQELI  186

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  187   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  246

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  247   ERKTLDRELARAKVTANRVAVVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLAI  306

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGN--NNVNPKVLSGFSKPEKANHLF------  936
              ER AK+EAQLK+K  LRLK LE+ L+   N  N   P+  S  + P +   L       
Sbjct  307   VERAAKSEAQLKEKYHLRLKVLEESLRGNSNSSNRGTPEGRSMSNGPSRRQSLGGADNFS  366

Query  935   -----GILSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKE  771
                  G LS +  S+    +   +T  +    +  S +   +      +  +   +    
Sbjct  367   KLTSNGFLSKRSPSSQLRSSLSSSTVLKHAKGTSKSFDGGTRSLERSKMLLNGTPLSYSF  426

Query  770   NAGM-----KENSDKLTDSGNFSKND------EDMVSGFLYDRLQKEVINMRKCFDMKEN  624
             N  +     +E SD    + +   ND       D V G LYD LQKEVI +RK    K+ 
Sbjct  427   NQSLEETKEREASDNWKGNSDDKPNDFPTVDLVDSVPGVLYDLLQKEVIALRKAGHEKDQ  486

Query  623   DLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
              L  K + I+ML KK++TLTKA+EVE++K +RE A  EK+ + ++ 
Sbjct  487   SLKDKGDAIEMLAKKVDTLTKAMEVEAKKMRREVAAMEKEVAAMRV  532



>ref|XP_002323245.1| hypothetical protein POPTR_0016s03570g [Populus trichocarpa]
 gb|EEF05006.1| hypothetical protein POPTR_0016s03570g [Populus trichocarpa]
Length=604

 Score =   350 bits (899),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 264/543 (49%), Positives = 373/543 (69%), Gaps = 27/543 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N+L++K+RELG A +E K L+ +E+ K+KA+EEL +E+ +++
Sbjct  60    ITLLHGSDPVRVELNRLENELRDKDRELGDALAEIKSLKNSERSKEKAVEELTDELDKVD  119

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK +E L+E KNLE KK+ +EKK AL AQ+AAEA LRRV+A QK+D+  PIE++IAPL
Sbjct  120   EKLKATEALLENKNLEIKKINDEKKAALAAQFAAEATLRRVHAAQKDDEMPPIEAIIAPL  179

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + E+A LQ+D +A++R  K+KEAALLEAER ++ AL +  +V+++QN+N EL 
Sbjct  180   EAELKLARLEVAKLQDDNKALDRLTKAKEAALLEAERTVQIALVKASLVDDLQNKNQELM  239

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L QT+ ELEEA+LAGGAAAN +RDY+R++ E+  
Sbjct  240   KQIEICQEENKILDKMHRQKVAEVEKLMQTVRELEEAVLAGGAAANAVRDYQRKVQEMNG  299

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TLERE+AR KVSANRVAT+VANEWKD NDKVMPVKQWLEERR  Q EMQ+L+DKLA+
Sbjct  300   ERKTLEREVARAKVSANRVATVVANEWKDGNDKVMPVKQWLEERRFFQGEMQQLRDKLAV  359

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGI-----L  927
             +ER AKAEAQLK+K ++R + LE+ LK    N+++ +  +  + P +   L G+     L
Sbjct  360   AERAAKAEAQLKEKYQIRFRVLEERLK--APNSISREGRNTSNGPSRRQSLGGVENFSRL  417

Query  926   S-----SKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHG---LWYSRNKIDEKE  771
             S     S+K   SQ  +   N        ++ S    D   R      L  +  K +   
Sbjct  418   SSNGYLSRKAPNSQAGSLRPNNAVTLLKHAKMSSRSFDGGSRSLDDKLLVGAAGKDNGPP  477

Query  770   NAGMKENSDKLTDSGNF--------SKND-EDMVSGFLYDRLQKEVINMRKCFDMKENDL  618
              A  + +S + T++G          SK++ ED VSG LYD LQKEVI +R+    K   L
Sbjct  478   KASDQTHSTERTETGEIENETSIEKSKSEHEDYVSGVLYDMLQKEVITLRRACHEKGQSL  537

Query  617   NTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY--KYDGNIRQTNSSLK  444
               KD+ I+ML KK++TL KA+E+E +K +RE A  EK+ + ++   ++D   R+ ++   
Sbjct  538   KDKDDAIEMLAKKVDTLNKAMEIEGKKMRREVAAMEKEVAAMRVSKEHDHRTRRGSAPRA  597

Query  443   SSI  435
             S +
Sbjct  598   SQL  600



>ref|NP_563959.1| microtubule-associated protein 70-4 [Arabidopsis thaliana]
 sp|Q9LQU7.1|MP704_ARATH RecName: Full=Microtubule-associated protein 70-4; Short=AtMAP70-4; 
AltName: Full=70 kDa microtubule-associated protein 4 
[Arabidopsis thaliana]
 gb|AAF79237.1|AC006917_22 F10B6.24 [Arabidopsis thaliana]
 emb|CAJ31081.1| 70 kDa microtubule associated protein Type 4 [Arabidopsis thaliana]
 gb|AEE29233.1| microtubule-associated protein 70-4 [Arabidopsis thaliana]
Length=604

 Score =   350 bits (899),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 254/528 (48%), Positives = 362/528 (69%), Gaps = 23/528 (4%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+REL   Q+E K LR +E+ ++KA+EEL  E+ ++ 
Sbjct  42    MNLLHGSDPVRIELNRLENEVRDKDRELSEGQAEIKALRLSERQREKAVEELTEELGKMA  101

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK+ ENL+E KNLE KK+  EKK ++ AQ+AAEA+LRRV+A QK+DD  PIE+++APL
Sbjct  102   EKLKLIENLLESKNLEIKKINEEKKASMAAQFAAEASLRRVHAAQKDDDMPPIEAILAPL  161

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D ++++R  KSKEAALL+AER ++SAL +  +V+++QN+N EL 
Sbjct  162   EAELKLSRQEIAKLQDDNKSLDRLTKSKEAALLDAERTVQSALAKASMVDDLQNKNQELM  221

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEEN+I+DK +RQKV EVE+L Q++ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  222   KQIEICQEENRIIDKMHRQKVAEVEKLMQSVRELEEAVLAGGAAANAVRDYQRKFQEMNE  281

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+ LERELAR KV+ANRVAT+VANEWKD NDKVMPV+QWLEERR LQ EMQ+L+DKLAI
Sbjct  282   ERKILERELARAKVNANRVATVVANEWKDSNDKVMPVRQWLEERRFLQGEMQQLRDKLAI  341

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVL--SGFSKPEKANHLFGILSS-  921
             ++R AK+EAQLK+K  LRL+ LE+ LK   +++     +  S  + P +   L G  +S 
Sbjct  342   ADRAAKSEAQLKEKFLLRLRVLEESLKGPTSSSSRGTSVGRSSSNGPTRRQSLGGAETSP  401

Query  920   ---------KKRSASQPRASMVNTTseqesssensgEYN------DQKKRHHGLWYSRNK  786
                      K+  +SQ R+   + ++  + +   S  ++      D+ K       S   
Sbjct  402   KITSNGSLIKRTPSSQLRSLTASASTVLKHAKGTSRSFDGGTRSLDRSKVLINGPRSNFP  461

Query  785   IDEKENAGMKENSDKLTDSGNFSKNDE----DMVSGFLYDRLQKEVINMRKCFDMKENDL  618
             ++ K + G        +  G     D+    D V G LYD LQKEVI +RK    K+  L
Sbjct  462   LNHKSSEGTSRGESPSSIKGEEESADKATNNDSVPGVLYDLLQKEVITLRKAAHEKDQSL  521

Query  617   NTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYDG  474
               KDE I+ML KK+ETLTKA++VE++K +RE A+  K+ + ++    G
Sbjct  522   RDKDEAIEMLAKKVETLTKAMDVEAKKMRREVAVMGKEVAAMRVVDKG  569



>ref|XP_002892833.1| atmap70-4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69092.1| atmap70-4 [Arabidopsis lyrata subsp. lyrata]
Length=603

 Score =   350 bits (898),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 252/529 (48%), Positives = 361/529 (68%), Gaps = 33/529 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+REL   Q+E K LR +E+ ++KA+EEL  E+ ++ 
Sbjct  42    MNLLHGSDPVRIELNRLENEVRDKDRELSEGQAEIKALRLSERQREKAVEELTEELGKMA  101

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK+ ENL+E KNLE K +  EKK ++ AQ+AAEA+LRRV+A QK+DD  PIE+++APL
Sbjct  102   EKLKLVENLLESKNLEIKMINEEKKASMAAQFAAEASLRRVHAAQKDDDMPPIEAILAPL  161

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D R+++R  KSKEAALL+AER ++SAL +  +V+++QN+N EL 
Sbjct  162   EAELKLARLEIAKLQDDNRSLDRLTKSKEAALLDAERTVQSALAKASMVDDLQNKNQELM  221

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEEN+I+DK +RQKV EVE+L Q++ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  222   KQIEICQEENRIIDKMHRQKVAEVEKLMQSVRELEEAVLAGGAAANAVRDYQRKFQEMNE  281

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+ LERELAR KV+ANRVAT+VANEWKD NDKVMPV+QWLEERR LQ EMQ+L+DKLAI
Sbjct  282   ERKILERELARAKVNANRVATVVANEWKDSNDKVMPVRQWLEERRFLQGEMQQLRDKLAI  341

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVL--SGFSKPEKANHLFGILSS-  921
             ++R AK+EAQLK+K  LRL+ LE+ LK   +++     +  S  + P +   L G  +S 
Sbjct  342   ADRAAKSEAQLKEKFLLRLRVLEESLKGPASSSSRGTSVGRSSSNGPSRRQSLGGAETSP  401

Query  920   ---------KKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKI---DE  777
                      K+  +SQ R+   + ++  + +   S  ++   +        R+K+     
Sbjct  402   KITSNGSLIKRTPSSQFRSLTASASTVLKHAKGTSRSFDGGTR-----SLDRSKVLINGP  456

Query  776   KENAGMKENSDKLTDSGNFSKN------------DEDMVSGFLYDRLQKEVINMRKCFDM  633
             + N  +   S + T  G    +            + D V G LYD LQKEVI +RK    
Sbjct  457   RSNFPLNHQSSEGTSRGETPSSVKGKEESDDKSTNNDSVPGVLYDLLQKEVITLRKAAHE  516

Query  632   KENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
             K+  L  KDE I+ML KK+ETLTKA++VE++K +RE A+  K+ + ++ 
Sbjct  517   KDQSLRDKDEAIEMLAKKVETLTKAMDVEAKKMRREVAVMGKEVAAMRV  565



>ref|XP_006583719.1| PREDICTED: microtubule-associated protein 70-2-like [Glycine 
max]
Length=611

 Score =   350 bits (898),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 258/526 (49%), Positives = 359/526 (68%), Gaps = 25/526 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+REL  AQ+E K LR +E+L++KA+EEL  E+ +++
Sbjct  45    MNLLHGSDPVKVELNRLENEVRDKDRELSEAQAEIKALRLSERLREKAVEELTEELSKVD  104

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
              KLK++E+L+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  105   GKLKLTESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  164

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL 
Sbjct  165   EAELKLARQEIAKLQDDNKALDRLTKSKEAALLEAERTVQVALAKASMVDDLQNKNQELI  224

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R++ E+ E
Sbjct  225   KQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNE  284

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  285   ERKTLDRELARAKVTANRVAVVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLAI  344

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGN--NNVNPKVLSGFSKPEKANHLF------  936
              ER AK+EAQLK+K  LRLK LE+ L+   N  N   P+  S  + P +   L       
Sbjct  345   VERAAKSEAQLKEKYHLRLKVLEESLRGNSNSSNRGTPEGRSMSNGPSRRQSLGGADNFS  404

Query  935   -----GILSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKIDEKE  771
                  G LS +  S+    +   +T  +    +  S +   +      +  +   +    
Sbjct  405   KLTSNGFLSKRSPSSQLRSSLSSSTVLKHAKGTSKSFDGGTRSLERSKMLLNGTPLSYSF  464

Query  770   NAGM-----KENSDKLTDSGNFSKND------EDMVSGFLYDRLQKEVINMRKCFDMKEN  624
             N  +     +E SD    + +   ND       D V G LYD LQKEVI +RK    K+ 
Sbjct  465   NQSLEETKEREASDNWKGNSDDKPNDFPTVDLVDSVPGVLYDLLQKEVIALRKAGHEKDQ  524

Query  623   DLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
              L  K + I+ML KK++TLTKA+EVE++K +RE A  EK+ + ++ 
Sbjct  525   SLKDKGDAIEMLAKKVDTLTKAMEVEAKKMRREVAAMEKEVAAMRV  570



>gb|AET05426.2| microtubule-associated protein 70-1 [Medicago truncatula]
Length=616

 Score =   350 bits (898),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 263/527 (50%), Positives = 364/527 (69%), Gaps = 27/527 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  LEL  L+N +++K+REL  AQ+E K L+ +E+L++KA+EEL  E+ +++
Sbjct  50    MNLLHGSDPVKLELNRLENDVRDKDRELSEAQAEIKALKHSERLREKAVEELTEELSKVD  109

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
              KLK +ENL+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  110   GKLKFTENLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  169

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D RA++R  KSKEAALLE ER ++ AL +  +V+++QN+N EL 
Sbjct  170   EAELKLARQEIAKLQDDNRALDRLTKSKEAALLEVERSVQVALAKASMVDDLQNKNQELM  229

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILD+ +R KV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  230   KQIEICQEENKILDRMHRLKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNE  289

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KV+ANRVA +VANEWKD NDKVMPVKQWLEERR LQ EMQ+L+DKLAI
Sbjct  290   ERKTLDRELARAKVTANRVAVVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDKLAI  349

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSG---FSKPEKANHLFGI---  930
             S+RTAK EAQLK+K +LRLK L++ L++T +N++N     G    + P +   L G    
Sbjct  350   SDRTAKYEAQLKEKYQLRLKVLQESLRET-SNSINRGTSEGKCVSNGPSRRQSLGGADNI  408

Query  929   -------LSSKKRSASQPRAS------MVNTTseqesssensgEYNDQKKRHHGLWYSRN  789
                      +K+ S+ Q R+S      + N     +S    S      K   +G   S +
Sbjct  409   SKPNSNGFLTKRTSSFQIRSSVSSSSILKNAKGASKSFDGGSRSLERSKILLNGKPPSSS  468

Query  788   KIDEKENAGMKENSDKLTDSGNFSKND------EDMVSGFLYDRLQKEVINMRKCFDMKE  627
                  E    KE ++    S +   ND      +D V G LYD LQKEV+ +RK    K+
Sbjct  469   FNQSSERTKDKEENNNWKGSLDDKPNDLPLVDTKDNVPGVLYDLLQKEVLGLRKAGHEKD  528

Query  626   NDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
               L  KD+ I+ML KK++TLTKA+EVE++K +RE A+ EK+ + ++ 
Sbjct  529   QSLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREVAVMEKEVAAMRV  575



>gb|KFK43754.1| hypothetical protein AALP_AA1G168500 [Arabis alpina]
Length=604

 Score =   350 bits (897),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 255/524 (49%), Positives = 361/524 (69%), Gaps = 24/524 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N++++K+REL  AQ+E K  + +E+ ++KA+EEL  E+ ++ 
Sbjct  42    ITLLHGSDPVRIELNRLENEVRDKDRELSEAQAEIKAFKLSERQREKAVEELTQELGKMT  101

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
              KLK+ ENL++ KNLE KK+  EKK ++ AQ+AAEA+LRRV+A QK+DD  PIE+++APL
Sbjct  102   GKLKLIENLLQSKNLEIKKINEEKKASMAAQFAAEASLRRVHAAQKDDDMPPIEAILAPL  161

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D ++++R  KSKEAALLEAER ++SAL +  +V+++QN+N EL 
Sbjct  162   EAELKLARLEIAKLQDDNKSLDRLTKSKEAALLEAERTVQSALAKASMVDDLQNKNQELM  221

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L Q++ ELEEA+LA GAAAN +RDY+R+  E+ E
Sbjct  222   KQIEICQEENKILDKMHRQKVAEVEKLMQSVRELEEAVLAAGAAANAVRDYQRKFQEMNE  281

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+ LERELAR KV+ANRVAT+VANEWKD ND+VMPV+QWLEERR LQ EMQ+L+DKLAI
Sbjct  282   ERKILERELARAKVNANRVATVVANEWKDSNDQVMPVRQWLEERRFLQGEMQQLRDKLAI  341

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQ--TGNNNVNPKVLSGFSKPEKANHLFGI----  930
             ++R AK+EAQLK+K  LRLK LE  LK+  + +N   P   S  + P +   + G     
Sbjct  342   ADRAAKSEAQLKEKFMLRLKVLEDSLKRPTSSSNRGMPGGRSSSNGPSRRQSIGGANTSP  401

Query  929   ------LSSKKRSASQPRASMVNTTseqesssensgEYN------DQKKRHHGLWYSRNK  786
                   + SK+  +SQ R+   + ++  + +   S  ++      D+ K       S+  
Sbjct  402   TSTSNGILSKRTPSSQLRSLTTSASTVLKHAKGTSRSFDGGTRSLDRSKVITNGPGSKFP  461

Query  785   IDEKENAGMKENSDKLT----DSGNFSKNDEDMVSGFLYDRLQKEVINMRKCFDMKENDL  618
             +  +   G        T    +S + S N+ D V G LYD LQKEVI +RK    K+  L
Sbjct  462   LSHQSTEGTSRGESPSTIKEEESDDKSTNN-DSVPGVLYDLLQKEVITLRKAAHEKDQSL  520

Query  617   NTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY  486
               KDE I+ML KK+ETLTKA+EVE++K +RE A+  K+ + ++ 
Sbjct  521   RDKDEAIEMLAKKVETLTKAMEVEAKKMRREVAVMGKEVAAMRV  564



>ref|XP_004503349.1| PREDICTED: microtubule-associated protein 70-2-like isoform X2 
[Cicer arietinum]
Length=616

 Score =   349 bits (896),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 260/532 (49%), Positives = 365/532 (69%), Gaps = 31/532 (6%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  LEL  L+N++K+K+REL  A  E K L+ +E+L++KA+EEL  E+ +++
Sbjct  50    MNLLHGSDPVKLELNRLENEVKDKDRELSEALVEIKALKHSERLREKAVEELTEELSKVD  109

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
              KLK++ENL+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APL
Sbjct  110   GKLKLTENLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPL  169

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + EIA LQ+D +A++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL 
Sbjct  170   EAELKLARQEIAKLQDDNKALDRLTKSKEAALLEAERTVQVALAKASMVDDLQNKNQELM  229

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +R KV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R+  E+ E
Sbjct  230   KQIEICQEENKILDKMHRLKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNE  289

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TL+RELAR KVSANRVA +VANEWKD NDKVMPVKQWLE+RR L  EMQ+L+DKLA 
Sbjct  290   ERKTLDRELARAKVSANRVAVVVANEWKDANDKVMPVKQWLEDRRFLMGEMQQLRDKLAT  349

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSG---FSKPEKANHLFGI---  930
             ++RTAK EAQLK+K +LRLK L++ L++T +N++N     G    + P +   L G    
Sbjct  350   ADRTAKYEAQLKEKYQLRLKVLQESLRET-SNSINRGTSEGRCVSNGPSRRQSLGGADNI  408

Query  929   -------LSSKKRSASQPRASMVNTTseqesssensg-------------EYNDQKKRHH  810
                       K+ S+ Q R+S+ ++T  + +   +                 N +     
Sbjct  409   SKLNSNGFLPKRTSSFQLRSSVSSSTVLKHAKGASKSFDGGSRSLERSKILLNGKPPSSS  468

Query  809   GLWYSRNKIDEKENAGMKENSDKLTDSGNFSKND-EDMVSGFLYDRLQKEVINMRKCFDM  633
                 S    D ++N   K + D      +F   D ED V G LYD LQKEV+ +RK    
Sbjct  469   FNQSSEGTKDREKNGDWKGSLD--DKPNDFPLIDAEDSVPGVLYDFLQKEVLVLRKAGLE  526

Query  632   KENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYD  477
             K+  L  KD+ I+ML KK++TLTKA+EVE++K +RE A+ EK+ + ++ + D
Sbjct  527   KDQSLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREVAVMEKEVAAMRVEKD  578



>ref|XP_006343173.1| PREDICTED: microtubule-associated protein 70-2-like isoform X1 
[Solanum tuberosum]
Length=651

 Score =   350 bits (899),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 272/556 (49%), Positives = 377/556 (68%), Gaps = 57/556 (10%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  LEL  L+N++++K+REL  AQ+E K LR +E+L++KA+EEL +E+ R++
Sbjct  60    MTLLHGSDPVKLELNRLENEVRDKDRELSEAQAEIKALRLSERLREKAVEELTDELTRVD  119

Query  1811  EKLKISENLVEQK-----------------------------NLETKKLINEKKealtaq  1719
             EKLK++E+L+E K                             NLE KK+ +EKK ++ AQ
Sbjct  120   EKLKLTESLLESKVLIQNLLIIGSSFFSVNYFITYNTFLALQNLEIKKINDEKKASMAAQ  179

Query  1718  yaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAA  1539
             +AAEA LRRV+A QK+DD  PIE+++APLEAE+K+ ++E A LQ+D +A++R  KSKEAA
Sbjct  180   FAAEATLRRVHAAQKDDDMPPIEAILAPLEAELKLARHETAKLQDDNKALDRLTKSKEAA  239

Query  1538  LLEAERILKSALERVLIVEEVQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTi  1359
             LL+AER ++SAL +  +V+++QN+N EL +QIEICQEENKILD+ +RQKV EVE+L+Q++
Sbjct  240   LLDAERTVQSALAKASMVDDLQNKNQELMKQIEICQEENKILDRMHRQKVAEVEKLTQSV  299

Query  1358  leleeailaggaaANTIRDYrrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDEN  1179
              ELEEA+LAGGAAAN +RDY+R++ E+ EER+TL+RELAR KV+ANRVAT+VANEWKD N
Sbjct  300   RELEEAVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDAN  359

Query  1178  DKVMPVKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGN  999
             DKVMPVKQWLEERRILQ EMQ+L+DKLAI+ERTAK+EA LKDK +LRLK LE+ L+ +  
Sbjct  360   DKVMPVKQWLEERRILQGEMQQLRDKLAITERTAKSEALLKDKYQLRLKVLEETLRPSST  419

Query  998   NNVNPK-VLSGFSKPEKANHLFGI-----LSS----KKRSAS-QPRASMVNTTseqesss  852
             ++ N     S  + P +   L G      L+S     KRS S Q R+S  +T  +    +
Sbjct  420   SSRNTTDGRSSSNGPSRRQSLGGAESISKLTSNGFLPKRSPSFQLRSSGSSTILKHAKGT  479

Query  851   ensgEYN----DQKKRHHGL----WYSRNKID-----EKENAGMKENSD-KLTDSGNFSK  714
               S +      D+ K+   +    + S   +D     E E+   K N D K TD      
Sbjct  480   SKSFDGGSRSLDRGKKLLNVTGPNFNSSKSVDGAKDNETESTSWKSNQDEKRTDLP--VT  537

Query  713   NDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKT  534
               ED V G LYD LQKEV+ +RK    K+  L  KD+ I+ML KK+ETLTKA+EVE++K 
Sbjct  538   ETEDTVPGLLYDLLQKEVVALRKAGHEKDQSLKDKDDAIEMLAKKVETLTKAMEVEAKKM  597

Query  533   KREAAIREKDSSTIKY  486
             +RE +  EK+ + ++ 
Sbjct  598   RREVSAMEKEVAAMRV  613



>ref|XP_008367624.1| PREDICTED: LOW QUALITY PROTEIN: microtubule-associated protein 
70-5-like [Malus domestica]
Length=549

 Score =   347 bits (890),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 249/449 (55%), Positives = 305/449 (68%), Gaps = 54/449 (12%)
 Frame = -3

Query  1664  SIPIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIV  1485
              +P+E V          +  +IAALQEDK+A ER  K+KE+ALLEAERIL+SALER LIV
Sbjct  99    GVPVEIVGYGFFLPFSPF--QIAALQEDKKAXERLTKTKESALLEAERILQSALERALIV  156

Query  1484  EEVQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIR  1305
             EEVQNQ FELRRQIEICQEEN+IL+KTNRQKVLEVE+LSQTI ELEEA+LAGGAA N IR
Sbjct  157   EEVQNQXFELRRQIEICQEENRILEKTNRQKVLEVEKLSQTIQELEEAVLAGGAAXNAIR  216

Query  1304  DYrrqiseiqeerrtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQA  1125
             DY RQ+ E+ EE+RTLERELAR KVSANRVAT++ANEWKD+NDKVMPVKQWLEERR++QA
Sbjct  217   DYZRQMEELHEEKRTLERELARXKVSANRVATVIANEWKDDNDKVMPVKQWLEERRLMQA  276

Query  1124  EMQRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKAN  945
             EMQRL+DKLAIS+RTAK EAQLK+K+KLRLK LE+GLK   + + NP +  G  KPEK++
Sbjct  277   EMQRLRDKLAISDRTAKTEAQLKEKMKLRLKMLEEGLKHVSSFSCNPNLFCGSPKPEKSS  336

Query  944   HLFGILS----SKKRSASQPRASMVN-------------TTseqesssensgEYNDQKKR  816
                G L+    S KRS SQPR S+++             T    +  +    +Y      
Sbjct  337   IFLGFLTSNGGSAKRSTSQPRGSIISRSSPQRQPHSDNKTAGGLKRENSFRKKYGSGHLL  396

Query  815   HHGLWYSRNKI---DEKENAGMKENSD---------------KLTDSGN------FSKN-  711
                +W SR+K+    EKEN  MKEN++               K  D GN       S N 
Sbjct  397   KKSIWASRSKVVDSGEKENTEMKENTNSDTENNNDKTAAADIKAADGGNEDSHIKISTNL  456

Query  710   -DEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKT  534
               EDMVSGFLYDRLQKEV++   C + KE+D+N KDEEI     K++ LTKA++VE +K 
Sbjct  457   ESEDMVSGFLYDRLQKEVLS--XC-EAKESDMNAKDEEI-----KVDALTKAMDVEFKKM  508

Query  533   KREAAIREKDSSTIKYKYDG-NIRQTNSS  450
             KR A  R+K+++  KY  D    R  NSS
Sbjct  509   KRGAVARDKETAAAKYMDDNKKSRNINSS  537



>ref|XP_011000423.1| PREDICTED: microtubule-associated protein 70-1-like [Populus 
euphratica]
Length=609

 Score =   348 bits (894),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 262/543 (48%), Positives = 372/543 (69%), Gaps = 27/543 (5%)
 Frame = -3

Query  1988  LCLLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLE  1812
             + LLH +DP  +EL  L+N+L++K+RELG A +E K L+ +E+ K+KA+EEL +E+ +++
Sbjct  60    ITLLHGSDPVRVELNRLENELRDKDRELGDALAEIKSLKNSERSKEKAVEELTDELDKVD  119

Query  1811  EKLKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPL  1632
             EKLK +E L+E KNLE KK+ +EKK AL AQ+AAEA LRRV+A QK+D+  PIE++IAPL
Sbjct  120   EKLKATEALLENKNLEIKKINDEKKAALAAQFAAEATLRRVHAAQKDDEMPPIEAIIAPL  179

Query  1631  EAEIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELR  1452
             EAE+K+ + E+A LQ+D +A++R  K+KEAALLEAER ++ AL +  +V+++QN+N EL 
Sbjct  180   EAELKLARLEVAKLQDDNKALDRLTKAKEAALLEAERTVQIALVKASLVDDLQNKNQELM  239

Query  1451  RQIEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqe  1272
             +QIEICQEENKILDK +RQKV EVE+L QT+ ELEEA+LAGGAAAN +RDY+R++ E+  
Sbjct  240   KQIEICQEENKILDKMHRQKVAEVEKLMQTVGELEEAVLAGGAAANAVRDYQRKVQEMNG  299

Query  1271  errtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAI  1092
             ER+TLERE+AR KVSANRVAT+VANEWKD NDKVMPVKQWL+ERR  Q EMQ+L+DKLA+
Sbjct  300   ERKTLEREVARAKVSANRVATVVANEWKDGNDKVMPVKQWLDERRFFQGEMQQLRDKLAV  359

Query  1091  SERTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSGFSKPEKANHLFGI-----L  927
             +ER AKAEAQLK+K ++R + LE+ LK    N+++ +  +    P +   L G+     L
Sbjct  360   AERAAKAEAQLKEKYQIRFRVLEERLK--APNSISREGRNTSYGPSRRQSLGGVENFSRL  417

Query  926   S-----SKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHG---LWYSRNKIDEKE  771
             S     S+K   SQ  +   N        ++ S    D   R      L  +  K +   
Sbjct  418   SSNGYLSRKAPNSQAGSLRPNNAVTLLKHAKMSSRSFDGGSRSLDDKLLVGAAGKDNGPP  477

Query  770   NAGMKENSDKLTDSGNF--------SKND-EDMVSGFLYDRLQKEVINMRKCFDMKENDL  618
              A  +  S + T++G          SK++ ED VSG LYD LQKEV+ +R+    K+  L
Sbjct  478   KASDQTQSTERTETGEIENETSIEKSKSEHEDYVSGVLYDMLQKEVVTLRRACHEKDQSL  537

Query  617   NTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKY--KYDGNIRQTNSSLK  444
               KD+ I+ML KK++TL KA+E+E +K +RE A  EK+ + ++   ++D   R+ ++   
Sbjct  538   KDKDDAIEMLAKKVDTLNKAMEIEGKKMRREVAAMEKEVAAMRVSKEHDHRTRRGSAPRA  597

Query  443   SSI  435
             S +
Sbjct  598   SQL  600



>gb|EMS51736.1| hypothetical protein TRIUR3_31011 [Triticum urartu]
Length=610

 Score =   348 bits (894),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 255/555 (46%), Positives = 361/555 (65%), Gaps = 60/555 (11%)
 Frame = -3

Query  1973  TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEE---------------  1839
             +DP  +EL  L+N++++K+RELG AQ+E K LR +E+ ++KA+EE               
Sbjct  4     SDPVKVELNRLENEVRDKDRELGEAQAEIKALRLSERAREKAVEEVLDSFFPLCNSTCRL  63

Query  1838  ----------------------LGNEVKRLEEKLKISENLVEQKNLETKKLINEKKealt  1725
                                   L +E+++L+EKLK++E+L++ KNLE KK  +EKK A+ 
Sbjct  64    LNKYVSYPNMLFKLPNEVAPGKLTDELEKLDEKLKLTESLLDSKNLELKKTNDEKKAAMA  123

Query  1724  aqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEAEIKMYKNEIAALQEDKRAMERHNKSKE  1545
             AQ+AAEA LRRV+A QK+DD  PIE+++APLEAE+K+ + EIA LQED RA++R  K KE
Sbjct  124   AQFAAEATLRRVHAAQKDDDMPPIEAILAPLEAELKLARQEIAKLQEDNRALDRLTKQKE  183

Query  1544  AALLEAERILKSALERVLIVEEVQNQNFELRRQIEICQEENKILDKTNRQKVLEVERLSQ  1365
             AALLEAER +++AL +  +V+++QN+N +L +QIEICQEENKILD+ +RQKV EVE+LSQ
Sbjct  184   AALLEAERTVQTALAKAAMVDDMQNKNQDLMKQIEICQEENKILDRLHRQKVAEVEKLSQ  243

Query  1364  TileleeailaggaaANTIRDYrrqiseiqeerrtlerelaRVKVSANRVATIVANEWKD  1185
             T+ ELEEA+LAGGAAAN +RDY+R++ E+ EER+ L+RELAR KV+ANRVA +VANEWKD
Sbjct  244   TVRELEEAVLAGGAAANAVRDYQRKVQEMNEERKVLDRELARTKVTANRVAVVVANEWKD  303

Query  1184  ENDKVMPVKQWLEERRILQAEMQRLKDKLAISERTAKAEAQlkdklklrlktLEQGLKQT  1005
              NDKVMPVKQWLEERR LQ EMQ+L+DKLAI+ERTA++EAQ+K+K + RLK LE GL+  
Sbjct  304   GNDKVMPVKQWLEERRFLQGEMQQLRDKLAIAERTARSEAQVKEKYQWRLKVLEDGLRGP  363

Query  1004  GNNNVNPKV--------------LSGFSKPEKANHLFGILSSKKRSASQPRASMVNTTse  867
              + +  P                L G     K + +  ++       S+P  S  ++   
Sbjct  364   PSGSSRPPTEGRNTSGGSSRRLSLGGADNMSKVSPVGALMRRSPSFNSRPSLSTGSSLVL  423

Query  866   qesssensgEYNDQKKRHHG--LWYSRNKIDEKENA-GMKENSDKLTDSG------NFSK  714
             + +   +       +    G  L    + ++   +A G  E +D    SG        + 
Sbjct  424   KHAKGTSRSFDGGTRSLDRGKVLVNGPHLLNRSTDAVGDCETTDSWKASGEEKNTETTNS  483

Query  713   NDEDMVSGFLYDRLQKEVINMRKCFDMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKT  534
             +  DMVSG LYD LQKEV+++RK    K+  L  KD+ I+ML KK++TLTKA+EVE++K 
Sbjct  484   DSTDMVSGVLYDMLQKEVVSLRKACHEKDQSLKDKDDAIEMLAKKVDTLTKAMEVEAKKM  543

Query  533   KREAAIREKDSSTIK  489
             +RE A  EK+ S ++
Sbjct  544   RREVAAMEKEVSAMR  558



>ref|XP_004503348.1| PREDICTED: microtubule-associated protein 70-2-like isoform X1 
[Cicer arietinum]
Length=632

 Score =   348 bits (894),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 260/534 (49%), Positives = 370/534 (69%), Gaps = 39/534 (7%)
 Frame = -3

Query  1982  LLH-TDPFILELTSLQNQLKEKERELGVAQSENKGLRATEQLKDKALEELGNEVKRLEEK  1806
             LLH +DP  LEL  L+N++K+K+REL  A  E K L+ +E+L++KA+EEL  E+ +++ K
Sbjct  52    LLHGSDPVKLELNRLENEVKDKDRELSEALVEIKALKHSERLREKAVEELTEELSKVDGK  111

Query  1805  LKISENLVEQKNLETKKLINEKKealtaqyaaeaaLRRVYAEQKEDDSIPIESVIAPLEA  1626
             LK++ENL+E KNLE KK+ +EKK ++ AQ+AAEA LRRV+A QK+DD  PIE+++APLEA
Sbjct  112   LKLTENLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEA  171

Query  1625  EIKMYKNEIAALQEDKRAMERHNKSKEAALLEAERILKSALERVLIVEEVQNQNFELRRQ  1446
             E+K+ + EIA LQ+D +A++R  KSKEAALLEAER ++ AL +  +V+++QN+N EL +Q
Sbjct  172   ELKLARQEIAKLQDDNKALDRLTKSKEAALLEAERTVQVALAKASMVDDLQNKNQELMKQ  231

Query  1445  IEICQEENKILDKTNRQKVLEVERLSQTileleeailaggaaANTIRDYrrqiseiqeer  1266
             IEICQEENKILDK +R KV EVE+L+QT+ ELEEA+LAGGAAAN +RDY+R+  E+ EER
Sbjct  232   IEICQEENKILDKMHRLKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNEER  291

Query  1265  rtlerelaRVKVSANRVATIVANEWKDENDKVMPVKQWLEERRILQAEMQRLKDKLAISE  1086
             +TL+RELAR KVSANRVA +VANEWKD NDKVMPVKQWLE+RR L  EMQ+L+DKLA ++
Sbjct  292   KTLDRELARAKVSANRVAVVVANEWKDANDKVMPVKQWLEDRRFLMGEMQQLRDKLATAD  351

Query  1085  RTAKAEAQlkdklklrlktLEQGLKQTGNNNVNPKVLSG---FSKPEKANHLFGI-----  930
             RTAK EAQLK+K +LRLK L++ L++T +N++N     G    + P +   L G      
Sbjct  352   RTAKYEAQLKEKYQLRLKVLQESLRET-SNSINRGTSEGRCVSNGPSRRQSLGGADNISK  410

Query  929   -----LSSKKRSASQPRASMVNTTseqesssensgEYNDQKKRHHGLWYSRNKI---DEK  774
                     K+ S+ Q R+S+ ++T  + +   +       +         R+KI    + 
Sbjct  411   LNSNGFLPKRTSSFQLRSSVSSSTVLKHAKGASKSFDGGSRS------LERSKILLNGKP  464

Query  773   ENAGMKENSDKLTD---SGNF------SKND------EDMVSGFLYDRLQKEVINMRKCF  639
              ++   ++S+   D   +G++        ND      ED V G LYD LQKEV+ +RK  
Sbjct  465   PSSSFNQSSEGTKDREKNGDWKGSLDDKPNDFPLIDAEDSVPGVLYDFLQKEVLVLRKAG  524

Query  638   DMKENDLNTKDEEIKMLTKKIETLTKAIEVESRKTKREAAIREKDSSTIKYKYD  477
               K+  L  KD+ I+ML KK++TLTKA+EVE++K +RE A+ EK+ + ++ + D
Sbjct  525   LEKDQSLKDKDDAIEMLAKKVDTLTKAMEVEAKKMRREVAVMEKEVAAMRVEKD  578



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6364936378164