BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13109_g1_i1 len=986 path=[82:0-836 39:837-873 955:874-985]

Length=986
                                                                      Score     E

gb|AIS71915.1|  hypothetical protein                                  98.6    1e-20   
ref|XP_009630289.1|  PREDICTED: miraculin-like                        96.3    6e-20   
ref|NP_001233769.1|  uncharacterized protein LOC544001 precursor      95.9    8e-20   
ref|XP_006360663.1|  PREDICTED: miraculin-like                        95.9    8e-20   
ref|XP_006441439.1|  hypothetical protein CICLE_v10022282mg           74.7    2e-12   
ref|XP_006441435.1|  hypothetical protein CICLE_v10023257mg           74.3    2e-12   
ref|XP_006495061.1|  PREDICTED: miraculin-like                        73.9    3e-12   
ref|XP_002305032.2|  trypsin protein inhibitor 3                      73.6    5e-12   Populus trichocarpa [western balsam poplar]
ref|XP_006441456.1|  hypothetical protein CICLE_v10023572mg           73.6    5e-12   
gb|ACS92509.1|  Kunitz-type protease inhibitor KPI-D2.3               73.6    5e-12   Populus trichocarpa [western balsam poplar]
ref|XP_006441432.1|  hypothetical protein CICLE_v10022276mg           73.2    7e-12   
ref|XP_006495063.1|  PREDICTED: miraculin-like                        72.8    8e-12   
gb|ADD51186.1|  tumor-related protein                                 72.8    8e-12   Vitis cinerea var. helleri x Vitis riparia
ref|XP_004515059.1|  PREDICTED: miraculin-like                        72.4    1e-11   
ref|XP_011035401.1|  PREDICTED: miraculin-like                        72.4    1e-11   
ref|XP_006493433.1|  PREDICTED: miraculin-like                        72.4    1e-11   
ref|XP_006441459.1|  hypothetical protein CICLE_v10022284mg           72.4    1e-11   
ref|XP_006493430.1|  PREDICTED: miraculin-like                        72.4    1e-11   
ref|XP_006495064.1|  PREDICTED: miraculin-like                        71.2    3e-11   
ref|XP_009777240.1|  PREDICTED: miraculin-like                        71.2    3e-11   
ref|XP_006441441.1|  hypothetical protein CICLE_v10023320mg           71.2    3e-11   
ref|XP_004241480.1|  PREDICTED: miraculin-like                        70.5    5e-11   
gb|AEK26933.1|  Kunitz-type trypsin inhibitor B2                      70.9    5e-11   
ref|XP_011072079.1|  PREDICTED: miraculin                             70.1    8e-11   
ref|XP_006441446.1|  hypothetical protein CICLE_v10023371mg           70.1    9e-11   
ref|XP_004299457.1|  PREDICTED: miraculin-like                        70.1    9e-11   
ref|XP_006441447.1|  hypothetical protein CICLE_v10021858mg           70.1    1e-10   
ref|XP_010918417.1|  PREDICTED: miraculin-like                        69.3    1e-10   
ref|XP_006493432.1|  PREDICTED: miraculin-like                        70.5    3e-10   
ref|XP_006441438.1|  hypothetical protein CICLE_v10023465mg           68.6    3e-10   
ref|XP_006347377.1|  PREDICTED: miraculin-like                        68.6    3e-10   
gb|AFK39812.1|  unknown                                               67.8    5e-10   
ref|XP_009608866.1|  PREDICTED: miraculin-like                        67.4    6e-10   
emb|CBI35464.3|  unnamed protein product                              67.4    8e-10   
emb|CAN81015.1|  hypothetical protein VITISV_025776                   67.0    9e-10   Vitis vinifera
ref|XP_009793041.1|  PREDICTED: miraculin-like                        67.0    1e-09   
gb|AAC49969.1|  tumor-related protein                                 66.6    1e-09   Nicotiana tabacum [American tobacco]
gb|ACL12055.1|  Kunitz trypsin inhibitor                              66.6    1e-09   Nicotiana tabacum [American tobacco]
ref|XP_002266430.1|  PREDICTED: miraculin                             66.6    1e-09   Vitis vinifera
emb|CAN75396.1|  hypothetical protein VITISV_028636                   66.6    1e-09   Vitis vinifera
ref|XP_009792285.1|  PREDICTED: miraculin                             66.6    1e-09   
ref|XP_009615974.1|  PREDICTED: miraculin-like                        66.6    1e-09   
ref|XP_007029361.1|  Kunitz family trypsin and protease inhibitor...  66.2    2e-09   
ref|XP_009803614.1|  PREDICTED: miraculin-like                        66.2    2e-09   
gb|ABR17296.1|  unknown                                               65.9    2e-09   Picea sitchensis
ref|XP_008778295.1|  PREDICTED: miraculin                             65.5    3e-09   
emb|CDP20822.1|  unnamed protein product                              65.9    3e-09   
emb|CAN65022.1|  hypothetical protein VITISV_027379                   65.5    3e-09   Vitis vinifera
gb|EYU22302.1|  hypothetical protein MIMGU_mgv1a013790mg              65.5    4e-09   
ref|XP_006360288.1|  PREDICTED: miraculin-like                        65.5    4e-09   
ref|XP_009627067.1|  PREDICTED: miraculin                             65.1    4e-09   
ref|XP_002270111.1|  PREDICTED: miraculin                             65.1    5e-09   Vitis vinifera
ref|XP_002265965.1|  PREDICTED: miraculin                             64.7    7e-09   Vitis vinifera
ref|XP_007211211.1|  hypothetical protein PRUPE_ppa011496mg           64.3    8e-09   
ref|XP_008238584.1|  PREDICTED: miraculin-like                        63.5    1e-08   
ref|XP_006347376.1|  PREDICTED: miraculin-like                        63.5    1e-08   
gb|ADK62529.1|  miraculin-like protein                                63.5    2e-08   
ref|XP_003620172.1|  21 kDa seed protein                              63.5    2e-08   
ref|XP_003620169.1|  Kunitz-type trypsin inhibitor alpha chain        63.2    2e-08   
ref|XP_006360306.1|  PREDICTED: miraculin-like                        62.8    3e-08   
emb|CDP21024.1|  unnamed protein product                              62.4    4e-08   
ref|XP_010428253.1|  PREDICTED: bark lectin isoform 2 isoform X2      62.4    5e-08   
ref|XP_010428252.1|  PREDICTED: bark lectin isoform 2 isoform X1      62.4    6e-08   
ref|XP_004241479.1|  PREDICTED: miraculin-like                        61.6    7e-08   
ref|XP_002888923.1|  trypsin and protease inhibitor family protein    62.0    7e-08   
ref|XP_003548289.1|  PREDICTED: miraculin-like                        61.6    7e-08   
gb|AFL91227.1|  Kunitz-like protease inhibitor                        61.2    7e-08   
emb|CDP21544.1|  unnamed protein product                              61.6    7e-08   
gb|AFL91233.1|  Kunitz-like protease inhibitor                        61.2    8e-08   
gb|AFK33359.1|  unknown                                               60.8    1e-07   
ref|NP_001237333.1|  uncharacterized protein LOC100500648 precursor   60.8    1e-07   
ref|XP_010537532.1|  PREDICTED: miraculin                             60.8    1e-07   
gb|AFL91231.1|  Kunitz-like protease inhibitor                        60.5    1e-07   
ref|XP_011092684.1|  PREDICTED: miraculin-like                        60.8    1e-07   
ref|XP_010683193.1|  PREDICTED: miraculin-like                        60.8    1e-07   
ref|NP_565062.1|  Kunitz family trypsin and protease inhibitor pr...  60.8    2e-07   Arabidopsis thaliana [mouse-ear cress]
gb|AFL91226.1|  Kunitz-like protease inhibitor                        59.7    2e-07   
gb|AFL91228.1|  Kunitz-like protease inhibitor                        59.7    2e-07   
ref|XP_002266302.2|  PREDICTED: miraculin-like                        59.3    3e-07   Vitis vinifera
ref|XP_010416131.1|  PREDICTED: bark lectin isoform 2-like isofor...  60.1    3e-07   
gb|KHM99732.1|  Miraculin                                             59.7    3e-07   
emb|CDP22082.1|  unnamed protein product                              59.7    4e-07   
ref|XP_010471390.1|  PREDICTED: bark lectin isoform 2-like            59.7    4e-07   
gb|AAQ96377.1|  miraculin-like protein                                59.3    4e-07   Solanum palustre
ref|XP_010416130.1|  PREDICTED: bark lectin isoform 2-like isofor...  59.7    4e-07   
ref|XP_010101167.1|  hypothetical protein L484_005403                 59.3    4e-07   
gb|AEK26927.1|  Kunitz-type trypsin inhibitor B4                      59.3    5e-07   
ref|XP_002305034.2|  hypothetical protein POPTR_0004s06610g           58.9    6e-07   Populus trichocarpa [western balsam poplar]
gb|ADW95380.1|  Kunitz-type trypsin inhibitor                         58.9    6e-07   
ref|XP_004137534.1|  PREDICTED: miraculin-like                        58.5    9e-07   
gb|AFL91232.1|  Kunitz-like protease inhibitor                        57.8    9e-07   
emb|CDO98557.1|  unnamed protein product                              58.2    1e-06   
emb|CDP21540.1|  unnamed protein product                              58.2    1e-06   
ref|XP_007210537.1|  hypothetical protein PRUPE_ppa011653mg           58.2    1e-06   
ref|XP_007152537.1|  hypothetical protein PHAVU_004G138500g           57.8    1e-06   
emb|CBI35471.3|  unnamed protein product                              59.7    2e-06   
ref|XP_006372633.1|  hypothetical protein POPTR_0017s03430g           57.4    2e-06   
ref|NP_001237597.1|  uncharacterized protein LOC100527288 precursor   57.4    2e-06   
ref|XP_003534100.1|  PREDICTED: miraculin-like                        57.4    2e-06   
ref|XP_007029360.1|  Kunitz family trypsin and protease inhibitor...  56.6    3e-06   
emb|CAC19831.1|  hypothetical protein                                 56.6    3e-06   Avicennia marina
ref|XP_006372632.1|  hypothetical protein POPTR_0017s03420g           56.6    3e-06   
ref|XP_006372654.1|  hypothetical protein POPTR_0017s03600g           56.6    3e-06   
ref|XP_006441461.1|  hypothetical protein CICLE_v10022001mg           57.0    3e-06   
gb|ACS92516.1|  Kunitz-type protease inhibitor KPI-D12                56.6    4e-06   Populus trichocarpa x Populus deltoides
ref|XP_006351546.1|  PREDICTED: miraculin-like                        56.6    4e-06   
ref|XP_010540187.1|  PREDICTED: bark lectin isoform 2-like            56.2    5e-06   
ref|XP_011046090.1|  PREDICTED: miraculin-like                        56.2    5e-06   
emb|CDO98554.1|  unnamed protein product                              56.2    5e-06   
ref|XP_010683390.1|  PREDICTED: miraculin-like                        56.6    5e-06   
prf||1922206B  trypsin inhibitor:ISOTYPE=b                            55.8    5e-06
gb|KHN24496.1|  Miraculin                                             56.2    5e-06   
ref|XP_004234331.1|  PREDICTED: miraculin                             55.8    6e-06   
gb|KHM99737.1|  Miraculin                                             55.8    7e-06   
gb|ACF74332.1|  Kunitz trypsin inhibitor 4                            55.8    7e-06   Arachis hypogaea [goober]
ref|XP_003534101.1|  PREDICTED: 21 kDa seed protein-like              55.5    8e-06   
ref|XP_004235409.1|  PREDICTED: miraculin-like                        55.5    8e-06   
ref|XP_003534081.1|  PREDICTED: miraculin-like                        55.8    8e-06   
dbj|BAA82840.1|  miraculin homologue                                  54.7    8e-06   Youngia japonica
gb|KDP27288.1|  hypothetical protein JCGZ_21019                       55.1    9e-06   
emb|CDP16462.1|  unnamed protein product                              55.5    1e-05   
ref|XP_008437082.1|  PREDICTED: miraculin                             55.1    1e-05   
gb|AFL91229.1|  Kunitz-like protease inhibitor                        53.9    2e-05   
ref|XP_006478135.1|  PREDICTED: miraculin-like                        55.1    2e-05   
emb|CAA56115.1|  trypsin/chymotrypsin inhibitor                       54.3    2e-05   Alocasia macrorrhizos [ape]
prf||1922206A  trypsin inhibitor:ISOTYPE=a                            53.9    2e-05
gb|AAG38518.1|AF283533_1  miraculin-like protein 2                    54.7    2e-05   Citrus x paradisi [grapefruit]
ref|XP_009406658.1|  PREDICTED: miraculin-like                        53.9    3e-05   
ref|XP_008437058.1|  PREDICTED: miraculin-like                        53.9    3e-05   
ref|XP_010683194.1|  PREDICTED: miraculin-like                        53.9    4e-05   
ref|XP_010539163.1|  PREDICTED: bark lectin isoform 1-like            53.5    4e-05   
gb|ADW95389.1|  Kunitz-type trypsin inhibitor                         53.5    4e-05   
ref|XP_009775241.1|  PREDICTED: latex serine proteinase inhibitor...  53.9    4e-05   
ref|XP_010042449.1|  PREDICTED: miraculin-like                        54.3    5e-05   
gb|AEK26936.1|  Kunitz-type trypsin inhibitor B3                      53.1    5e-05   
sp|P13087.3|MIRA_SYNDU  RecName: Full=Miraculin; Short=MIR; Flags...  53.5    5e-05   Synsepalum dulcificum [miracle fruit]
gb|KCW48670.1|  hypothetical protein EUGRSUZ_K02326                   53.1    6e-05   
emb|CDO98558.1|  unnamed protein product                              53.1    6e-05   
ref|XP_003534082.1|  PREDICTED: miraculin-like                        52.8    7e-05   
ref|XP_002525871.1|  Alpha-amylase/subtilisin inhibitor precursor...  52.8    7e-05   Ricinus communis
ref|XP_010037029.1|  PREDICTED: miraculin-like                        53.5    7e-05   
dbj|BAA82843.1|  miraculin homologue                                  52.0    8e-05   Solanum melongena [aubergine]
ref|XP_003534080.1|  PREDICTED: miraculin-like                        52.4    9e-05   
ref|XP_010279465.1|  PREDICTED: miraculin-like                        52.4    1e-04   
ref|XP_009614755.1|  PREDICTED: miraculin-like                        52.4    1e-04   
ref|XP_003534079.1|  PREDICTED: miraculin-like                        51.6    1e-04   
ref|XP_002309884.2|  hypothetical protein POPTR_0007s03650g           52.0    1e-04   Populus trichocarpa [western balsam poplar]
emb|CDP21779.1|  unnamed protein product                              52.0    2e-04   
gb|AHJ25677.1|  Kunitz-type trypsin inhibitor                         52.0    2e-04   
gb|AFL91230.1|  Kunitz-like protease inhibitor                        50.8    2e-04   
ref|XP_004235412.1|  PREDICTED: miraculin-like                        52.4    2e-04   
ref|XP_006847953.1|  hypothetical protein AMTR_s00029p00141480        51.6    2e-04   
ref|XP_006372631.1|  trypsin protein inhibitor 3                      51.6    2e-04   
ref|XP_006390569.1|  hypothetical protein EUTSA_v10019129mg           51.6    2e-04   
ref|XP_004235491.1|  PREDICTED: cysteine protease inhibitor 8-like    52.0    2e-04   
sp|P35812.1|ITC_ALOMA  RecName: Full=Trypsin/chymotrypsin inhibitor   51.2    2e-04   Alocasia macrorrhizos [ape]
gb|KDP46945.1|  hypothetical protein JCGZ_07962                       50.8    2e-04   
ref|XP_004515058.1|  PREDICTED: miraculin-like                        51.2    2e-04   
gb|AIT42208.1|  Kunitz-type inhibitor C                               51.6    3e-04   
ref|XP_010537526.1|  PREDICTED: bark lectin isoform 1-like            51.2    3e-04   
ref|XP_011046091.1|  PREDICTED: miraculin-like                        51.2    3e-04   
ref|XP_010041215.1|  PREDICTED: miraculin-like                        50.8    3e-04   
emb|CDP19138.1|  unnamed protein product                              51.2    3e-04   
gb|KHM99741.1|  Miraculin                                             50.8    3e-04   
gb|AEK26923.1|  Kunitz-type trypsin inhibitor C7                      50.4    3e-04   
ref|XP_003620187.1|  Miraculin                                        50.8    3e-04   
emb|CAI77768.1|  kunitz trypsin inhibitor                             50.8    3e-04   Populus tremula [European aspen]
ref|XP_009344614.1|  PREDICTED: miraculin-like                        50.8    3e-04   
gb|AIT42206.1|  Kunitz-type inhibitor C                               51.2    3e-04   
emb|CAI77785.1|  kunitz trypsin inhibitor                             50.8    3e-04   Populus tremula [European aspen]
ref|XP_010279488.1|  PREDICTED: miraculin-like                        50.8    4e-04   
ref|XP_009344613.1|  PREDICTED: miraculin-like                        50.8    4e-04   
gb|AFL91234.1|  Kunitz-like protease inhibitor                        49.7    4e-04   
ref|XP_010098225.1|  Endogenous alpha-amylase/subtilisin inhibitor    50.4    4e-04   
ref|NP_001237312.1|  uncharacterized protein LOC100527782 precursor   50.4    4e-04   
gb|AFK34345.1|  unknown                                               50.4    5e-04   
emb|CAI77774.1|  kunitz trypsin inhibitor                             50.4    5e-04   Populus tremula [European aspen]
ref|XP_007133280.1|  hypothetical protein PHAVU_011G166500g           50.4    5e-04   
gb|KHM99743.1|  Miraculin                                             50.1    5e-04   
ref|XP_003620188.1|  Miraculin                                        50.4    5e-04   
ref|XP_007041757.1|  21 kDa seed protein, putative                    50.4    5e-04   
gb|ACO40080.1|  kunitz trypsin inhibitor 4                            49.7    6e-04   Populus balsamifera [balsam poplar]
ref|XP_010098227.1|  Endogenous alpha-amylase/subtilisin inhibitor    50.1    6e-04   
ref|NP_001274816.1|  Kunitz-type enzyme inhibitor S9C11 precursor     50.4    6e-04   
ref|XP_006353929.1|  PREDICTED: LOW QUALITY PROTEIN: Kunitz-type ...  50.4    6e-04   
emb|CDP19136.1|  unnamed protein product                              50.1    6e-04   
gb|AAL60243.1|AF459078_1  putative Kunitz-type tuber invertase in...  50.1    6e-04   Solanum tuberosum [potatoes]
emb|CAI77764.1|  kunitz trypsin inhibitor                             50.1    6e-04   Populus tremula [European aspen]
emb|CAI77777.1|  kunitz trypsin inhibitor                             50.1    6e-04   Populus tremula [European aspen]
emb|CAI77803.1|  kunitz trypsin inhibitor                             50.1    7e-04   Populus tremula [European aspen]
gb|AFK41530.1|  unknown                                               50.1    7e-04   
gb|AFK41478.1|  unknown                                               50.1    7e-04   
emb|CAI77772.1|  kunitz trypsin inhibitor                             50.1    7e-04   Populus tremula [European aspen]
emb|CAI77775.1|  kunitz trypsin inhibitor                             50.1    7e-04   Populus tremula [European aspen]
ref|XP_011023016.1|  PREDICTED: endogenous alpha-amylase/subtilis...  49.7    7e-04   
ref|XP_006441460.1|  hypothetical protein CICLE_v10024584mg           48.9    7e-04   
emb|CAI77770.1|  kunitz trypsin inhibitor                             50.1    8e-04   Populus tremula [European aspen]
emb|CAI77798.1|  kunitz trypsin inhibitor                             49.7    8e-04   Populus tremula [European aspen]
emb|CAI77800.1|  kunitz trypsin inhibitor                             49.7    8e-04   Populus tremula [European aspen]
emb|CAI77793.1|  kunitz trypsin inhibitor                             49.7    8e-04   Populus tremula [European aspen]
emb|CAI77765.1|  kunitz trypsin inhibitor                             49.7    9e-04   Populus tremula [European aspen]
emb|CAI77783.1|  kunitz trypsin inhibitor                             49.7    0.001   Populus tremula [European aspen]
emb|CAI77782.1|  kunitz trypsin inhibitor                             49.7    0.001   Populus tremula [European aspen]



>gb|AIS71915.1| hypothetical protein [Nicotiana tabacum]
Length=221

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 98/195 (50%), Gaps = 15/195 (8%)
 Frame = -2

Query  946  MKTAIILLVFSGIAISFLPLAISG-LPPLIRLPTKADGT--NAILDAAGNPVIAGAKYYA  776
            MK  I+ L      + FLPLA S      + LP++       ++LD  GNP+  G +Y+ 
Sbjct  1    MKNLILCLSI----VLFLPLAFSSNFSSNLILPSEVSSALYPSVLDTDGNPLKVGLRYFV  56

Query  775  IPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVI  596
            +P + G  GG+ ++     N   CP D+V +     +      RP+ F+P        +I
Sbjct  57   LPILRGTGGGLILSRVVDKNVKNCPQDIVQDPNELHLG-----RPVEFFPAYPSKTGELI  111

Query  595  ISQYPLNVAFDSPDPSDPCAEENVWKLNYQAMIVTG-GVIDKEDDIGNWFRIQKNINGRG  419
            +   P+NV F SP  +  CA   VWK++ +   V G G +   ++I NWFRIQ    G+G
Sbjct  112  LKNNPINVKFYSPSATSRCANFTVWKMDKKYKYVVGRGKVGILNNIRNWFRIQP--YGKG  169

Query  418  YLFTWWPSLCLGCRI  374
            Y F + P+LC+ C+I
Sbjct  170  YRFVYCPTLCVPCKI  184



>ref|XP_009630289.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=221

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 82/153 (54%), Gaps = 8/153 (5%)
 Frame = -2

Query  829  AILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAV  650
            ++LD  GNP+ AG +Y+ +P + G  GG+ ++     N   CP D+V +     +     
Sbjct  39   SVLDTDGNPLKAGLRYFVLPILRGTGGGLILSRVVDKNVKNCPQDIVQDPNELHLG----  94

Query  649  RRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNYQAMIVTG-GVIDK  473
             RP+ F+P        +I+   P+NV F SP  +  CA   VWK++ +   V G G +  
Sbjct  95   -RPVEFFPAYPSKTGELILKNNPINVKFYSPSATSRCANFTVWKMDKKYKYVVGRGKVGI  153

Query  472  EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRI  374
             ++I NWFRIQ    G+GY F + P+LC+ C+I
Sbjct  154  LNNIRNWFRIQP--YGKGYRFVYCPTLCVPCKI  184



>ref|NP_001233769.1| uncharacterized protein LOC544001 precursor [Solanum lycopersicum]
 gb|AAA80497.1| unknown [Solanum lycopersicum]
Length=225

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 65/197 (33%), Positives = 99/197 (50%), Gaps = 19/197 (10%)
 Frame = -2

Query  928  LLVFSGIAISFLPLAISG------LPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPA  767
            L++F  IA+  +PLA+S       L P   +        +++D+ GNPV AGAKY+ +P+
Sbjct  5    LVLFVSIALC-VPLALSSTFSSDLLLPSDEVVPNGKTYASVVDSDGNPVKAGAKYFVLPS  63

Query  766  VIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVR--RPLSFYPLKREGGDAVII  593
            + G  GG+ ++     N   CP D+V        +P  +   RP+ F+P        +I 
Sbjct  64   LRGSGGGLVLSRVVDKNVKVCPQDIV-------QEPQELNTGRPVEFFPAYPNKTGEIIK  116

Query  592  SQYPLNVAFDSPDPSDPCAEENVWKLNYQAMIVTG-GVIDKEDDIGNWFRIQKNINGRGY  416
               P+NV F S   +  CA   VWK++ +   V G G +   + I NWFRI     G+GY
Sbjct  117  VNNPINVNFFSLSKTSRCANFTVWKMDKKYKYVVGRGTLGALNRIRNWFRIVP--YGKGY  174

Query  415  LFTWWPSLCLGCRIGYF  365
             F + PSLC+ C+I  F
Sbjct  175  RFVYCPSLCVPCKIRCF  191



>ref|XP_006360663.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=225

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 98/198 (49%), Gaps = 20/198 (10%)
 Frame = -2

Query  928  LLVFSGIAISFLPLAISG-------LPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIP  770
            L++F  IA+ F+PLA+S        LP    +        +++D  GNPV AGAKY+ +P
Sbjct  4    LVLFVSIAL-FVPLALSSTFSSDLLLPSEEEVVPNGKTYASVVDIDGNPVKAGAKYFVLP  62

Query  769  AVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVR--RPLSFYPLKREGGDAVI  596
            ++ G  GG+ ++     +   CP D+V         P  +   RP+ F+P   E     I
Sbjct  63   SLRGSGGGLILSRVVDKDVKVCPQDIV-------QVPKELNSGRPVEFFPAYPEKTGEFI  115

Query  595  ISQYPLNVAFDSPDPSDPCAEENVWKLNYQAMIVTG-GVIDKEDDIGNWFRIQKNINGRG  419
                P+NV F SP  +  CA   VWK++ +   V G G +   + I NWFRI     G+ 
Sbjct  116  KVNNPINVNFFSPYETSRCANFTVWKMDKKYKYVVGRGTLGALNRIRNWFRIVP--YGKD  173

Query  418  YLFTWWPSLCLGCRIGYF  365
            Y F + PSLC+ C+I  F
Sbjct  174  YRFVYCPSLCVPCKIKCF  191



>ref|XP_006441439.1| hypothetical protein CICLE_v10022282mg [Citrus clementina]
 gb|ESR54679.1| hypothetical protein CICLE_v10022282mg [Citrus clementina]
Length=206

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 85/171 (50%), Gaps = 27/171 (16%)
 Frame = -2

Query  856  LPTKADGT-NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINI  680
            LP K +   + +LD AG  + AG+KYY +P   G  GG+++A    GN  TCP DVV   
Sbjct  21   LPVKGNAQPDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGR--GNNKTCPLDVV---  75

Query  679  TLAGMQPPAVRR--PLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY-  509
                 +  + +   P++F P+  + G  V+     LN+ FD+   +  CA+  VWKL+  
Sbjct  76   ----QEQHSFKNGLPVTFSPVNPKKG--VVRESTDLNIKFDA---ATSCAQSTVWKLDNF  126

Query  508  -----QAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCR  377
                 Q ++ TGGV        + NWF+I+K      Y   + PS+C  CR
Sbjct  127  DAAFGQWLVTTGGVEGNPGPRTMRNWFKIEKFFG--DYKLVYCPSVCNFCR  175



>ref|XP_006441435.1| hypothetical protein CICLE_v10023257mg [Citrus clementina]
 gb|ESR54675.1| hypothetical protein CICLE_v10023257mg [Citrus clementina]
Length=206

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 85/171 (50%), Gaps = 27/171 (16%)
 Frame = -2

Query  856  LPTKADGT-NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINI  680
            LP + + + + +LD AG  + AG+KYY +P   G  GG+++A     N  TCP DVV   
Sbjct  21   LPVRGNASPDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRS--NNKTCPVDVV---  75

Query  679  TLAGMQPPAVRR--PLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY-  509
                 +  + R   P++F P+  + G  V+     LN+ FD+   +  CA+  VWKL+  
Sbjct  76   ----QEQHSFRNGLPVTFSPVNPKKG--VVRESTDLNIKFDA---ATSCAQSTVWKLDNF  126

Query  508  -----QAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCR  377
                 Q ++ TGGV        + NWF+I+K      Y   + PS+C  CR
Sbjct  127  DAALGQWLVTTGGVEGNPGPRTMRNWFKIEKFFG--NYKLVYCPSVCNFCR  175



>ref|XP_006495061.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 85/171 (50%), Gaps = 27/171 (16%)
 Frame = -2

Query  856  LPTKADGT-NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINI  680
            LP + + + + +LD AG  + AG+KYY +P   G  GG+++A     N  TCP DVV   
Sbjct  21   LPVRGNASPDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRS--NNKTCPLDVV---  75

Query  679  TLAGMQPPAVRR--PLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY-  509
                 +  + R   P++F P+  + G  V+     LN+ FD+   +  CA+  VWKL+  
Sbjct  76   ----QEQHSFRNGLPVTFSPVNPKKG--VVRESTDLNIKFDA---ATSCAQSTVWKLDNF  126

Query  508  -----QAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCR  377
                 Q ++ TGGV        + NWF+I+K      Y   + PS+C  CR
Sbjct  127  DAAFGQWLVTTGGVEGNPGPRTMRNWFKIEKFFG--DYKLVYCPSVCNFCR  175



>ref|XP_002305032.2| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|ACS92483.1| Kunitz-type protease inhibitor KPI-D2.2 [Populus trichocarpa]
 gb|ADW95386.1| Kunitz-type trypsin inhibitor [Populus nigra]
 gb|EEE85543.2| trypsin protein inhibitor 3 [Populus trichocarpa]
Length=215

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 89/190 (47%), Gaps = 33/190 (17%)
 Frame = -2

Query  928  LLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDG  749
            LLV S    SFL  A++   P I      D T A+LD  G  + AG +YY +P   G  G
Sbjct  5    LLVLS----SFLVFALASTRPSI--AGDLDATEAVLDTDGEKLRAGTEYYILPVFRGRGG  58

Query  748  GISVANSDTGNPSTCPTDVVINITLAGMQPPAVRR--PLSFYPLKREGGDAVIISQYPLN  575
            G+++A++      TCP DVV         P  + +  PL+F P+  + G  VI     LN
Sbjct  59   GLTMAST---RDETCPLDVV-------QDPLEISKGLPLTFTPVNPKKG--VIRVSTDLN  106

Query  574  VAFDSPDPSDPCAEENVWKLNY------QAMIVTGGVIDKE--DDIGNWFRIQKNINGRG  419
            + F +   S  C +  VWK+        Q  + TGGV      + I NWF+I+K   G  
Sbjct  107  IKFSA---SSICVQSTVWKIQKSVNSEIQWFVTTGGVEGNPGIETITNWFKIEK--AGDD  161

Query  418  YLFTWWPSLC  389
            Y   + P++C
Sbjct  162  YKLVFCPTVC  171



>ref|XP_006441456.1| hypothetical protein CICLE_v10023572mg [Citrus clementina]
 gb|ESR54696.1| hypothetical protein CICLE_v10023572mg [Citrus clementina]
Length=206

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 86/171 (50%), Gaps = 27/171 (16%)
 Frame = -2

Query  856  LPTKADGT-NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINI  680
            LP + + + + +LD AG  + AG+KYY +P   G  GG+++A     N  TCP DVV   
Sbjct  21   LPVRGNASPDPVLDIAGKQLRAGSKYYILPVTKGQGGGLTLAGRS--NNKTCPLDVV---  75

Query  679  TLAGMQPPAVRR--PLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY-  509
                 +  ++R   P++F P+  + G  V+     LN+ FD+   +  CA+  VWKL+  
Sbjct  76   ----QEQHSLRNGFPVTFSPVNPKKG--VVRESTDLNIKFDA---ATSCAQSTVWKLDNF  126

Query  508  -----QAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCR  377
                 Q ++ TGGV        + NWF+I+K      Y   + PS+C  CR
Sbjct  127  DAALGQWLVTTGGVEGNPGPRTMRNWFKIEKFYG--DYKLVFCPSVCNFCR  175



>gb|ACS92509.1| Kunitz-type protease inhibitor KPI-D2.3 [Populus trichocarpa]
 gb|ACS92510.1| Kunitz-type protease inhibitor KPI-D2 [Populus trichocarpa x 
Populus deltoides]
Length=215

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 89/190 (47%), Gaps = 33/190 (17%)
 Frame = -2

Query  928  LLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDG  749
            LLV S    SFL  A++   P I      D T A+LD  G  + AG +YY +P   G  G
Sbjct  5    LLVLS----SFLVFALASTRPSI--AGDLDATEAVLDTDGEKLRAGTEYYILPVFRGRGG  58

Query  748  GISVANSDTGNPSTCPTDVVINITLAGMQPPAVRR--PLSFYPLKREGGDAVIISQYPLN  575
            G+++A++      TCP DVV         P  + +  PL+F P+  + G  VI     LN
Sbjct  59   GLTMAST---RDETCPLDVV-------QDPLEISKGLPLTFTPVNPKKG--VIRVSTDLN  106

Query  574  VAFDSPDPSDPCAEENVWKLNY------QAMIVTGGVIDKE--DDIGNWFRIQKNINGRG  419
            + F +   S  C +  VWK+        Q  + TGGV      + I NWF+I+K   G  
Sbjct  107  IKFSA---SSICVQSTVWKIQKSVNSEIQWFVTTGGVEGNPGIETITNWFKIEK--AGDD  161

Query  418  YLFTWWPSLC  389
            Y   + P++C
Sbjct  162  YKLVFCPTVC  171



>ref|XP_006441432.1| hypothetical protein CICLE_v10022276mg [Citrus clementina]
 gb|ESR54672.1| hypothetical protein CICLE_v10022276mg [Citrus clementina]
Length=206

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 85/171 (50%), Gaps = 27/171 (16%)
 Frame = -2

Query  856  LPTKADGT-NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINI  680
            LP + + + + +LD AG  + AG+KYY +P   G  GG+++A     N  TCP DVV   
Sbjct  21   LPVRGNASADPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRS--NNKTCPVDVV---  75

Query  679  TLAGMQPPAVRR--PLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY-  509
                 +  + R   P++F P+  + G  V+     +N+ FD+   +  CA+  VWKL+  
Sbjct  76   ----QEQHSFRNGLPVTFSPVNPKKG--VVRESTDINIKFDA---ATSCAQSTVWKLDNF  126

Query  508  -----QAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCR  377
                 Q ++ TGGV        + NWF+I+K      Y   + PS+C  CR
Sbjct  127  DAAIGQWLVTTGGVEGNPGPRTMRNWFKIEKFFG--DYKLVYCPSVCNFCR  175



>ref|XP_006495063.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 85/171 (50%), Gaps = 27/171 (16%)
 Frame = -2

Query  856  LPTKADGT-NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINI  680
            LP + + + + +LD AG  + AG+KYY +P   G  GG+++A     N  TCP DVV   
Sbjct  21   LPVRGNASPDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRS--NNKTCPLDVV---  75

Query  679  TLAGMQPPAVRR--PLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY-  509
                 +  + R   P++F P+  + G  V+     LN+ FD+   +  CA+  VWKL+  
Sbjct  76   ----QEQHSFRNGLPVTFSPVNPKKG--VVRESTDLNIKFDA---ATSCAQSTVWKLDNF  126

Query  508  -----QAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCR  377
                 Q ++ TGGV        + NWF+I+K      Y   + PS+C  CR
Sbjct  127  DTAFGQWLVTTGGVEGNPGPRTMRNWFKIEKFYG--DYKLVFCPSVCNFCR  175



>gb|ADD51186.1| tumor-related protein [Vitis cinerea var. helleri x Vitis riparia]
Length=203

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 97/212 (46%), Gaps = 33/212 (16%)
 Frame = -2

Query  946  MKTAIILLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPA  767
            MKT  +L     IA++  P +++               + +LD  G  + +G  YY +P 
Sbjct  1    MKTTSLLFSLQLIALAVKPFSVAA----------ESAPDPVLDTEGKKLRSGVDYYILPV  50

Query  766  VIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQ  587
              G  GG+++A+  TGN  TCP DVV        Q  +   PL+F P+  + G  VI   
Sbjct  51   FRGRGGGLTLAS--TGN-ETCPLDVV-----QEQQEVSNGLPLTFTPVNPKKG--VIRVS  100

Query  586  YPLNVAFDSPDPSDPCAEENVWKLNY-----QAMIVTGGVIDK--EDDIGNWFRIQKNIN  428
               N+ F +   S  C +  +WKL Y     Q  + TGGV      + + NWF+I+K  +
Sbjct  101  TDHNIKFSA---STICVQSTLWKLEYDESSGQRFVTTGGVEGNPGRETLDNWFKIEKYDD  157

Query  427  GRGYLFTWWPSLCLGCRIGYFRIG-RVGNGYQ  335
               Y   + P++C  C+     IG  + NGY+
Sbjct  158  --DYKLVFCPTVCDFCKPVCGDIGIYIQNGYR  187



>ref|XP_004515059.1| PREDICTED: miraculin-like [Cicer arietinum]
Length=204

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 89/192 (46%), Gaps = 31/192 (16%)
 Frame = -2

Query  946  MKTAIILLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPA  767
            MKT   LL FS I   F+   I+   P             +LD +G  V  G KYY +P 
Sbjct  1    MKT--FLLAFSIICFVFICKTIAAPQP-------------VLDISGKKVTTGVKYYILPV  45

Query  766  VIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQ  587
            ++G  GG++V +    N +TCP  VV        Q     +P++F P     G  VI++ 
Sbjct  46   IVGNGGGLTVTSIADNNNNTCPLYVV-----QEKQEVQNGQPVTFTPYNATKG--VILTS  98

Query  586  YPLNVAFDSPDPSDPCAEENVWK----LNYQAMIVTGGVIDKE--DDIGNWFRIQKNING  425
              LN+   S      CA+  VWK    L+    + TGGV        IGNW++I+K   G
Sbjct  99   TDLNIK-SSFTKKTTCAQPPVWKLLKVLSGVWFLSTGGVEGNPGFQTIGNWYKIEK--AG  155

Query  424  RGYLFTWWPSLC  389
            + Y+ ++ PS+C
Sbjct  156  KDYVLSFCPSVC  167



>ref|XP_011035401.1| PREDICTED: miraculin-like [Populus euphratica]
Length=215

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 62/196 (32%), Positives = 95/196 (48%), Gaps = 35/196 (18%)
 Frame = -2

Query  946  MKTAIILLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPA  767
            M++A+++L       SFL  A++   P I      D T A+LD  G  + AG +YY +P 
Sbjct  1    MRSALLVLS------SFLVFALASARPSI--AGDLDATEAVLDTDGEKLRAGTEYYILPV  52

Query  766  VIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVRR--PLSFYPLKREGGDAVII  593
              G  GG+++A+  TG+ + CP DVV         P  + +  PL+F P+  + G  VI 
Sbjct  53   FRGRGGGLTMAS--TGDEA-CPLDVV-------QDPLEISKGLPLTFTPVNPKKG--VIR  100

Query  592  SQYPLNVAFDSPDPSDPCAEENVWKLNY------QAMIVTGGVIDKE--DDIGNWFRIQK  437
                LN+ F +   S  C +  VWK+        Q  + TGGV      + I NWF+I+K
Sbjct  101  VSTDLNIKFSA---SSICVQSTVWKIQKSVNSEIQWFVTTGGVEGNPGIETITNWFKIEK  157

Query  436  NINGRGYLFTWWPSLC  389
               G  Y   + P++C
Sbjct  158  --AGDDYKLVFCPTVC  171



>ref|XP_006493433.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=221

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 84/171 (49%), Gaps = 27/171 (16%)
 Frame = -2

Query  856  LPTKADGT-NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINI  680
            LP K +   + +LD AG  + AG+KYY +P   G  GG+++A     N  TCP DVV   
Sbjct  21   LPVKGNAQPDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRR--NNKTCPLDVV---  75

Query  679  TLAGMQPPAVRR--PLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY-  509
                 +  + +   P++F P+  + G  V+     LN+ FD+   +  CA+  VWKL+  
Sbjct  76   ----QEQHSFKNGLPVTFSPVNPKKG--VVRESTDLNIKFDA---ATSCAQSTVWKLDNF  126

Query  508  -----QAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCR  377
                 Q ++ TGGV        + NWF+I+K      Y   + PS+C  CR
Sbjct  127  DAAFGQWLVTTGGVEGNPGPRTMRNWFKIEKFFG--DYKLVYCPSVCNFCR  175



>ref|XP_006441459.1| hypothetical protein CICLE_v10022284mg [Citrus clementina]
 gb|ESR54699.1| hypothetical protein CICLE_v10022284mg [Citrus clementina]
Length=206

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 84/171 (49%), Gaps = 27/171 (16%)
 Frame = -2

Query  856  LPTKADGT-NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINI  680
            LP + + + + +LD AG  + AG+KYY +P   G  GG+++A     N  TCP DVV   
Sbjct  21   LPVRGNASPDPVLDVAGKKLRAGSKYYILPVTKGQGGGLTLAGRS--NNKTCPLDVV---  75

Query  679  TLAGMQPPAVRR--PLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY-  509
                 +  + R   P++F P+  + G  V+      N+ FD+   +  CA+  VWKL+  
Sbjct  76   ----QEQHSFRNGLPVTFSPVNPKKG--VVRESTDFNIKFDA---ATSCAQSTVWKLDNF  126

Query  508  -----QAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCR  377
                 Q ++ TGGV        + NWF+I+K      Y   + PS+C  CR
Sbjct  127  DAALGQWLVTTGGVEGNPGPRTMRNWFKIEKFYG--DYKLVFCPSVCNFCR  175



>ref|XP_006493430.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 84/171 (49%), Gaps = 27/171 (16%)
 Frame = -2

Query  856  LPTKADGT-NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINI  680
            LP K +   + +LD +G  + AG+KYY +P   G  GG+++A     N  TCP DVV   
Sbjct  21   LPVKGNAQPDPVLDISGKQLRAGSKYYILPVTKGRGGGLTLAGRS--NNKTCPVDVV---  75

Query  679  TLAGMQPPAVRR--PLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY-  509
                 +  + R   P++F P+  + G  V+     LN+ FD+   +  CA+  VWKL+  
Sbjct  76   ----QEQHSFRNGLPVTFSPVNPKKG--VVRESTDLNIKFDA---ATSCAQSTVWKLDNF  126

Query  508  -----QAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCR  377
                 Q ++ TGGV        + NWF+I+K      Y   + PS+C  CR
Sbjct  127  DAAFGQWVVTTGGVEGNPGPRTMRNWFKIEKFFG--DYKLVYCPSVCNFCR  175



>ref|XP_006495064.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 84/171 (49%), Gaps = 27/171 (16%)
 Frame = -2

Query  856  LPTKADGT-NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINI  680
            LP K +   + +LD +G  + AG+KYY +P   G  GG+++A     N  TCP DVV   
Sbjct  21   LPVKGNAQPDPVLDISGKQLRAGSKYYILPVTKGRGGGLTLAGRS--NNKTCPVDVV---  75

Query  679  TLAGMQPPAVRR--PLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY-  509
                 +  + +   P++F P+  + G  V+     LN+ FD+   +  CA+  VWKL+  
Sbjct  76   ----QEQHSFKNGFPVTFSPVNPKKG--VVRESTDLNIKFDA---ATSCAQSTVWKLDNF  126

Query  508  -----QAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCR  377
                 Q ++ TGGV        + NWF+I+K      Y   + PS+C  CR
Sbjct  127  DAAFGQWLVTTGGVEGNPGPRTMRNWFKIEKFFG--DYKLVYCPSVCNFCR  175



>ref|XP_009777240.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=209

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 57/193 (30%), Positives = 90/193 (47%), Gaps = 25/193 (13%)
 Frame = -2

Query  928  LLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDG  749
            +L+ S I + +   +++    L+   +     + +LD  G+ + AG+ Y+ +P + G  G
Sbjct  3    ILLLSFILLQYFAFSLANPSELV---SAGPSPSPVLDTNGDKIRAGSNYFVLPVIRGRGG  59

Query  748  GISVANSDTGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVA  569
            G+  +N    N  +CP D++ N        P V     F P+  + G  VI     LNV 
Sbjct  60   GLLPSNVKQNN--SCPRDIIQNSNEVQEGLPVV-----FTPVDPKKG--VIRLSTDLNVR  110

Query  568  FDSPDPSDPCAEENVWKLN------YQAMIVTGGVIDKED--DIGNWFRIQKNINGRGYL  413
            F +P     CA E +WKL        Q  IVTGGV        + NWF+I+K   G  Y 
Sbjct  111  FFTP---TICARETIWKLGTYDEKLKQYFIVTGGVEGNPGPLTVSNWFKIEK--LGTDYK  165

Query  412  FTWWPSLCLGCRI  374
            F + PS+C  C++
Sbjct  166  FVFCPSVCTFCKV  178



>ref|XP_006441441.1| hypothetical protein CICLE_v10023320mg [Citrus clementina]
 gb|ESR54681.1| hypothetical protein CICLE_v10023320mg [Citrus clementina]
Length=206

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 84/171 (49%), Gaps = 27/171 (16%)
 Frame = -2

Query  856  LPTKADGT-NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINI  680
            LP K +   + +LD AG  + AG+KYY +P   G  GG+++A    GN  TCP DVV   
Sbjct  21   LPVKGNAQPDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGR--GNNKTCPLDVV---  75

Query  679  TLAGMQPPAVRR--PLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY-  509
                 +  + +   P++F P+  + G  V+     +N+  D+   +  CA+  VWKL+  
Sbjct  76   ----QEQHSFKNGLPVTFSPVNPKKG--VVRESTDINIKLDA---ATSCAQSTVWKLDNF  126

Query  508  -----QAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCR  377
                 Q ++ TGGV        + NWF+I+K      Y   + PS+C  CR
Sbjct  127  DAAFGQWLVTTGGVEGNPGPRTMRNWFKIEKFFG--DYKLVYCPSVCNFCR  175



>ref|XP_004241480.1| PREDICTED: miraculin-like [Solanum lycopersicum]
Length=211

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 75/159 (47%), Gaps = 21/159 (13%)
 Frame = -2

Query  826  ILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVR  647
            +LD  G+ V AG  Y+ +P + G  GG+  +N    N STCP D++        +   V+
Sbjct  35   VLDINGDKVKAGPNYFILPVIQGKGGGLYPSNVKQHN-STCPRDII-------QETDDVQ  86

Query  646  RPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN------YQAMIVTGG  485
              L     + +    V+     +NV F +P     CA E +WKL        Q  +VTGG
Sbjct  87   EGLPVVFTRLDAKKGVVRVSTDVNVRFFTP---TICARETIWKLGAYDDKLKQYFVVTGG  143

Query  484  VIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRI  374
            V        +GNWF+I K   G GY F + PS+C  C++
Sbjct  144  VEGNPGPKTVGNWFKIVK--FGSGYKFVFCPSVCKFCKV  180



>gb|AEK26933.1| Kunitz-type trypsin inhibitor B2 [Populus nigra]
Length=215

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 85/181 (47%), Gaps = 29/181 (16%)
 Frame = -2

Query  901  SFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDT  722
            SFL  A++   P I      D T A+LD  G  + AG +YY +P   G  GG+++A++  
Sbjct  10   SFLVFALASTRPSI--AGDLDATEAVLDTDGEKLRAGTEYYILPVFRGRGGGLTMAST--  65

Query  721  GNPSTCPTDVVINITLAGMQPPAVRR--PLSFYPLKREGGDAVIISQYPLNVAFDSPDPS  548
                TCP DVV         P  + +  PL+F P+  + G  VI     LN+ F +   S
Sbjct  66   -RDETCPLDVV-------QDPLEISKGLPLTFTPVNPKKG--VIRVSTDLNIKFSA---S  112

Query  547  DPCAEENVWKLNY------QAMIVTGGVIDKE--DDIGNWFRIQKNINGRGYLFTWWPSL  392
              C +  VWK+        Q  + TGGV      + I NWF+I+K  +   Y   + P++
Sbjct  113  SICVQSTVWKIQKSVNSEIQWFVTTGGVEGNPGIETITNWFKIEKADD--DYKLVFCPTV  170

Query  391  C  389
            C
Sbjct  171  C  171



>ref|XP_011072079.1| PREDICTED: miraculin [Sesamum indicum]
Length=206

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 66/201 (33%), Positives = 92/201 (46%), Gaps = 36/201 (18%)
 Frame = -2

Query  946  MKTAIILLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPA  767
            MKT  + L F      FL    +   PL      A+    +LD   N V AG  YY +P 
Sbjct  1    MKTTQLFLSF------FLFTIFANRSPL---SAAAEEPAPVLDTDRNLVRAGVDYYILPV  51

Query  766  VIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVRR--PLSFYPLKREGGDAVII  593
            + G  GG+++A+  TGN  TCP DVV        +   VR   PL+F P+  + G  V+ 
Sbjct  52   IRGRGGGLTLAS--TGN-ETCPLDVV-------QEQLEVRNGLPLTFRPVNPKKG--VVR  99

Query  592  SQYPLNVAFDSPDPSDPCAEENVWKL-NYQA-----MIVTGGVIDK--EDDIGNWFRIQK  437
                 N+ F     +  C +  VWKL NY A      I TGGV  K   + I NWF+I+ 
Sbjct  100  VSTDQNIKFSG---ATICVQSTVWKLDNYDASTGKYFITTGGVEGKPGRETISNWFKIE-  155

Query  436  NINGRGYLFTWWPSLCLGCRI  374
               G  Y   + P++C  C++
Sbjct  156  -TYGDDYKLVFCPTVCNYCKV  175



>ref|XP_006441446.1| hypothetical protein CICLE_v10023371mg [Citrus clementina]
 gb|ESR54686.1| hypothetical protein CICLE_v10023371mg [Citrus clementina]
Length=206

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 84/171 (49%), Gaps = 27/171 (16%)
 Frame = -2

Query  856  LPTKADGT-NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINI  680
            LP + + + + +LD AG  + AG+KYY +P   G  GG+++A     N  TC  DVV   
Sbjct  21   LPVRGNASPDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRS--NNKTCLLDVV---  75

Query  679  TLAGMQPPAVRR--PLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY-  509
                 +  + R   P++F P+  + G  V+     LN+ FD+   +  CA+  VWKL+  
Sbjct  76   ----QEQHSFRNGLPVTFSPVNPKKG--VVRESTDLNIKFDA---ATSCAQSTVWKLDNF  126

Query  508  -----QAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCR  377
                 Q ++ TGGV        + NWF+I+K      Y   + PS+C  CR
Sbjct  127  DAVLGQWLLTTGGVEGNPGPRTMRNWFKIEKFFG--DYKLVYCPSVCNFCR  175



>ref|XP_004299457.1| PREDICTED: miraculin-like [Fragaria vesca subsp. vesca]
Length=218

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 89/191 (47%), Gaps = 20/191 (10%)
 Frame = -2

Query  916  SGIAISFLPL-AISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGIS  740
            S + I +L L A  G P L+ +   +D    +LD  G+ +  G +Y+ +P + G  GG++
Sbjct  8    SQVLICYLSLLAFRGKPLLVAVHADSDPA-PVLDIKGHNIQTGVEYWILPVIRGRGGGLT  66

Query  739  VANSDTGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDS  560
            +A +   N S CP DVV        Q  +   PL+F P+  + G  V+     LN+ F +
Sbjct  67   LATTGNRNRSICPLDVV-----QEQQEVSNGLPLTFSPVNLKIG--VVRLSTDLNIKFST  119

Query  559  PDPSDPCAE-ENVWKLNY------QAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFT  407
                  C     VWKL+       Q  + TGGV        I NWF+I+K    + Y   
Sbjct  120  SAAVTICLNTSKVWKLDNLDESTGQRFVTTGGVEGNPGPKTISNWFKIEK--YDKDYKLV  177

Query  406  WWPSLCLGCRI  374
            + P++C  C++
Sbjct  178  FCPTVCNFCKV  188



>ref|XP_006441447.1| hypothetical protein CICLE_v10021858mg [Citrus clementina]
 gb|ESR54687.1| hypothetical protein CICLE_v10021858mg [Citrus clementina]
Length=249

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 61/206 (30%), Positives = 97/206 (47%), Gaps = 43/206 (21%)
 Frame = -2

Query  952  IKMKTAIIL----LVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAK  785
            I M++ ++L    L+F+ IA    PL ++G              + +LD AG  +  G+K
Sbjct  42   ITMRSTLVLPSLILLFAFIAT---PLPVNG----------NASPDPVLDIAGKQLRTGSK  88

Query  784  YYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVRR--PLSFYPLKREG  611
            YY +P   G  GG+++A     N  TCP DVV        +  + +   P++F P+  + 
Sbjct  89   YYILPVTKGRGGGLTLAGR--SNNKTCPLDVV-------QEQHSFKNGLPVTFSPVNPKK  139

Query  610  GDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY------QAMIVTGGVIDK--EDDIGN  455
            G  V+     LN+ FD+   +  CA+  VWKL+       Q ++ TGGV        + N
Sbjct  140  G--VVRESTDLNIKFDA---ATSCAQSTVWKLDNFDAVLGQWLLTTGGVEGNPGPRTMRN  194

Query  454  WFRIQKNINGRGYLFTWWPSLCLGCR  377
            WF+I+K      Y   + PS+C  CR
Sbjct  195  WFKIEKFFG--DYKLVYCPSVCNFCR  218



>ref|XP_010918417.1| PREDICTED: miraculin-like [Elaeis guineensis]
Length=199

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 88/192 (46%), Gaps = 24/192 (13%)
 Frame = -2

Query  865  LIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVI  686
            L  L T A G   +LD  GN +  G +YY  P +  V GG+++A+ +     +CP DV +
Sbjct  13   LSSLTTLAAG-EVVLDTDGNELRRGVEYYIYPGITDVAGGLTLASRN----HSCPLDVTL  67

Query  685  NITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY-  509
             I+     P     P++F P   E  +  I +   LN+ F +      C +   WKL++ 
Sbjct  68   AIS-----PTNNGLPVTFLPADPE--EDTINTSTDLNIVFSA---FTICLQSTAWKLDFD  117

Query  508  ----QAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCR--IGYFRIGR  353
                +  + TGGV      + + NWF+IQ      GY   + PS+C  CR   G   + R
Sbjct  118  NTTRRFYVTTGGVTGNPGRETLDNWFKIQSASGRSGYNLVFCPSVCNICRPVCGSLGVVR  177

Query  352  VGNGYQLGINYN  317
                 +LGI+ +
Sbjct  178  EDGRLRLGISSD  189



>ref|XP_006493432.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=342

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 84/171 (49%), Gaps = 27/171 (16%)
 Frame = -2

Query  856  LPTKADGT-NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINI  680
            LP   + + + ++D AG  + AG+KYY +P   G  GG+++A     N  TCP DVV   
Sbjct  21   LPVNGNASPDPVVDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRS--NNKTCPLDVV---  75

Query  679  TLAGMQPPAVRR--PLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY-  509
                 +  + R   P++F P+  + G  V+     LN+ FD+   +  CA+  VWKL+  
Sbjct  76   ----QEQHSFRNGLPVTFSPVNPKKG--VVRESTDLNIKFDA---ATSCAQSTVWKLDNF  126

Query  508  -----QAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCR  377
                 Q ++ TGGV        + NWF+I+K      Y   + PS+C  CR
Sbjct  127  DAVLGQWLVTTGGVEGNPGPRTMRNWFKIEKFYG--DYKLVFCPSVCNFCR  175



>ref|XP_006441438.1| hypothetical protein CICLE_v10023465mg [Citrus clementina]
 gb|ESR54678.1| hypothetical protein CICLE_v10023465mg [Citrus clementina]
Length=206

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 83/167 (50%), Gaps = 27/167 (16%)
 Frame = -2

Query  856  LPTKADGT-NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINI  680
            LP + + + + +LD AG  + AG+KYY +P   G  GG+++A     N  TCP DVV   
Sbjct  21   LPVRGNASPDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRS--NNKTCPLDVV---  75

Query  679  TLAGMQPPAVRR--PLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY-  509
                 +  + R   P++F P+  + G  V+     +N+ FD+   +  CA+  VWKL+  
Sbjct  76   ----QEQHSFRNGLPVTFSPVNPKKG--VVRESTDINIKFDA---ATSCAQSTVWKLDNF  126

Query  508  -----QAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLC  389
                 Q ++ TGGV        + NWF+I+K      Y   + PS+C
Sbjct  127  DAALGQWLVTTGGVEGNPGPRTMRNWFKIEKFYG--DYKLVFCPSVC  171



>ref|XP_006347377.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=210

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/157 (32%), Positives = 75/157 (48%), Gaps = 21/157 (13%)
 Frame = -2

Query  835  TNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPP  656
            ++ +LD  G+ V AG  Y+ +P + G  GG+  +N    N STCP D+V        +  
Sbjct  31   SSPVLDINGDKVQAGPNYFILPVIRGKGGGLYPSNVKQHN-STCPRDIV-------QETD  82

Query  655  AVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN------YQAMIV  494
             V++ L     + +    V+     +NV F +P     CA E +WKL        Q  +V
Sbjct  83   EVQQGLPVVFTRLDAKKGVVRVSTDVNVRFYTP---TICARETIWKLGAYDDKLKQYFVV  139

Query  493  TGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLC  389
            TGGV        +GNWF+I+K   G  Y F + PS+C
Sbjct  140  TGGVEGNPGPQTVGNWFKIEK--FGSDYKFVFCPSVC  174



>gb|AFK39812.1| unknown [Lotus japonicus]
 gb|AFK45182.1| unknown [Lotus japonicus]
Length=208

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 93/192 (48%), Gaps = 26/192 (14%)
 Frame = -2

Query  946  MKTAIILLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPA  767
            MKT+   L FS I  +F    + G+         A     +LD +G  +  G KYY +P 
Sbjct  1    MKTS--QLAFSIICFAFTTEFLIGI-------ASAAAPEPVLDISGQKLRTGVKYYILPV  51

Query  766  VIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQ  587
            + G  GG+++ +S   N +TCP  VV    L  ++  +V    +F P   +GG  VI++ 
Sbjct  52   LRGKGGGLTLTSSGNINNNTCPLHVVQE-KLEVLKGQSV----TFTPYNAKGG--VILTS  104

Query  586  YPLNVAFDSPDPSDPCAEENVWKLNYQA----MIVTGGVIDK--EDDIGNWFRIQKNING  425
              LN+   S   +  CA+  VWKL  +      + TGGV        I NWF+I+K    
Sbjct  105  TDLNI--KSSLTNTTCAKAPVWKLLKELSGVWFLATGGVEGNPGMATISNWFKIEK--AD  160

Query  424  RGYLFTWWPSLC  389
            + Y+F++ PS+C
Sbjct  161  KDYVFSFCPSVC  172



>ref|XP_009608866.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=209

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 52/159 (33%), Positives = 77/159 (48%), Gaps = 22/159 (14%)
 Frame = -2

Query  826  ILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVR  647
            +LD  G+ +  G+ Y+ +P + G  GG+  +N    N  TCP D +I  +L   Q     
Sbjct  34   VLDTNGDKIRTGSNYFVLPVIRGRGGGLFPSNVKQNN--TCPRD-IIQESLDVQQ----G  86

Query  646  RPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN------YQAMIVTGG  485
             P+ F P+  + G  VI     LNV F +P     CA E +WK+        Q  +VTGG
Sbjct  87   LPVVFTPVDPKKG--VIRLSSDLNVRFFTP---TICARETIWKVGDFDEKLKQYFVVTGG  141

Query  484  VIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRI  374
            V        + NWF+I+K   G  Y F + PS+C  C++
Sbjct  142  VEGNPGPQTVSNWFKIEK--LGTDYKFVFCPSVCSFCKV  178



>emb|CBI35464.3| unnamed protein product [Vitis vinifera]
Length=225

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 50/157 (32%), Positives = 76/157 (48%), Gaps = 22/157 (14%)
 Frame = -2

Query  826  ILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVR  647
            +LD  G  + +G  YY +P   G  GG+++A+  TGN  TCP DVV        Q  +  
Sbjct  53   VLDTEGKKLRSGVDYYILPVFRGRGGGLTLAS--TGN-ETCPLDVV-----QEQQEVSNG  104

Query  646  RPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY-----QAMIVTGGV  482
             PL+F P+  + G  VI      N+ F +   S  C +  +WKL Y     Q  + TGGV
Sbjct  105  LPLTFTPVNPKKG--VIRVSTDHNIKFSA---STICVQSTLWKLEYDESSGQRFVTTGGV  159

Query  481  IDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCR  377
                  + + NWF+I+K  +   Y   + P++C  C+
Sbjct  160  EGNPGRETLDNWFKIEKYED--DYKLVFCPTVCDFCK  194



>emb|CAN81015.1| hypothetical protein VITISV_025776 [Vitis vinifera]
Length=203

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 60/212 (28%), Positives = 94/212 (44%), Gaps = 33/212 (16%)
 Frame = -2

Query  946  MKTAIILLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPA  767
            MKT   L     IA++  P  ++               + +LD  G  + +G  YY +P 
Sbjct  1    MKTTSFLFSLLLIALAVKPFPVAA----------ESSPDPVLDTEGKQLRSGVDYYILPV  50

Query  766  VIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQ  587
            + G  GG+++A+  TGN   CP DVV           +   PL+F P+  + G  VI   
Sbjct  51   IRGRGGGLTLAS--TGN-ENCPLDVV-----QEQHEVSNGLPLTFTPVNPKKG--VIRVS  100

Query  586  YPLNVAFDSPDPSDPCAEENVWKLNY-----QAMIVTGGVIDK--EDDIGNWFRIQKNIN  428
               N+ F +   S  C +  +WKL Y     Q  + TGGV      + + NWF+I+K  +
Sbjct  101  TDHNIKFSA---STICVQSTLWKLEYDESSGQRFVTTGGVEGNPGXETLDNWFKIEKYED  157

Query  427  GRGYLFTWWPSLCLGCRIGYFRIG-RVGNGYQ  335
               Y   + P++C  C+     IG  + NGY+
Sbjct  158  --DYKLVFCPTVCDFCKPVCGDIGIYIQNGYR  187



>ref|XP_009793041.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=209

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/159 (33%), Positives = 73/159 (46%), Gaps = 22/159 (14%)
 Frame = -2

Query  826  ILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVR  647
            +LD  G+ V  G  Y+ +P + G  GG+  +N    N  TCP D++ N        P V 
Sbjct  34   VLDINGDKVKVGLNYFVLPVIRGRGGGLLPSNVKQNN--TCPRDIIQNSDEVQEGLPVV-  90

Query  646  RPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN------YQAMIVTGG  485
                F P   + G  V+     LNV F +P     CA E +WKL        Q  IVTGG
Sbjct  91   ----FTPFNTKKG--VVRLSIDLNVRFFTP---TICARETIWKLGTYDDKLKQYFIVTGG  141

Query  484  VIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRI  374
            V        + +WF+I+K   G  Y F + PS+C  C++
Sbjct  142  VEGNPGPQTLSSWFKIEK--LGTDYKFVFCPSVCKICKV  178



>gb|AAC49969.1| tumor-related protein [Nicotiana tabacum]
Length=210

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 84/183 (46%), Gaps = 22/183 (12%)
 Frame = -2

Query  898  FLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTG  719
            FLP  I  +     L + A+   A++D AG  +  G  YY +P V G  GG+++    TG
Sbjct  7    FLPFLIFTISFNSFLSSSAEAPPAVVDIAGKKLRTGIDYYILPVVRGRGGGLTL--DSTG  64

Query  718  NPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPC  539
            N S CP D V+       Q      PL+F P+  + G  VI     LN+ F +   +  C
Sbjct  65   NES-CPLDAVVQ----EQQEIKNGLPLTFTPVNPKKG--VIRESTDLNIKFSA---ASIC  114

Query  538  AEENVWKLNY------QAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLG  383
             +  +WKL+       +  I  GG       + I NWF+I+K    R Y   + P++C  
Sbjct  115  VQTTLWKLDDFDETTGKYFITIGGNEGNPGRETISNWFKIEK--FERDYKLVYCPTVCNF  172

Query  382  CRI  374
            C++
Sbjct  173  CKV  175



>gb|ACL12055.1| Kunitz trypsin inhibitor [Nicotiana tabacum]
Length=209

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/159 (33%), Positives = 73/159 (46%), Gaps = 22/159 (14%)
 Frame = -2

Query  826  ILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVR  647
            +LD  G+ V  G  Y+ +P + G  GG+  +N    N  TCP D++ N        P V 
Sbjct  34   VLDINGDKVKVGLNYFVLPVIRGRGGGLLPSNVKQNN--TCPRDIIQNSDEVQEGLPVV-  90

Query  646  RPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN------YQAMIVTGG  485
                F P   + G  V+     LNV F +P     CA E +WKL        Q  IVTGG
Sbjct  91   ----FAPFNTKKG--VVRLSIDLNVRFFTP---TICARETIWKLGTYDDKLKQYFIVTGG  141

Query  484  VIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRI  374
            V        + +WF+I+K   G  Y F + PS+C  C++
Sbjct  142  VEGNPGPQTLSSWFKIEK--LGTDYKFVFCPSVCKICKV  178



>ref|XP_002266430.1| PREDICTED: miraculin [Vitis vinifera]
Length=203

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 77/159 (48%), Gaps = 22/159 (14%)
 Frame = -2

Query  832  NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPA  653
            + +LD  G  + +G  YY +P   G  GG+++A+  TGN  TCP DVV        Q  +
Sbjct  29   DPVLDTEGKKLRSGVDYYILPVFRGRGGGLTLAS--TGN-ETCPLDVV-----QEQQEVS  80

Query  652  VRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY-----QAMIVTG  488
               PL+F P+  + G  VI      N+ F +   S  C +  +WKL Y     Q  + TG
Sbjct  81   NGLPLTFTPVNPKKG--VIRVSTDHNIKFSA---STICVQSTLWKLEYDESSGQRFVTTG  135

Query  487  GVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCR  377
            GV      + + NWF+I+K  +   Y   + P++C  C+
Sbjct  136  GVEGNPGRETLDNWFKIEKYED--DYKLVFCPTVCDFCK  172



>emb|CAN75396.1| hypothetical protein VITISV_028636 [Vitis vinifera]
Length=203

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 77/159 (48%), Gaps = 22/159 (14%)
 Frame = -2

Query  832  NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPA  653
            + +LD  G  + +G  YY +P   G  GG+++A+  TGN  TCP DVV        Q  +
Sbjct  29   DPVLDTEGKKLRSGVDYYILPVFRGRGGGLTLAS--TGN-ETCPLDVV-----QEQQEVS  80

Query  652  VRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY-----QAMIVTG  488
               PL+F P+  + G  VI      N+ F +   S  C +  +WKL Y     Q  + TG
Sbjct  81   NGLPLTFTPVNPKKG--VIRVSTDHNIKFSA---STICVQSTLWKLEYDESSGQRFVTTG  135

Query  487  GVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCR  377
            GV      + + NWF+I+K  +   Y   + P++C  C+
Sbjct  136  GVEGNPGRETLDNWFKIEKYED--DYKLVFCPTVCDFCK  172



>ref|XP_009792285.1| PREDICTED: miraculin [Nicotiana sylvestris]
Length=210

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 84/183 (46%), Gaps = 22/183 (12%)
 Frame = -2

Query  898  FLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTG  719
            FLP  I  +     L + A+   A++D AG  +  G  YY +P V G  GG+++    TG
Sbjct  7    FLPFLIFTISFNSFLSSAAEAPPAVVDIAGKKLRTGIDYYILPVVRGRGGGLTL--DSTG  64

Query  718  NPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPC  539
            N S CP D V+       Q      PL+F P+  + G  VI     LN+ F +   +  C
Sbjct  65   NES-CPLDAVVQ----EQQEIKNGLPLTFTPVNPKKG--VIRESTDLNIKFSA---ASIC  114

Query  538  AEENVWKLNY------QAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLG  383
             +  +WKL+       +  I  GG       + I NWF+I+K    R Y   + P++C  
Sbjct  115  VQTTLWKLDDFDETTGKYFITIGGNEGNPGRETISNWFKIEK--FERDYKLVYCPTVCNF  172

Query  382  CRI  374
            C++
Sbjct  173  CKV  175



>ref|XP_009615974.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=209

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 72/159 (45%), Gaps = 22/159 (14%)
 Frame = -2

Query  826  ILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVR  647
            +LD  G+ V  G+ Y+ +P + G  GG+  +N    N  TCP D++ N        P V 
Sbjct  34   VLDINGDKVRVGSNYFVLPVIRGRGGGLLPSNVKQIN--TCPRDIIQNSDEVQQGLPVVF  91

Query  646  RPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN------YQAMIVTGG  485
             P        +    V+     LNV F +P     CA E +WKL        Q  IVTGG
Sbjct  92   TPF-------DAKKGVVRLSTDLNVRFYTP---TICARETIWKLGTYDDKLKQYFIVTGG  141

Query  484  VIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRI  374
            V        + +WF+I+K   G  Y F + PS+C  C++
Sbjct  142  VEGNPGPQTVSSWFKIEK--LGTDYKFLFCPSVCKICKV  178



>ref|XP_007029361.1| Kunitz family trypsin and protease inhibitor protein, putative 
[Theobroma cacao]
 gb|EOY09863.1| Kunitz family trypsin and protease inhibitor protein, putative 
[Theobroma cacao]
Length=198

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 80/163 (49%), Gaps = 22/163 (13%)
 Frame = -2

Query  844  ADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGM  665
             DG + +LD +G  +  G  YY +P + G  GG+++A+  TGN  TCP DVV        
Sbjct  20   TDGLDPVLDISGEELRTGTDYYILPVIRGGGGGLTLAS--TGN-ETCPLDVVQE-----Q  71

Query  664  QPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN----YQAMI  497
               +   PL+F P+    G  V+     LN+ F +   +  C +  VWKL+     Q M+
Sbjct  72   LEVSNGLPLTFSPVNITKG--VVRVSTDLNIKFSA---ATICVQSTVWKLDNDEATQKMV  126

Query  496  VTGGVIDKE---DDIGNWFRIQKNINGRGYLFTWWPSLCLGCR  377
            VT G ++     + + NWF+I++  +   Y   + P +C  CR
Sbjct  127  VTTGGVEGNPGIETLSNWFKIERYED--DYKLVFCPGVCDFCR  167



>ref|XP_009803614.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=210

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 71/159 (45%), Gaps = 22/159 (14%)
 Frame = -2

Query  826  ILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVR  647
            +LD  G+ V  G  Y+ +P + G  GG+  +N    N  TCP D++  +       P V 
Sbjct  34   VLDINGDKVQVGLNYFVLPVIRGRGGGLYPSNVKQNN--TCPRDIIQEVDEVQQGLPVVF  91

Query  646  RPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN------YQAMIVTGG  485
             P        +    V+     LNV F +P     CA E +WKL        Q  +VTGG
Sbjct  92   TPF-------DAKKGVVRLSTDLNVRFFTP---TICARETIWKLGTYDDKLKQYFMVTGG  141

Query  484  VIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRI  374
            V        + +WF+I+K   G  Y F + PS+C  C++
Sbjct  142  VEGNPGPQTLSSWFKIEK--LGTDYKFVFCPSVCKICKV  178



>gb|ABR17296.1| unknown [Picea sitchensis]
Length=211

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 92/203 (45%), Gaps = 16/203 (8%)
 Frame = -2

Query  904  ISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSD  725
            +  + +AI+     I LP +  G   ++DA GNPV+ G +YY +PAV G  GG+++    
Sbjct  14   MQMVMVAITAFMLFINLPLQVQGAADVVDAEGNPVLVGGEYYVLPAVAGSGGGLTLKMRV  73

Query  724  TGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSD  545
                ++CP  V    +      P V RP       + G  + +I Q  +N+  +    + 
Sbjct  74   N---NSCPLYVAQENSEKSRGLPVVLRPAK----GQRGNYSSVIVQEHVNLNVNMAAVT-  125

Query  544  PCAEENVWKLNYQAMIVTGGVIDKEDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRIGYF  365
             C +   W +   A   T     K  D  + F+I K I+G GY+  + P     CR+   
Sbjct  126  ACVQSTAWSVQNDAN--TTKRFIKASDSSSLFQIVKAIDGDGYVLYFCPC---NCRLVCT  180

Query  364  RIGRVGNGYQ---LGINYNDESL  305
            ++G   +G +   L IN + E+L
Sbjct  181  KVGIYVDGDEKRWLVINNSGEAL  203



>ref|XP_008778295.1| PREDICTED: miraculin, partial [Phoenix dactylifera]
Length=184

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 85/181 (47%), Gaps = 26/181 (14%)
 Frame = -2

Query  895  LPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGN  716
            L L  S    L  L T A     +LD  GN +  G +YY  P +  V GG+++A+ +   
Sbjct  11   LILLFSAFFLLSSLTTLA-AAEVVLDRDGNELRRGVEYYIYPGITDVAGGLTLASRN---  66

Query  715  PSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCA  536
              +CP DV + I+     P +   PL+F P   E  +  I +   LN+ F +      C 
Sbjct  67   -HSCPLDVTLAIS-----PTSNGLPLTFLPADPE--EDTINTSTDLNIVFSA---VTICV  115

Query  535  EENVWKLNY-----QAMIVTGGVIDK--EDDIGNWFRIQKNINGRG-YLFTWWPSLCLGC  380
            +  VWKL++     +  + TGGV      + + NWF+I+   N RG Y   + P++C  C
Sbjct  116  QSTVWKLDFDDAAGRFYVTTGGVAGNPGRETLANWFKIE---NDRGAYKLVFCPTVCDIC  172

Query  379  R  377
            +
Sbjct  173  K  173



>emb|CDP20822.1| unnamed protein product [Coffea canephora]
Length=204

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 83/164 (51%), Gaps = 26/164 (16%)
 Frame = -2

Query  838  GTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQP  659
             +NA+ D  G  VI GA YY +P + G  GG+++ ++D     TCP DV+        + 
Sbjct  26   ASNAVRDIDGKEVIVGAHYYILPVIRGRGGGLTLGSADN---ETCPLDVI-------QEQ  75

Query  658  PAVRR--PLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY-----QAM  500
              V+R  PL+F P+    G  V+     LN+ F +   +  C +  VWKL +     Q +
Sbjct  76   FEVKRGLPLTFTPVNTTKG--VVPVSTDLNIKFFA---ATICVQSTVWKLEFDADISQYV  130

Query  499  IVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRI  374
            IV+GG+      + I NWF+I+K    + Y   + P++C  C++
Sbjct  131  IVSGGIEGNPGRETISNWFKIEK--YDQDYKLVYCPTVCNFCKV  172



>emb|CAN65022.1| hypothetical protein VITISV_027379 [Vitis vinifera]
Length=203

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 84/174 (48%), Gaps = 23/174 (13%)
 Frame = -2

Query  832  NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPA  653
            + +LD  G  + +G  YY +P   G  GG+++A+  TGN S CP DVV        Q  +
Sbjct  29   DPVLDTEGKKLRSGVDYYILPVFRGRGGGLTLAS--TGNES-CPLDVVQE-----QQEVS  80

Query  652  VRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY-----QAMIVTG  488
               PL+F P+  + G  VI      N+ F +   S  C +  +WKL Y     Q  + TG
Sbjct  81   NGLPLTFTPVNPKKG--VIRVSTDHNIKFSA---STICVQSTLWKLEYDESSGQWFVTTG  135

Query  487  GVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRIGYFRIG-RVGNGYQ  335
            GV      + + NWF+I+K  +   Y   + P++C  C+     IG  + NGY+
Sbjct  136  GVEGNPGRETLDNWFKIEKYED--DYKLVFCPTVCDFCKPVCGDIGIYIQNGYR  187



>gb|EYU22302.1| hypothetical protein MIMGU_mgv1a013790mg [Erythranthe guttata]
Length=210

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 103/213 (48%), Gaps = 30/213 (14%)
 Frame = -2

Query  916  SGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISV  737
            + +++ F+  +I  +P    L + A+    +LD +G  + AG  YY +P + G  GG+S+
Sbjct  6    THLSLCFILFSIHTIP---LLSSAAEAPPPVLDISGKELRAGVNYYILPVIRGRGGGLSL  62

Query  736  ANSDTGNPSTCPTDVVINITLAGMQPPAVRR--PLSFYPLKREGGDAVIISQYPLNVAFD  563
            A+  TGN +TCP  VV        +   +++  PL+F+P+  + G   + + +  N+ F 
Sbjct  63   AS--TGN-NTCPLSVV-------QEQSELKKGLPLTFHPVDPKKGVVRLSTDH--NIKFS  110

Query  562  SPDPSDPCAEENVWKLNY-----QAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTW  404
            +   S  C +  VW+L+      +  + TGGV        I NWF+I+       Y   +
Sbjct  111  A---STICVQSTVWRLDNDESTGKYFVNTGGVEGNPGSGSISNWFKIEA-YGSSDYKLLF  166

Query  403  WPSLCLGCRIGYFRIGRV--GNGYQLGINYNDE  311
             P++C  C++    +G V      +LG+   D+
Sbjct  167  CPTVCNFCKVICRDVGIVVQDGKRRLGLTLTDD  199



>ref|XP_006360288.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=212

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 104/218 (48%), Gaps = 40/218 (18%)
 Frame = -2

Query  937  AIILLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIG  758
             II+++F  +AI FLPLA      L+           +LD  G P+ A  +Y+ +PA   
Sbjct  2    KIIVVLFVSLAI-FLPLATCNNNQLLV---------DVLDIDGKPLNASRRYHILPAYNT  51

Query  757  V-DGGISVANSDTGNPSTCPTDVV--INITLAGMQPPAVRRPLSFYPLKREGGDAVIISQ  587
            + DGG+S+AN    + +TCPT VV   ++T  G+        + F P  ++     I++ 
Sbjct  52   MRDGGVSLANLGDQSQNTCPTSVVQSKDVTDNGI-------AVHFMP--KDQTYEHIVAY  102

Query  586  YPLNVAFDSPDPSDPCAEENVWKLNYQ--------AMIVTGGVIDKEDDIGNWFRIQKNI  431
             P+N+ F   D  +PC+   VWK+++           I TGG +    D+  WF+I+   
Sbjct  103  SPVNIRF-YLDNFNPCSNLMVWKVDHLREDVPLNGHTISTGGELVNPIDVSRWFQIEPVA  161

Query  430  NGRGYLFTWWPSLCLGCRIGYFRIGRVGNG--YQLGIN  323
            N + Y   + P      RI  + IGR      Y+LG++
Sbjct  162  NNK-YKLVFCP------RIKCYDIGRFRQSGYYRLGLS  192



>ref|XP_009627067.1| PREDICTED: miraculin [Nicotiana tomentosiformis]
Length=205

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 85/185 (46%), Gaps = 26/185 (14%)
 Frame = -2

Query  898  FLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTG  719
            FLP  I  +     L + A+   A++D AG  +  G  YY +P V G  GG+++    TG
Sbjct  7    FLPFLIFTISFNSFLSSAAEAPPAVIDIAGKKLRTGVDYYILPVVRGRGGGLTL--DSTG  64

Query  718  NPSTCPTDVVINITLAGMQPPAVRR--PLSFYPLKREGGDAVIISQYPLNVAFDSPDPSD  545
            N S CP D V+       +   ++   PL+F P+  + G  VI     LN+ F +   + 
Sbjct  65   NES-CPLDAVVQ------EHHEIKNGLPLTFTPVNPKKG--VIRESTDLNIKFSA---AS  112

Query  544  PCAEENVWKLNY------QAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLC  389
             C +  +WKL+       +  I  GG       + I NWF+I K    R Y   + P++C
Sbjct  113  ICVQTTLWKLDDFDEATGKYFITIGGNEGNPGRETISNWFKIDK--FERDYKLVYCPTVC  170

Query  388  LGCRI  374
              C++
Sbjct  171  NFCKV  175



>ref|XP_002270111.1| PREDICTED: miraculin [Vitis vinifera]
 emb|CBI35474.3| unnamed protein product [Vitis vinifera]
Length=203

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 87/183 (48%), Gaps = 24/183 (13%)
 Frame = -2

Query  856  LPTKADGT-NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINI  680
             P  A+ + + +LD  G  + +G  YY +P + G  GG+++A+  TGN   CP DVV   
Sbjct  20   FPVAAESSPDPVLDTEGKQLWSGVDYYILPVIRGRGGGLTLAS--TGN-ENCPLDVV---  73

Query  679  TLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY---  509
                    +   PL+F P+  + G  VI      N+ F +   S  C +  +WKL Y   
Sbjct  74   --QEQHEVSNGLPLTFTPVNPKKG--VIRVSTDHNIKFSA---STICVQSTLWKLEYDES  126

Query  508  --QAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRIGYFRIG-RVGN  344
              Q  + TGGV      + + NWF+I+K  +   Y   + P++C  C+     IG  + N
Sbjct  127  SGQRFVTTGGVEGNPGHETLDNWFKIEKYED--DYKLVFCPTVCDFCKPVCGDIGIYIQN  184

Query  343  GYQ  335
            GY+
Sbjct  185  GYR  187



>ref|XP_002265965.1| PREDICTED: miraculin [Vitis vinifera]
 emb|CBI35463.3| unnamed protein product [Vitis vinifera]
Length=205

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 78/169 (46%), Gaps = 23/169 (14%)
 Frame = -2

Query  856  LPTKADGT-NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINI  680
            LP  A+   + +LD  G  + +G  YY +P + G  GG++VA+       TCP DVV + 
Sbjct  21   LPGAAEAAPDPVLDIEGKQLRSGVDYYILPVIRGRGGGLTVASVRN---KTCPLDVVQDK  77

Query  679  TLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY---  509
                        PL+F P+  +    VI      N+ F +   +  CA+  VWKL Y   
Sbjct  78   LEVSHG-----LPLTFTPVNPK--QDVIRVSTDHNIKFSA---ATICAQSTVWKLEYDES  127

Query  508  --QAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRI  374
              Q  I TGGV        + NWF+I+K   G  Y   + P++C  C++
Sbjct  128  TGQRFITTGGVEGNPGRGTLSNWFKIEK--YGDDYKLVFCPTVCNFCKV  174



>ref|XP_007211211.1| hypothetical protein PRUPE_ppa011496mg [Prunus persica]
 gb|EMJ12410.1| hypothetical protein PRUPE_ppa011496mg [Prunus persica]
Length=208

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 81/176 (46%), Gaps = 29/176 (16%)
 Frame = -2

Query  826  ILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVV--INITLAGMQPPA  653
            +LD  GN +  G  YY +P + G  GG+++A+  T N ++CP DVV   N    G+    
Sbjct  34   VLDITGNKLQTGVDYYILPVIRGRGGGLTLAS--TSNKTSCPLDVVQEQNEVSNGL----  87

Query  652  VRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY------QAMIVT  491
               PL F P+    G  V+     LN+ F +   +  C +  VWKL        Q  + +
Sbjct  88   ---PLKFSPVNVTKG--VVRVSTDLNIKFSA---TTICVQSTVWKLGKFDEQTGQWFVTS  139

Query  490  GGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRIGYFRIGRVGNGYQLG  329
            GGV          NWF+I+K   G  Y   + P++C  C++     G VG  +Q G
Sbjct  140  GGVEGNPGRQTTSNWFKIEK--FGDDYKLVFCPTVCNFCKV---ICGDVGIFFQDG  190



>ref|XP_008238584.1| PREDICTED: miraculin-like [Prunus mume]
Length=208

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 75/161 (47%), Gaps = 26/161 (16%)
 Frame = -2

Query  826  ILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVR  647
            +LD  GN +  G  YY +P + G  GG+++A+  T N ++CP DVV        +   V 
Sbjct  34   VLDITGNKLQTGVNYYILPVIRGRGGGLTLAS--TSNKTSCPLDVV-------QEQNEVS  84

Query  646  RPLS--FYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY------QAMIVT  491
              LS  F P+    G  V++    LN+ F +   +  C +  VWKL        Q  + +
Sbjct  85   NGLSLKFSPVNVTKG--VVLVSTDLNIKFSA---TTICVQSTVWKLGKFDEQTGQWFVTS  139

Query  490  GGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRI  374
            GGV          NWF+I+K   G  Y   + P++C  C++
Sbjct  140  GGVEGNPGRQTTSNWFKIEK--FGDDYKLVFCPTVCNFCKV  178



>ref|XP_006347376.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=202

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 73/160 (46%), Gaps = 23/160 (14%)
 Frame = -2

Query  826  ILDAAGNPVIAGAKYYAIPAVIGVDGG-ISVANSDTGNPSTCPTDVVINITLAGMQPPAV  650
            +LD  GN V AG  Y+ +P + G  GG +S  N    N  TCP D++             
Sbjct  25   VLDVNGNEVEAGPNYFILPVIRGRGGGGLSPFNVKQNN--TCPRDII-------QWDDEE  75

Query  649  RRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY------QAMIVTG  488
            +  L     + +   +V+     +NV F +P     CA E +WKL        Q  +VTG
Sbjct  76   QEGLPVVFTRIDAKKSVVRVSTDVNVRFYTPTI---CARETIWKLGEYDENLKQYFVVTG  132

Query  487  GVIDKE--DDIGNWFRIQKNINGRGYLFTWWPSLCLGCRI  374
            GV        +GNWF+I+K     GY F + PS+C  C++
Sbjct  133  GVEGNPGLKTVGNWFKIEK--FESGYKFVYCPSVCKFCKV  170



>gb|ADK62529.1| miraculin-like protein [Nicotiana benthamiana]
Length=205

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 84/185 (45%), Gaps = 26/185 (14%)
 Frame = -2

Query  898  FLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTG  719
            FLP  I        L + A+   A++D AG  +  G  YY +P V G  GG+++    TG
Sbjct  7    FLPFLIFTXSFNSFLSSAAEAPPAVVDIAGKKLRTGIDYYILPVVRGRGGGLTL--DSTG  64

Query  718  NPSTCPTDVVINITLAGMQPPAVRR--PLSFYPLKREGGDAVIISQYPLNVAFDSPDPSD  545
            N S CP D V+       +   +    PL+F P+  + G  VI     LN+ F +   + 
Sbjct  65   NES-CPLDAVVQ------EQKEINNGFPLTFTPVNPKKG--VIRESTDLNIKFSA---AS  112

Query  544  PCAEENVWKLNY------QAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLC  389
             C +  +WKL+       +  I  GG       + I NWF+I+K    R Y   + P++C
Sbjct  113  ICVQTTLWKLDDFDETTGKYFITIGGNEGNPGRETISNWFKIEK--FERDYKLVYCPTVC  170

Query  388  LGCRI  374
              C++
Sbjct  171  NFCKV  175



>ref|XP_003620172.1| 21 kDa seed protein [Medicago truncatula]
 gb|AES76390.1| Kunitz type trypsin inhibitor / miraculin [Medicago truncatula]
Length=205

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 93/196 (47%), Gaps = 38/196 (19%)
 Frame = -2

Query  946  MKTAIILLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPA  767
            MKT+   L FS I ++F+    +   P             +LD +G  V  G KYY +P 
Sbjct  1    MKTS--FLAFSIIFLAFICKTFAAPEP-------------VLDISGKKVTTGVKYYILPV  45

Query  766  VIGVDGGISVA--NSDTGNPSTCPTDVVINITLAGMQPPAVR--RPLSFYPLKREGGDAV  599
            + G  GG++V   N+  GN +TCP  V+        +   V+  + ++F P   + G  V
Sbjct  46   IRGKGGGLTVVNENNLNGNNNTCPLYVL-------QEKLEVKNGQAVTFTPYNAKKG--V  96

Query  598  IISQYPLNVAFDSPDPSDPCAEENVWKLNYQA----MIVTGGVIDKE--DDIGNWFRIQK  437
            I++   LN+   S      CA+  VWKLN        + TGGV      D I NWF+I+K
Sbjct  97   ILTSTDLNI--KSYVTKTTCAQSQVWKLNKVLSGVWFLATGGVEGNPGFDTIFNWFKIEK  154

Query  436  NINGRGYLFTWWPSLC  389
                + Y+F++ PS+C
Sbjct  155  --ADKDYVFSFCPSVC  168



>ref|XP_003620169.1| Kunitz-type trypsin inhibitor alpha chain [Medicago truncatula]
 gb|AES76387.1| Kunitz type trypsin inhibitor / miraculin [Medicago truncatula]
 gb|AFK40758.1| unknown [Medicago truncatula]
 gb|AFK41434.1| unknown [Medicago truncatula]
Length=203

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 89/198 (45%), Gaps = 37/198 (19%)
 Frame = -2

Query  946  MKTAIILLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPA  767
            MKT+   L FS + ++F+   I+   P             +LD +G  +  G KYY +P 
Sbjct  1    MKTS--FLAFSILCLAFICKTIAAPEP-------------VLDISGKQLTTGVKYYILPV  45

Query  766  VIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVR--RPLSFYPLKREGGDAVII  593
            + G  GG++VAN    N  TCP  VV        +   V+    ++F P   + G  VI+
Sbjct  46   IRGKGGGLTVANHGENN-QTCPLYVV-------QEKLEVKNGEAVTFTPYNAKQG--VIL  95

Query  592  SQYPLNVAFDSPDPSDPCAEENVWKLNYQA----MIVTGGVIDKED--DIGNWFRIQKNI  431
            +   LN+   S      C +  VWKL  +      + TGGV        +GNWF+I+K  
Sbjct  96   TSTDLNI--KSFVTKTKCPQTQVWKLLKELTGVWFLATGGVEGNPSMATVGNWFKIEK--  151

Query  430  NGRGYLFTWWPSLCLGCR  377
              + Y+ ++ P+    C+
Sbjct  152  ADKDYVLSFCPAEACKCQ  169



>ref|XP_006360306.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=212

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 96/209 (46%), Gaps = 35/209 (17%)
 Frame = -2

Query  934  IILLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGV  755
            IILL+F  +AIS LPLA      L+           +LD  G P+ A ++YY IP    +
Sbjct  3    IILLLFVSLAIS-LPLATCNNNQLLV---------DVLDIDGKPLNASSRYYMIPPHHSI  52

Query  754  -DGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPL  578
             DGG+S+A+      +TCPT VV ++ +A          +  Y + +      I+   PL
Sbjct  53   EDGGMSLADLGDQQQNTCPTSVVESLDVADYG-------IGVYFVPKNPNYKKIVESSPL  105

Query  577  NVAFDSPDPSDPCAEENVWKLN--------YQAMIVTGGVIDKEDDIGNWFRIQKNINGR  422
            N+ F   D  + C +  VWK++        +   I TG  +    D+ +WF+I K++   
Sbjct  106  NIKF-YIDSLNSCTDLMVWKVDNIGKLVPQHGHTISTGAKLGNPFDVSSWFQI-KHVARY  163

Query  421  GYLFTWWPSLCLGCRIGYFRIGRV-GNGY  338
             Y   +    CL   I  + IG V  NGY
Sbjct  164  SYKLVF----CLD--IECYNIGTVRQNGY  186



>emb|CDP21024.1| unnamed protein product [Coffea canephora]
Length=207

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 91/203 (45%), Gaps = 38/203 (19%)
 Frame = -2

Query  946  MKTAIILLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPA  767
            MK +++ L      ISFLP  IS +         A     +LD AGN +     YY +PA
Sbjct  1    MKISLLFL------ISFLPFFISTVSSF----ASAAEPEPVLDVAGNVLRTDLYYYILPA  50

Query  766  -VIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVRR---PLSFYPLKREGGDAV  599
             V G  GG  +  S  GN  TCP  V         Q  + +R   P++F P+K   G   
Sbjct  51   NVRGRFGGGGLTLSSIGN-DTCPVGV--------FQELSAQRNGIPVTFSPVKPRNGVVR  101

Query  598  IISQYPLNVAFDSPDPSDPCAEENVWKL-NY-----QAMIVTGGVIDKED--DIGNWFRI  443
            I +   LN+ F  P   + C E  VW++ NY      + +  GGV+       +G+WF+I
Sbjct  102  ISTD--LNIEFAYP---ETCGESPVWRVDNYLDPSADSFVSIGGVVGNPGPATLGSWFKI  156

Query  442  QKNINGRGYLFTWWPSLCLGCRI  374
            QK   G  Y   + P++C  C +
Sbjct  157  QK--FGYDYKLVYCPTVCSYCDV  177



>ref|XP_010428253.1| PREDICTED: bark lectin isoform 2 isoform X2 [Camelina sativa]
Length=223

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 83/175 (47%), Gaps = 15/175 (9%)
 Frame = -2

Query  907  AISFLPLAISGLPPLIRLPT-KADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVAN  731
            ++SF+ L +  +  L   P   A  +  +LD AG+PV +  +YY IPA IG  GG+  ++
Sbjct  5    SLSFITLTVLSVVILTAAPAADAVSSQVVLDIAGHPVQSNDQYYIIPAKIGTGGGLIPSS  64

Query  730  SDTGNPSTCPTDVVINITLAGMQPPAVR-RPLSFYPLKREGGDAVIISQYPLNVAFDSPD  554
             D      C     +N+ +     P V   P++F PL  +    ++     LN+ FDS  
Sbjct  65   RDLNTQDLC-----LNLDIVQSSSPFVSGLPVTFSPLDTKT--KLVQLSTSLNLEFDS--  115

Query  553  PSDPCAEENVWKLNYQAMIVTGGV-IDKEDDIGN-WFRIQKNINGRGYLFTWWPS  395
                C E  +W++++   +    V I  E   GN WF+IQ+  +G  Y   + PS
Sbjct  116  TVWLCPESKIWRIDHSVQLRKSFVSIGGEKGKGNSWFQIQE--DGDAYKLMYCPS  168



>ref|XP_010428252.1| PREDICTED: bark lectin isoform 2 isoform X1 [Camelina sativa]
Length=231

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 61/213 (29%), Positives = 100/213 (47%), Gaps = 19/213 (9%)
 Frame = -2

Query  907  AISFLPLAISGLPPLIRLPT-KADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVAN  731
            ++SF+ L +  +  L   P   A  +  +LD AG+PV +  +YY IPA IG  GG+  ++
Sbjct  5    SLSFITLTVLSVVILTAAPAADAVSSQVVLDIAGHPVQSNDQYYIIPAKIGTGGGLIPSS  64

Query  730  SDTGNPSTCPTDVVINITLAGMQPPAVR-RPLSFYPLKREGGDAVIISQYPLNVAFDSPD  554
             D      C     +N+ +     P V   P++F PL  +    ++     LN+ FDS  
Sbjct  65   RDLNTQDLC-----LNLDIVQSSSPFVSGLPVTFSPLDTKT--KLVQLSTSLNLEFDS--  115

Query  553  PSDPCAEENVWKLNYQAMIVTGGV-IDKEDDIGN-WFRIQKNINGRGYLFTWWP-SLCLG  383
                C E  +W++++   +    V I  E   GN WF+IQ+  +G  Y   + P S  + 
Sbjct  116  TVWLCPESKIWRIDHSVQLRKSFVSIGGEKGKGNSWFQIQE--DGDAYKLMYCPSSSTVA  173

Query  382  CRIGYFRIGRVGNGYQLGINYNDESLYAFEFLK  284
            C      I  +G   +L ++ ND+S +  EF K
Sbjct  174  CINVSLEIDDLG-ARRLVLS-NDQS-FTVEFQK  203



>ref|XP_004241479.1| PREDICTED: miraculin-like [Solanum lycopersicum]
Length=200

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 74/159 (47%), Gaps = 21/159 (13%)
 Frame = -2

Query  826  ILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVR  647
            +LD  G+ V AG  Y+ +P + G  GG  ++  +  N +TCP D++             +
Sbjct  23   VLDVNGDEVQAGPNYFILPVIRGRGGG-GLSPFNVKNNNTCPRDII-------QWDDEEQ  74

Query  646  RPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN------YQAMIVTGG  485
              L     + +   +V+     +NV F +P     CA E +WKL        +  +VTGG
Sbjct  75   EGLPVVFTRIDAKKSVVRVSTDVNVRFYTP---TICARETIWKLGDYDDKLKKYFVVTGG  131

Query  484  VIDKE--DDIGNWFRIQKNINGRGYLFTWWPSLCLGCRI  374
            V        +GNWF+I++   G GY   + PS+C  C++
Sbjct  132  VEGNPGLKTVGNWFKIER--FGSGYKLVYCPSVCKFCKV  168



>ref|XP_002888923.1| trypsin and protease inhibitor family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH65182.1| trypsin and protease inhibitor family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=222

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 82/178 (46%), Gaps = 22/178 (12%)
 Frame = -2

Query  910  IAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVAN  731
            + +SF+ L +            A  +  +LD AG+PV +  +YY IPA IG  GG+  +N
Sbjct  4    LTLSFITLTVLSALLTAASAADAVPSQVVLDTAGHPVQSNVQYYIIPAKIGTGGGLIPSN  63

Query  730  SDTGNPSTCPTDVVINITLAGMQPPAVR-RPLSFYPLKREGGDAVIISQYPLNVAFDSPD  554
             +      C     +N+ +     P V   P++F PL  +     + +   LN+ FDS  
Sbjct  64   RNLNTQDLC-----LNLDIVQSSSPFVSGLPVTFSPLNTKTKHVQLSTS--LNLEFDS--  114

Query  553  PSDPCAEENVWKLNY-----QAMIVTGGVIDKEDDIGN-WFRIQKNINGRGYLFTWWP  398
                C E  VW++++     ++ + TGG    E   GN WF+IQ+  +G  Y   + P
Sbjct  115  TVWLCPESKVWRIDHSLQLRKSFVSTGG----EKGKGNSWFQIQE--DGDAYKLMYCP  166



>ref|XP_003548289.1| PREDICTED: miraculin-like [Glycine max]
Length=201

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 54/175 (31%), Positives = 78/175 (45%), Gaps = 26/175 (15%)
 Frame = -2

Query  838  GTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQP  659
             +  +LDA G  V A + YY +PA   + GG++ A +D      CP DVV      G+  
Sbjct  23   ASEPVLDALGKKVRADSIYYIVPASSDI-GGLASARTDVD----CPLDVVAVDGDLGL--  75

Query  658  PAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY------QAMI  497
                 PLSF P+  + G  +I     LN+ F S   +  C +  VWKL Y      Q  +
Sbjct  76   -----PLSFTPVNDKKG--IIRVSSDLNIYFTS--YTIFCPQTTVWKLKYYDDSTSQWFV  126

Query  496  VTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRIGYFRIGRVGNGY  338
             TGG +       + NWF+I+K  +   Y   + PS+C  C      IG   + Y
Sbjct  127  TTGGELGHPSSQTVANWFKIEKYED--AYKLVYCPSVCSDCNHQCSDIGIYQDQY  179



>gb|AFL91227.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 50/157 (32%), Positives = 75/157 (48%), Gaps = 20/157 (13%)
 Frame = -2

Query  832  NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPA  653
            +A+ D  GN V +G +YY +P   G  GG+++A +      +CP DVV      G +   
Sbjct  2    DAVRDXDGNLVXSGTEYYILPVFRGRGGGVTLAPTRN---ESCPLDVV----QEGFELDD  54

Query  652  VRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKL-NYQAMIVTGGVID  476
               PL+F P+  + G  VI     LN+ F +   S  C + NVW L  Y+   +  G   
Sbjct  55   -GLPLTFTPVDPKKG--VIRESTDLNIIFSA---SSICIQSNVWMLEEYEGQRIISGRGT  108

Query  475  K----EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCR  377
                  + I NWF+I+K  N  GY   + P++C  CR
Sbjct  109  AGNPGGETISNWFKIEKYEN--GYKLVYCPTVCDLCR  143



>emb|CDP21544.1| unnamed protein product [Coffea canephora]
Length=207

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 64/203 (32%), Positives = 92/203 (45%), Gaps = 38/203 (19%)
 Frame = -2

Query  946  MKTAIILLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPA  767
            MK +++ L      ISFLP  IS +         A     +LD AGN +     YY +PA
Sbjct  1    MKISLLFL------ISFLPFFISTVSSF----ASAAEPEPVLDVAGNVLRTDLYYYILPA  50

Query  766  -VIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVRR---PLSFYPLKREGGDAV  599
             V G   G  +  S  GN  TCP  V         Q  + +R   PL+F PLK +  D V
Sbjct  51   NVRGRFRGGGLTLSSIGN-DTCPVGV--------FQELSEQRNGIPLTFSPLKPK--DGV  99

Query  598  IISQYPLNVAFDSPDPSDPCAEENVWKL-NY-----QAMIVTGGVIDKED--DIGNWFRI  443
            +     LN+ F  P   + C E  VW++ NY      +++  GGV+       +G+WF+I
Sbjct  100  VRISTDLNIQFAYP---ETCGESPVWRVDNYLDPSADSIVSIGGVVGNPGPATLGSWFKI  156

Query  442  QKNINGRGYLFTWWPSLCLGCRI  374
            QK   G  Y   + P++C  C +
Sbjct  157  QK--LGYDYKLVYCPAVCSYCDV  177



>gb|AFL91233.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 50/157 (32%), Positives = 75/157 (48%), Gaps = 20/157 (13%)
 Frame = -2

Query  832  NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPA  653
            +A+ D  GN V +G +YY +P   G  GG+++A +      +CP DVV      G +   
Sbjct  2    DAVRDIDGNLVXSGTEYYILPVFRGXGGGVTLAPTRN---ESCPLDVV----QEGFELDD  54

Query  652  VRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKL-NYQAMIVTGGVID  476
               PL+F P+  + G  VI     LN+ F +   S  C + NVW L  Y+   +  G   
Sbjct  55   -GLPLTFTPVDPKKG--VIRESTDLNIIFSA---SSICIQSNVWMLEEYEGQRIISGRGT  108

Query  475  K----EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCR  377
                  + I NWF+I+K  N  GY   + P++C  CR
Sbjct  109  AGNPGGETISNWFKIEKYEN--GYKLVYCPTVCDLCR  143



>gb|AFK33359.1| unknown [Medicago truncatula]
Length=202

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 60/196 (31%), Positives = 92/196 (47%), Gaps = 38/196 (19%)
 Frame = -2

Query  946  MKTAIILLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPA  767
            MKT+   L FS I ++F+    +   P             +LD +G  V  G KYY +P 
Sbjct  1    MKTS--FLAFSIIFLAFICKTFAAPEP-------------VLDISGKKVTTGVKYYILPV  45

Query  766  VIGVDGGISVA--NSDTGNPSTCPTDVVINITLAGMQPPAVR--RPLSFYPLKREGGDAV  599
            + G  GG++V   N+  GN +TCP  V+        +   V+  + ++F P   + G  V
Sbjct  46   IRGKGGGLTVVNENNLNGNNNTCPLYVL-------QEKLEVKNGQAVTFTPYNAKKG--V  96

Query  598  IISQYPLNVAFDSPDPSDPCAEENVWKLNYQA----MIVTGGVIDKE--DDIGNWFRIQK  437
            I++   LN+   S      CA+  VWKLN        + TG V      D I NWF+I+K
Sbjct  97   ILTSTDLNI--KSYVTKTTCAQSQVWKLNKVLSGVWFLATGSVEGNPGFDTIFNWFKIEK  154

Query  436  NINGRGYLFTWWPSLC  389
                + Y+F++ PS+C
Sbjct  155  --ADKDYVFSFCPSVC  168



>ref|NP_001237333.1| uncharacterized protein LOC100500648 precursor [Glycine max]
 gb|ACU15788.1| unknown [Glycine max]
Length=213

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 51/167 (31%), Positives = 72/167 (43%), Gaps = 33/167 (20%)
 Frame = -2

Query  826  ILDAAGNPVIAGAKYYAIPAV---------IGVDGGISVANSDTGNPSTCPTDVVINITL  674
            ++D +G  + A A Y+ IPAV             GG+S+ + D     +CP DV+I    
Sbjct  31   VIDTSGKKLRADANYHIIPAVPFTICGFVSCFTGGGLSLDSID----ESCPLDVIIEKAN  86

Query  673  AGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY-----  509
             G+       PL F P+  + G  VI     LN+ F   D   P     VW L+      
Sbjct  87   EGL-------PLRFSPVNTKKG--VIRVSTDLNIFFSDSDERCP-HHSTVWMLDQFDASI  136

Query  508  -QAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCR  377
             Q  + TGGV+    E  I NWF+IQK  +   Y   + P +C  C 
Sbjct  137  GQTYVTTGGVVGNPGEHTILNWFKIQKYED--AYKLVYCPRVCPSCH  181



>ref|XP_010537532.1| PREDICTED: miraculin [Tarenaya hassleriana]
Length=202

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 75/163 (46%), Gaps = 24/163 (15%)
 Frame = -2

Query  838  GTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQP  659
             +  + D  G PV AG  YY +P V G  GG+++A++  GN  TCP  VV +        
Sbjct  26   ASEPVRDIRGKPVRAGLDYYILPVVRGRGGGLTMASA--GN-KTCPMSVVQDKFEVS---  79

Query  658  PAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN------YQAMI  497
            P    PL+F P  +     +   Q   NV F +   +  C +  VWKL        Q  +
Sbjct  80   PGF--PLTFSPSDKSRIVGISTDQ---NVKFSA---ATICVQSTVWKLESFDETTKQWFV  131

Query  496  VTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRI  374
             TGGV      + I NWF+I+K   G  Y   + P++C  C++
Sbjct  132  TTGGVEGNPGRETISNWFKIEK--LGNDYKLVFCPTVCNFCKV  172



>gb|AFL91231.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 75/157 (48%), Gaps = 20/157 (13%)
 Frame = -2

Query  832  NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPA  653
            +A+ D  GN V +G +YY +P   G  GG+++A +      +CP DVV      G +   
Sbjct  2    DAVRDIDGNLVRSGTEYYILPVFRGRGGGVTLAPTRN---ESCPLDVV----QEGFELDD  54

Query  652  VRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY---QAMIVTGGV  482
               PL+F P+  + G  VI     LN+ F +   S  C + NVW L     Q +I   G 
Sbjct  55   -GLPLTFTPVDPKKG--VIRESTDLNIIFSA---SSICIQSNVWMLEEYEGQRIISGRGT  108

Query  481  IDKE--DDIGNWFRIQKNINGRGYLFTWWPSLCLGCR  377
                  + I NWF+I+K  N  GY   + P++C  CR
Sbjct  109  AGNPGGETISNWFKIEKYEN--GYKLVYCPTVCDLCR  143



>ref|XP_011092684.1| PREDICTED: miraculin-like [Sesamum indicum]
Length=214

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 82/170 (48%), Gaps = 25/170 (15%)
 Frame = -2

Query  832  NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVI--NITLAGMQP  659
             ++LD  GN +    KYY +P   G  GG +++  D  +P  CP +VV   +   AG+  
Sbjct  34   TSVLDLDGNLLQINTKYYILPLDGGGGGGFALSVRDPRDP--CPPNVVQENDEGSAGLS-  90

Query  658  PAVRRPLSFYPLKREGGDAVIIS-QYPLNVAFDSPDPSDPCAEENVWKLNY------QAM  500
                  L F+PL RE   A  +S    +N+AF +   +  C +  VW+         +  
Sbjct  91   ------LKFFPLDREQQQATSVSLSSDMNIAFMA---ATTCVQRTVWRTGVADGTTGRRY  141

Query  499  IVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRIGYFRIG  356
            + TGGV+ +   + +G WF+I K   G+GY   + PS+C  CR+    +G
Sbjct  142  VRTGGVLGRPGAETVGEWFKIDK--YGKGYKIGYCPSVCSACRVECGEMG  189



>ref|XP_010683193.1| PREDICTED: miraculin-like [Beta vulgaris subsp. vulgaris]
Length=206

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 79/171 (46%), Gaps = 25/171 (15%)
 Frame = -2

Query  856  LPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINIT  677
            L + AD T A+LD  G P+ AG  YY +P + G  GG+++A+ +      CP  V     
Sbjct  20   LTSTADNT-AVLDINGRPLQAGYNYYILPVIRGRGGGLTMASKNA--TELCPLYV-----  71

Query  676  LAGMQPPAVRR--PLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNYQA  503
                +   V    PL FYP+  +  D  I     LN  FD+   +  C +   W L  + 
Sbjct  72   --AQEDHEVSNGLPLKFYPVNPK--DKRISLSSDLNFVFDA---ATTCVQSTGWSLTIEM  124

Query  502  -----MIVTGGVIDKE--DDIGNWFRIQKNINGR-GYLFTWWPSLCLGCRI  374
                  + TGG I     + + NWF+I+K+ +G+  Y   + P +C  C++
Sbjct  125  ETGRRYVGTGGEIGNPGVETVDNWFKIEKDGSGKYDYKIVYCPGVCNFCKV  175



>ref|NP_565062.1| Kunitz family trypsin and protease inhibitor protein [Arabidopsis 
thaliana]
 gb|AAG30988.1|AC012396_24 tumor-related protein, putative [Arabidopsis thaliana]
 gb|AEE35443.1| Kunitz family trypsin and protease inhibitor protein [Arabidopsis 
thaliana]
Length=222

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 83/176 (47%), Gaps = 18/176 (10%)
 Frame = -2

Query  910  IAISFLPLAISGLPPLIRLPTKADGT--NAILDAAGNPVIAGAKYYAIPAVIGVDGGISV  737
            + +SF+ L +  L  +    + AD T    +LD AG+PV +  +YY IPA IG  GG+  
Sbjct  4    LTLSFITLTV--LSAIFTAASAADATPSQVVLDIAGHPVQSNVQYYIIPAKIGTGGGLIP  61

Query  736  ANSDTGNPSTCPTDVVINITLAGMQPPAVR-RPLSFYPLKREGGDAVIISQYPLNVAFDS  560
            +N +      C     +N+ +     P V   P++F PL  +     + +   LN+ FDS
Sbjct  62   SNRNLSTQDLC-----LNLDIVQSSSPFVSGLPVTFSPLNTKVKHVQLSA--SLNLEFDS  114

Query  559  PDPSDPCAEENVWKLNYQAMIVTGGV-IDKEDDIGN-WFRIQKNINGRGYLFTWWP  398
                  C +  VW++++   +    V I  +   GN WF+IQ+  +G  Y   + P
Sbjct  115  TVW--LCPDSKVWRIDHSVQLRKSFVSIGGQKGKGNSWFQIQE--DGDAYKLMYCP  166



>gb|AFL91226.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 75/157 (48%), Gaps = 20/157 (13%)
 Frame = -2

Query  832  NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPA  653
            +A+ D  GN + +G +YY +P   G  GG+++A +      +CP DVV      G +   
Sbjct  2    DAVRDIDGNLLRSGTEYYILPVFRGRGGGVTLAPTRN---ESCPLDVV----QEGFELDN  54

Query  652  VRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKL-NYQAMIVTGGVID  476
               PL+F P+  + G  VI     LN+ F +   S  C + NVW L  Y+   +  G   
Sbjct  55   -GLPLTFTPVDPKKG--VIRESTDLNIIFSA---SSICIQSNVWMLEEYEGQRIISGRGT  108

Query  475  K----EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCR  377
                  + I NWF+I+K  N  GY   + P++C  CR
Sbjct  109  SGNPGGETISNWFKIEKYEN--GYKLVYCPTVCDLCR  143



>gb|AFL91228.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 74/157 (47%), Gaps = 20/157 (13%)
 Frame = -2

Query  832  NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPA  653
            +A+ D  GN V  G +YY +P   G  GG+++A +      +CP DVV      G +   
Sbjct  2    DAVRDIDGNLVXXGXEYYILPXFRGRGGGVTLAPTRN---ESCPLDVV----QEGFELDD  54

Query  652  VRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY---QAMIVTGGV  482
               PL+F P+  + G  VI     LN+ F +   S  C + NVW L     Q +I   G 
Sbjct  55   -GLPLTFTPVDPKKG--VIRESTDLNIIFSA---SSICIQSNVWMLEEYEGQRIISGRGT  108

Query  481  IDKE--DDIGNWFRIQKNINGRGYLFTWWPSLCLGCR  377
                  + I NWF+I+K  N  GY   + P++C  CR
Sbjct  109  AGNPGGETISNWFKIEKYEN--GYKLVYCPTVCDLCR  143



>ref|XP_002266302.2| PREDICTED: miraculin-like, partial [Vitis vinifera]
Length=162

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 77/161 (48%), Gaps = 23/161 (14%)
 Frame = -2

Query  793  GAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKRE  614
            G  YY +P   G  GG+++A+  TGN  TCP DVV        Q  +   PL+F P+  +
Sbjct  1    GVDYYILPVFRGRGGGLTLAS--TGN-ETCPLDVV-----QEQQEVSNGLPLTFTPVNPK  52

Query  613  GGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY-----QAMIVTGGVIDK--EDDIGN  455
             G  VI      N+ F +   S  C +  +WKL Y     Q  + TGGV      + + N
Sbjct  53   KG--VIRVSTDHNIKFSA---STICVQSTLWKLEYDESSGQRFVTTGGVEGNPGRETLDN  107

Query  454  WFRIQKNINGRGYLFTWWPSLCLGCRIGYFRIG-RVGNGYQ  335
            WF+I+K  +   Y   + P++C  C+     IG  + NGY+
Sbjct  108  WFKIEKYED--DYKLVFCPTVCDFCKPVCGDIGIYIQNGYR  146



>ref|XP_010416131.1| PREDICTED: bark lectin isoform 2-like isoform X2 [Camelina sativa]
Length=223

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 86/187 (46%), Gaps = 34/187 (18%)
 Frame = -2

Query  934  IILLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGV  755
            I+L V S + ++  P A             A  +  +LD AG+PV +  +YY IPA IG 
Sbjct  9    IVLTVLSAVILTTAPAA------------DAVSSQVVLDIAGHPVQSNDQYYIIPAKIGT  56

Query  754  DGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVR-RPLSFYPLKREGGDAVIISQYPL  578
             GG+  ++ D      C     +N+ +     P V   P++F PL  +    ++     L
Sbjct  57   GGGLIPSSRDLNTQDLC-----LNLDIVQSSSPFVSGLPVTFSPLNTKT--KLVQLSTSL  109

Query  577  NVAFDSPDPSDPCAEENVWKLNY-----QAMIVTGGVIDKEDDIGN-WFRIQKNINGRGY  416
            N+ FDS      C E  +W++++     ++ + TGG    E   GN WF+I++  +G  Y
Sbjct  110  NLEFDS--TVWLCPESKIWRIDHSVQLRKSFVSTGG----EKGKGNSWFQIKE--DGDAY  161

Query  415  LFTWWPS  395
               + PS
Sbjct  162  KLMYCPS  168



>gb|KHM99732.1| Miraculin [Glycine soja]
Length=207

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 51/165 (31%), Positives = 70/165 (42%), Gaps = 33/165 (20%)
 Frame = -2

Query  820  DAAGNPVIAGAKYYAIPAV---------IGVDGGISVANSDTGNPSTCPTDVVINITLAG  668
            D +G  + A A Y+ IPAV             GG+S+ + D     +CP DV+I     G
Sbjct  27   DTSGKKLRADANYHIIPAVPFTICGFVSCFTGGGLSLDSID----ESCPLDVIIEKANEG  82

Query  667  MQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY------Q  506
            +       PL F P+  + G  VI     LN+ F   D   P     VW L+       Q
Sbjct  83   L-------PLRFSPVNTKKG--VIRVSTDLNIFFSDSDERCP-HHSTVWMLDQFDASIGQ  132

Query  505  AMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCR  377
              + TGGV+    E  I NWF+IQK  +   Y   + P +C  C 
Sbjct  133  TYVTTGGVVGNPGEHTILNWFKIQKYED--AYKLVYCPRVCPSCH  175



>emb|CDP22082.1| unnamed protein product [Coffea canephora]
Length=207

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 62/203 (31%), Positives = 90/203 (44%), Gaps = 38/203 (19%)
 Frame = -2

Query  946  MKTAIILLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPA  767
            MK +++ L      ISFLP  IS +         A     +LD AGN +     YY +PA
Sbjct  1    MKISLLFL------ISFLPFFISTVSSF----ASAAEPEPVLDVAGNVLRTDLYYYILPA  50

Query  766  -VIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVRR---PLSFYPLKREGGDAV  599
             V G   G  +  S  GN  TCP  V         Q  + +R   P++F P+K   G   
Sbjct  51   NVRGRFRGGGLTLSSIGN-DTCPVGV--------FQELSAQRNGIPVTFSPVKPRNGVVR  101

Query  598  IISQYPLNVAFDSPDPSDPCAEENVWKL-NY-----QAMIVTGGVIDKED--DIGNWFRI  443
            I +   LN+ F  P   + C E  VW++ NY      + +  GGV+       +G+WF+I
Sbjct  102  ISTD--LNIEFAYP---ETCGESPVWRVDNYVDPSADSFVSIGGVVGNPGPATLGSWFKI  156

Query  442  QKNINGRGYLFTWWPSLCLGCRI  374
            QK   G  Y   + P++C  C +
Sbjct  157  QK--FGYDYKLVYCPTVCSYCDV  177



>ref|XP_010471390.1| PREDICTED: bark lectin isoform 2-like [Camelina sativa]
Length=223

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 101/223 (45%), Gaps = 30/223 (13%)
 Frame = -2

Query  940  TAIILLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVI  761
            + I L V S + ++  P A             A  +  +LD +G+PV +  +YY IPA I
Sbjct  7    SVITLTVLSAVILTTAPAA------------DAVSSQVVLDISGHPVQSNDQYYIIPAKI  54

Query  760  GVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVR-RPLSFYPLKREGGDAVIISQY  584
            G  GG+  ++ D      C     +N+ +     P V   P++F PL  +    ++    
Sbjct  55   GTGGGLIPSSRDLNTQDLC-----LNLDIVQSSSPFVSGLPVTFSPL--DTKTKLVQLST  107

Query  583  PLNVAFDSPDPSDPCAEENVWKLNYQAMIVTGGV-IDKEDDIGN-WFRIQKNINGRGYLF  410
             LN+ FDS      C E  +W++++   +    V I  E   GN WF+IQ+  +G  Y  
Sbjct  108  SLNLEFDS--TVWLCPESKIWRIDHSVQLRKSFVSIGGEKSKGNSWFQIQE--DGDAYKL  163

Query  409  TWWPSLCL-GCRIGYFRIGRVGNGYQLGINYNDESLYAFEFLK  284
             + PS  +  C      I  +G   +L ++ ND+S +A +F K
Sbjct  164  MYCPSSSIVACINVSLEIDDLG-ARRLVLS-NDQS-FAVKFQK  203



>gb|AAQ96377.1| miraculin-like protein [Solanum palustre]
Length=209

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 81/189 (43%), Gaps = 22/189 (12%)
 Frame = -2

Query  898  FLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTG  719
            FLP  I  +     L + A+    ++D  G  +  G  YY +P V G  GG+++   D+ 
Sbjct  11   FLPFLILVISSNSFLSSAAESPPEVVDIDGKILRTGVDYYILPVVRGRGGGLTM---DSI  67

Query  718  NPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPC  539
                CP D V+       Q      PL+F P+  + G  VI     LN+ F +   +  C
Sbjct  68   GDKICPLDAVVQ----EHQEIDQGLPLTFTPVNPKKG--VIRESTDLNIIFSA---NSIC  118

Query  538  AEENVWKLNY------QAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLG  383
             +   WKL+       Q  I  GG       + I NWF+I+K    R Y   + P++C  
Sbjct  119  VQTTQWKLDDFDETTGQYFITLGGNQGNPGRETISNWFKIEK--FDRDYKLLYCPTVCDF  176

Query  382  CRIGYFRIG  356
            C++    IG
Sbjct  177  CKVICKEIG  185



>ref|XP_010416130.1| PREDICTED: bark lectin isoform 2-like isoform X1 [Camelina sativa]
Length=231

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 86/187 (46%), Gaps = 34/187 (18%)
 Frame = -2

Query  934  IILLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGV  755
            I+L V S + ++  P A             A  +  +LD AG+PV +  +YY IPA IG 
Sbjct  9    IVLTVLSAVILTTAPAA------------DAVSSQVVLDIAGHPVQSNDQYYIIPAKIGT  56

Query  754  DGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVR-RPLSFYPLKREGGDAVIISQYPL  578
             GG+  ++ D      C     +N+ +     P V   P++F PL  +    ++     L
Sbjct  57   GGGLIPSSRDLNTQDLC-----LNLDIVQSSSPFVSGLPVTFSPLNTKT--KLVQLSTSL  109

Query  577  NVAFDSPDPSDPCAEENVWKLNY-----QAMIVTGGVIDKEDDIGN-WFRIQKNINGRGY  416
            N+ FDS      C E  +W++++     ++ + TGG    E   GN WF+I++  +G  Y
Sbjct  110  NLEFDS--TVWLCPESKIWRIDHSVQLRKSFVSTGG----EKGKGNSWFQIKE--DGDAY  161

Query  415  LFTWWPS  395
               + PS
Sbjct  162  KLMYCPS  168



>ref|XP_010101167.1| hypothetical protein L484_005403 [Morus notabilis]
 gb|EXB87528.1| hypothetical protein L484_005403 [Morus notabilis]
Length=197

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 75/161 (47%), Gaps = 23/161 (14%)
 Frame = -2

Query  832  NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPA  653
            +A+LD +G  +  G  YY +P + G  GG+ +AN+      T P DVV +         +
Sbjct  22   SAVLDLSGKKLQKGVDYYILPVIRGRGGGLKLANARN---KTSPLDVVQD-----QFEVS  73

Query  652  VRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY------QAMIVT  491
               PL+F P  +    + +     LN+ F +   +  CA+  VWKL+       Q  + +
Sbjct  74   SGFPLTFSPANQN--QSFVCLSTDLNIKFSA---ATTCAQSTVWKLDSFDESLGQWFVTS  128

Query  490  GGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRI  374
            GGV        I NWF+I+K  +   Y   + P++C  C++
Sbjct  129  GGVEGNPGRQTISNWFKIEKYND--DYKLVFCPTVCNFCKV  167



>gb|AEK26927.1| Kunitz-type trypsin inhibitor B4 [Populus nigra]
Length=211

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 84/185 (45%), Gaps = 30/185 (16%)
 Frame = -2

Query  910  IAISFLPLAISGLPPLIRLPTKADGT--NAILDAAGNPVIAGAKYYAI-PAVIGVDGGIS  740
            + +SFL  A++  P    LP  A G     +LD AG  +  G  YY I P   G  GGI+
Sbjct  9    LVLSFLLFALAAKP----LPRVAAGAAPEPVLDIAGKVLRTGTNYYDILPVERGRGGGIT  64

Query  739  VANSDTGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDS  560
             A   TG+ S CP DV++          +   PL F P  R+ G  VI     LN+ F  
Sbjct  65   FAI--TGHKS-CPVDVMLED-----YEDSDGLPLQFIPANRKKG--VIRLSTDLNIKF--  112

Query  559  PDPSDPCAEENVW------KLNYQAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTW  404
            P P+  CA   VW      KL  Q  I T GV      + + NWF+I+K   G  Y   +
Sbjct  113  PGPAS-CAATAVWKVEKYDKLTSQMFISTSGVEGNPGPETVDNWFKIEK--YGNDYKLVF  169

Query  403  WPSLC  389
             P++C
Sbjct  170  CPTVC  174



>ref|XP_002305034.2| hypothetical protein POPTR_0004s06610g [Populus trichocarpa]
 gb|EEE85545.2| hypothetical protein POPTR_0004s06610g [Populus trichocarpa]
Length=207

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 83/184 (45%), Gaps = 29/184 (16%)
 Frame = -2

Query  910  IAISFLPLAISGLPPLIRLPTKADGT--NAILDAAGNPVIAGAKYYAIPAVIGVDGGISV  737
            + +SFL  A++  P    LP  A G     +LD AG  +  G  Y  +P   G  GGI+ 
Sbjct  6    LVLSFLLFALAAKP----LPRVAAGAAPEPVLDIAGKVLRTGTYYDILPVERGRGGGITF  61

Query  736  ANSDTGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSP  557
            A   TG+ S CP DV++          +   PL F P  R+ G  VI     LN+ F  P
Sbjct  62   AC--TGHKS-CPVDVMLE-----DYEDSDGLPLQFIPANRKKG--VIRLSTDLNIKF--P  109

Query  556  DPSDPCAEENVWK------LNYQAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWW  401
             P+  CA   VWK      L  Q  I T GV      + + NWF+I+K   G  Y   + 
Sbjct  110  GPAS-CAATAVWKVEKYDELTSQMFISTSGVEGNPGPETVDNWFKIEK--YGNDYKLVFC  166

Query  400  PSLC  389
            P++C
Sbjct  167  PTVC  170



>gb|ADW95380.1| Kunitz-type trypsin inhibitor [Populus nigra]
Length=210

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 83/184 (45%), Gaps = 29/184 (16%)
 Frame = -2

Query  910  IAISFLPLAISGLPPLIRLPTKADGT--NAILDAAGNPVIAGAKYYAIPAVIGVDGGISV  737
            + +SFL  A++  P    LP  A G     +LD AG  +  G  Y  +P   G  GGI+ 
Sbjct  9    LVLSFLLFALAAKP----LPRVAAGAAPEPVLDIAGKVLRTGTYYDILPVERGRGGGITF  64

Query  736  ANSDTGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSP  557
            A   TG+ S CP DV++          +   PL F P  R+ G  VI     LN+ F  P
Sbjct  65   AC--TGHKS-CPVDVMLED-----YEDSDGLPLQFIPANRKKG--VIRLSTDLNIKF--P  112

Query  556  DPSDPCAEENVWK------LNYQAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWW  401
             P+  CA   VWK      L  Q  I T GV      + + NWF+I+K   G  Y   + 
Sbjct  113  GPAS-CAATAVWKVEKYDELTSQMFISTSGVEGNPGPETVDNWFKIEK--YGNDYKLVFC  169

Query  400  PSLC  389
            P++C
Sbjct  170  PTVC  173



>ref|XP_004137534.1| PREDICTED: miraculin-like [Cucumis sativus]
 ref|XP_004165460.1| PREDICTED: miraculin-like [Cucumis sativus]
 gb|KGN64217.1| Tumor-related protein [Cucumis sativus]
Length=206

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 89/194 (46%), Gaps = 24/194 (12%)
 Frame = -2

Query  913  GIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVA  734
            GI   FL + ++    LIR  T      A+LD  G  + AG  YY +P   G  GG+++ 
Sbjct  5    GILFYFLFILLAS-TQLIRFSTADASPEAVLDIDGKKLRAGVNYYILPVFRGRGGGLTLG  63

Query  733  NSDTGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPD  554
            N  +     CP +VV    L  M       P +F+P+  + G  V+     LNV F++  
Sbjct  64   NLQS---EKCPLNVVQE-QLEVMNG----FPTTFHPVNPKKG--VVRVSTDLNVQFEA--  111

Query  553  PSDPCAEENVWKLNY------QAMIVTGGVIDKE--DDIGNWFRIQKNINGRGYLFTWWP  398
             S  C    VWKL+       Q ++  GG       + + NWF+I+K  +G+ Y   + P
Sbjct  112  -STICVTSTVWKLDKFDESTGQWLVTIGGSRGNPGVETVDNWFKIEK--HGKDYKLVFCP  168

Query  397  SLCLGCRIGYFRIG  356
            ++C  C++    IG
Sbjct  169  TVCNFCKVMCRDIG  182



>gb|AFL91232.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=172

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 72/155 (46%), Gaps = 20/155 (13%)
 Frame = -2

Query  826  ILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVR  647
            + D  GN V  G +YY +P   G  GG+++A +      +CP DVV      G +     
Sbjct  1    VRDIDGNLVXXGXEYYILPVFRGRGGGVTLAPTRN---ESCPLDVV----QEGFELDD-G  52

Query  646  RPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKL-NYQAMIVTGGVIDK-  473
             PL+F P+  + G  VI     LN+ F +   S  C + NVW L  Y+   +  G     
Sbjct  53   LPLTFTPVDPKKG--VIRESTDLNIIFSA---SSICIQSNVWMLEEYEGQRIISGRGTAG  107

Query  472  ---EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCR  377
                + I NWF+I+K  N  GY   + P++C  CR
Sbjct  108  NPGGETISNWFKIEKYEN--GYKLVYCPTVCDLCR  140



>emb|CDO98557.1| unnamed protein product [Coffea canephora]
Length=207

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 91/203 (45%), Gaps = 38/203 (19%)
 Frame = -2

Query  946  MKTAIILLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPA  767
            MK +++ +      ISFL   IS +       + A     +LD  GN +     YY +PA
Sbjct  1    MKISLLFM------ISFLLFFISTVSSF----SSAAEPEPVLDIDGNVLRTNHYYYILPA  50

Query  766  -VIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVRR---PLSFYPLKREGGDAV  599
             V G   G  +A S  GN  TCP  V         Q  + +R   PL+F P+K   G  V
Sbjct  51   KVRGRFRGGGLALSSIGN-DTCPVGV--------FQELSEQRNGIPLTFSPVKPRHG--V  99

Query  598  IISQYPLNVAFDSPDPSDPCAEENVWKL-NY-----QAMIVTGGVIDKED--DIGNWFRI  443
            + +   LN+ F  P+    C E  VW++ NY      + +  GGV+       +G+WF+I
Sbjct  100  VRTSTDLNIQFAYPET---CGESPVWRVDNYLDPLVDSFVSIGGVVGNPGPATLGSWFKI  156

Query  442  QKNINGRGYLFTWWPSLCLGCRI  374
            QK   G  Y   + P++C  C +
Sbjct  157  QK--FGYDYKLVYCPTVCSNCDV  177



>emb|CDP21540.1| unnamed protein product [Coffea canephora]
Length=207

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 89/203 (44%), Gaps = 38/203 (19%)
 Frame = -2

Query  946  MKTAIILLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPA  767
            MK +++ L      ISFLP   S +         A     +LD AGN +     YY +PA
Sbjct  1    MKISLLFL------ISFLPFFFSTVSSF----ASAAEPEPVLDVAGNVLRTDLYYYILPA  50

Query  766  -VIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVRR---PLSFYPLKREGGDAV  599
             V G   G  +  S  GN  TCP  V         Q  + +R   P++F P+K   G   
Sbjct  51   NVRGRFRGGGLTLSSIGN-DTCPVGV--------FQELSAQRNGIPVTFSPVKPRNGVVR  101

Query  598  IISQYPLNVAFDSPDPSDPCAEENVWKL-NY-----QAMIVTGGVIDKED--DIGNWFRI  443
            I +   LN+ F  P   + C E  VW++ NY      + +  GGV+       +G+WF+I
Sbjct  102  ISTD--LNIEFAYP---ETCGESPVWRVDNYVDPSADSFVSIGGVVGNPGPATLGSWFKI  156

Query  442  QKNINGRGYLFTWWPSLCLGCRI  374
            QK   G  Y   + P++C  C +
Sbjct  157  QK--FGYDYKLVYCPTVCSYCDV  177



>ref|XP_007210537.1| hypothetical protein PRUPE_ppa011653mg [Prunus persica]
 gb|EMJ11736.1| hypothetical protein PRUPE_ppa011653mg [Prunus persica]
Length=202

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 74/160 (46%), Gaps = 22/160 (14%)
 Frame = -2

Query  826  ILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVR  647
            +LD  G  +  G  YY +P + G  GG+++A+  T N ++CP DVV           +  
Sbjct  30   VLDITGKKLRTGTDYYILPVIRGRGGGLTLAS--TSNTTSCPLDVVQE-----QHEVSNG  82

Query  646  RPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY------QAMIVTGG  485
             PL+F P+  + G   + + +  N+ F +   +  C +  +WKL+       Q  + +GG
Sbjct  83   LPLTFSPVNPKKGVVRVSTDH--NIKFSA---ATICVQSTMWKLDKFDEQTGQWFVTSGG  137

Query  484  VIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRIG  371
            V          NWF+I+K      Y   + P++C  C++ 
Sbjct  138  VEGNPGRQTTSNWFKIEK--YDEDYKLVFCPTVCNFCKVA  175



>ref|XP_007152537.1| hypothetical protein PHAVU_004G138500g [Phaseolus vulgaris]
 gb|ESW24531.1| hypothetical protein PHAVU_004G138500g [Phaseolus vulgaris]
Length=205

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 84/174 (48%), Gaps = 27/174 (16%)
 Frame = -2

Query  826  ILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVR  647
            ++D +G  +  G KYY +P   G  GG++V++S  GN +TCP  VV        + P V 
Sbjct  31   VVDTSGQKLRTGVKYYILPVFRGRGGGLTVSSS--GN-NTCPLFVV-------QEKPEVL  80

Query  646  R--PLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNYQA----MIVTGG  485
               P++F P   + G  VI++   LN+   S   +  C +  VWKL         + TGG
Sbjct  81   NGTPVTFTPYNAKSG--VILTSTDLNI--KSYGTTTSCDKPPVWKLLKVLTGVWFLSTGG  136

Query  484  VIDKE--DDIGNWFRIQKNINGRGYLFTWWPSLCLG---CRIGYFRIGRVGNGY  338
            V      D I NWF+I+K    + Y+ ++ PS+C     CR     +G  GN +
Sbjct  137  VEGNPGIDTIVNWFKIEK--AEKDYVISFCPSVCKCQTLCRELGLYVGDDGNKH  188



>emb|CBI35471.3| unnamed protein product [Vitis vinifera]
Length=2095

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 52/162 (32%), Positives = 78/162 (48%), Gaps = 23/162 (14%)
 Frame = -2

Query  796   AGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKR  617
             +G  YY +P   G  GG+++A+  TGN  TCP DVV        Q  +   PL+F P+  
Sbjct  1933  SGVDYYILPVFRGRGGGLTLAS--TGN-ETCPLDVV-----QEQQEVSNGLPLTFTPVNP  1984

Query  616   EGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY-----QAMIVTGGVIDK--EDDIG  458
             + G  VI      N+ F +   S  C +  +WKL Y     Q  + TGGV      + + 
Sbjct  1985  KKG--VIRVSTDHNIKFSA---STICVQSTLWKLEYDESSGQRFVTTGGVEGNPGRETLD  2039

Query  457   NWFRIQKNINGRGYLFTWWPSLCLGCRIGYFRIG-RVGNGYQ  335
             NWF+I+K  +   Y   + P++C  C+     IG  + NGY+
Sbjct  2040  NWFKIEKYED--DYKLVFCPTVCDFCKPVCGDIGIYIQNGYR  2079



>ref|XP_006372633.1| hypothetical protein POPTR_0017s03430g [Populus trichocarpa]
 gb|ERP50430.1| hypothetical protein POPTR_0017s03430g [Populus trichocarpa]
Length=206

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 76/167 (46%), Gaps = 27/167 (16%)
 Frame = -2

Query  826  ILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLA--GMQPPA  653
            +LD  G  +  G  YY +P + G  GG+ +A++      TCP DVV +   A  G+    
Sbjct  32   VLDVTGKILRTGTSYYILPVIRGRGGGLKMASTVR---RTCPLDVVQDRYEASNGL----  84

Query  652  VRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKL-NY-----QAMIVT  491
               PL F P+  + G  V+     LN+ F +   +  C +   WKL NY     Q  + T
Sbjct  85   ---PLKFTPVNTKKG--VVRVHTDLNIRFSA---ASICHQSTAWKLDNYDEWTKQWFVTT  136

Query  490  GGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRIGYFRIG  356
             GV      +   NWF+I+K  +   Y   + P++C  C++    IG
Sbjct  137  DGVEGNPGPETTNNWFKIEKFED--KYKLVFCPTVCQHCKVMCKDIG  181



>ref|NP_001237597.1| uncharacterized protein LOC100527288 precursor [Glycine max]
 gb|ACU16359.1| unknown [Glycine max]
Length=204

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 96/202 (48%), Gaps = 28/202 (14%)
 Frame = -2

Query  916  SGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISV  737
            S +A S L LA + + P I +   A    A+LD +G  +  G KYY +P   G  GG++V
Sbjct  5    SPLAFSILFLAFT-IEPFIGIAAAAP--EAVLDTSGQKLRTGVKYYILPVFRGKGGGLTV  61

Query  736  ANSDTGNPSTCPTDVVINITLAGMQPPAVRR--PLSFYPLKREGGDAVIISQYPLNVAFD  563
            ++S  GN +TCP  VV        +   V +  P++F P   + G  VI++   LN+   
Sbjct  62   SSS--GN-NTCPLFVV-------QEKLEVSKGTPVTFTPYNAKSG--VILTSTDLNI--K  107

Query  562  SPDPSDPCAEENVWKLNYQA----MIVTGGVIDKE--DDIGNWFRIQKNINGRGYLFTWW  401
            S   +  C +  VWKL         + TGGV      + + NWF+I+K    + Y+ ++ 
Sbjct  108  SYGKTTTCDKPPVWKLLKVLTGVWFLSTGGVEGNPGVNTVVNWFKIEK--AEKDYVLSFC  165

Query  400  PSLCLG-CRIGYFRIGRVGNGY  338
            PS     CR     +G  GN +
Sbjct  166  PSFAQTLCRELGLYVGDDGNKH  187



>ref|XP_003534100.1| PREDICTED: miraculin-like [Glycine max]
 gb|KHM99733.1| Miraculin [Glycine soja]
Length=216

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 47/163 (29%), Positives = 75/163 (46%), Gaps = 26/163 (16%)
 Frame = -2

Query  832  NAILDAAGNPVIAGAKYYAIPAVIGVD--GGISVANSD----TGNPSTCPTDVVINITLA  671
             A++D +G  +  G  YY +PA+      G     N++         +CP DVV+     
Sbjct  28   EAVIDTSGTELQPGLSYYVVPAMRSFTRCGKFECLNAEGLSLASIGESCPLDVVVEQRSF  87

Query  670  GMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEEN-VWKLNY-----  509
            G+       PLSF PL  +  ++V+     LN+ F +   S  CAE + VWKL++     
Sbjct  88   GL-------PLSFSPL--DTNESVVRVSTDLNIMFCTDRTSYSCAEYSPVWKLDHFDVSK  138

Query  508  -QAMIVTGGVIDKE--DDIGNWFRIQKNINGRGYLFTWWPSLC  389
             +  + TGG +     + I NWF+I+K      Y   + PS+C
Sbjct  139  GKWFVTTGGSMGNPSWETIRNWFKIEK--CDSAYRIVYCPSVC  179



>ref|XP_007029360.1| Kunitz family trypsin and protease inhibitor protein [Theobroma 
cacao]
 gb|EOY09862.1| Kunitz family trypsin and protease inhibitor protein [Theobroma 
cacao]
Length=195

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 57/205 (28%), Positives = 91/205 (44%), Gaps = 42/205 (20%)
 Frame = -2

Query  946  MKTAIILLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPA  767
            MKTA+ L      A+S L  A +   P             +LD +G  +  G  YY +P 
Sbjct  1    MKTAVFL------ALSLLLCANAAPDP-------------VLDISGKKLRTGTDYYILPV  41

Query  766  VIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQ  587
              G  GG+++A+  TGN S CP DVV           +   P++F P+  + G  V+   
Sbjct  42   FRGRGGGLTLAS--TGNES-CPLDVV-----QEQLEVSDGLPVTFSPVNIKKG--VVRVS  91

Query  586  YPLNVAFDSPDPSDPCAEENVWKLN------YQAMIVTGGVIDK--EDDIGNWFRIQKNI  431
               N+ F +   +  C +  +WKL+       Q  + TGGV      + I NWF+I+K  
Sbjct  92   TDQNIKFSA---ATICVQPTLWKLDSFDDSTRQWFVTTGGVEGNPGRETIDNWFKIEKYE  148

Query  430  NGRGYLFTWWPSLCLGCRIGYFRIG  356
            +   Y   + P++C  C++    +G
Sbjct  149  D--DYKLVFCPTVCDFCKVMCRDVG  171



>emb|CAC19831.1| hypothetical protein [Avicennia marina]
Length=202

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 63/139 (45%), Gaps = 17/139 (12%)
 Frame = -2

Query  844  ADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGM  665
            A    A+LD  GN + AG+KYY + A+ G  GG  V    TGN   CP  V       G 
Sbjct  26   AAAEEAVLDIEGNELQAGSKYYMVSAIWGAGGG-GVTLRLTGN-DRCPVTV-------GQ  76

Query  664  QPPAVRR--PLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNYQAMIVT  491
            +   +R   P+SF P   E  + V+     LN+ F   + S PCA   VW++        
Sbjct  77   EGSDLRNGLPVSFQPANSE--ETVVRVSTQLNIKF---EVSVPCANSTVWRVGRLDAWTR  131

Query  490  GGVIDKEDDIG-NWFRIQK  437
               I  E + G +WF I+K
Sbjct  132  TSFIQIEGEPGFDWFEIEK  150



>ref|XP_006372632.1| hypothetical protein POPTR_0017s03420g [Populus trichocarpa]
 gb|ERP50429.1| hypothetical protein POPTR_0017s03420g [Populus trichocarpa]
Length=206

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 76/167 (46%), Gaps = 27/167 (16%)
 Frame = -2

Query  826  ILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLA--GMQPPA  653
            +LD  G  +  G  YY +P + G  GG+ +A++      TCP DVV +   A  G+    
Sbjct  32   VLDVTGKILRIGTSYYILPVIRGRGGGLKMASTVR---RTCPLDVVQDRYEASNGL----  84

Query  652  VRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKL-NY-----QAMIVT  491
               PL F P+  + G  V+     LN+ F +   +  C +   WKL NY     Q  + T
Sbjct  85   ---PLKFTPVNTKKG--VVRVHTDLNIRFSA---ASICHQSTAWKLDNYDEWTKQWFVTT  136

Query  490  GGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRIGYFRIG  356
             GV      +   NWF+I+K  +   Y   + P++C  C++    IG
Sbjct  137  DGVEGNPGPETTNNWFKIEKFED--KYKLVFCPTVCQHCKVMCKDIG  181



>ref|XP_006372654.1| hypothetical protein POPTR_0017s03600g [Populus trichocarpa]
 gb|ERP50451.1| hypothetical protein POPTR_0017s03600g [Populus trichocarpa]
Length=206

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 75/167 (45%), Gaps = 27/167 (16%)
 Frame = -2

Query  826  ILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLA--GMQPPA  653
            +LD  G  +  G  YY +P + G  GG+ +A++      TCP DVV +   A  G+    
Sbjct  32   VLDVTGKILRTGTSYYILPVIRGRGGGLKMASTVR---RTCPLDVVQDRYEASNGL----  84

Query  652  VRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKL-NY-----QAMIVT  491
               PL F P+  + G  V+     LN+ F +      C +   WKL NY     Q  + T
Sbjct  85   ---PLKFTPVNTKKG--VVRVHTDLNIRFSA---GSICHQSTAWKLDNYDEWTKQWFVTT  136

Query  490  GGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRIGYFRIG  356
             GV      +   NWF+I+K  +   Y   + P++C  C++    IG
Sbjct  137  DGVEGNPGPETTNNWFKIEKFED--KYKLVFCPTVCQHCKVMCKDIG  181



>ref|XP_006441461.1| hypothetical protein CICLE_v10022001mg [Citrus clementina]
 gb|ESR54701.1| hypothetical protein CICLE_v10022001mg [Citrus clementina]
Length=236

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 66/245 (27%), Positives = 104/245 (42%), Gaps = 43/245 (18%)
 Frame = -2

Query  946  MKTAIILLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPA  767
            MKT++I        +SFL L ++  P L      +  +  +LD  GN V +  +Y  IP 
Sbjct  1    MKTSLI------TTLSFLILTLATQPLL----GISSNSEPVLDIIGNKVKSTLEYKLIPV  50

Query  766  VIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVR------RPLSFYPLKREGGD  605
            + G  GG S   +  G    CP DV+       +  P+ R       P   Y + +   D
Sbjct  51   LDGA-GGFS---THLGTNGQCPLDVI------QLSSPSERGDNLRLLPYDNYKIVKVSTD  100

Query  604  AVIISQYPLNVAFDSPDPSDPCAEENVWKLNY--QAMIVTGGVIDK--EDDIGNWFRIQK  437
              +  ++P+ V+        PC EE +WK++     +IVTGG+      + + NWF+I+K
Sbjct  101  VNL--RFPVKVSVK------PCNEEPLWKVDSYDDPLIVTGGIEGHPGAETLLNWFKIEK  152

Query  436  NIN---GRGYLFTWWPSLCLGC--RIGYFRIGRVGNGYQLGINYNDESLYAFEFLKVDE*  272
              N   G  Y     PS+CL C  R     +       +L +  +DE      F   +E 
Sbjct  153  AGNFSYGGVYNIVHCPSVCLSCPRRCNKIGVSSKDGVRRLALVGDDEPALNVLFFPSEER  212

Query  271  SKPYQ  257
            S+  Q
Sbjct  213  SRLLQ  217



>gb|ACS92516.1| Kunitz-type protease inhibitor KPI-D12 [Populus trichocarpa x 
Populus deltoides]
Length=206

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 75/167 (45%), Gaps = 27/167 (16%)
 Frame = -2

Query  826  ILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLA--GMQPPA  653
            +LD  G  +  G  YY +P + G  GG+ +A+  TG   TCP DVV +   A  G+    
Sbjct  32   VLDVTGKILRTGTGYYILPVIRGRGGGLKMAS--TGR-RTCPLDVVQDRYEASNGL----  84

Query  652  VRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKL------NYQAMIVT  491
               PL F P+  + G  V+     LN+ F +   +  C +   WKL        Q  + T
Sbjct  85   ---PLKFTPVNTKKG--VVRVHTDLNIRFSA---ASICHQSTAWKLGSYDEWTKQWFVTT  136

Query  490  GGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRIGYFRIG  356
             GV      +   NWF+I+K  +   Y   + P++C  C++    IG
Sbjct  137  NGVEGNPGPETTNNWFKIEKFED--KYKLVFCPTVCQHCKVMCKDIG  181



>ref|XP_006351546.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=205

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 49/183 (27%), Positives = 78/183 (43%), Gaps = 22/183 (12%)
 Frame = -2

Query  898  FLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTG  719
            FLP  I  +     L + A+    ++D  G  +  G  YY +P V G  GG+++   D+ 
Sbjct  7    FLPFLILAISSNSFLSSAAESPPEVVDIDGKILRTGVDYYILPVVRGRGGGLTM---DSI  63

Query  718  NPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPC  539
                CP D V+       Q      PL+F P+  + G  VI     LN+ F +   +  C
Sbjct  64   GDKICPLDAVVQEHHEIDQG----LPLTFTPVNPKKG--VIRESTDLNIIFSA---NSIC  114

Query  538  AEENVWKLNY------QAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLG  383
             +   WKL+       Q  I  GG       + + NW +I+K    R Y   + P++C  
Sbjct  115  VQTTQWKLDDFDETTGQYFITLGGTQGNPGRETVSNWIKIEK--FDRDYKLLYCPTVCDI  172

Query  382  CRI  374
            C++
Sbjct  173  CKV  175



>ref|XP_010540187.1| PREDICTED: bark lectin isoform 2-like [Tarenaya hassleriana]
Length=213

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 58/182 (32%), Positives = 80/182 (44%), Gaps = 34/182 (19%)
 Frame = -2

Query  832  NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPST-CPTDVVINITLAGMQPP  656
              +LD +GNPV AG +YY IPA  G  GG+ V +S T NP   CP DV            
Sbjct  25   QEVLDTSGNPVEAGVQYYIIPAKSGNGGGL-VPSSRTFNPQQLCPLDV------------  71

Query  655  AVRRPLSFYP------LKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWK------LN  512
             V+ PL F P            D V+     LNV F+S      C E  VWK       +
Sbjct  72   -VQSPLPFIPGLPVTFTVLNSADNVLQLNTNLNVQFES--TVWLCPETKVWKGEDFENTD  128

Query  511  YQAMIVTGGVIDKEDDIGNWFRIQKNINGRGYLFTWWPSLC--LGCRIGYFRIGRVGNGY  338
              A I TGG I   +   +WFR+ K ++    +F    + C  +G     F + R+  G+
Sbjct  129  EYAYISTGGEIGGPN---SWFRVLKFVDDYKLVFCKDGTTCHYVGTYNDGFGVQRLVVGH  185

Query  337  QL  332
            ++
Sbjct  186  EI  187



>ref|XP_011046090.1| PREDICTED: miraculin-like [Populus euphratica]
Length=209

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 75/165 (45%), Gaps = 23/165 (14%)
 Frame = -2

Query  826  ILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVR  647
            +LD  G  ++AG KYY +P   G  GGI++A+    N ++CP  VV +   A     +  
Sbjct  28   VLDIDGEKLVAGTKYYILPVFRGRGGGITMAS----NQTSCPLAVVQDRLEA-----SKG  78

Query  646  RPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKL------NYQAMIVTGG  485
             PL+F P   +    +++S   LN+ F        C    VWK+        Q  + TGG
Sbjct  79   LPLTFTPAADDKKGVILVST-DLNIKFLD---KTTCPHSTVWKIIKSSNSKVQWFVSTGG  134

Query  484  VIDKE--DDIGNWFRIQKNINGRGYLFTWWPSLCLGCRIGYFRIG  356
            V      + +GNWF+I+K  +   Y   + P+    C +    IG
Sbjct  135  VEGNPGFNTVGNWFQIEKADD--DYKLVFCPTKVCKCGVLCRDIG  177



>emb|CDO98554.1| unnamed protein product [Coffea canephora]
Length=209

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 73/158 (46%), Gaps = 22/158 (14%)
 Frame = -2

Query  826  ILDAAGNPVIAGAKYYAIPA-VIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAV  650
            +LD AGN +     YY +PA V G   G  +  S  GN  TCP  V        M     
Sbjct  33   VLDTAGNVLRTDRDYYILPAKVRGRFRGGGLTLSSIGN-DTCPVGV-----FQEMSEQRN  86

Query  649  RRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKL-NY-----QAMIVTG  488
              PL+F P+K+  G  V+ +   LN+ F  P   + C E  VW++ NY      + +  G
Sbjct  87   GIPLTFSPVKQRYG--VVRTSTDLNIQFAYP---ETCGESPVWRVDNYLDPSADSFVSIG  141

Query  487  GVIDKED--DIGNWFRIQKNINGRGYLFTWWPSLCLGC  380
            GV+       +G+WF+IQK   G  Y   + P++C  C
Sbjct  142  GVVGNPGPATLGSWFKIQK--FGYDYKLVYCPAVCSYC  177



>ref|XP_010683390.1| PREDICTED: miraculin-like [Beta vulgaris subsp. vulgaris]
Length=224

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 42/164 (26%), Positives = 74/164 (45%), Gaps = 24/164 (15%)
 Frame = -2

Query  829  AILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAV  650
            ++LD  G P+ A ++YY +PA  G  GGI+V  S     + CP  V         +   +
Sbjct  28   SVLDTEGRPLRAKSRYYILPASQGQGGGITV--SQKNQTTLCPLYV-------SQESQEI  78

Query  649  RRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN-----YQAMIVTGG  485
               LS + L  +    +I     +N+ F+     + C +   WKL+     ++  + TGG
Sbjct  79   YLGLSVWFLPSKHNQRLIYISSDINILFNMV---NICLQSAAWKLSIDHTTWRKYVATGG  135

Query  484  VIDK--EDDIGNWFRIQKNINGR-----GYLFTWWPSLCLGCRI  374
             I    E+ + +WF+I+K  +G       Y   + P++C  C +
Sbjct  136  AIGNPGEETVSSWFKIEKVKSGSYEYDYNYKIMYCPNVCSFCMV  179



>prf||1922206B trypsin inhibitor:ISOTYPE=b
Length=184

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 83/197 (42%), Gaps = 27/197 (14%)
 Frame = -2

Query  832  NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPA  653
            N ILD  GN +  G +YYAI     V G    A S+    + CP +V      A   P  
Sbjct  2    NPILDVDGNELRRGNRYYAISERRPVSGLTLAARSN----APCPLNV------AQAAPRE  51

Query  652  VRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNYQ-AMIVTGGVID  476
              RPL+F+P      D  +     LN+ F  P P+  C E  VW L  +  ++ TGG   
Sbjct  52   YGRPLAFFP--ENADDDTVQEGSTLNIMF--PQPTR-CRESTVWTLGRERGVVTTGGTSS  106

Query  475  KEDDIGN-WFRIQK---NINGRGYLFTWWPSLCLG-----CRIGYF-RIGRVGNGYQLGI  326
             E    N  F I++     + R Y  T  P   LG     CR+     +G   +   L +
Sbjct  107  SEIGPHNERFAIRRAGDASSKREYQITVCP-CSLGVSRPSCRLACVGSLGLTEDEANLLL  165

Query  325  NYNDESLYAFEFLKVDE  275
            N N+E  +   F+KV E
Sbjct  166  NINNERPHEVRFVKVQE  182



>gb|KHN24496.1| Miraculin [Glycine soja]
Length=204

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 95/205 (46%), Gaps = 33/205 (16%)
 Frame = -2

Query  925  LVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGG  746
            LVFS   I FL   I    P I +   A    A+LD +G  +  G KYY +P   G  GG
Sbjct  7    LVFS---ILFLAFTIE---PFIGIAAAAP--EAVLDTSGQKLRTGVKYYILPVFRGKGGG  58

Query  745  ISVANSDTGNPSTCPTDVVINITLAGMQPPAVRR--PLSFYPLKREGGDAVIISQYPLNV  572
            ++V++S  GN +TCP  VV        +   V +  P++F P   + G  VI++   LN+
Sbjct  59   LTVSSS--GN-NTCPLFVV-------QEKLEVSKGTPVTFTPYNAKSG--VILTSTDLNI  106

Query  571  AFDSPDPSDPCAEENVWKLNYQA----MIVTGGVIDKE--DDIGNWFRIQKNINGRGYLF  410
               S   +  C +  VWKL         + TGGV      + + NWF+I+K    + Y+ 
Sbjct  107  --KSYGKTTTCDKPPVWKLLKVLTGVWFLSTGGVEGNPGVNTVVNWFKIEK--AEKDYVL  162

Query  409  TWWPSLCLG-CRIGYFRIGRVGNGY  338
            ++ PS     CR     +G  GN +
Sbjct  163  SFCPSFARTLCRELGLYVGDDGNKH  187



>ref|XP_004234331.1| PREDICTED: miraculin [Solanum lycopersicum]
 gb|AAC63057.1| Lemir [Solanum lycopersicum]
Length=205

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 52/188 (28%), Positives = 82/188 (44%), Gaps = 32/188 (17%)
 Frame = -2

Query  898  FLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTG  719
            F P  I  +     L + A+    ++D  G  +  G  YY +P V G  GG+++   D+ 
Sbjct  7    FFPFLILAISFNSLLSSAAESPPEVVDIDGKILRTGVDYYILPVVRGRGGGLTM---DSI  63

Query  718  NPSTCPTDVVI---NITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPS  548
                CP D V+   N    G+       PL+F P+  + G  VI     LN+ F +   +
Sbjct  64   GDKMCPLDAVVQEHNEIDQGL-------PLTFTPVDPKKG--VIRESTDLNIIFSA---N  111

Query  547  DPCAEENVWKLNY------QAMIVTGGVIDK----EDDIGNWFRIQKNINGRGYLFTWWP  398
              C +   WKL+       Q  I  GG  D+     + I NWF+I+K    R Y   + P
Sbjct  112  SICVQTTQWKLDDFDETTGQYFITLGG--DQGNPGVETISNWFKIEK--YDRDYKLLYCP  167

Query  397  SLCLGCRI  374
            ++C  C++
Sbjct  168  TVCDFCKV  175



>gb|KHM99737.1| Miraculin [Glycine soja]
Length=215

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 47/177 (27%), Positives = 78/177 (44%), Gaps = 26/177 (15%)
 Frame = -2

Query  841  DGTNAILDAAGNPVIAGAKYYAIPA-------VIGVDGGISVANSDTGNPSTCPTDVVIN  683
            D  + ++D +GN +  GA YY IP             G   +  +      T P DV++ 
Sbjct  25   DSPHQVVDTSGNILRVGANYYIIPNPTTKCSIFSNYKGNNGLVLAKVAANKTFPLDVLV-  83

Query  682  ITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY--  509
              + G Q   + +PL+F P+  +   A +     LN+ F        C++ NVWK+++  
Sbjct  84   --VEGQQ---LGQPLTFTPIHDQKKGAPVRVSTDLNIEFSM---QTSCSQSNVWKIDHFD  135

Query  508  ----QAMIVTGGVIDKED--DIGNWFRIQKNINGRGYLFTWWPSLCLGCRIGYFRIG  356
                +  + TGGV+       I NWF+I+K  +G  Y     P+ C  C++    IG
Sbjct  136  RATRKWFVTTGGVVGHPSWRTISNWFKIEK-YDG-DYKLVSCPTFCAYCKVQCRDIG  190



>gb|ACF74332.1| Kunitz trypsin inhibitor 4 [Arachis hypogaea]
Length=203

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 76/160 (48%), Gaps = 24/160 (15%)
 Frame = -2

Query  844  ADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGM  665
            A     +LD  G  + +G KY+ +P + G  GG++V +S     STCP  V+        
Sbjct  22   ASAAEPVLDVTGQKLRSGVKYFILPVLRGRGGGLTVGSSVN---STCPIYVL-------Q  71

Query  664  QPPAVRR--PLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWK----LNYQA  503
                V R  P++F P      D VI++   LN+   S   +  C E +VW+    L+   
Sbjct  72   DKLEVTRGTPVTFTP-STPNKDGVILTSTDLNINSTS---APKCKESSVWRLLKVLSGVW  127

Query  502  MIVTGGVIDKE--DDIGNWFRIQKNINGRGYLFTWWPSLC  389
             I T GV      + + NWF+I+K  +G+ Y  ++ PS+C
Sbjct  128  FISTDGVAGNPGVNTVVNWFKIEK--DGKDYNLSFCPSVC  165



>ref|XP_003534101.1| PREDICTED: 21 kDa seed protein-like [Glycine max]
 gb|KHM99730.1| Miraculin [Glycine soja]
Length=203

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 61/205 (30%), Positives = 93/205 (45%), Gaps = 33/205 (16%)
 Frame = -2

Query  925  LVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGG  746
            L FS + +SF      G+    + P        +LD +G  +  G KYY +P   G  GG
Sbjct  6    LAFSILFLSFTIELFIGIASAAQEP--------VLDTSGQKLRTGVKYYILPVFRGRGGG  57

Query  745  ISVANSDTGNPSTCPTDVVINITLAGMQPPAVRR--PLSFYPLKREGGDAVIISQYPLNV  572
            ++V++S  GN +TCP  VV        +   V +  P++F P   E G  VI++   LN+
Sbjct  58   LTVSSS--GN-NTCPLFVV-------QEKLEVSKGTPVTFTPYNAESG--VILTSTDLNI  105

Query  571  AFDSPDPSDPCAEENVWKLNYQA----MIVTGGVIDKE--DDIGNWFRIQKNINGRGYLF  410
               S   S  C +  VWKL         + TGGV      + + NWF+I+K    + Y+ 
Sbjct  106  --KSYVKSTTCDKPPVWKLLKVLTGVWFLSTGGVEGNPGVNTVVNWFKIEK--AEKDYVL  161

Query  409  TWWPSLCLG-CRIGYFRIGRVGNGY  338
            ++ PS     CR     +G  GN +
Sbjct  162  SFCPSFAQTLCRELGLYVGDDGNKH  186



>ref|XP_004235409.1| PREDICTED: miraculin-like [Solanum lycopersicum]
Length=201

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 81/185 (44%), Gaps = 26/185 (14%)
 Frame = -2

Query  907  AISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVAN-  731
            A+ FL +A+  L  +  L    D    ILD +GN V  G  YY +PA  G  GG+ VA+ 
Sbjct  3    AVPFLLVAL--LSTIFFLVNAQDVAEPILDVSGNAVRTGVNYYILPAGRGNGGGLQVASI  60

Query  730  SDTGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDP  551
             +  NP     +V  ++    +Q         F P+  +  +  I     +NV F S + 
Sbjct  61   KNRTNPLVVSQNVDDSVIGVNVQ---------FSPV--DPKENTIRLSTDMNVKFTSMEI  109

Query  550  SDPCAEENVWKLNYQA-----MIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSL  392
            SD      VW++N +      ++  GGV      + +GNWF I K  +   Y   + P +
Sbjct  110  SD---SSTVWRINTELIPQRYLVTIGGVEGNPGRETLGNWFNIDKYED--AYKLVYCPVV  164

Query  391  CLGCR  377
            C  CR
Sbjct  165  CETCR  169



>ref|XP_003534081.1| PREDICTED: miraculin-like [Glycine max]
Length=215

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 47/177 (27%), Positives = 78/177 (44%), Gaps = 26/177 (15%)
 Frame = -2

Query  841  DGTNAILDAAGNPVIAGAKYYAIPA-------VIGVDGGISVANSDTGNPSTCPTDVVIN  683
            D  + ++D +GN +  GA YY IP             G   +  +      T P DV++ 
Sbjct  25   DSPHQVVDTSGNILRVGANYYIIPNPTTKCSIFSKYKGNNGLVLAKVAANKTFPLDVLV-  83

Query  682  ITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY--  509
              + G Q   + +PL+F P+  +   A +     LN+ F        C++ NVWK+++  
Sbjct  84   --VEGQQ---LGQPLTFTPIHDQKKGAPVRVSTDLNIEFSM---QTSCSQSNVWKIDHFD  135

Query  508  ----QAMIVTGGVIDKED--DIGNWFRIQKNINGRGYLFTWWPSLCLGCRIGYFRIG  356
                +  + TGGV+       I NWF+I+K  +G  Y     P+ C  C++    IG
Sbjct  136  RATRKWFVTTGGVVGHPSWRTISNWFKIEK-YDG-DYKLVSCPTFCAYCKVQCRDIG  190



>dbj|BAA82840.1| miraculin homologue [Youngia japonica]
Length=142

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 71/145 (49%), Gaps = 20/145 (14%)
 Frame = -2

Query  796  AGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKR  617
            +G +YY +P   G+ GG+++A++      TCP DVV     A ++      PL+F P+  
Sbjct  3    SGTEYYILPVFRGMGGGLTLASTRN---DTCPLDVV----QADLEVDN-GLPLTFTPVDP  54

Query  616  EGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY---QAMIVTGGVIDK--EDDIGNW  452
            + G  VI     LN+ F +   S  C + NVW L     Q ++   GV      + I NW
Sbjct  55   KKG--VIRESTDLNIIFSA---SSICIQSNVWNLEEYDGQLIVSAHGVAGNPGRETISNW  109

Query  451  FRIQKNINGRGYLFTWWPSLCLGCR  377
            F+I+K  +   Y   + P++C  CR
Sbjct  110  FKIEKYED--DYKIVFCPTVCDFCR  132



>gb|KDP27288.1| hypothetical protein JCGZ_21019 [Jatropha curcas]
 gb|KDP46944.1| hypothetical protein JCGZ_07961 [Jatropha curcas]
Length=194

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 70/161 (43%), Gaps = 26/161 (16%)
 Frame = -2

Query  865  LIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVI  686
            L+   T    +  ILD  G P+ +G +YY +PA     GG+++ N     P     + + 
Sbjct  13   LVMATTAMAQSTTILDTNGQPLTSGVEYYVLPAATDTAGGLTLVNRTGSCPFYVGQEPLS  72

Query  685  NITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN--  512
             +   G+       P+ F P     GD+V+    P  VAF +   S  C +   W++   
Sbjct  73   TVVSQGL-------PVVFTP---NDGDSVVREDIPFTVAFSA---STTCVQSTGWRVEND  119

Query  511  ---YQAMIVTGGVIDKEDDIGNWFRIQKNINGRGYLFTWWP  398
                +  IVTGG  D+     ++FRIQ + NG  Y   W P
Sbjct  120  EEVSRTFIVTGG--DQ-----SFFRIQIDDNGL-YNLIWCP  152



>emb|CDP16462.1| unnamed protein product [Coffea canephora]
Length=220

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/166 (31%), Positives = 76/166 (46%), Gaps = 22/166 (13%)
 Frame = -2

Query  844  ADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINI--TLA  671
            A+  N +LD  G+ + AG +YY + ++ G  GG        GN S CP  VV      L 
Sbjct  21   AEKPNPVLDHDGDEIRAGVEYYIVSSIRGAGGGGVTYGRSIGNES-CPLPVVQEKLDLLR  79

Query  670  GMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY-----Q  506
            G        P++F P+  + G  V+     LN+ F    P   C E NVWKL++     Q
Sbjct  80   G-------HPVTFTPVNSKEG--VVRVSTDLNIKFSKAAPV--CNESNVWKLDFDEELGQ  128

Query  505  AMIVTGGVIDKE--DDIGNWFRIQKNINGRGYLFTWWPSLCLGCRI  374
              I+T GV        I NWF+I+   + + Y   + P++C  C +
Sbjct  129  HFILTNGVEGNPGCGTIHNWFKIEGPYH-KSYRLVFCPTVCNICNV  173



>ref|XP_008437082.1| PREDICTED: miraculin [Cucumis melo]
Length=207

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/169 (27%), Positives = 78/169 (46%), Gaps = 27/169 (16%)
 Frame = -2

Query  847  KADGT-NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINI--T  677
            +AD + +A+LD  G  + AG +YY +       GG+S+          CP +++      
Sbjct  23   RADASPDAVLDTDGKKLRAGDQYYILSVYSRNSGGLSIGG--IYGYEKCPINILPESYDY  80

Query  676  LAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN-----  512
            L G+       P +F P+  + G  V+     LN+ F++   S  C    VWK+      
Sbjct  81   LDGL-------PATFSPVNPKKG--VVRVSTDLNIEFEA---STRCGISTVWKVGKFDQY  128

Query  511  -YQAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRI  374
              Q  +  GG       + IGNWF+++K  +G+ Y F + P++C  C++
Sbjct  129  LKQYFVTMGGTKGNPGRETIGNWFKVEK--HGKNYKFVYCPTVCKYCKV  175



>gb|AFL91229.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=164

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 69/147 (47%), Gaps = 20/147 (14%)
 Frame = -2

Query  802  VIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPL  623
            V +G +YY +P   G  GG+++A +      +CP DVV      G +      PL+F P+
Sbjct  1    VRSGXEYYXLPVFXGRGGGVTLAPTRN---ESCPLDVV----QEGFELDD-GLPLTFTPV  52

Query  622  KREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKL-NYQAMIVTGGVIDK----EDDIG  458
              + G  VI     LN+ F +   S  C + NVW L  Y+   +  G         + I 
Sbjct  53   DPKKG--VIRESTDLNIIFSA---SSICIQSNVWMLEEYEGQRIISGRGTAGNPGGETIS  107

Query  457  NWFRIQKNINGRGYLFTWWPSLCLGCR  377
            NWF+I+K  N  GY   + P++C  CR
Sbjct  108  NWFKIEKYEN--GYKLVYCPTVCDLCR  132



>ref|XP_006478135.1| PREDICTED: miraculin-like [Citrus sinensis]
 gb|ACL78790.1| putative miraculin-like protein 2 [Citrus unshiu]
Length=236

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 60/210 (29%), Positives = 92/210 (44%), Gaps = 41/210 (20%)
 Frame = -2

Query  946  MKTAIILLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPA  767
            MKT++I        +SFL L ++  P L      +  +  +LD  GN V +  +Y  IP 
Sbjct  1    MKTSLI------TTLSFLILTLATQPLL----GISSNSEPVLDIIGNKVKSTLEYKLIPV  50

Query  766  VIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVR------RPLSFYPLKREGGD  605
            + G  GG S   +  G    CP DV+       +  P+ R       P   Y + +   D
Sbjct  51   LDGA-GGFS---THLGTNGQCPLDVI------QLSSPSERGDNLRLLPYDNYKIVKVSTD  100

Query  604  AVIISQYPLNVAFDSPDPSDPCAEENVWKLNY--QAMIVTGGVIDK--EDDIGNWFRIQK  437
              +  ++P+ V+        PC EE +WK++     +IVTGG       + + NWF+I+K
Sbjct  101  VNL--RFPVKVSVK------PCNEEPLWKVDSYDDPLIVTGGSEGHPGAETLLNWFKIEK  152

Query  436  NIN---GRGYLFTWWPSLCLGCRIGYFRIG  356
              N   G  Y     PS+CL C     +IG
Sbjct  153  AGNFSYGGVYNIVHCPSVCLSCPRRCNKIG  182



>emb|CAA56115.1| trypsin/chymotrypsin inhibitor [Alocasia macrorrhizos]
Length=207

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 57/206 (28%), Positives = 88/206 (43%), Gaps = 32/206 (16%)
 Frame = -2

Query  850  TKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLA  671
            T A  TN +LD  GN +  G  YYA  +V+   GG+++A        +CP +V       
Sbjct  14   TTAAATNPVLDVDGNELQRGQLYYAT-SVMRPGGGLTLAAPK----GSCPLNVA------  62

Query  670  GMQPPAVR---RPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNYQA-  503
              Q P  +   RPL+F+P      D  +     L + F  P+P+  C +  VW  + +A 
Sbjct  63   --QAPFDKYSGRPLAFFP--ENADDDTVQEGSTLYIMF--PEPTR-CPQSTVWTFDREAG  115

Query  502  MIVTGGVIDKEDDIGN-WFRIQKNINGRGYLFTWWPSLC--------LGCRIGYF-RIGR  353
             + TGG   K     N  F I+K  +       +   +C          CR+G    +G 
Sbjct  116  FVTTGGTTSKAIGPHNSRFAIRKAGDASSQPRDYQIEVCPCSTGVERPSCRMGCLGTLGL  175

Query  352  VGNGYQLGINYNDESLYAFEFLKVDE  275
               G  + +N N+ES +   F+KV E
Sbjct  176  AEGGKNVLLNINNESPHTIRFVKVKE  201



>prf||1922206A trypsin inhibitor:ISOTYPE=a
Length=184

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 56/201 (28%), Positives = 87/201 (43%), Gaps = 35/201 (17%)
 Frame = -2

Query  832  NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPA  653
            N +LD  GN +  G +YYAI ++   + G+++A       + CP +V      A   P  
Sbjct  2    NPVLDVDGNELRRGNRYYAI-SLRRPNSGLTLAARSN---APCPLNV------AQAAPRD  51

Query  652  VRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNYQA-MIVTGGVID  476
              RPL+F+P      D  +     LN+ F  P+P++ C E  VW L+ +  ++ TGG   
Sbjct  52   YGRPLAFFP--ENADDDTVQEGSTLNIMF--PEPTE-CRESTVWTLDRETGVVTTGGTSS  106

Query  475  KEDDIGN-WFRIQKNING---RGYLFTWWPSLCLGCRIGYFR----------IGRVGNGY  338
             E    N  F I++  +    R Y     P     C IG  R          +G   +  
Sbjct  107  SEIGPHNERFAIRRAGDASSKREYQIEVCP-----CSIGVSRPSCRMACVGSLGLTEDEA  161

Query  337  QLGINYNDESLYAFEFLKVDE  275
             L +N N+E  +   F+KV E
Sbjct  162  NLLLNINNERPHTVRFVKVQE  182



>gb|AAG38518.1|AF283533_1 miraculin-like protein 2 [Citrus x paradisi]
Length=236

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 60/210 (29%), Positives = 92/210 (44%), Gaps = 41/210 (20%)
 Frame = -2

Query  946  MKTAIILLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPA  767
            MKT++I        +SFL L ++  P L      +  +  +LD  GN V +  +Y  IP 
Sbjct  1    MKTSLI------TTLSFLILTLATQPLL----GISSNSEPVLDIIGNKVKSTLEYKLIPV  50

Query  766  VIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVR------RPLSFYPLKREGGD  605
            + G  GG S   +  G    CP DV+       +  P+ R       P   Y + +   D
Sbjct  51   LDGA-GGFS---THLGTNGQCPLDVI------QLSSPSERGDNLRLLPYDNYKIVKVSTD  100

Query  604  AVIISQYPLNVAFDSPDPSDPCAEENVWKLNY--QAMIVTGGVIDK--EDDIGNWFRIQK  437
              +  ++P+ V+        PC EE +WK++     +IVTGG       + + NWF+I+K
Sbjct  101  VNL--RFPVKVSVK------PCNEEPLWKVDSYDDPLIVTGGSEGHPGAETLINWFKIEK  152

Query  436  NIN---GRGYLFTWWPSLCLGCRIGYFRIG  356
              N   G  Y     PS+CL C     +IG
Sbjct  153  AGNFSYGGVYNIVHCPSVCLSCPRRCNKIG  182



>ref|XP_009406658.1| PREDICTED: miraculin-like [Musa acuminata subsp. malaccensis]
Length=200

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 60/225 (27%), Positives = 96/225 (43%), Gaps = 41/225 (18%)
 Frame = -2

Query  937  AIILLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIG  758
            + I LVFS +A                LP  AD    + D  GN +  G  YY  P V  
Sbjct  9    SAIFLVFSALA----------------LPASAD--EPVRDTDGNVLQRGVDYYIRPTVTD  50

Query  757  VDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPL  578
            + GG+++   +     +CP    +++ LA + P     PL F P + +  D V +S    
Sbjct  51   IGGGLTLEARN----GSCP----LSVALASL-PADNGLPLQFSP-EDDDDDTVELST-DT  99

Query  577  NVAFDSPDPSDPCAEENVWKLNYQA-----MIVTGGVIDK--EDDIGNWFRIQKNINGRG  419
            NV F +      C +  VWKL          +V GGV     ++ + NWF+I+ +  G  
Sbjct  100  NVIFSA---FTTCLQSTVWKLELDEGEGRYYVVIGGVAGNPGKETLSNWFKIE-SYQGV-  154

Query  418  YLFTWWPSLCLGCRIGYFRIGRVGNGYQLGINYNDESLYAFEFLK  284
            Y   + P++C  CR     +G    G +  +   D++ + FEF +
Sbjct  155  YKLVFCPTVCDYCRPVCGSLGVYEQGGRQWLGIRDDTPFPFEFKR  199



>ref|XP_008437058.1| PREDICTED: miraculin-like [Cucumis melo]
Length=205

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 80/179 (45%), Gaps = 27/179 (15%)
 Frame = -2

Query  862  IRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVIN  683
            +R  T      A+LD  G  + AG  YY +P   G  GG+++ N  +     CP +VV  
Sbjct  20   LRFSTADASPEAVLDIDGKKLRAGVNYYILPVFRGRGGGLTLGNLQS---EICPVNVVQE  76

Query  682  I--TLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY  509
                + G        P +F+P+  + G  V+     LNV FD+   S  C    VWKL+ 
Sbjct  77   QFELMNGF-------PTTFHPVNPKKG--VVRVSTDLNVQFDA---STICVTSTVWKLDK  124

Query  508  ------QAMIVTGGVIDKE--DDIGNWFRIQKNINGRGYLFTWWPSLCLGCRIGYFRIG  356
                  Q  +  GG       + + NWF+I+K  +G+ Y   + P++C  C++    IG
Sbjct  125  FDESTGQWFVTIGGSRGNPGVETVDNWFKIEK--HGKDYKLVFCPTVCNFCKVMCRDIG  181



>ref|XP_010683194.1| PREDICTED: miraculin-like [Beta vulgaris subsp. vulgaris]
Length=208

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 46/166 (28%), Positives = 73/166 (44%), Gaps = 19/166 (11%)
 Frame = -2

Query  829  AILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAV  650
            A+LD  G P+ A + YY +P + G  GG+ +   +      CP   V      G +  A 
Sbjct  29   AVLDINGRPLQARSNYYILPVIRGRGGGLRMTPKNA--TQLCPLAYVAQ---EGSE-LAN  82

Query  649  RRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNYQAM-----IVTGG  485
              PL FYP+  +  D  I     LN  FD+   +  C +   W+L +  +     +  GG
Sbjct  83   GLPLKFYPVNPK--DKTISLSTDLNFVFDA---ATICVQSTQWRLAFDEVTGRRYVGFGG  137

Query  484  VIDKE--DDIGNWFRIQKNINGR-GYLFTWWPSLCLGCRIGYFRIG  356
             I     + + NWF+I+K   G+  Y   + P +C  C++    IG
Sbjct  138  EIGNPGGNTVSNWFKIEKAETGKYDYKIVFCPGVCNFCKVACGEIG  183



>ref|XP_010539163.1| PREDICTED: bark lectin isoform 1-like [Tarenaya hassleriana]
Length=205

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 77/168 (46%), Gaps = 18/168 (11%)
 Frame = -2

Query  904  ISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSD  725
            +SF  + +S +  ++  P+       +LD  G PV AG  YY +PA  G  GG+   +  
Sbjct  1    MSFPVIFLSIVLAVVSAPSAVHAQGTVLDTKGRPVRAGEPYYVLPA-DGNGGGLRHESRA  59

Query  724  TGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSD  545
            T +P  CP  VV         P ++  P++F P   + G   + +   L + F SPD S 
Sbjct  60   TFHPRPCPHGVV-----QAQFPGSLGDPVTFSPWNSKLG--FVPASTNLTIEF-SPDSSS  111

Query  544  PCAEENVWKLNYQA-----MIVTGGVIDKEDDIGNWFRIQKNINGRGY  416
               +  VW   + A      + TGG + +E   G+WF I ++  G GY
Sbjct  112  CPDQPLVWTSAFSAWLRGSYVSTGGEVGRE---GSWFNILED-GGGGY  155



>gb|ADW95389.1| Kunitz-type trypsin inhibitor [Populus nigra]
Length=209

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 46/165 (28%), Positives = 75/165 (45%), Gaps = 23/165 (14%)
 Frame = -2

Query  826  ILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVR  647
            +LD  G  ++AG KYY +P   G  GGI++A+    N ++CP  VV +         +  
Sbjct  28   VLDIDGEKLVAGTKYYILPVFRGRGGGITMAS----NKTSCPLAVVQD-----RLEVSKG  78

Query  646  RPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKL------NYQAMIVTGG  485
             PL+F P   +    +++S   LN+ F +      C +  VWK+        Q  + TGG
Sbjct  79   LPLTFTPAADDKKGVILVST-DLNIKFLA---KTTCPQSTVWKIIKSSNSKVQWFVSTGG  134

Query  484  VIDKE--DDIGNWFRIQKNINGRGYLFTWWPSLCLGCRIGYFRIG  356
            V      + + NWF+I+K  +   Y   + P+    C +    IG
Sbjct  135  VEGNPGFNTVTNWFQIEKADD--DYKLVFCPTKVCNCGVLCRDIG  177



>ref|XP_009775241.1| PREDICTED: latex serine proteinase inhibitor-like [Nicotiana 
sylvestris]
Length=224

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 69/164 (42%), Gaps = 20/164 (12%)
 Frame = -2

Query  898  FLPLAISGLPPLIRLPTKADGTNAIL----DAAGNPVIAGAKYYAIPAVIGV-DGGISVA  734
            FL LA      L    T     N +L    D  G+P+  GA+Y+ + A  G   GG+ +A
Sbjct  7    FLSLAFLPFSALATCTTDTGHGNQVLRVVKDWKGHPLDKGARYFIVSAFNGAGGGGVRLA  66

Query  733  NSDTGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPD  554
            N    + +TCPT VV         P      ++ Y   +E     I+   PLN+ F    
Sbjct  67   NLGGQDENTCPTSVV-------QSPRDKDDGIAVYFKPKEPKHQEIVESAPLNINFYL--  117

Query  553  PSDPCAEENVWKLNY------QAMIVTGGVIDKEDDIGNWFRIQ  440
                CA   VWK+++         I TG  +    D+ +WF+I+
Sbjct  118  DYYKCANLTVWKVDHYPKPAEHYTISTGAKLANPLDVNSWFQIK  161



>ref|XP_010042449.1| PREDICTED: miraculin-like [Eucalyptus grandis]
Length=262

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 85/184 (46%), Gaps = 24/184 (13%)
 Frame = -2

Query  838  GTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQP  659
             ++ +LD  G+ +  G  Y+ +P + G  GG+++  S +GN   CP  VV        Q 
Sbjct  86   ASSPVLDTDGHELQTGVNYHILPVLRGRGGGLTLGASRSGN---CPLAVV-----QEQQE  137

Query  658  PAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN------YQAMI  497
             +   P  F P+    G++ I     LNV FD+   +  C +  VW+L        Q  I
Sbjct  138  LSDGLPAKFSPV---DGNSTIRLSTDLNVWFDA---ATICVQSTVWRLAAFDEEVKQYFI  191

Query  496  VTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRIGYFRIGRVGNGYQLGIN  323
             +GGV+     + + NWF+I+K      Y F + P++C  CR+    +G   +G    + 
Sbjct  192  ESGGVLGNPGRETVSNWFKIEK--VDEDYNFRFCPTVCDTCRVICRDVGIYVDGSTRRLA  249

Query  322  YNDE  311
             +DE
Sbjct  250  LSDE  253



>gb|AEK26936.1| Kunitz-type trypsin inhibitor B3 [Populus nigra]
Length=209

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 46/165 (28%), Positives = 75/165 (45%), Gaps = 23/165 (14%)
 Frame = -2

Query  826  ILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVR  647
            +LD  G  ++AG KYY +P   G  GGI++A+    N ++CP  VV +         +  
Sbjct  28   VLDIDGEKLVAGTKYYILPVFRGRGGGITMAS----NKTSCPLAVVQD-----RLEVSNG  78

Query  646  RPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKL------NYQAMIVTGG  485
             PL+F P   +    +++S   LN+ F +      C +  VWK+        Q  + TGG
Sbjct  79   LPLTFTPAADDKKGVILVST-DLNIKFLA---KTTCPQSTVWKIIKSSNSKVQWFVSTGG  134

Query  484  VIDKE--DDIGNWFRIQKNINGRGYLFTWWPSLCLGCRIGYFRIG  356
            V      + + NWF+I+K  +   Y   + P+    C +    IG
Sbjct  135  VEGNPGFNTVTNWFQIEKADD--DYKLVFCPTKVCNCGVLCRDIG  177



>sp|P13087.3|MIRA_SYNDU RecName: Full=Miraculin; Short=MIR; Flags: Precursor [Synsepalum 
dulcificum]
 dbj|BAA07603.1| miraculin precursor [Synsepalum dulcificum]
 dbj|BAH84844.1| miraculin [Synsepalum dulcificum]
Length=220

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 46/172 (27%), Positives = 74/172 (43%), Gaps = 23/172 (13%)
 Frame = -2

Query  832  NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPA  653
            N +LD  G  +  G  YY +P +    GG++V+ +       CP  VV            
Sbjct  34   NPVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHD---  90

Query  652  VRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPC--AEENVWKLNY------QAMI  497
              RPL+F+P +    D V +S   LN+ F +     PC      VW+L+       Q  +
Sbjct  91   --RPLAFFP-ENPKEDVVRVST-DLNINFSA---FMPCRWTSSTVWRLDKYDESTGQYFV  143

Query  496  VTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRIGYFRIGRVG  347
              GGV      + I +WF+I++      Y   + P++C  C++   + G VG
Sbjct  144  TIGGVKGNPGPETISSWFKIEEFCGSGFYKLVFCPTVCGSCKV---KCGDVG  192



>gb|KCW48670.1| hypothetical protein EUGRSUZ_K02326 [Eucalyptus grandis]
Length=203

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 85/184 (46%), Gaps = 24/184 (13%)
 Frame = -2

Query  838  GTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQP  659
             ++ +LD  G+ +  G  Y+ +P + G  GG+++  S +GN   CP  VV        Q 
Sbjct  27   ASSPVLDTDGHELQTGVNYHILPVLRGRGGGLTLGASRSGN---CPLAVV-----QEQQE  78

Query  658  PAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN------YQAMI  497
             +   P  F P+    G++ I     LNV FD+   +  C +  VW+L        Q  +
Sbjct  79   LSDGLPAKFSPVD---GNSTIRLSTDLNVWFDA---ATICVQSTVWRLAAFDEEVKQYFV  132

Query  496  VTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRIGYFRIGRVGNGYQLGIN  323
             +GGV+     + + NWF+I+K      Y F + P++C  CR+    +G   +G    + 
Sbjct  133  ESGGVLGNPGRETVSNWFKIEK--VDEDYNFRFCPTVCDTCRVICRDVGIYVDGSTRRLA  190

Query  322  YNDE  311
             +DE
Sbjct  191  LSDE  194



>emb|CDO98558.1| unnamed protein product [Coffea canephora]
 emb|CDO98559.1| unnamed protein product [Coffea canephora]
Length=212

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 76/171 (44%), Gaps = 22/171 (13%)
 Frame = -2

Query  856  LPTKADGTNAILDAAGNPVIAGAKYYAIPAVI--GVDGGISVANSDTGNPSTCPTDVVIN  683
              + A+    +LD AG  +     YY +PA +  G   G  +  S  GN  TCP  V   
Sbjct  23   FSSAAEAPEPVLDVAGKMLRTYLNYYILPANVFRGRYRGGGLTLSGIGN-DTCPAGV---  78

Query  682  ITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKL-NY-  509
                  Q   +  PL+F+P+  + G  V+     LN+ FD P   D C E  VW + NY 
Sbjct  79   FQETSQQINGI--PLTFFPVNPKKG--VVRVSTDLNIKFDYP---DTCDESPVWSVDNYV  131

Query  508  ----QAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRI  374
                 + +  GGV+     + + +WF+IQK    R Y   + P++C  C +
Sbjct  132  YPSDDSFVNIGGVVGNPGPETLSSWFKIQK-FGYRDYKLVFCPTVCSYCDV  181



>ref|XP_003534082.1| PREDICTED: miraculin-like [Glycine max]
 gb|KHM99736.1| Miraculin [Glycine soja]
Length=211

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 87/196 (44%), Gaps = 32/196 (16%)
 Frame = -2

Query  826  ILDAAGNPVIAGAKYYAIPAV--IGVDGGISVANSDTGNPSTCPTDVVI-NITLAGMQPP  656
            +LD +G  +  G  Y  + ++          +  S  GN  +CP DVV+ +I        
Sbjct  32   VLDTSGKVLREGVNYNILISMPYTSCRSPQGLGLSKIGN--SCPLDVVVVDINH------  83

Query  655  AVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEEN-VWKLNY------QAMI  497
              R PL F P+  + G  VI     LN+ F  PD +  C   + VWK++         ++
Sbjct  84   --RLPLRFIPVNPKKG--VIRVATDLNIMF--PDRNVTCPHHSTVWKVDNFHVSKGHRLV  137

Query  496  VTGGVID--KEDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRIGYFRIGRV--GNGYQ-L  332
             TGGV+     + IGNWF+I+K      Y   + PS+C  C+     +G V   NG Q L
Sbjct  138  TTGGVVGYPGRETIGNWFKIEKYDGAYNYKLVYCPSVCPSCKHECKNVGMVVDQNGNQRL  197

Query  331  GINYNDESLYAFEFLK  284
             ++   +  Y F F K
Sbjct  198  ALS---DVPYQFRFFK  210



>ref|XP_002525871.1| Alpha-amylase/subtilisin inhibitor precursor, putative [Ricinus 
communis]
 gb|EEF36475.1| Alpha-amylase/subtilisin inhibitor precursor, putative [Ricinus 
communis]
Length=194

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 47/158 (30%), Positives = 72/158 (46%), Gaps = 33/158 (21%)
 Frame = -2

Query  877  GLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPT  698
            GL  L+   +    T A+LD++G P+ +G +YY +PA     GG+++ N       +CP 
Sbjct  10   GLACLLMAVSTIAQTPAVLDSSGQPLTSGVEYYVLPAATDTAGGLTLVN----RTGSCPF  65

Query  697  DVVINITLAGMQP-PAVRR---PLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEE  530
             V       G +P P V +   P+ F PL    G+++I       VAF +      C + 
Sbjct  66   YV-------GQEPLPTVAKTGFPVIFTPLA--AGESIIREGMDFRVAFSA---VTNCVQS  113

Query  529  NVWKL------NYQAMIVTGGVIDKEDDIGNWFRIQKN  434
              W +        +  IVTGG    E+D   +FRI KN
Sbjct  114  TTWSIGDEDAETSRRFIVTGG----EED---YFRIDKN  144



>ref|XP_010037029.1| PREDICTED: miraculin-like [Eucalyptus grandis]
Length=262

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 85/184 (46%), Gaps = 24/184 (13%)
 Frame = -2

Query  838  GTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQP  659
             ++ +LD  G+ +  G  Y+ +P + G  GG+++  S +GN   CP  VV        Q 
Sbjct  86   ASSPVLDTDGHELQTGVNYHILPVLRGRGGGLTLGASRSGN---CPLAVV-----QEQQE  137

Query  658  PAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN------YQAMI  497
             +   P  F P+    G++ I     LNV FD+   +  C +  VW+L        Q  +
Sbjct  138  LSDGLPAKFSPV---DGNSTIRLSTDLNVWFDA---ATICVQSTVWRLAAFDEEVKQYFV  191

Query  496  VTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRIGYFRIGRVGNGYQLGIN  323
             +GGV+     + + NWF+I+K      Y F + P++C  CR+    +G   +G    + 
Sbjct  192  ESGGVLGNPGRETVSNWFKIEK--VDEDYNFRFCPTVCDTCRVICRDVGIYVDGSTRRLA  249

Query  322  YNDE  311
             +DE
Sbjct  250  LSDE  253



>dbj|BAA82843.1| miraculin homologue [Solanum melongena]
Length=160

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 70/156 (45%), Gaps = 26/156 (17%)
 Frame = -2

Query  811  GNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVRR--PL  638
            G  +  G  YY +P V G  GG+++   D+    TCP D V+       +   V++  PL
Sbjct  1    GKILRTGIDYYILPVVRGRGGGLTM---DSIGNKTCPLDAVV------QEQEEVKQGLPL  51

Query  637  SFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY------QAMIVTGGVID  476
            +F P   + G  VI     LN+ F +   +  C +   WKL+       +  I  GG   
Sbjct  52   TFTPFNPKKG--VIRESTDLNIIFSA---NSICVQTTQWKLDNFDETTGKYFITLGGNQG  106

Query  475  K--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRI  374
                + I NWF+I+K    R Y   + P++C  C++
Sbjct  107  NPGRETISNWFKIEK--FERDYKLVYCPTVCDFCKV  140



>ref|XP_003534080.1| PREDICTED: miraculin-like [Glycine max]
Length=199

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 55/191 (29%), Positives = 83/191 (43%), Gaps = 28/191 (15%)
 Frame = -2

Query  832  NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPA  653
              +LD +G  V A + YY +PA   + GG+ +A++     + CP DVV    + G Q   
Sbjct  28   EQVLDTSGKIVRARSSYYIVPASPDL-GGLDMASTG----ADCPLDVV---AIDGYQ---  76

Query  652  VRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN------YQAMIVT  491
              +PL F P+    G  VI     LN+ F     +  C +  VWKL        Q  + T
Sbjct  77   -GQPLIFTPVNFNKG--VIRVSTDLNIYFPV---ATSCPQTTVWKLKDYDYSTSQWFVTT  130

Query  490  GGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRIGYFRIGRVGNGYQLGINYN  317
            GG         + NWF+I+K  +   Y   + PS+C  C      IG   + Y   +  +
Sbjct  131  GGDFGNPGSQTMANWFKIEKYED--AYKLVYCPSVCNDCSYPCSDIGIYQDQYGKRLALS  188

Query  316  DESLYAFEFLK  284
             E  Y  +FL+
Sbjct  189  SEP-YKVKFLR  198



>ref|XP_010279465.1| PREDICTED: miraculin-like [Nelumbo nucifera]
Length=205

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/171 (27%), Positives = 78/171 (46%), Gaps = 27/171 (16%)
 Frame = -2

Query  853  PTKADGTN-AILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVI--N  683
            P KAD +  A+ D AG+ + +G KYY  PA     GG +   ++ G    CP  VV   N
Sbjct  21   PVKADASPPAVRDTAGHKLSSGVKYYIFPANPKKGGGFTFEATNNGK---CPFGVVQDNN  77

Query  682  ITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY--  509
                G+       P+ F+P+  +     + + +  N+ F  P    P    +VWK+    
Sbjct  78   KLSKGL-------PVRFFPVNPKMDTIRVSTDH--NIKFAIPISHPP--SSSVWKVGEYS  126

Query  508  ----QAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRI  374
                + ++ T GV+     D + +WF+I+K  +   Y   + PS+C  C++
Sbjct  127  KWIGKQLVTTCGVLGNPGRDTLSSWFKIEKYDD--DYKLVFCPSVCKSCKV  175



>ref|XP_009614755.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=210

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 79/192 (41%), Gaps = 25/192 (13%)
 Frame = -2

Query  925  LVFSGIAISFLPLAISGLPPLIRLPTKA-DGTNAILDAAGNPVIAGAKYYAIPAVIGVDG  749
            + F  +A   +P  +  L        KA D  + +LD +GN V  G  YY +PA  G  G
Sbjct  1    MEFFNVARFMVPFLLVTLSTSFLFLVKAQDVPDPVLDVSGNAVRTGVNYYILPAGQGNGG  60

Query  748  GISVAN-SDTGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNV  572
            G+ VA+  +  NP          +        ++   L F P+     + +I     LNV
Sbjct  61   GLQVASIRNRTNPL---------VVSQHADESSIGGYLQFSPVNPN--ENIIGISTDLNV  109

Query  571  AFDSPDPSDPCAEENVWKLNYQA-----MIVTGGVIDK--EDDIGNWFRIQKNINGRGYL  413
             F S   SD      VW++N +      ++  GGV      + + NWFRI K  +   Y 
Sbjct  110  KFTSIHISD---SSTVWRINTELIPQRYLVTVGGVEGNPGRETLSNWFRIDKYED--AYK  164

Query  412  FTWWPSLCLGCR  377
              + P +C  CR
Sbjct  165  LVYCPGVCETCR  176



>ref|XP_003534079.1| PREDICTED: miraculin-like [Glycine max]
Length=199

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 71/159 (45%), Gaps = 27/159 (17%)
 Frame = -2

Query  832  NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPA  653
              +LD +G  V A + YY +PA   + GG+ +A +     + CP DVV+   + G Q   
Sbjct  28   EQVLDTSGKIVRARSSYYIVPASPDL-GGLDMATTG----ADCPLDVVV---VDGYQ---  76

Query  652  VRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN------YQAMIVT  491
              +PL F P+    G  VI     LN+ F     +  C +  VWKL        Q  + T
Sbjct  77   -GQPLIFTPVNFNKG--VIRVSTDLNIYFPV---ATSCPQTTVWKLKDYDYSTSQRFVTT  130

Query  490  GGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGC  380
            GG         + NWF+I+K  +   Y   + PS+C  C
Sbjct  131  GGDFGNPGSQTVANWFKIEKYED--AYKLVYCPSVCNDC  167



>ref|XP_002309884.2| hypothetical protein POPTR_0007s03650g [Populus trichocarpa]
 gb|EEE90334.2| hypothetical protein POPTR_0007s03650g [Populus trichocarpa]
Length=207

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 70/167 (42%), Gaps = 22/167 (13%)
 Frame = -2

Query  865  LIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVI  686
            L+   T A    A+LDA G P+ +G +YY +PAV  V GG+++ N + G  S CP  V  
Sbjct  14   LMATSTMAQTWPAVLDADGQPLRSGVEYYVLPAVTDVAGGLTLVNLNNG--SICPLFV--  69

Query  685  NITLAGMQP--PAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN  512
                 G +P  P V R  S     R   D V+       VAF        CA+   W + 
Sbjct  70   -----GQEPLAPVVSRGTSVIFTPRV-ADTVVRETRDFTVAFTG---VTICAQSTAWMVG  120

Query  511  YQAMIVTGGVIDKEDD----IGNW-FRIQKNINGRGYLFTWWPSLCL  386
             Q        I  E D       W F I KN  G  Y F W P+ CL
Sbjct  121  EQNPETRRRYILAETDPNPSSNAWHFNIVKNDQGL-YNFQWCPN-CL  165



>emb|CDP21779.1| unnamed protein product [Coffea canephora]
Length=213

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 72/159 (45%), Gaps = 20/159 (13%)
 Frame = -2

Query  844  ADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGM  665
            A+  N +LD  G  +  G +YY +  +    GG++      GN   CP  VV      G 
Sbjct  21   AEEPNPVLDTNGEEIRPGVEYY-MGTIFRPGGGVTYGKG-PGN-EICPLAVVQAWLQRG-  76

Query  664  QPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY-----QAM  500
                   P++F P+  E G  V+     LN+ F  P   + C   NVWK+++     Q  
Sbjct  77   ------DPVTFTPVNPEEG--VVRVSTDLNIKFAEPPIINFCRGSNVWKVHFNEALKQHF  128

Query  499  IVTGGVIDKE--DDIGNWFRIQKNINGRGYLFTWWPSLC  389
            ++T GV      +   NWF+I+  ++ R Y F + P++C
Sbjct  129  VLTDGVEGNSGCETTANWFKIEA-VSDRDYKFVFCPTVC  166



>gb|AHJ25677.1| Kunitz-type trypsin inhibitor [Curcuma longa]
Length=213

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/172 (26%), Positives = 77/172 (45%), Gaps = 19/172 (11%)
 Frame = -2

Query  865  LIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVI  686
            L  L  +A    ++ D  G  +  G +YY +P + G  GG+++A     +   CP    +
Sbjct  17   LCSLSAEATSFASVRDTDGRSLRPGHEYYILPLIRGRGGGLTLAARSNDSSFACP----L  72

Query  685  NITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKL---  515
             +   G++  +   P+ F P   EG + V +S   LNV F +   +  C +  VW+L   
Sbjct  73   AVAQEGLEVDS-GLPVIFSPAP-EGSEFVKMST-DLNVRFSA---ATICVQSTVWRLGDV  126

Query  514  ---NYQAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRI  374
                 +  +++GGV          NWF+I++    R Y     PS+C  C++
Sbjct  127  DASTGRRYVISGGVEGSPGAGTASNWFKIER-YGERDYKLVHCPSVCQDCKV  177



>gb|AFL91230.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=159

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/142 (31%), Positives = 66/142 (46%), Gaps = 20/142 (14%)
 Frame = -2

Query  787  KYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGG  608
            +YY +P   G  GG+++A +      +CP DVV      G +      PL+F P+  + G
Sbjct  1    EYYXLPVFXGRGGGVTLAPTRN---ESCPLDVV----QEGFELDD-GLPLTFTPVDPKKG  52

Query  607  DAVIISQYPLNVAFDSPDPSDPCAEENVWKLN-YQAMIVTGGVIDKE----DDIGNWFRI  443
              VI     LN+ F +   S  C + NVW L  Y+   +  G         + I NWF+I
Sbjct  53   --VIRESTDLNIIFSA---SSICIQSNVWMLEEYEGQRIISGRGTAGNPGGETISNWFKI  107

Query  442  QKNINGRGYLFTWWPSLCLGCR  377
            +K  N  GY   + P++C  CR
Sbjct  108  EKYEN--GYKLVYCPTVCDLCR  127



>ref|XP_004235412.1| PREDICTED: miraculin-like [Solanum lycopersicum]
Length=246

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 73/157 (46%), Gaps = 21/157 (13%)
 Frame = -2

Query  826  ILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVR  647
            +LD +GNP++ G++Y+ +P        +S  +++ G   +   + V  + +      +V 
Sbjct  29   VLDISGNPLVKGSQYFIVP--------VSGRSNEGGLDVSSIRNTVDTLVVTQNAQSSVG  80

Query  646  RPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN-----YQAMIVTGGV  482
            + L F P+  +  + ++     LNV F +   SD  +   VW +N      + ++  GGV
Sbjct  81   KSLRFTPV--DANENIVRLSTDLNVKFMNIIFSDNMS--TVWTINTRLIPQRNLVSVGGV  136

Query  481  IDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCR  377
                  D +GNWF+I K      Y F + P +C  CR
Sbjct  137  EGNPGRDTLGNWFKIDK--YEEAYKFVYCPGVCETCR  171



>ref|XP_006847953.1| hypothetical protein AMTR_s00029p00141480 [Amborella trichopoda]
 gb|ERN09534.1| hypothetical protein AMTR_s00029p00141480 [Amborella trichopoda]
Length=196

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/178 (24%), Positives = 81/178 (46%), Gaps = 27/178 (15%)
 Frame = -2

Query  853  PTKADGTNAILDAAGNPVIAGAKYYAIPAV-IGVDGGISVANSDTGNPSTCPTDVVINIT  677
            P     T+ +LD  G+P+   ++YY +P +   +  G++VA  +     +CP +V ++  
Sbjct  10   PIAQAATDFVLDLDGHPLRTDSQYYILPVLNQKITSGLTVATRN----GSCPLNVALSTG  65

Query  676  LAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKL-NYQAM  500
            +      +   P++F P+    GD V+      N+ F++      C +  VW+  N+  +
Sbjct  66   I------STGLPVTFSPVN--AGDKVVRLSVDQNIQFEA---ITICIQSTVWRRSNFDQV  114

Query  499  -----IVTGGVIDK--EDDIGNWFRIQKN---INGRGYLFTWWPSLCLGCRIGYFRIG  356
                 ++TGGV        + NWF +++    +N   Y   + P +C  CRI    +G
Sbjct  115  TGIQFVITGGVTGNPGRATVSNWFTVERESEVVNNGRYKLVFCPGVCDICRINCGNLG  172



>ref|XP_006372631.1| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|ERP50428.1| trypsin protein inhibitor 3 [Populus trichocarpa]
Length=209

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 75/165 (45%), Gaps = 23/165 (14%)
 Frame = -2

Query  826  ILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVR  647
            +LD  G  ++AG +YY +P   G  GGI++A+    N ++CP  VV +         +  
Sbjct  28   VLDIDGEKLVAGTEYYILPVFRGRGGGITMAS----NKTSCPLAVVQD-----RLEVSKG  78

Query  646  RPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKL------NYQAMIVTGG  485
             PL+F P   +    +++S   LN+ F +      C +  VWK+        Q  + TGG
Sbjct  79   LPLTFTPAADDKKGVILVST-DLNIKFLA---KTTCPQSTVWKITKSSNSKVQWFVSTGG  134

Query  484  VIDKE--DDIGNWFRIQKNINGRGYLFTWWPSLCLGCRIGYFRIG  356
            V      + + NWF+I+K  +   Y   + P+    C +    IG
Sbjct  135  VEGNPGFNTVTNWFQIEKADD--DYKIVFCPTKVCNCGVLCRDIG  177



>ref|XP_006390569.1| hypothetical protein EUTSA_v10019129mg [Eutrema salsugineum]
 gb|ESQ27855.1| hypothetical protein EUTSA_v10019129mg [Eutrema salsugineum]
Length=213

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 82/172 (48%), Gaps = 21/172 (12%)
 Frame = -2

Query  895  LPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGN  716
            L L+   L  L+   T A  TN +LD AG+PV +  +YY IPA  G  GG+  ++ +   
Sbjct  4    LTLSFITLTVLLAGLTAASATN-VLDIAGHPVQSNFQYYIIPAKTGTGGGLVPSSRNLNT  62

Query  715  PSTCPTDVVINITLAGMQPPAVR-RPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPC  539
             + C     +N+ +     P V   P++F  L  +  + ++     LN+ FDS      C
Sbjct  63   DNLC-----LNLDIVQSSSPFVSGLPITFSLLNTK--NKLVQLSTSLNLEFDSTVW--LC  113

Query  538  AEENVWKLNY-----QAMIVTGGVIDKEDDIGNWFRIQKNINGRGYLFTWWP  398
             E  VW++++     ++ +  GG   K +   ++F+IQ+  +G  Y   + P
Sbjct  114  PESKVWRIDHSVQLRKSFVSIGGEKRKAN---SFFQIQQ--DGDAYKLMYCP  160



>ref|XP_004235491.1| PREDICTED: cysteine protease inhibitor 8-like [Solanum lycopersicum]
Length=224

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 88/198 (44%), Gaps = 25/198 (13%)
 Frame = -2

Query  826  ILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVR  647
            +LD  G  +    +Y  +   I V GG SV   +  N + CP DV+ + + +     AV 
Sbjct  32   VLDREGKSLKINEEY--VINSIAVGGG-SVYLDNIKNRTQCPNDVLHDSSGSFYNSTAVL  88

Query  646  RPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKL-NYQ--------AMIV  494
                FY ++   G   +     +++ F +   S  C  E VW+  +Y           ++
Sbjct  89   ----FYTMQL--GSLFVSENQDVSIMFSTSSVSKSCVNETVWQAGDYMLGPIHPPPRFVI  142

Query  493  TGGVID--KEDDIGNWFRIQKNINGR--GYLFTWWPS--LCLGCRIGYFRIGRVGNGYQL  332
            TG  +     ++I NWF+I K+  GR   Y   + PS  +C  C++    +G   +  + 
Sbjct  143  TGATLGFPGPNNIKNWFKIVKHETGRPHSYKLRYCPSKFICPTCQVDCADVGLYKDSGRT  202

Query  331  GINYNDESLYAFEFLKVD  278
             +  NDE+ YAF F KV+
Sbjct  203  RLVLNDET-YAFGFSKVN  219



>sp|P35812.1|ITC_ALOMA RecName: Full=Trypsin/chymotrypsin inhibitor [Alocasia macrorrhizos]
Length=184

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 86/201 (43%), Gaps = 32/201 (16%)
 Frame = -2

Query  835  TNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPP  656
            TN +LD  GN +  G  YYA  +V+   GG+++A        +CP +V         Q P
Sbjct  1    TNPVLDVDGNELQRGQLYYAT-SVMRPGGGLTLAAPK----GSCPLNVA--------QAP  47

Query  655  AVR---RPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNYQA-MIVTG  488
                  RPL+F+P   +  D  +     L + F  P+P+  C +  VW  + +A  + TG
Sbjct  48   FDEYSGRPLAFFPENAD--DDTVQEGSTLYIMF--PEPTR-CPQSTVWTFDREAGFVTTG  102

Query  487  GVIDKEDDIGN-WFRIQKNINGRGYLFTWWPSLC--------LGCRIGYF-RIGRVGNGY  338
            G   K     N  F I+K  +       +   +C          CR+G    +G    G 
Sbjct  103  GTTSKAIGPHNSRFAIRKAGDASSQPRDYQIEVCPCSTGVERPSCRMGCLGTLGLAEGGK  162

Query  337  QLGINYNDESLYAFEFLKVDE  275
             + +N N+ES +   F+KV E
Sbjct  163  NVLLNINNESPHTIRFVKVKE  183



>gb|KDP46945.1| hypothetical protein JCGZ_07962 [Jatropha curcas]
Length=175

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 67/151 (44%), Gaps = 26/151 (17%)
 Frame = -2

Query  835  TNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPP  656
            +  ILD  G P+ +G +Y+ +PA   + GG+++ N     P     + +  +   G+   
Sbjct  4    STTILDTDGQPLTSGVEYFVLPAATDIAGGLTLVNRTGSCPLYVGQEPLSTVVSQGL---  60

Query  655  AVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN-----YQAMIVT  491
                P+ F P     GD+V+       VAF +   S  C +   W++       +  IVT
Sbjct  61   ----PVVFTP---NDGDSVVREDISFTVAFSA---STTCVQSTGWRVENDEEVSRTFIVT  110

Query  490  GGVIDKEDDIGNWFRIQKNINGRGYLFTWWP  398
            GG  D+     ++FRIQ + NG  Y   W P
Sbjct  111  GG--DQ-----SFFRIQIDDNGL-YNLIWCP  133



>ref|XP_004515058.1| PREDICTED: miraculin-like [Cicer arietinum]
Length=196

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 80/196 (41%), Gaps = 38/196 (19%)
 Frame = -2

Query  946  MKTAIILLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPA  767
            MK   IL  F   A+S  PL          L +     + +LD +G  +   A YY IPA
Sbjct  1    MKITTILAFFLLFALSSQPL----------LGSAKASPDHVLDTSGKKLRVDADYYIIPA  50

Query  766  VIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQ  587
                +GG     +   N  +CP  VV++    G+       PL F P+K      VI   
Sbjct  51   ----NGGFIDLET---NGESCPLHVVVDKHSQGL-------PLRFAPIK-----GVIRVS  91

Query  586  YPLNVAFDSPDPSDPCAEENVWKLN----YQAMIVTGGVID--KEDDIGNWFRIQKNING  425
              LN+   + D   P     VWK++     +  +  GGV+       I +WF+I+K  + 
Sbjct  92   IDLNIMLANYDSRCP-HHSIVWKIDPSSKEETFVTLGGVLGYPSSKTIQSWFKIEKYED-  149

Query  424  RGYLFTWWPSLCLGCR  377
              Y   + P +C  C+
Sbjct  150  -AYKLVYCPYVCPSCK  164



>gb|AIT42208.1| Kunitz-type inhibitor C [Solanum tuberosum]
Length=222

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 105/232 (45%), Gaps = 37/232 (16%)
 Frame = -2

Query  928  LLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAIL----DAAGNPVIAGAKYYAIPAVI  761
            LLV S +++     + +   P++   T  D  N +L    D  G+P+  G +Y  +  ++
Sbjct  10   LLVSSTLSLVAFARSFTSENPIVLPTTCHDDDNLVLLEVYDQDGHPLRIGERYIIMNPLL  69

Query  760  GVDGGISVANSDTGNPSTCPTDVVINITL---AGMQPPAV--RRPLSFYPLKREGGDAVI  596
            G  G + + N   GN   CP  V+ ++++    G   P V  R+  S Y      GD V 
Sbjct  70   GA-GAVYLYN--IGNLQ-CPNAVLQHMSIPQFLGKGTPVVFVRKSESDY------GDVVR  119

Query  595  ISQYPLNVAFDSPDPSDPCAEENVWKLNYQAMIVTGGVIDKEDDIGNWFRIQKNI-----  431
            +        F     +  C +E VWK+N + ++VTGG +  E+DI   F+I+K       
Sbjct  120  VMTAVYIKFF--VKTTKLCVDETVWKVNDEQLVVTGGRVGNENDI---FKIKKTDLVTPG  174

Query  430  -NGRGYLFTWWPSLCLGCR-IGYFRIGRVGNGY-QLGINYNDESLYAFEFLK  284
             +   Y     PS  LGC+ IG    G   NGY +L    +D+   +F F+K
Sbjct  175  GSKNVYKLLHCPSH-LGCKNIG----GNFKNGYPRLATVDDDKHFISFVFIK  221



>ref|XP_010537526.1| PREDICTED: bark lectin isoform 1-like [Tarenaya hassleriana]
Length=210

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 62/139 (45%), Gaps = 17/139 (12%)
 Frame = -2

Query  835  TNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPP  656
            ++ +LD  G PV  G  YY +PA  G   G  V  +       CP  VV         P 
Sbjct  28   SSIVLDTVGRPVRPGVPYYILPAEDGTGAGGLVPATAYYQRDACPPAVV-----QSQLPY  82

Query  655  AVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDP--CAEENVWKLNYQAMIVTGGV  482
             +  P++F P+  E G   + +   L V FD    SD   C E  VWK +Y  ++ T  V
Sbjct  83   VLGVPVTFAPVNSEAG--FVPTSSDLTVEFD----SDVWICPESKVWKTDYAQLLRTSYV  136

Query  481  I---DKEDDIGNWFRIQKN  434
                DK D   +WF+I+++
Sbjct  137  SAGGDKSDG-DSWFKIEQD  154



>ref|XP_011046091.1| PREDICTED: miraculin-like [Populus euphratica]
Length=206

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 84/195 (43%), Gaps = 29/195 (15%)
 Frame = -2

Query  910  IAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVAN  731
            +A+SFL  A +    L R+   A     +L+  G  +  G  YY +  + G  GG+ +A+
Sbjct  6    LALSFLLFAFAA-NQLPRVAATA-APEPVLNVTGKILRTGTGYYILLVIRGRGGGLKMAS  63

Query  730  SDTGNPSTCPTDVVINITLA--GMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSP  557
            +      TCP DVV     A  G+       PL F P+  + G  V+     LN+ F + 
Sbjct  64   TVR---RTCPLDVVQERYEASNGL-------PLKFTPVNTKKG--VVRVHTDLNIRFSA-  110

Query  556  DPSDPCAEENVWKLN------YQAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWW  401
              +  C +   WKL+       Q  + T GV      +   NWF+I+K  +   Y     
Sbjct  111  --ASICQQSTAWKLDSYDEWTKQWFVTTNGVEGNPGSETTNNWFKIEKLED--KYKLVVC  166

Query  400  PSLCLGCRIGYFRIG  356
            P++C  C++    IG
Sbjct  167  PTVCQHCKVMCKDIG  181



>ref|XP_010041215.1| PREDICTED: miraculin-like [Eucalyptus grandis]
 gb|KCW44534.1| hypothetical protein EUGRSUZ_L01961 [Eucalyptus grandis]
Length=203

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 84/184 (46%), Gaps = 24/184 (13%)
 Frame = -2

Query  838  GTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQP  659
             ++ +LD  G+ +  G  Y+ +P + G  GG+++  S +GN   CP  VV        Q 
Sbjct  27   ASSPVLDTDGHKLQTGVNYHILPVLRGRGGGLTLGASRSGN---CPLAVV-----QEQQE  78

Query  658  PAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN------YQAMI  497
             +   P  F P+    G + I     LNV FD+   +  C +  VW+L        Q  +
Sbjct  79   LSDGLPAKFSPV---DGRSTIRLSTDLNVWFDA---ATICVQSTVWRLAAFDEEVKQYFV  132

Query  496  VTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRIGYFRIGRVGNGYQLGIN  323
             +GGV+     + + NWF+I+K      Y F + P++C  C++    +G   +G    + 
Sbjct  133  ESGGVLGNPGRETVSNWFKIEK--MDEDYNFRFCPTVCDTCKVICRDVGIYVDGATRRLA  190

Query  322  YNDE  311
             +DE
Sbjct  191  LSDE  194



>emb|CDP19138.1| unnamed protein product [Coffea canephora]
Length=218

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 72/162 (44%), Gaps = 22/162 (14%)
 Frame = -2

Query  844  ADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGM  665
            A+  N +LD  G  +  G +Y+ +    G  GG        GN   CP        LA +
Sbjct  21   AEEPNPVLDINGEEIRPGVEYHVVSLFWGAGGGGVTYGKGPGN-EICP--------LAVV  71

Query  664  QPPAVR---RPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY-----  509
            Q P+ R    P++F P+  E G  V+     LN+ F  P   + C   NVWK+++     
Sbjct  72   QEPSDRNRGHPVTFTPVNPEEG--VVRVSTDLNIKFAEPPIINFCRGSNVWKVHFNEALE  129

Query  508  QAMIVTGGVIDKE--DDIGNWFRIQKNINGRGYLFTWWPSLC  389
            Q  ++T GV      +   NWF+I+  I   GY   + P++C
Sbjct  130  QHFVLTDGVEGNSGCETEANWFKIEA-IGSLGYKLVYCPAVC  170



>gb|KHM99741.1| Miraculin [Glycine soja]
Length=199

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 72/159 (45%), Gaps = 27/159 (17%)
 Frame = -2

Query  832  NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPA  653
              +LD +G  V A + YY +PA   + GG+ +A++     + CP DVV+   + G Q   
Sbjct  28   EQVLDTSGKIVRARSSYYIVPASPDL-GGLDMASTG----ADCPLDVVV---VDGYQ---  76

Query  652  VRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN------YQAMIVT  491
              +PL F P+    G  VI     LN+ F     +  C +  VWKL        Q  + T
Sbjct  77   -GQPLIFTPVNFNKG--VIRVSTDLNIYFPV---ATSCPQTTVWKLKDYDYSTSQWFVTT  130

Query  490  GGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGC  380
            GG         + NWF+I+K  +   Y   + PS+C  C
Sbjct  131  GGDFGNPGSQTVANWFKIEKYED--AYKLVYCPSVCNDC  167



>gb|AEK26923.1| Kunitz-type trypsin inhibitor C7 [Populus nigra]
Length=183

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 67/160 (42%), Gaps = 25/160 (16%)
 Frame = -2

Query  829  AILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQP--P  656
            A+LDA G P+ +G +YY +PAV  V GG+++ N + G  S CP  V       G +P  P
Sbjct  7    AVLDADGQPLRSGVEYYVLPAVTDVAGGLTLVNLNNG--SICPLFV-------GQEPLAP  57

Query  655  AVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNYQAMIVTGGVID  476
             V R  S     R   D V+       VAF        CA+   W++  +        I 
Sbjct  58   VVSRGTSVIFTPRV-ADTVVRETRDFTVAFTG---VSVCAQSTAWRVGERNPETRRRYIL  113

Query  475  KEDD----IGNW-FRIQKNINGRGYLFTWWPSLCLGCRIG  371
             E +       W F I KN  G  Y F W    CL C  G
Sbjct  114  AETNPIPSSNAWHFNIVKNDQGL-YKFQW----CLNCLTG  148



>ref|XP_003620187.1| Miraculin [Medicago truncatula]
 gb|AES76405.1| Kunitz type trypsin inhibitor / miraculin [Medicago truncatula]
Length=212

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/165 (28%), Positives = 74/165 (45%), Gaps = 25/165 (15%)
 Frame = -2

Query  832  NAILDAAGNPVIAGAKYYAIPAV-IGVDGGISVANS-----DTGNPSTCPTDVVINITLA  671
            + ++D +G  + A   YY IPA      G +S  NS     +T   S CP DVV+     
Sbjct  28   DQVIDTSGKKLRADTNYYIIPAKPFTTCGFVSCFNSGGIALETVGES-CPLDVVVVKHNQ  86

Query  670  GMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEEN-VWKLN----YQ  506
            G+       PL F P+  + G  V+     LN+ F +      C   + VWK++     +
Sbjct  87   GL-------PLRFTPVNNKKG--VVRVSTDLNIKFSNDAYDSRCPNHSLVWKIDPFSKEE  137

Query  505  AMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCR  377
              + T GV+     + I NWF+I+K  +   Y   + P++C  C+
Sbjct  138  TFVTTNGVLGNPGSNTIHNWFQIEKYED--AYKLVYCPNVCPSCK  180



>emb|CAI77768.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 48/166 (29%), Positives = 68/166 (41%), Gaps = 25/166 (15%)
 Frame = -2

Query  865  LIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGG-ISVANSDTGNPSTCPTDVV  689
            ++ +P+    T  +LD  G  + AG +Y       G  GG +S  N       TCP DV 
Sbjct  17   VLSVPSIEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVSATNK------TCPDDV-  69

Query  688  INITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN-  512
            I  +L  +Q      P++F P   E  D VI     LN+ F        C   +VWK+  
Sbjct  70   IQYSLDLLQG----LPVTFSPASSE--DDVIRVSTDLNIKFS---IKKACDHSSVWKIQK  120

Query  511  -----YQAMIVTGGVIDKE--DDIGNWFRIQKNINGRGYLFTWWPS  395
                  Q ++ TGG       D   NWF+I+K     GY   + P 
Sbjct  121  SSNSEVQRLVTTGGEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPE  166



>ref|XP_009344614.1| PREDICTED: miraculin-like [Pyrus x bretschneideri]
Length=210

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 98/232 (42%), Gaps = 47/232 (20%)
 Frame = -2

Query  946  MKTAIILLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPA  767
            M T  + L+ S  +  +L +A+S       L   +D +NA+LD  G  + +G  YY  PA
Sbjct  1    MYTMSMKLIGSLCSCIWLVMAVS------TLAQTSDDSNAVLDTTGQALQSGVDYYINPA  54

Query  766  VIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQ  587
            +    G  ++ N  TG P        +N+    +  P    P++F P     G+ V+   
Sbjct  55   ITDSGGRFTLINR-TGCP--------LNVGQENVSGPE-GLPVTFSPFVE--GETVVREG  102

Query  586  YPLNVAFDSPDPSDPCAEENVWKL------NYQAMIVTGGVIDKEDDIG------NWFRI  443
                + F +   S  C +   WK+        + +I+TG    ++++ G      N+FRI
Sbjct  103  RDQKITFSA---STICVQSTAWKVGETDQDTQRRLIITG----EDENQGLPGPARNYFRI  155

Query  442  QKNINGRG-YLFTWWPS-LCLGCRIGYFRIGRVGNGYQLGINYNDESLYAFE  293
             K     G Y   W P+ +C  CR   F  G VG      I  ND+ L A +
Sbjct  156  TKQATPDGVYNLEWCPTEVCPTCR---FICGSVG-----AIVENDKRLLALD  199



>gb|AIT42206.1| Kunitz-type inhibitor C, partial [Solanum tuberosum]
Length=219

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 100/226 (44%), Gaps = 24/226 (11%)
 Frame = -2

Query  928  LLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAIL----DAAGNPVIAGAKYYAIPAVI  761
            L++ S +++     + S   P++   T  D  N +L    D  GNP+  G +Y     ++
Sbjct  8    LVLSSTLSLVAFAQSFSSENPIVLPTTCHDDDNLVLPEVYDQDGNPLRIGERYIIKNPLL  67

Query  760  GVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYP  581
            G   G +V   + GN   CP  V+ ++++          P+ F          V+     
Sbjct  68   G---GGAVYLDNIGNLQ-CPNAVLQHMSIPQFLGKGT--PVMFVRKSESDYRDVVRVMTG  121

Query  580  LNVAFDSPDPSDPCAEENVWKLNYQAMIVTGGVIDKEDDIGNWFRIQK-NINGRG----Y  416
            + + F     S  C +E VWK+N++ ++VTGG +  E+DI   F+I+K ++  RG    Y
Sbjct  122  VYIKF-FVKTSRLCVDETVWKVNHEQLVVTGGNVGNENDI---FKIKKTDLVVRGMKNVY  177

Query  415  LFTWWPSLCLGCRIGYFRIGRVGNGY-QLGINYNDESLYAFEFLKV  281
                 PS      IG        NGY +L   ++D+    F F+KV
Sbjct  178  KLLHCPSHLQCKNIG----SNFKNGYPRLVTVHDDKDFIPFVFIKV  219



>emb|CAI77785.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 68/165 (41%), Gaps = 23/165 (14%)
 Frame = -2

Query  865  LIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVI  686
            ++ +P+    T ++LD  G  + AG +Y       G  GG   A +      TCP DV I
Sbjct  17   VLSVPSIEASTESVLDIQGEELKAGTEYIISSIFWGAGGGDVAATN-----KTCPDDV-I  70

Query  685  NITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN--  512
              +L  +Q      P++F P   E  D VI     LN+ F        C   +VWK+   
Sbjct  71   QYSLDLLQG----LPVTFSPASSE--DDVIRVSTDLNIKFS---IKKACDRSSVWKIQKS  121

Query  511  ----YQAMIVTGGVIDKE--DDIGNWFRIQKNINGRGYLFTWWPS  395
                 Q ++ TGG       D   NWF+I+K     GY   + P 
Sbjct  122  SNSEVQWLVTTGGEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPE  166



>ref|XP_010279488.1| PREDICTED: miraculin-like [Nelumbo nucifera]
Length=208

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 76/165 (46%), Gaps = 27/165 (16%)
 Frame = -2

Query  841  DGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQ  662
            D   A+LD  G  + + A Y+ +PA+ G+ GG++  ++  G   TCP DVV +       
Sbjct  28   DEPEAVLDTMGRQLCSTATYFILPAISGMGGGLNFESTKNG---TCPFDVVQD-----ED  79

Query  661  PPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDS--PDPSDPCAEENVWKL---NYQA--  503
              +   PL+F P+  +     +++   +  A D+  P P+       VW L   N  A  
Sbjct  80   EESNGLPLAFSPVNPKEEIIRVLTDQNIRFAIDTLLPQPT-------VWNLGDFNESART  132

Query  502  -MIVTGGVIDKE--DDIGNWFRIQKNINGRGYLFTWWPSLCLGCR  377
             ++ T G I     + + NWFRI+   +   Y   + P++C  CR
Sbjct  133  FLVETCGSIGNPGIETLSNWFRIEPFDD--DYKLVFCPTVCNFCR  175



>ref|XP_009344613.1| PREDICTED: miraculin-like [Pyrus x bretschneideri]
Length=207

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 86/202 (43%), Gaps = 41/202 (20%)
 Frame = -2

Query  856  LPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINIT  677
            L   +D +NA+LD AG  + +G  YY  PA+    G  ++ N  TG P        +N+ 
Sbjct  22   LAQTSDDSNAVLDTAGQALQSGVDYYINPAITDSGGRFTLINR-TGCP--------LNVG  72

Query  676  LAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKL------  515
               +  P    P++F P     G+ V+       + F +   S  C +   WK+      
Sbjct  73   QENVSGPK-GLPVTFSPFVE--GETVVREGRDQKITFSA---STICVQSTAWKVGETDQD  126

Query  514  NYQAMIVTGGVIDKEDDIG------NWFRIQKNINGRG-YLFTWWPS-LCLGCRIGYFRI  359
              + +I+TG    ++++ G      N+FRI K     G Y   W P+ +C  CR   F  
Sbjct  127  TQRRLIITG----EDENQGLPGPARNYFRITKQATPDGVYNLEWCPTEVCPTCR---FIC  179

Query  358  GRVGNGYQLGINYNDESLYAFE  293
            G VG      I  ND+ L A +
Sbjct  180  GSVG-----AIVENDKRLLALD  196



>gb|AFL91234.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=161

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/144 (31%), Positives = 66/144 (46%), Gaps = 20/144 (14%)
 Frame = -2

Query  793  GAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKRE  614
            G +YY +P   G  GG+++A +      +CP DVV      G +      PL+F P+  +
Sbjct  1    GTEYYILPVFRGRGGGVTLAPTRN---ESCPLDVV----QEGFELDN-GLPLTFTPVDPK  52

Query  613  GGDAVIISQYPLNVAFDSPDPSDPCAEENVWKL-NYQAMIVTGGVIDK----EDDIGNWF  449
             G  VI     LN+ F +   S  C + NVW L  Y+   +  G         + I NWF
Sbjct  53   KG--VIRESTDLNIIFSA---SSICIQSNVWMLEEYEGQRIISGRGTSGNPGGETISNWF  107

Query  448  RIQKNINGRGYLFTWWPSLCLGCR  377
            +I+K  N   Y   + P++C  CR
Sbjct  108  KIEKYEN--DYKLVYCPTVCDLCR  129



>ref|XP_010098225.1| Endogenous alpha-amylase/subtilisin inhibitor [Morus notabilis]
 gb|EXB74710.1| Endogenous alpha-amylase/subtilisin inhibitor [Morus notabilis]
Length=191

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 47/183 (26%), Positives = 78/183 (43%), Gaps = 23/183 (13%)
 Frame = -2

Query  865  LIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVI  686
            L+ +       N +LD +G P+  GA+YY  PA+    G  ++ + +     +CP  V  
Sbjct  11   LLAMAVAVTAQNPVLDTSGEPLRRGAEYYIKPAITDNGGRFTLIDRN----GSCPFYVGQ  66

Query  685  NITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNYQ  506
              + A     A   P++F P  +E  + ++  +    V+F +      C +   W+L+ +
Sbjct  67   ENSSA-----AKGLPVTFEPFFKE--ENIVRERRDFKVSFAA---VTVCVQSTTWQLDGE  116

Query  505  AMIVTGGVIDKEDDIGNWFRIQKNINGRGYLFTWWPSL-CLGCRIGYFRIGRVG----NG  341
             +I TG   D      N+F I        Y   W P   CL     +FR G+VG    NG
Sbjct  117  -LISTG---DDGAGFNNYFHISHGQVESTYFMGWCPQDPCLPADCSWFRCGQVGAIVENG  172

Query  340  YQL  332
             +L
Sbjct  173  KRL  175



>ref|NP_001237312.1| uncharacterized protein LOC100527782 precursor [Glycine max]
 gb|ACU16955.1| unknown [Glycine max]
Length=199

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 74/173 (43%), Gaps = 27/173 (16%)
 Frame = -2

Query  832  NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPA  653
              +LD AG  V A + YY +PA   + GG+ +A++     + CP DVV    + G Q   
Sbjct  28   EQVLDTAGKIVRARSSYYIVPASPDL-GGLDMASTG----ADCPLDVV---AVDGYQ---  76

Query  652  VRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN------YQAMIVT  491
              +PL F P+    G  VI     LN+ F        C +  VWKL        Q  + T
Sbjct  77   -GQPLIFTPVNFNKG--VIRVSTDLNIYFPV---GTSCPQTTVWKLKDYDYSTSQWFVTT  130

Query  490  GGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRIGYFRIGRVGNGY  338
            GG         + NWF+I+K  +   Y   + PS+C  C      IG   + Y
Sbjct  131  GGDFGNPGSQTVANWFKIEKYED--AYKLVYCPSVCNDCSYPCSDIGIYQDEY  181



>gb|AFK34345.1| unknown [Medicago truncatula]
Length=212

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 76/165 (46%), Gaps = 25/165 (15%)
 Frame = -2

Query  832  NAILDAAGNPVIAGAKYYAIPAV-IGVDGGISVANS-----DTGNPSTCPTDVVINITLA  671
            + ++D +G  + A   YY IPA      G +S  NS     +T   S CP DVV+     
Sbjct  28   DQVIDTSGKKLRADTNYYIIPAKPFTTCGFVSCFNSGGIALETVGES-CPLDVVVVKHNQ  86

Query  670  GMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEEN-VWKLN----YQ  506
            G+       PL F P+  + G AV +S   LN+ F +      C   + VWK++     +
Sbjct  87   GL-------PLRFTPVNNKKG-AVRVST-DLNIKFSNDAYDSRCPNHSLVWKIDPFSKEE  137

Query  505  AMIVTGGVIDKE--DDIGNWFRIQKNINGRGYLFTWWPSLCLGCR  377
              + T GV+     + I NWF+I+K  +   Y   + P++C  C+
Sbjct  138  TFVTTNGVLGNPGFNTIHNWFQIEKYED--AYKLVYCPNVCPSCK  180



>emb|CAI77774.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 51/178 (29%), Positives = 71/178 (40%), Gaps = 28/178 (16%)
 Frame = -2

Query  904  ISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSD  725
             SFL  A      ++ +P+    T  +LD  G  + AG +Y       G  GG   A + 
Sbjct  9    FSFLLFAF-----VLSVPSIEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAATN-  62

Query  724  TGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSD  545
                 TCP DV I  +L  +Q      P++F P   E  D VI     LN+ F       
Sbjct  63   ----KTCPDDV-IQYSLDLLQG----LPVTFSPASSE--DDVIRVSTDLNIKFS---IKK  108

Query  544  PCAEENVWKLN------YQAMIVTGGVIDKE--DDIGNWFRIQKNINGRGYLFTWWPS  395
             C   +VWK+        Q ++ TGG       D   NWF+I+K     GY   + P 
Sbjct  109  ACDHSSVWKIQKSSNSEVQWLVTTGGEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPE  166



>ref|XP_007133280.1| hypothetical protein PHAVU_011G166500g [Phaseolus vulgaris]
 gb|ESW05274.1| hypothetical protein PHAVU_011G166500g [Phaseolus vulgaris]
Length=207

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 72/170 (42%), Gaps = 18/170 (11%)
 Frame = -2

Query  862  IRLPTKADGTNA-ILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVI  686
            +  PT +   N  ++D  G+P+ +  +Y+  PA+    G  ++ N +     +CP    +
Sbjct  17   VATPTLSQSNNRYVMDTHGDPLESDEEYFIRPAITDNGGRFTLINRN----QSCP----L  68

Query  685  NITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNYQ  506
            ++ L     P    P+ F P  RE  D  +     L V F   + S  C +   WKL   
Sbjct  69   HVGLENTDLPQ-GYPVRFTPFAREEDDDEVRVDRDLKVEF--VEVSSTCVQSTAWKLGEN  125

Query  505  -----AMIVTGGVIDKEDDIGNWFRIQKNINGRGYLFTWWPS-LCLGCRI  374
                   ++  G+ D     GN+FRI++  N   Y   W P+ +C  CR 
Sbjct  126  DTSIGRRVIVTGLDDGTHSAGNYFRIEETQNASIYNIRWCPTEVCPTCRF  175



>gb|KHM99743.1| Miraculin [Glycine soja]
Length=199

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 75/173 (43%), Gaps = 27/173 (16%)
 Frame = -2

Query  832  NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPA  653
              +LD +G  V A + YY +PA   + GG+ +A++     + CP DVV    + G Q   
Sbjct  28   EQVLDTSGKIVRARSSYYIVPASPDL-GGLDMASTG----ADCPLDVV---AVDGYQ---  76

Query  652  VRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN------YQAMIVT  491
              +PL F P+    G  VI     LN+ F     +  C +  VWKL        Q  + T
Sbjct  77   -GQPLIFTPVNFNKG--VIRVSTDLNIYFPV---ATSCPQTTVWKLKDYDYSTSQWFVTT  130

Query  490  GGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRIGYFRIGRVGNGY  338
            GG         + NWF+I+K  +   Y   + PS+C  C      IG   + Y
Sbjct  131  GGDFGNPGSQTVANWFKIEKYED--AYKLVYCPSVCNDCSYPCSDIGIYQDEY  181



>ref|XP_003620188.1| Miraculin [Medicago truncatula]
 gb|AES76406.1| Lipid transfer protein [Medicago truncatula]
Length=213

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 60/226 (27%), Positives = 98/226 (43%), Gaps = 52/226 (23%)
 Frame = -2

Query  946  MKTAIILLVFSGIAISFLPLAISGLPPLIRLPTKADGT-NAILDAAGNPVIAGAKYYAIP  770
            MK+  ILL     A+ F   A+S  P L     +AD +   ++D  G  V AG  YY  P
Sbjct  1    MKSICILL-----AVLF---ALSTQPLL----GEADASPEQVVDTEGKKVRAGVDYYIRP  48

Query  769  -----------AVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPL  623
                        V+G  G + +A S      TCP +VV+     G       + ++F P+
Sbjct  49   VPTTPCDGRGPCVVG-SGFVLIARSPN---ETCPLNVVVVEGFRG-------QGVTFTPV  97

Query  622  KREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY------QAMIVTGGVIDK--ED  467
              + G   + +   +  + ++      C E  +W L+       Q  + TGGV+    +D
Sbjct  98   NPKKGVIRVSTDLNIKTSLNTS-----CEESTIWTLDDFDSSTGQWFVTTGGVLGNPGKD  152

Query  466  DIGNWFRIQKNINGRGYLFTWWPSLCLGCRIGYFRIG--RVGNGYQ  335
             + NWF+I+K  +   Y F + P++C  C++    +G  R  NG Q
Sbjct  153  TVDNWFKIEKYED--DYKFVFCPTVCNFCKVMCRNVGIFRDSNGNQ  196



>ref|XP_007041757.1| 21 kDa seed protein, putative [Theobroma cacao]
 gb|EOX97588.1| 21 kDa seed protein, putative [Theobroma cacao]
Length=219

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 53/198 (27%), Positives = 82/198 (41%), Gaps = 22/198 (11%)
 Frame = -2

Query  898  FLPLAISGLPPLIRLPTKADGTNA---ILDAAGNPVIAGAKYYAIPAVIGVDGGISVANS  728
             +   ++ L  L    +K+  T+    + D  G+ V  G +YY + A+ G  GG      
Sbjct  1    MMKTTLAMLLLLFVFSSKSSATDENVPVYDVNGDEVRPGVQYYVVSAIWGAGGGGLYLGQ  60

Query  727  DTGNPSTCPTDVVINITLAGMQPPAVRR-PLSFYPLKREGGDAVIISQYPLNVAFDSPDP  551
                  TCP DV      A  +   VR  P++F  +  EG   VI     LN+ F  P P
Sbjct  61   GRNK--TCPYDV------AQERSDLVRGIPVTFSTVDTEGD--VIHESTDLNIKFIRPQP  110

Query  550  SDPCAEENVWKLNY------QAMIVTGGVIDKEDDIGNWFRIQKNINGRGYLFTWWPSLC  389
            +  C+   VWK++       +  + TGG+      + + FRI     G  Y     PS+C
Sbjct  111  T-ACSPSTVWKVDCYDESGGEWFVTTGGLEGDAQALSSLFRITAAPGGISYKLALCPSVC  169

Query  388  LGC-RIGYFRIGRVGNGY  338
              C +     IGR  +G+
Sbjct  170  ESCTKYLCSEIGRHSSGF  187



>gb|ACO40080.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=180

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 55/191 (29%), Positives = 77/191 (40%), Gaps = 33/191 (17%)
 Frame = -2

Query  865  LIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGG-ISVANSDTGNPSTCPTDVV  689
            ++ +P+    T  +LD  G  + AG +Y       G  GG +S  N       TCP DV+
Sbjct  2    VLSVPSTEAYTEPVLDIQGEELKAGTEYIITSIFWGARGGDVSATNK------TCPDDVI  55

Query  688  I--NITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWK-  518
               +  L G+       P++F P   E  D VI     LN+ F        C   +VWK 
Sbjct  56   KYSSDRLQGL-------PVTFSPASSE--DDVIRVSTDLNIKFS---IKKACDHSSVWKI  103

Query  517  -----LNYQAMIVTGGVIDKE--DDIGNWFRIQKNINGRGYLFTWWPSLCLGCRIGYFRI  359
                 L  Q  + TGG       D + NWF+I+K   G GY     P     C +    I
Sbjct  104  QKSSNLEVQWFVTTGGEEGNPGIDTLTNWFKIEK--AGIGYKLVSCPEDICHCGVLCRDI  161

Query  358  G--RVGNGYQL  332
            G  R  NG ++
Sbjct  162  GIYRENNGRKI  172



>ref|XP_010098227.1| Endogenous alpha-amylase/subtilisin inhibitor [Morus notabilis]
 gb|EXB74712.1| Endogenous alpha-amylase/subtilisin inhibitor [Morus notabilis]
Length=192

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 47/176 (27%), Positives = 74/176 (42%), Gaps = 26/176 (15%)
 Frame = -2

Query  865  LIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVI  686
            L+ +   A   N + D +G P+  G +YY  PA     G  ++ + +     +CP  V  
Sbjct  13   LLAMAIAATARNPVRDTSGKPLRRGVEYYIKPAKTDHGGRFTLIDRN----GSCPFYVGQ  68

Query  685  NITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNYQ  506
              T AG        P++F P   E  + ++       V+F +   +  C +   WKL+  
Sbjct  69   ENTSAGRGL-----PVTFAPFFEE--EKIVRETRDFKVSFAA---ATTCVQSTTWKLD--  116

Query  505  AMIVTGGVIDKEDDIG--NWFRIQKNINGRGYLFTWWP-SLCLGCRIGYFRIGRVG  347
                 GG+I   D+ G  N+F I        Y+  W P   C GCR  + R G+VG
Sbjct  117  -----GGLIGTGDEGGYSNYFYISPGEVENTYVIGWCPDEACPGCR--WLRCGQVG  165



>ref|NP_001274816.1| Kunitz-type enzyme inhibitor S9C11 precursor [Solanum tuberosum]
 gb|AAL67830.1|AF460237_1 Kunitz-type enzyme inhibitor S9C11 [Solanum tuberosum]
Length=242

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 67/149 (45%), Gaps = 14/149 (9%)
 Frame = -2

Query  862  IRLPTKADGTN----AILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTD  695
            I LPT     N    A+LD  G+PV  G +Y     +I  +GG SV   + G    CP D
Sbjct  32   IVLPTTTHDDNLVLPAVLDQDGDPVKIGKEYIIETPII--EGG-SVYLDNIGG-HKCPND  87

Query  694  VVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKL  515
            V+++I   G+       P+ F        D V+   Y +++ F     S  C  + VWK+
Sbjct  88   VLLHIPYLGLTGDGT--PVKFI---LNDDDLVLREMYAIHIMFSVRTSSTSCVNQTVWKV  142

Query  514  -NYQAMIVTGGVIDKEDDIGNWFRIQKNI  431
             + +  +VTGG +  E+      +I+  +
Sbjct  143  GDEKDFLVTGGTVGNENTFFKMMKIEMEL  171



>ref|XP_006353929.1| PREDICTED: LOW QUALITY PROTEIN: Kunitz-type enzyme inhibitor 
S9C11 [Solanum tuberosum]
Length=244

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 67/149 (45%), Gaps = 14/149 (9%)
 Frame = -2

Query  862  IRLPTKADGTN----AILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTD  695
            I LPT     N    A+LD  G+PV  G +Y     +I  +GG SV   + G    CP D
Sbjct  32   IVLPTTTHDDNLVLPAVLDQDGDPVKIGKEYIIETPII--EGG-SVYLDNIGG-HKCPND  87

Query  694  VVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKL  515
            V+++I   G+       P+ F        D V+   Y +++ F     S  C  + VWK+
Sbjct  88   VLLHIPYLGLTGDGT--PVKFI---LNDDDLVLREMYAIHIMFSVRTSSTSCVNQTVWKV  142

Query  514  -NYQAMIVTGGVIDKEDDIGNWFRIQKNI  431
             + +  +VTGG +  E+      +I+  +
Sbjct  143  GDEKDFLVTGGTVGNENTFFKMMKIEMEL  171



>emb|CDP19136.1| unnamed protein product [Coffea canephora]
Length=216

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 68/156 (44%), Gaps = 18/156 (12%)
 Frame = -2

Query  832  NAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPA  653
            N ++D  G  +  G  YY +    G  G         GN   CP  VV        +P  
Sbjct  25   NPVVDFNGEEIRPGVDYYVVSVFPGGRGSGVTYGKGPGN-EICPLAVV------QARPDF  77

Query  652  VR-RPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY-----QAMIVT  491
             R  P++F P+  E  ++V+     LN+ F  P   + C   NVWK+++     Q  ++T
Sbjct  78   NRGHPVTFTPVNPE--ESVVRVSTDLNIKFSEPPFINFCRGSNVWKVHFNEALKQHFVLT  135

Query  490  GGVIDKE--DDIGNWFRIQKNINGRGYLFTWWPSLC  389
             GV      +   NWF+I+   N  GY F + P++C
Sbjct  136  DGVEGNSGCETEANWFKIELTGN-VGYKFVFCPAVC  170



>gb|AAL60243.1|AF459078_1 putative Kunitz-type tuber invertase inhibitor precursor, partial 
[Solanum tuberosum]
 gb|AIT42201.1| Kunitz-type inhibitor C, partial [Solanum tuberosum]
Length=219

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 102/230 (44%), Gaps = 34/230 (15%)
 Frame = -2

Query  928  LLVFSGIAISFLPLAISGLPPLIRLPTKADGTNAIL----DAAGNPVIAGAKYYAIPAVI  761
            L++ S +++     + S   P++   T  D  N +L    D  GNP+  G +Y     ++
Sbjct  8    LVLSSTLSLVAFARSFSSENPIVLPTTCHDDDNLVLPEVYDQDGNPLRIGERYIIKNPLL  67

Query  760  GVDGGISVANSDTGNPSTCPTDVVINITL-----AGMQPPAVRRPLSFYPLKREGGDAVI  596
            G   G +V   + GN   CP  V+ ++++      G     VR+  S Y      GD V 
Sbjct  68   G---GGAVYLDNIGNLQ-CPNAVLQHMSIPQFLGKGTPVMFVRKSESDY------GDVVR  117

Query  595  ISQYPLNVAFDSPDPSDPCAEENVWKLNYQAMIVTGGVIDKEDDIGNWFRIQK-NINGRG  419
            +        F     S  C +E VWK+N++ ++VTGG +  E+DI   F+I+K ++  RG
Sbjct  118  VMTGVYIKFF--VKTSKLCVDETVWKVNHEQLVVTGGNVGNENDI---FKIKKTDLVIRG  172

Query  418  ----YLFTWWPSLCLGCRIGYFRIGRVGNGY-QLGINYNDESLYAFEFLK  284
                Y     PS      IG        NGY +L   ++D+    F F+K
Sbjct  173  MKNVYKLLHCPSHLQCKNIG----SNFKNGYPRLVTVHDDKDFIPFVFIK  218



>emb|CAI77764.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 67/165 (41%), Gaps = 23/165 (14%)
 Frame = -2

Query  865  LIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVI  686
            ++ +P+    T  +LD  G  + AG +Y       G  GG   A +      TCP DV I
Sbjct  17   VLSVPSIEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAATN-----KTCPDDV-I  70

Query  685  NITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN--  512
              +L  +Q      P++F P   E  D VI     LN+ F        C   +VWK+   
Sbjct  71   QYSLDLLQG----LPVTFSPASSE--DDVIRVSTDLNIKFS---IKKACDHSSVWKIQKS  121

Query  511  ----YQAMIVTGGVIDKE--DDIGNWFRIQKNINGRGYLFTWWPS  395
                 Q ++ TGG       D   NWF+I+K     GY   + P 
Sbjct  122  SNSEVQWLVTTGGEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPE  166



>emb|CAI77777.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 72/180 (40%), Gaps = 28/180 (16%)
 Frame = -2

Query  910  IAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVAN  731
            +  SFL  A      ++ +P+    T  +LD  G  + AG +Y       G  GG   A 
Sbjct  7    VWFSFLLFAF-----VLSVPSIEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAAT  61

Query  730  SDTGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDP  551
            +      TCP DV I  +L  +Q      P++F P   E  D VI     LN+ F     
Sbjct  62   N-----KTCPDDV-IQYSLDLLQG----LPVTFSPASSE--DDVIRVSTDLNIKFS---I  106

Query  550  SDPCAEENVWKLN------YQAMIVTGGVIDKE--DDIGNWFRIQKNINGRGYLFTWWPS  395
               C   +VWK+        Q ++ TGG       D   NWF+I+K     GY   + P 
Sbjct  107  KKACDRSSVWKIQKSSNSEVQWLVTTGGEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPE  166



>emb|CAI77803.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 52/181 (29%), Positives = 73/181 (40%), Gaps = 30/181 (17%)
 Frame = -2

Query  910  IAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGG-ISVA  734
            +  SFL  A      ++ +P+    T  +LD  G  + AG +Y       G  GG +S  
Sbjct  7    VWFSFLLFAF-----VLSVPSIEANTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVSAT  61

Query  733  NSDTGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPD  554
            N       TCP DV I  +L  +Q      P++F P   E  D VI     LN+ F    
Sbjct  62   NK------TCPDDV-IQYSLDLLQG----LPVTFSPASSE--DDVIRVSTDLNIKFS---  105

Query  553  PSDPCAEENVWKLN------YQAMIVTGGVIDKE--DDIGNWFRIQKNINGRGYLFTWWP  398
                C   +VWK+        Q ++ TGG       D   NWF+I+K     GY   + P
Sbjct  106  IKKACDRSSVWKIQKSSNSEVQWLVTTGGEEGNPGCDTFTNWFKIEKGAGILGYKLVYCP  165

Query  397  S  395
             
Sbjct  166  E  166



>gb|AFK41530.1| unknown [Lotus japonicus]
Length=212

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 82/183 (45%), Gaps = 29/183 (16%)
 Frame = -2

Query  829  AILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVINITLAGMQPPAV  650
            AI D +G  VI+GA+YY +P    V GG+ +A         CP DVV+ +       P V
Sbjct  32   AIRDTSGKNVISGAQYYIVPGSP-VVGGVGLARR---GKEHCPLDVVVVVN-GNRGLPVV  86

Query  649  RRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKL------NYQAMIVTG  488
              P++          +VI +   LN+ F +      C E NVWKL        Q  + TG
Sbjct  87   FTPVNTI-------KSVIRADTDLNINFYT---ETSCPESNVWKLGDFNSTTGQWCVTTG  136

Query  487  GVID---KEDDIGNWFRIQKNINGRG-YLFTWWPSLC--LGCRIGYFRIGRVGNGY--QL  332
            G +      D+I NWF+I    +    Y  ++ PS+C   GC      IG   + Y  +L
Sbjct  137  GYLGDPWNYDNIYNWFKIHTYEDKEDVYALSYCPSVCNKKGCEHECSSIGIYEDHYGKRL  196

Query  331  GIN  323
            G+N
Sbjct  197  GLN  199



>gb|AFK41478.1| unknown [Medicago truncatula]
Length=213

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 85/193 (44%), Gaps = 40/193 (21%)
 Frame = -2

Query  847  KADGT-NAILDAAGNPVIAGAKYYAIP-----------AVIGVDGGISVANSDTGNPSTC  704
            +AD +   ++D  G  V AG  YY  P            V+G  G + +A S      TC
Sbjct  22   EADASPEQVVDTEGKKVRAGVDYYIRPVPTTPCDGRGPCVVG-SGFVLIARSPN---ETC  77

Query  703  PTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENV  524
            P +VV+   + G +   V    +F P+  + G   + +   +  + ++      C E  +
Sbjct  78   PLNVVV---VEGFRGQGV----TFTPVNPKKGVIRVSTDLNIKTSLNTS-----CEESTI  125

Query  523  WKLNY------QAMIVTGGVIDK--EDDIGNWFRIQKNINGRGYLFTWWPSLCLGCRIGY  368
            W L+       Q  + TGGV+    +D + NWF+I+K  +   Y F + P++C  C++  
Sbjct  126  WTLDDFDSSTGQWFVTTGGVLGNPGKDTVDNWFKIEKYED--DYKFVFCPTVCNFCKVMC  183

Query  367  FRIG--RVGNGYQ  335
              +G  R  NG Q
Sbjct  184  RNVGIFRDSNGNQ  196



>emb|CAI77772.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77776.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77780.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77781.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77791.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77802.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 52/181 (29%), Positives = 73/181 (40%), Gaps = 30/181 (17%)
 Frame = -2

Query  910  IAISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGG-ISVA  734
            +  SFL  A      ++ +P+    T  +LD  G  + AG +Y       G  GG +S  
Sbjct  7    VWFSFLLFAF-----VLSVPSIEANTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVSAT  61

Query  733  NSDTGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPD  554
            N       TCP DV I  +L  +Q      P++F P   E  D VI     LN+ F    
Sbjct  62   NK------TCPDDV-IQYSLDLLQG----LPVTFSPASSE--DDVIRVSTDLNIKFS---  105

Query  553  PSDPCAEENVWKLN------YQAMIVTGGVIDKE--DDIGNWFRIQKNINGRGYLFTWWP  398
                C   +VWK+        Q ++ TGG       D   NWF+I+K     GY   + P
Sbjct  106  IKKACDRSSVWKIQKSSNSEVQWLVTTGGEEGNPGCDTFTNWFKIEKGAGILGYKLVYCP  165

Query  397  S  395
             
Sbjct  166  E  166



>emb|CAI77775.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 51/178 (29%), Positives = 71/178 (40%), Gaps = 28/178 (16%)
 Frame = -2

Query  904  ISFLPLAISGLPPLIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSD  725
             SFL  A      ++ +P+    T  +LD  G  + AG +Y       G  GG   A + 
Sbjct  9    FSFLLFAF-----VLSVPSIEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAATN-  62

Query  724  TGNPSTCPTDVVINITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSD  545
                 TCP DV I  +L  +Q      P++F P   E  D VI     LN+ F       
Sbjct  63   ----KTCPDDV-IQYSLDLLQG----LPVTFSPASSE--DDVIRVSTDLNIKFS---IKK  108

Query  544  PCAEENVWKLN------YQAMIVTGGVIDKE--DDIGNWFRIQKNINGRGYLFTWWPS  395
             C   +VWK+        Q ++ TGG       D   NWF+I+K     GY   + P 
Sbjct  109  ACDRSSVWKIQKSSNSEVQWLVTTGGEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPE  166



>ref|XP_011023016.1| PREDICTED: endogenous alpha-amylase/subtilisin inhibitor-like 
[Populus euphratica]
Length=202

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 67/167 (40%), Gaps = 19/167 (11%)
 Frame = -2

Query  865  LIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVI  686
            L+   T A     +LDA G P+ +G +YY +PA   V GG+++ N + G  S CP  V  
Sbjct  14   LMATSTMAQTWPPVLDADGQPLRSGVEYYVLPAATDVAGGLTLVNLNNG--SICPLFV--  69

Query  685  NITLAGMQPPA-VRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLNY  509
                 G +P A V  P +         D VI       VAF  P     CA+   W +  
Sbjct  70   -----GQEPLAPVVSPGTSVIFTPRVADTVIRETRDFTVAFTGP---TICAQSTAWMVGE  121

Query  508  QAMIVTGGVIDKEDD----IGNW-FRIQKNINGRGYLFTWWPSLCLG  383
            Q        I  E D       W F I KN  G  Y F W P+   G
Sbjct  122  QNPETRRRYILAEMDPSPSSNAWHFNIVKNDQGL-YNFQWCPNCLTG  167



>ref|XP_006441460.1| hypothetical protein CICLE_v10024584mg, partial [Citrus clementina]
 gb|ESR54700.1| hypothetical protein CICLE_v10024584mg, partial [Citrus clementina]
Length=153

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 64/135 (47%), Gaps = 26/135 (19%)
 Frame = -2

Query  751  GGISVANSDTGNPSTCPTDVVINITLAGMQPPAVRR--PLSFYPLKREGGDAVIISQYPL  578
            GG+++A     N  TCP DVV        +  + +   P++F P+  + G  V+     L
Sbjct  4    GGLTLAGRS--NNKTCPLDVV-------QEQHSFKNGFPVTFSPVNPKKG--VVRESTDL  52

Query  577  NVAFDSPDPSDPCAEENVWKLNY------QAMIVTGGVIDK--EDDIGNWFRIQKNINGR  422
            N+ FD+   +  CA+  VWKL+       Q ++ TGGV        + NWF+I+K     
Sbjct  53   NIKFDA---ATSCAQSTVWKLDNFDAAFGQWLVTTGGVEGNPGPRTMRNWFKIEKFFG--  107

Query  421  GYLFTWWPSLCLGCR  377
             Y   + PS+C  CR
Sbjct  108  DYKLVYCPSVCNFCR  122



>emb|CAI77770.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 73/186 (39%), Gaps = 31/186 (17%)
 Frame = -2

Query  865  LIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVI  686
            ++ +P+    T  +LD  G  + AG +Y       G  GG   A +      TCP DV I
Sbjct  17   VLSVPSIEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAATN-----KTCPDDV-I  70

Query  685  NITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN--  512
              +L  +Q      P++F P   E  D VI     LN+ F        C   +VWK+   
Sbjct  71   QYSLDLLQG----LPVTFSPASSE--DDVIRVSTDLNIKFS---IKKACDRSSVWKIQKS  121

Query  511  ----YQAMIVTGGVIDKE--DDIGNWFRIQKNINGRGYLFTWWPS-------LCLGCRIG  371
                 Q ++ TGG       D   NWF+I+K     GY   + P        LC    I 
Sbjct  122  SNSEVQWLVTTGGEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGI-  180

Query  370  YFRIGR  353
            YF   R
Sbjct  181  YFETNR  186



>emb|CAI77798.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77799.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77806.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77807.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 48/166 (29%), Positives = 68/166 (41%), Gaps = 25/166 (15%)
 Frame = -2

Query  865  LIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGG-ISVANSDTGNPSTCPTDVV  689
            ++ +P+    T  +LD  G  + AG +Y       G  GG +S  N       TCP DV 
Sbjct  17   VLSVPSIEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVSATNK------TCPDDV-  69

Query  688  INITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN-  512
            I  +L  +Q      P++F P   E  D VI     LN+ F        C   +VWK+  
Sbjct  70   IQYSLDLLQG----LPVTFSPASSE--DDVIRVSTDLNIKFS---IKKACDRSSVWKIQK  120

Query  511  -----YQAMIVTGGVIDKE--DDIGNWFRIQKNINGRGYLFTWWPS  395
                  Q ++ TGG       D   NWF+I+K     GY   + P 
Sbjct  121  SSNSEVQWLVTTGGEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPE  166



>emb|CAI77800.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 67/165 (41%), Gaps = 23/165 (14%)
 Frame = -2

Query  865  LIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVI  686
            ++ +P+    T  +LD  G  + AG +Y       G  GG   A +      TCP DV I
Sbjct  17   VLSVPSIEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAATN-----KTCPDDV-I  70

Query  685  NITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN--  512
              +L  +Q      P++F P   E  D VI     LN+ F        C   +VWK+   
Sbjct  71   QYSLDLLQV----LPVTFSPASSE--DDVIRVSTDLNIKFS---IKKACDRSSVWKIQKS  121

Query  511  ----YQAMIVTGGVIDKE--DDIGNWFRIQKNINGRGYLFTWWPS  395
                 Q ++ TGG       D   NWF+I+K     GY   + P 
Sbjct  122  SNSEVQWLVTTGGEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPE  166



>emb|CAI77793.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 67/165 (41%), Gaps = 23/165 (14%)
 Frame = -2

Query  865  LIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVI  686
            ++ +P+    T  +LD  G  + AG +Y       G  GG   A +      TCP DV I
Sbjct  17   VLSVPSIEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAATN-----KTCPDDV-I  70

Query  685  NITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN--  512
              +L  +Q      P++F P   E  D VI     LN+ F        C   +VWK+   
Sbjct  71   QYSLDLLQG----LPVTFSPASSE--DDVIRVSTDLNIKFS---IKKACDRSSVWKIQKS  121

Query  511  ----YQAMIVTGGVIDKE--DDIGNWFRIQKNINGRGYLFTWWPS  395
                 Q ++ TGG       D   NWF+I+K     GY   + P 
Sbjct  122  SNSEVQWLVTTGGEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPE  166



>emb|CAI77765.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77792.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77796.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77797.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77801.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 67/165 (41%), Gaps = 23/165 (14%)
 Frame = -2

Query  865  LIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVI  686
            ++ +P+    T  +LD  G  + AG +Y       G  GG   A +      TCP DV I
Sbjct  17   VLSVPSIEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAATN-----KTCPDDV-I  70

Query  685  NITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN--  512
              +L  +Q      P++F P   E  D VI     LN+ F        C   +VWK+   
Sbjct  71   QYSLDLLQG----LPVTFSPASSE--DDVIRVSTDLNIKFS---IKKACDRSSVWKIQKS  121

Query  511  ----YQAMIVTGGVIDKE--DDIGNWFRIQKNINGRGYLFTWWPS  395
                 Q ++ TGG       D   NWF+I+K     GY   + P 
Sbjct  122  SNSEVQWLVTTGGEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPE  166



>emb|CAI77783.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77784.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77788.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77789.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77804.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77805.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 67/165 (41%), Gaps = 23/165 (14%)
 Frame = -2

Query  865  LIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVI  686
            ++ +P+    T  +LD  G  + AG +Y       G  GG   A +      TCP DV I
Sbjct  17   VLSVPSIEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAATN-----KTCPDDV-I  70

Query  685  NITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN--  512
              +L  +Q      P++F P   E  D VI     LN+ F        C   +VWK+   
Sbjct  71   QYSLDLLQG----LPVTFSPASSE--DDVIRVSTDLNIKFS---IKKACDRSSVWKIQKS  121

Query  511  ----YQAMIVTGGVIDKE--DDIGNWFRIQKNINGRGYLFTWWPS  395
                 Q ++ TGG       D   NWF+I+K     GY   + P 
Sbjct  122  SNSEVQWLVTTGGEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPE  166



>emb|CAI77782.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77794.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 67/165 (41%), Gaps = 23/165 (14%)
 Frame = -2

Query  865  LIRLPTKADGTNAILDAAGNPVIAGAKYYAIPAVIGVDGGISVANSDTGNPSTCPTDVVI  686
            ++ +P+    T  +LD  G  + AG +Y       G  GG   A +      TCP DV I
Sbjct  17   VLSVPSIEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAATN-----KTCPDDV-I  70

Query  685  NITLAGMQPPAVRRPLSFYPLKREGGDAVIISQYPLNVAFDSPDPSDPCAEENVWKLN--  512
              +L  +Q      P++F P   E  D VI     LN+ F        C   +VWK+   
Sbjct  71   QYSLDLLQG----LPVTFSPASSE--DDVIRVSTDLNIKFS---IKKACDRSSVWKIQKS  121

Query  511  ----YQAMIVTGGVIDKE--DDIGNWFRIQKNINGRGYLFTWWPS  395
                 Q ++ TGG       D   NWF+I+K     GY   + P 
Sbjct  122  SNSEVQWLVTTGGEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPE  166



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2169515985086