BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13032_g1_i1 len=1419 path=[41:0-648 40:649-1418]

Length=1419
                                                                      Score     E

ref|XP_009590663.1|  PREDICTED: protein notum homolog isoform X1        311   1e-97   
ref|XP_009589915.1|  PREDICTED: uncharacterized protein LOC104087...    308   3e-96   
ref|XP_009589914.1|  PREDICTED: uncharacterized protein LOC104087...    308   3e-96   
ref|XP_004244682.2|  PREDICTED: uncharacterized protein LOC101248898    306   5e-96   
ref|XP_009803843.1|  PREDICTED: uncharacterized protein LOC104249167    305   3e-95   
ref|XP_010314003.1|  PREDICTED: protein notum homolog isoform X1        300   5e-93   
ref|XP_010314004.1|  PREDICTED: protein notum homolog isoform X2        299   5e-93   
ref|XP_006365947.1|  PREDICTED: uncharacterized protein LOC102601254    297   3e-92   
ref|XP_006361594.1|  PREDICTED: protein notum homolog                   296   2e-90   
ref|XP_009624847.1|  PREDICTED: protein notum homolog isoform X2        285   1e-87   
ref|XP_009799834.1|  PREDICTED: protein notum homolog                   283   6e-87   
ref|XP_009624845.1|  PREDICTED: protein notum homolog isoform X1        281   3e-86   
ref|XP_010248193.1|  PREDICTED: uncharacterized protein LOC104591101    281   4e-86   
ref|XP_009778395.1|  PREDICTED: protein notum homolog                   281   5e-86   
ref|XP_009797876.1|  PREDICTED: protein notum homolog isoform X2        281   6e-86   
ref|XP_010244169.1|  PREDICTED: protein notum homolog                   281   8e-86   
ref|XP_006385137.1|  hypothetical protein POPTR_0004s24220g             280   1e-85   
ref|XP_011028483.1|  PREDICTED: uncharacterized protein LOC105128...    281   1e-85   
ref|XP_006385134.1|  hypothetical protein POPTR_0004s24220g             281   1e-85   
ref|XP_006385138.1|  hypothetical protein POPTR_0004s24220g             280   1e-85   
ref|XP_011082149.1|  PREDICTED: protein notum homolog isoform X1        280   2e-85   
ref|XP_006432881.1|  hypothetical protein CICLE_v10001426mg             280   2e-85   
gb|KDP28068.1|  hypothetical protein JCGZ_19476                         279   4e-85   
ref|XP_006385133.1|  pectinacetylesterase family protein                278   5e-85   
ref|XP_011028476.1|  PREDICTED: protein notum homolog                   278   5e-85   
gb|EYU37448.1|  hypothetical protein MIMGU_mgv1a007102mg                278   1e-84   
ref|XP_009605804.1|  PREDICTED: protein notum homolog                   277   1e-84   
ref|XP_009797875.1|  PREDICTED: protein notum homolog isoform X1        277   1e-84   
gb|KCW72723.1|  hypothetical protein EUGRSUZ_E01170                     277   1e-84   
ref|XP_011028482.1|  PREDICTED: uncharacterized protein LOC105128...    280   2e-84   
ref|XP_002519912.1|  pectin acetylesterase, putative                    279   2e-84   Ricinus communis
ref|XP_011028479.1|  PREDICTED: uncharacterized protein LOC105128...    280   2e-84   
gb|KCW72721.1|  hypothetical protein EUGRSUZ_E01170                     277   2e-84   
ref|XP_004244767.2|  PREDICTED: protein notum homolog                   276   2e-84   
gb|KDP28066.1|  hypothetical protein JCGZ_19474                         276   3e-84   
ref|XP_010056136.1|  PREDICTED: protein notum homolog                   276   4e-84   
gb|KCW72720.1|  hypothetical protein EUGRSUZ_E01169                     277   4e-84   
ref|XP_009600038.1|  PREDICTED: protein notum homolog                   275   5e-84   
ref|XP_009779347.1|  PREDICTED: protein notum homolog isoform X1        275   5e-84   
ref|XP_006432880.1|  hypothetical protein CICLE_v10001467mg             275   7e-84   
gb|ADR82372.1|  pectin acetylesterase                                   275   8e-84   
ref|XP_006494119.1|  PREDICTED: protein notum homolog isoform X1        275   9e-84   
ref|XP_009589853.1|  PREDICTED: uncharacterized protein LOC104087...    275   9e-84   
gb|KCW72722.1|  hypothetical protein EUGRSUZ_E01170                     275   1e-83   
ref|XP_010056129.1|  PREDICTED: protein notum homolog isoform X1        276   1e-83   
ref|XP_010056132.1|  PREDICTED: protein notum homolog isoform X3        276   1e-83   
ref|XP_010056135.1|  PREDICTED: protein notum homolog                   274   2e-83   
gb|KHG23648.1|  Notum                                                   274   2e-83   
ref|XP_011012520.1|  PREDICTED: protein notum homolog                   274   2e-83   
ref|XP_010056131.1|  PREDICTED: protein notum homolog isoform X2        276   2e-83   
gb|ACF05806.1|  PAE                                                     274   3e-83   Litchi chinensis [litchi]
ref|XP_009607289.1|  PREDICTED: protein notum homolog                   274   3e-83   
ref|XP_007040902.1|  Pectinacetylesterase family protein                274   3e-83   
ref|XP_002519911.1|  pectin acetylesterase, putative                    273   4e-83   Ricinus communis
gb|KCW72726.1|  hypothetical protein EUGRSUZ_E01170                     272   7e-83   
ref|XP_010644665.1|  PREDICTED: uncharacterized protein LOC100245856    273   8e-83   
ref|XP_006385136.1|  hypothetical protein POPTR_0004s24220g             272   1e-82   
ref|XP_002303225.2|  pectinacetylesterase family protein                272   1e-82   Populus trichocarpa [western balsam poplar]
ref|NP_001047850.1|  Os02g0702400                                       272   2e-82   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010536210.1|  PREDICTED: uncharacterized protein LOC104811251    271   3e-82   
ref|XP_009590664.1|  PREDICTED: uncharacterized protein LOC104087...    271   3e-82   
emb|CDY26383.1|  BnaA02g23870D                                          271   4e-82   
ref|XP_006878664.1|  hypothetical protein AMTR_s00011p00266820          271   4e-82   
ref|XP_007040900.1|  Pectinacetylesterase family protein                271   5e-82   
ref|XP_004509522.1|  PREDICTED: uncharacterized protein LOC101493...    270   1e-81   
gb|EYU29129.1|  hypothetical protein MIMGU_mgv1a023759mg                269   2e-81   
ref|XP_009128780.1|  PREDICTED: uncharacterized protein LOC103853624    269   3e-81   
ref|XP_010676220.1|  PREDICTED: uncharacterized protein LOC104892094    270   3e-81   
ref|XP_009592441.1|  PREDICTED: uncharacterized protein LOC104089292    268   3e-81   
emb|CDP15690.1|  unnamed protein product                                268   4e-81   
ref|XP_009108427.1|  PREDICTED: protein notum homolog                   268   4e-81   
emb|CDX87799.1|  BnaC02g31500D                                          268   4e-81   
ref|XP_006355154.1|  PREDICTED: protein notum homolog                   269   5e-81   
ref|XP_007209217.1|  hypothetical protein PRUPE_ppa006718mg             268   5e-81   
emb|CDY09289.1|  BnaC03g63190D                                          268   8e-81   
ref|XP_009601364.1|  PREDICTED: protein notum homolog                   267   9e-81   
ref|XP_010266384.1|  PREDICTED: uncharacterized protein LOC104603...    267   1e-80   
ref|XP_006471634.1|  PREDICTED: uncharacterized protein LOC102628021    267   1e-80   
ref|XP_009132797.1|  PREDICTED: protein notum homolog                   266   2e-80   
ref|XP_011073252.1|  PREDICTED: protein notum homolog isoform X2        266   2e-80   
ref|XP_006413980.1|  hypothetical protein EUTSA_v10025385mg             266   2e-80   
ref|XP_011082152.1|  PREDICTED: protein notum homolog isoform X2        266   3e-80   
ref|XP_010529277.1|  PREDICTED: protein notum homolog                   266   3e-80   
gb|KCW72718.1|  hypothetical protein EUGRSUZ_E01169                     266   3e-80   
ref|XP_010266383.1|  PREDICTED: uncharacterized protein LOC104603...    267   3e-80   
emb|CDX78933.1|  BnaA01g10000D                                          268   3e-80   
ref|XP_006359967.1|  PREDICTED: protein notum homolog                   265   5e-80   
ref|XP_011073171.1|  PREDICTED: protein notum homolog isoform X1        266   6e-80   
ref|XP_010325697.1|  PREDICTED: uncharacterized protein LOC101260962    271   7e-80   
ref|XP_008238012.1|  PREDICTED: protein notum homolog isoform X2        265   7e-80   
gb|AAM65412.1|  pectin acetylesterase                                   265   7e-80   Arabidopsis thaliana [mouse-ear cress]
gb|KDO40410.1|  hypothetical protein CISIN_1g013734mg                   266   8e-80   
ref|XP_009784099.1|  PREDICTED: protein notum homolog                   265   8e-80   
emb|CDX99377.1|  BnaC01g11750D                                          267   8e-80   
ref|XP_010536189.1|  PREDICTED: uncharacterized protein LOC104811...    265   9e-80   
ref|XP_002867940.1|  hypothetical protein ARALYDRAFT_492921             265   9e-80   
ref|NP_199341.1|  pectinacetylesterase family protein                   265   1e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006398195.1|  hypothetical protein EUTSA_v10000914mg             265   1e-79   
ref|XP_009759657.1|  PREDICTED: uncharacterized protein LOC104212153    265   2e-79   
ref|XP_002867938.1|  pectinacetylesterase family protein                264   2e-79   
ref|XP_009589854.1|  PREDICTED: uncharacterized protein LOC104087...    261   2e-79   
ref|XP_006280604.1|  hypothetical protein CARUB_v10026563mg             264   2e-79   
gb|ACJ85294.1|  unknown                                                 264   2e-79   Medicago truncatula
ref|NP_567585.1|  pectinacetylesterase family protein                   264   2e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004300391.1|  PREDICTED: protein notum homolog                   264   2e-79   
dbj|BAJ97261.1|  predicted protein                                      264   2e-79   
ref|XP_010439718.1|  PREDICTED: protein notum homolog                   264   2e-79   
ref|XP_009797415.1|  PREDICTED: uncharacterized protein LOC104243851    263   2e-79   
ref|XP_007209211.1|  hypothetical protein PRUPE_ppa006668mg             264   2e-79   
ref|XP_010235850.1|  PREDICTED: protein notum homolog isoform X1        263   3e-79   
ref|NP_193677.2|  putative pectinacetylesterase                         263   4e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009350399.1|  PREDICTED: protein notum homolog                   263   4e-79   
emb|CAA67728.1|  pectinacetylesterase precursor                         263   4e-79   Vigna radiata var. radiata [golden gram]
ref|XP_010434420.1|  PREDICTED: protein notum homolog                   263   5e-79   
ref|XP_009776988.1|  PREDICTED: uncharacterized protein LOC104226...    262   7e-79   
ref|XP_010449357.1|  PREDICTED: protein notum homolog                   263   7e-79   
gb|KEH20327.1|  pectinacetylesterase family protein                     262   8e-79   
ref|XP_010911666.1|  PREDICTED: protein notum homolog                   262   8e-79   
ref|XP_002865253.1|  pectin acetylesterase                              262   8e-79   
ref|XP_009397056.1|  PREDICTED: protein notum homolog                   262   8e-79   
ref|XP_003628995.1|  Notum-like protein                                 262   9e-79   
ref|XP_004172255.1|  PREDICTED: protein notum homolog                   262   9e-79   
gb|EYU37455.1|  hypothetical protein MIMGU_mgv1a007934mg                262   9e-79   
ref|XP_010233620.1|  PREDICTED: protein notum homolog                   262   1e-78   
ref|XP_010494620.1|  PREDICTED: uncharacterized protein LOC104771742    261   2e-78   
ref|XP_008451860.1|  PREDICTED: protein notum homolog isoform X1        261   2e-78   
ref|XP_009612887.1|  PREDICTED: uncharacterized protein LOC104106115    261   2e-78   
ref|XP_006573492.1|  PREDICTED: protein notum homolog isoform X2        261   2e-78   
ref|XP_008451861.1|  PREDICTED: protein notum homolog isoform X2        261   2e-78   
gb|AET03471.2|  pectinacetylesterase family protein                     262   3e-78   
ref|XP_008808358.1|  PREDICTED: protein notum homolog                   261   3e-78   
ref|XP_009627060.1|  PREDICTED: uncharacterized protein LOC104117690    261   3e-78   
ref|XP_010481611.1|  PREDICTED: uncharacterized protein LOC104760390    261   3e-78   
ref|XP_010244170.1|  PREDICTED: uncharacterized protein LOC104588061    261   4e-78   
emb|CDX99378.1|  BnaC01g11740D                                          260   4e-78   
dbj|BAJ90066.1|  predicted protein                                      260   4e-78   
gb|KDO40409.1|  hypothetical protein CISIN_1g016608mg                   260   4e-78   
ref|XP_008238011.1|  PREDICTED: protein notum homolog isoform X1        261   4e-78   
ref|XP_006573491.1|  PREDICTED: protein notum homolog isoform X1        262   4e-78   
ref|XP_008355284.1|  PREDICTED: uncharacterized protein LOC103418943    261   4e-78   
ref|XP_006363875.1|  PREDICTED: protein notum homolog                   261   5e-78   
ref|XP_010441760.1|  PREDICTED: uncharacterized protein LOC104724893    260   5e-78   
ref|XP_010327577.1|  PREDICTED: uncharacterized protein LOC101244626    260   5e-78   
ref|XP_010318089.1|  PREDICTED: protein notum homolog                   261   5e-78   
gb|AFK45147.1|  unknown                                                 260   6e-78   
ref|XP_010434425.1|  PREDICTED: uncharacterized protein LOC104718...    259   6e-78   
ref|XP_010439720.1|  PREDICTED: uncharacterized protein LOC104723107    260   6e-78   
gb|KHN41756.1|  Protein notum like                                      261   7e-78   
gb|KHG23649.1|  Notum                                                   259   7e-78   
ref|XP_003628996.1|  Carboxylic ester hydrolase                         260   7e-78   
ref|XP_009771151.1|  PREDICTED: uncharacterized protein LOC104221730    260   9e-78   
ref|NP_001190770.1|  pectinacetylesterase family protein                263   1e-77   
ref|XP_006283887.1|  hypothetical protein CARUB_v10005004mg             259   1e-77   
ref|XP_008667853.1|  PREDICTED: hypothetical protein isoform X1         259   1e-77   
ref|XP_010434424.1|  PREDICTED: uncharacterized protein LOC104718...    259   1e-77   
ref|XP_009132784.1|  PREDICTED: uncharacterized protein LOC103857370    259   1e-77   
ref|XP_003548585.1|  PREDICTED: protein notum homolog                   259   2e-77   
ref|XP_009398466.1|  PREDICTED: protein notum homolog                   259   2e-77   
emb|CDY67801.1|  BnaAnng25210D                                          258   2e-77   
ref|XP_004150551.1|  PREDICTED: protein notum homolog                   263   2e-77   
ref|XP_010536220.1|  PREDICTED: protein notum homolog isoform X1        259   2e-77   
ref|XP_009619780.1|  PREDICTED: uncharacterized protein LOC104111729    258   3e-77   
ref|XP_010449359.1|  PREDICTED: uncharacterized protein LOC104731629    258   3e-77   
emb|CDX78932.1|  BnaA01g09990D                                          258   4e-77   
ref|XP_004300392.1|  PREDICTED: protein notum homolog                   258   4e-77   
ref|XP_009108426.1|  PREDICTED: protein notum homolog                   257   6e-77   
emb|CDY09287.1|  BnaC03g63170D                                          257   8e-77   
ref|XP_006413981.1|  hypothetical protein EUTSA_v10024796mg             262   8e-77   
ref|XP_009771153.1|  PREDICTED: uncharacterized protein LOC104221731    261   9e-77   
gb|ACG39759.1|  carboxylic ester hydrolase                              257   9e-77   Zea mays [maize]
ref|XP_009626489.1|  PREDICTED: protein notum homolog isoform X1        256   9e-77   
dbj|BAK03817.1|  predicted protein                                      258   1e-76   
gb|KHG09455.1|  Protein notum                                           257   1e-76   
ref|XP_008373439.1|  PREDICTED: protein notum homolog isoform X2        258   1e-76   
ref|XP_009776987.1|  PREDICTED: uncharacterized protein LOC104226...    256   1e-76   
ref|XP_003565180.2|  PREDICTED: uncharacterized protein LOC100841...    261   1e-76   
ref|XP_009771487.1|  PREDICTED: protein notum homolog                   256   1e-76   
gb|KHN41567.1|  Protein notum like                                      257   1e-76   
ref|XP_003613922.1|  Notum-like protein                                 256   1e-76   
ref|XP_003547731.1|  PREDICTED: protein notum homolog isoform X1        256   1e-76   
ref|XP_006599203.1|  PREDICTED: uncharacterized protein LOC100781...    256   1e-76   
ref|NP_001151183.1|  LOC100284816 precursor                             256   2e-76   Zea mays [maize]
ref|XP_006363883.1|  PREDICTED: uncharacterized protein LOC102589191    259   2e-76   
gb|EPS71696.1|  hypothetical protein M569_03061                         256   2e-76   
ref|XP_007156330.1|  hypothetical protein PHAVU_003G277500g             256   2e-76   
gb|EMT30528.1|  hypothetical protein F775_25893                         256   2e-76   
ref|XP_008797987.1|  PREDICTED: protein notum homolog isoform X1        256   2e-76   
ref|XP_010942974.1|  PREDICTED: protein notum homolog                   256   2e-76   
ref|XP_006587657.1|  PREDICTED: protein notum homolog isoform X3        256   2e-76   
gb|KHN27509.1|  Protein notum like                                      256   3e-76   
ref|XP_004244443.1|  PREDICTED: uncharacterized protein LOC101251798    256   3e-76   
ref|XP_006359968.1|  PREDICTED: protein notum homolog                   254   3e-76   
tpg|DAA36176.1|  TPA: pectinacetylesterase                              259   3e-76   
ref|XP_007156331.1|  hypothetical protein PHAVU_003G277500g             256   3e-76   
emb|CDY11398.1|  BnaA09g39640D                                          256   4e-76   
ref|XP_003547821.1|  PREDICTED: protein notum homolog                   256   4e-76   
ref|XP_008373438.1|  PREDICTED: protein notum homolog isoform X1        257   4e-76   
ref|NP_974575.2|  putative pectinacetylesterase                         254   4e-76   Arabidopsis thaliana [mouse-ear cress]
gb|KHN27511.1|  Protein notum like                                      255   5e-76   
ref|XP_006587656.1|  PREDICTED: protein notum homolog isoform X2        257   5e-76   
ref|XP_009116880.1|  PREDICTED: protein notum homolog                   255   6e-76   
ref|XP_004509558.1|  PREDICTED: protein notum homolog                   254   7e-76   
ref|XP_003580427.1|  PREDICTED: uncharacterized protein LOC100827...    254   1e-75   
ref|XP_009603747.1|  PREDICTED: protein notum homolog isoform X1        254   1e-75   
ref|XP_010240371.1|  PREDICTED: uncharacterized protein LOC100827...    254   1e-75   
ref|XP_002454426.1|  hypothetical protein SORBIDRAFT_04g030720          254   1e-75   Sorghum bicolor [broomcorn]
gb|ABK24994.1|  unknown                                                 254   1e-75   Picea sitchensis
gb|EMT14315.1|  hypothetical protein F775_08483                         254   1e-75   
gb|ABK24433.1|  unknown                                                 254   1e-75   Picea sitchensis
gb|EYU29130.1|  hypothetical protein MIMGU_mgv1a007782mg                254   2e-75   
ref|XP_009794297.1|  PREDICTED: protein notum homolog                   254   2e-75   
ref|XP_006361581.1|  PREDICTED: protein notum homolog                   253   2e-75   
ref|XP_004512351.1|  PREDICTED: protein notum homolog isoform X3        255   2e-75   
gb|EYU37453.1|  hypothetical protein MIMGU_mgv1a007583mg                254   2e-75   
ref|XP_006363510.1|  PREDICTED: uncharacterized protein LOC102583822    253   2e-75   
ref|XP_011082153.1|  PREDICTED: protein notum homolog                   253   2e-75   
gb|EYU29131.1|  hypothetical protein MIMGU_mgv1a007782mg                253   2e-75   
ref|XP_009794027.1|  PREDICTED: uncharacterized protein LOC104240572    253   3e-75   
ref|XP_004953590.1|  PREDICTED: protein notum homolog isoform X1        253   3e-75   
ref|XP_010325632.1|  PREDICTED: protein notum homolog isoform X1        253   3e-75   
emb|CDM87215.1|  unnamed protein product                                254   4e-75   
ref|XP_010942975.1|  PREDICTED: protein notum homolog isoform X1        253   4e-75   
tpg|DAA36173.1|  TPA: hypothetical protein ZEAMMB73_990456              252   5e-75   
ref|XP_002447050.1|  hypothetical protein SORBIDRAFT_06g027560          252   5e-75   Sorghum bicolor [broomcorn]
ref|XP_003565721.1|  PREDICTED: protein notum homolog                   253   6e-75   
ref|XP_008808370.1|  PREDICTED: uncharacterized protein LOC103720...    252   6e-75   
ref|XP_010235852.1|  PREDICTED: protein notum homolog isoform X2        251   7e-75   
ref|XP_004512349.1|  PREDICTED: protein notum homolog isoform X1        255   7e-75   
ref|XP_004246219.1|  PREDICTED: protein notum homolog                   252   7e-75   
ref|XP_009407790.1|  PREDICTED: protein notum homolog                   253   7e-75   
ref|XP_010111521.1|  hypothetical protein L484_021346                   252   8e-75   
ref|XP_007158098.1|  hypothetical protein PHAVU_002G123900g             252   8e-75   
gb|ADE77373.1|  unknown                                                 252   9e-75   
ref|XP_008347803.1|  PREDICTED: uncharacterized protein LOC103410929    252   9e-75   
gb|EMS59699.1|  hypothetical protein TRIUR3_12152                       251   9e-75   
ref|XP_009413211.1|  PREDICTED: protein notum homolog                   251   1e-74   
ref|XP_006587655.1|  PREDICTED: protein notum homolog isoform X1        253   2e-74   
gb|EMT00867.1|  hypothetical protein F775_21765                         254   2e-74   
gb|KDP28067.1|  hypothetical protein JCGZ_19475                         251   2e-74   
ref|XP_009616254.1|  PREDICTED: protein notum homolog                   251   2e-74   
ref|XP_010266381.1|  PREDICTED: uncharacterized protein LOC104603...    251   2e-74   
ref|XP_006291204.1|  hypothetical protein CARUB_v10017332mg             251   3e-74   
ref|XP_007156332.1|  hypothetical protein PHAVU_003G277600g             251   3e-74   
gb|EMS61917.1|  hypothetical protein TRIUR3_01659                       251   3e-74   
ref|XP_010266380.1|  PREDICTED: uncharacterized protein LOC104603...    251   3e-74   
dbj|BAJ89162.1|  predicted protein                                      251   3e-74   
gb|AFK37852.1|  unknown                                                 250   4e-74   
emb|CAD41867.2|  OSJNBa0041A02.14                                       250   4e-74   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008378614.1|  PREDICTED: uncharacterized protein LOC103441693    250   4e-74   
emb|CDX76613.1|  BnaC08g31990D                                          250   6e-74   
gb|AGT16732.1|  carboxylic ester hydrolase                              249   9e-74   
ref|XP_009408703.1|  PREDICTED: protein notum homolog                   249   1e-73   
ref|XP_009763242.1|  PREDICTED: protein notum homolog isoform X1        248   2e-73   
gb|AAP72959.1|  pectin acetylesterase                                   248   2e-73   Lactuca sativa [cultivated lettuce]
gb|EMT09212.1|  hypothetical protein F775_13462                         249   2e-73   
ref|XP_011074219.1|  PREDICTED: protein notum homolog                   248   2e-73   
ref|NP_001053773.1|  Os04g0602500                                       250   2e-73   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002876658.1|  pectinacetylesterase family protein                249   2e-73   
ref|XP_008808367.1|  PREDICTED: uncharacterized protein LOC103720...    248   3e-73   
dbj|BAJ95183.1|  predicted protein                                      248   3e-73   
ref|XP_008808368.1|  PREDICTED: uncharacterized protein LOC103720...    248   4e-73   
ref|XP_004970862.1|  PREDICTED: protein notum homolog                   248   6e-73   
ref|XP_006368062.1|  PREDICTED: protein notum homolog                   245   6e-73   
ref|XP_006351092.1|  PREDICTED: protein notum homolog                   244   7e-73   
ref|XP_003561153.1|  PREDICTED: protein notum homolog                   246   1e-72   
ref|XP_008656990.1|  PREDICTED: protein notum homolog isoform X2        247   1e-72   
gb|EEC77932.1|  hypothetical protein OsI_17271                          250   1e-72   Oryza sativa Indica Group [Indian rice]
ref|XP_006385140.1|  hypothetical protein POPTR_0004s24220g             244   2e-72   
ref|NP_191765.2|  pectinacetylesterase family protein                   246   2e-72   Arabidopsis thaliana [mouse-ear cress]
gb|EYU37449.1|  hypothetical protein MIMGU_mgv1a011392mg                242   2e-72   
ref|XP_010914807.1|  PREDICTED: protein notum homolog isoform X1        246   2e-72   
gb|KDP28360.1|  hypothetical protein JCGZ_14131                         247   2e-72   
ref|XP_009626490.1|  PREDICTED: protein notum homolog isoform X2        245   3e-72   
ref|XP_009388076.1|  PREDICTED: protein notum homolog                   246   3e-72   
ref|XP_008656989.1|  PREDICTED: protein notum homolog isoform X1        246   3e-72   
emb|CDX93989.1|  BnaC04g21480D                                          246   4e-72   
ref|NP_851135.1|  pectinacetylesterase family protein                   244   4e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003547822.1|  PREDICTED: protein notum homolog                   245   4e-72   
ref|XP_006392395.1|  hypothetical protein EUTSA_v10023485mg             245   5e-72   
gb|EPS71965.1|  hypothetical protein M569_02793                         244   5e-72   
ref|XP_008227765.1|  PREDICTED: protein notum homolog isoform X2        246   5e-72   
ref|XP_010468989.1|  PREDICTED: protein notum homolog                   246   6e-72   
ref|XP_003518126.1|  PREDICTED: protein notum homolog                   245   6e-72   
ref|XP_009142580.1|  PREDICTED: protein notum homolog                   245   6e-72   
dbj|BAJ85221.1|  predicted protein                                      246   6e-72   
ref|XP_002455557.1|  hypothetical protein SORBIDRAFT_03g013080          245   8e-72   
ref|XP_010914803.1|  PREDICTED: protein notum homolog isoform X1        244   8e-72   
emb|CDY41569.1|  BnaC04g00530D                                          244   1e-71   
ref|XP_006652763.1|  PREDICTED: protein notum homolog                   243   1e-71   
emb|CBI37039.3|  unnamed protein product                                243   1e-71   
gb|KHG26188.1|  Protein notum                                           244   1e-71   
ref|XP_004251486.1|  PREDICTED: uncharacterized protein LOC101264402    244   1e-71   
ref|XP_010054028.1|  PREDICTED: uncharacterized protein LOC104442...    244   1e-71   
ref|XP_008227764.1|  PREDICTED: protein notum homolog isoform X1        246   1e-71   
ref|XP_004983742.1|  PREDICTED: protein notum homolog isoform X2        244   1e-71   
emb|CDX95291.1|  BnaC09g15790D                                          244   1e-71   
ref|XP_006397884.1|  hypothetical protein EUTSA_v10001449mg             244   2e-71   
gb|KDO40416.1|  hypothetical protein CISIN_1g013734mg                   241   2e-71   
gb|AGT17273.1|  hypothetical protein SHCRBa_020_L15_F_100               243   2e-71   
ref|XP_006382250.1|  hypothetical protein POPTR_0005s00330g             244   2e-71   
ref|XP_009113357.1|  PREDICTED: protein notum homolog                   244   2e-71   
ref|XP_004970863.1|  PREDICTED: protein notum homolog                   244   2e-71   
ref|XP_004983741.1|  PREDICTED: protein notum homolog isoform X1        244   3e-71   
ref|XP_008673121.1|  PREDICTED: uncharacterized protein LOC100382...    243   3e-71   
gb|KHG13045.1|  Protein notum                                           244   3e-71   
ref|XP_009407792.1|  PREDICTED: protein notum homolog                   243   3e-71   
gb|ABR16604.1|  unknown                                                 244   3e-71   
gb|EEE61621.1|  hypothetical protein OsJ_16047                          249   3e-71   
ref|XP_007154511.1|  hypothetical protein PHAVU_003G124700g             243   4e-71   
ref|XP_007221559.1|  hypothetical protein PRUPE_ppa006038mg             243   4e-71   
ref|XP_002280816.3|  PREDICTED: protein notum homolog                   243   4e-71   
ref|XP_009388128.1|  PREDICTED: protein notum homolog                   242   4e-71   
ref|XP_007051327.1|  Pectinacetylesterase family protein                244   5e-71   
ref|XP_010512591.1|  PREDICTED: protein notum homolog                   244   5e-71   
ref|XP_007205243.1|  hypothetical protein PRUPE_ppa006114mg             243   5e-71   
ref|XP_011039058.1|  PREDICTED: protein notum homolog isoform X1        243   5e-71   
ref|NP_172426.2|  pectinacetylesterase family protein                   242   5e-71   
emb|CDY58759.1|  BnaA04g27440D                                          244   5e-71   
ref|XP_009138739.1|  PREDICTED: protein notum homolog isoform X2        243   5e-71   
ref|XP_006402417.1|  hypothetical protein EUTSA_v10005997mg             243   7e-71   
ref|XP_011074200.1|  PREDICTED: protein notum homolog                   242   7e-71   
ref|XP_004509524.1|  PREDICTED: uncharacterized protein LOC101493...    238   8e-71   
gb|ABK26312.1|  unknown                                                 242   9e-71   
emb|CDY32190.1|  BnaCnng06990D                                          241   9e-71   
ref|XP_006423958.1|  hypothetical protein CICLE_v10028674mg             240   1e-70   
ref|XP_010677538.1|  PREDICTED: protein notum homolog isoform X1        241   1e-70   
gb|KHG30410.1|  Protein notum                                           241   1e-70   
ref|XP_010544918.1|  PREDICTED: protein notum homolog isoform X2        241   2e-70   
gb|EYU19372.1|  hypothetical protein MIMGU_mgv1a006907mg                239   2e-70   
gb|KHN14241.1|  Protein notum like                                      241   2e-70   
ref|XP_009335553.1|  PREDICTED: uncharacterized protein LOC103928...    241   2e-70   
emb|CDY31081.1|  BnaA08g26310D                                          241   2e-70   
ref|XP_009138738.1|  PREDICTED: protein notum homolog isoform X1        243   2e-70   
ref|XP_004495849.1|  PREDICTED: protein notum homolog isoform X1        241   2e-70   
ref|XP_004288665.1|  PREDICTED: protein notum homolog                   243   2e-70   
ref|XP_008369575.1|  PREDICTED: protein notum homolog isoform X2        241   2e-70   
ref|XP_010266386.1|  PREDICTED: uncharacterized protein LOC104603...    239   2e-70   
emb|CBI39680.3|  unnamed protein product                                239   2e-70   
ref|XP_008388417.1|  PREDICTED: uncharacterized protein LOC103450...    241   2e-70   
ref|XP_010544917.1|  PREDICTED: protein notum homolog isoform X1        242   3e-70   
ref|NP_176072.3|  pectinacetylesterase family protein                   241   3e-70   
gb|KHN45022.1|  Protein notum like                                      240   3e-70   
gb|AFK38038.1|  unknown                                                 241   3e-70   
ref|XP_008363956.1|  PREDICTED: protein notum homolog                   240   3e-70   
ref|XP_008365238.1|  PREDICTED: uncharacterized protein LOC103428882    237   3e-70   
gb|AAM74495.1|  At1g57590/T8L23_6                                       241   3e-70   
gb|AAG50747.1|AC079733_15  pectinacetylesterase precursor, putative     241   3e-70   
ref|XP_008807933.1|  PREDICTED: protein notum homolog                   240   3e-70   
ref|XP_006367726.1|  PREDICTED: uncharacterized protein LOC102600035    239   3e-70   
gb|ACG42746.1|  carboxylic ester hydrolase                              241   4e-70   
ref|XP_006432878.1|  hypothetical protein CICLE_v100013712mg            236   4e-70   
ref|XP_011039993.1|  PREDICTED: uncharacterized protein LOC105136378    241   4e-70   
ref|XP_002894676.1|  hypothetical protein ARALYDRAFT_474842             240   4e-70   
ref|NP_182216.1|  pectinacetylesterase-like protein                     240   4e-70   
ref|XP_004970864.1|  PREDICTED: protein notum homolog isoform X1        240   4e-70   
ref|XP_006480336.1|  PREDICTED: protein notum homolog                   240   5e-70   
ref|XP_006293476.1|  hypothetical protein CARUB_v10023292mg             240   5e-70   
ref|XP_002880274.1|  hypothetical protein ARALYDRAFT_483863             240   6e-70   
ref|XP_009110820.1|  PREDICTED: uncharacterized protein LOC103836327    239   6e-70   
ref|XP_003542396.2|  PREDICTED: protein notum homolog isoform X1        239   6e-70   
ref|XP_010914805.1|  PREDICTED: protein notum homolog                   239   6e-70   
ref|XP_004968122.1|  PREDICTED: protein notum homolog isoform X1        241   6e-70   
ref|XP_009335552.1|  PREDICTED: protein notum homolog isoform X1        239   6e-70   
gb|KFK35390.1|  hypothetical protein AALP_AA5G279000                    239   7e-70   
ref|XP_008673790.1|  PREDICTED: protein notum homolog                   241   7e-70   
ref|XP_007031285.1|  Pectinacetylesterase family protein                240   7e-70   
ref|XP_008800308.1|  PREDICTED: protein notum homolog isoform X1        239   8e-70   
ref|XP_006593986.1|  PREDICTED: protein notum homolog isoform X3        239   9e-70   
ref|XP_006593985.1|  PREDICTED: protein notum homolog isoform X2        239   9e-70   
ref|XP_002320250.2|  hypothetical protein POPTR_0014s10650g             241   9e-70   
gb|KDP23324.1|  hypothetical protein JCGZ_23157                         239   1e-69   
ref|XP_002279030.1|  PREDICTED: protein notum homolog                   239   1e-69   
ref|XP_008388414.1|  PREDICTED: protein notum homolog                   239   1e-69   
emb|CAN62190.1|  hypothetical protein VITISV_020113                     239   1e-69   
ref|XP_003536008.1|  PREDICTED: protein notum homolog isoform X1        239   1e-69   
gb|EYU19373.1|  hypothetical protein MIMGU_mgv1a006907mg                239   1e-69   
ref|XP_010043350.1|  PREDICTED: protein notum homolog                   239   1e-69   
gb|AAC33215.1|  Similar to pectinacetylesterase                         237   2e-69   
ref|XP_002512590.1|  pectin acetylesterase, putative                    238   2e-69   
ref|XP_003536006.1|  PREDICTED: uncharacterized protein LOC100810716    238   2e-69   
ref|XP_003609911.1|  Pectin acetylesterase                              238   2e-69   
ref|XP_006385135.1|  hypothetical protein POPTR_0004s24220g             236   3e-69   
ref|NP_001042886.1|  Os01g0319000                                       238   3e-69   
ref|XP_006604768.1|  PREDICTED: protein notum homolog isoform X2        238   3e-69   
ref|XP_008238015.1|  PREDICTED: protein notum homolog isoform X5        235   3e-69   
ref|XP_003551008.1|  PREDICTED: protein notum homolog                   238   3e-69   
dbj|BAD94756.1|  putative pectinacetylesterase protein                  234   3e-69   
gb|KCW85365.1|  hypothetical protein EUGRSUZ_B02195                     239   3e-69   
ref|XP_011092213.1|  PREDICTED: protein notum homolog                   238   4e-69   
ref|NP_001060382.1|  Os07g0634600                                       237   4e-69   
ref|XP_011074218.1|  PREDICTED: protein notum homolog                   236   5e-69   
ref|XP_010677539.1|  PREDICTED: protein notum homolog isoform X2        236   5e-69   
ref|XP_003554582.1|  PREDICTED: protein notum homolog isoform X1        238   6e-69   
ref|XP_008238014.1|  PREDICTED: protein notum homolog isoform X4        234   6e-69   
ref|XP_008238013.1|  PREDICTED: protein notum homolog isoform X3        234   7e-69   
ref|XP_007145083.1|  hypothetical protein PHAVU_007G208200g             237   7e-69   
gb|KHN43400.1|  Protein notum like                                      238   8e-69   
ref|XP_003572052.1|  PREDICTED: uncharacterized protein LOC100821937    237   8e-69   
ref|XP_011087572.1|  PREDICTED: protein notum homolog isoform X1        237   9e-69   
ref|XP_006604776.1|  PREDICTED: protein notum homolog isoform X1        237   1e-68   
gb|EYU36473.1|  hypothetical protein MIMGU_mgv1a007602mg                236   1e-68   
ref|XP_003521640.1|  PREDICTED: protein notum homolog                   236   1e-68   
ref|XP_008246333.1|  PREDICTED: uncharacterized protein LOC103344...    237   1e-68   
ref|XP_003555771.1|  PREDICTED: uncharacterized protein LOC100793403    236   1e-68   
ref|XP_007222071.1|  hypothetical protein PRUPE_ppa007506mg             234   1e-68   
gb|KHN14201.1|  Protein notum like                                      236   1e-68   
ref|NP_001141895.1|  uncharacterized protein LOC100274042 precursor     236   2e-68   
ref|XP_006306028.1|  hypothetical protein CARUB_v10011324mg             235   2e-68   
ref|XP_004971772.1|  PREDICTED: protein notum homolog                   236   2e-68   
ref|XP_010042497.1|  PREDICTED: protein notum homolog isoform X1        236   2e-68   
ref|XP_002280865.3|  PREDICTED: protein notum homolog                   236   2e-68   
ref|XP_003562611.1|  PREDICTED: protein notum homolog                   236   2e-68   
ref|XP_010054026.1|  PREDICTED: uncharacterized protein LOC104442...    236   2e-68   
ref|XP_004970861.1|  PREDICTED: protein notum homolog                   236   2e-68   
emb|CDY66251.1|  BnaC04g52030D                                          234   2e-68   
ref|XP_010507953.1|  PREDICTED: protein notum homolog                   236   2e-68   
ref|XP_002892509.1|  hypothetical protein ARALYDRAFT_311997             234   3e-68   
ref|XP_010914808.1|  PREDICTED: uncharacterized protein LOC105040...    234   3e-68   
ref|XP_004248530.1|  PREDICTED: protein notum homolog isoform X2        235   3e-68   
ref|XP_010458242.1|  PREDICTED: uncharacterized protein LOC104739548    235   4e-68   
ref|XP_004302322.1|  PREDICTED: protein notum homolog                   235   4e-68   
ref|XP_010518382.1|  PREDICTED: protein notum homolog isoform X1        235   4e-68   
emb|CDP15161.1|  unnamed protein product                                233   4e-68   
ref|XP_010914804.1|  PREDICTED: protein notum homolog isoform X2        234   5e-68   
ref|XP_002318919.2|  hypothetical protein POPTR_0013s00280g             235   5e-68   
ref|XP_010070108.1|  PREDICTED: protein notum homolog                   235   5e-68   
ref|XP_009359821.1|  PREDICTED: protein notum homolog                   235   5e-68   
ref|XP_002459181.1|  hypothetical protein SORBIDRAFT_03g047440          235   5e-68   
ref|XP_007163281.1|  hypothetical protein PHAVU_001G221400g             234   6e-68   
tpg|DAA54427.1|  TPA: carboxylic ester hydrolase                        234   6e-68   
gb|KEH43170.1|  pectinacetylesterase family protein                     234   7e-68   
ref|XP_010506713.1|  PREDICTED: protein notum homolog isoform X1        234   7e-68   
ref|XP_008810598.1|  PREDICTED: protein notum homolog                   234   7e-68   
ref|XP_008807936.1|  PREDICTED: protein notum homolog isoform X2        234   8e-68   
ref|XP_006302295.1|  hypothetical protein CARUB_v10020343mg             234   8e-68   
ref|XP_009401969.1|  PREDICTED: uncharacterized protein LOC103985...    234   8e-68   
ref|XP_004494487.1|  PREDICTED: protein notum homolog isoform X3        234   9e-68   
ref|XP_010327277.1|  PREDICTED: protein notum homolog isoform X1        234   9e-68   
ref|XP_004296984.1|  PREDICTED: protein notum homolog                   234   9e-68   
ref|XP_008360208.1|  PREDICTED: protein notum homolog isoform X3        234   9e-68   
ref|XP_004246220.1|  PREDICTED: uncharacterized protein LOC101249672    240   9e-68   
ref|XP_008807935.1|  PREDICTED: protein notum homolog isoform X1        233   1e-67   
gb|KFK37453.1|  hypothetical protein AALP_AA4G259200                    234   1e-67   
ref|XP_010240825.1|  PREDICTED: protein notum homolog                   234   1e-67   
ref|XP_003567618.1|  PREDICTED: uncharacterized protein LOC100841630    234   1e-67   
gb|AFK45877.1|  unknown                                                 234   1e-67   
ref|XP_008369574.1|  PREDICTED: protein notum homolog isoform X1        234   1e-67   
ref|XP_007154510.1|  hypothetical protein PHAVU_003G124700g             234   1e-67   
ref|XP_008246334.1|  PREDICTED: protein notum homolog isoform X2        233   2e-67   
ref|XP_009600844.1|  PREDICTED: protein notum homolog                   233   2e-67   
ref|XP_004494486.1|  PREDICTED: protein notum homolog isoform X2        234   2e-67   
ref|XP_009363058.1|  PREDICTED: LOW QUALITY PROTEIN: protein notu...    234   2e-67   
emb|CDY39939.1|  BnaA09g15210D                                          243   2e-67   
ref|XP_004494485.1|  PREDICTED: protein notum homolog isoform X1        234   2e-67   
ref|XP_009353455.1|  PREDICTED: protein notum homolog                   233   2e-67   
ref|XP_006646555.1|  PREDICTED: protein notum homolog                   233   2e-67   
ref|XP_008222318.1|  PREDICTED: protein notum homolog                   233   2e-67   
ref|XP_008246335.1|  PREDICTED: uncharacterized protein LOC103344...    233   2e-67   
ref|XP_006646554.1|  PREDICTED: protein notum homolog                   232   2e-67   
ref|XP_010999345.1|  PREDICTED: protein notum homolog isoform X2        233   3e-67   
ref|XP_004958440.1|  PREDICTED: protein notum homolog                   233   3e-67   
dbj|BAD87540.1|  putative pectinacetylesterase precursor                233   3e-67   
ref|XP_003521625.1|  PREDICTED: protein notum homolog isoformX1         232   3e-67   
ref|XP_004304922.1|  PREDICTED: protein notum homolog                   232   3e-67   
ref|XP_006645824.1|  PREDICTED: uncharacterized protein LOC102702519    233   3e-67   
emb|CBI37040.3|  unnamed protein product                                235   4e-67   
emb|CBI26039.3|  unnamed protein product                                231   4e-67   
ref|XP_002515160.1|  pectin acetylesterase, putative                    233   4e-67   
ref|XP_008388415.1|  PREDICTED: uncharacterized protein LOC103450...    233   4e-67   
ref|XP_002461086.1|  hypothetical protein SORBIDRAFT_02g040470          232   4e-67   
ref|XP_010524828.1|  PREDICTED: protein notum homolog                   232   5e-67   
ref|XP_006358515.1|  PREDICTED: protein notum homolog                   232   5e-67   
ref|XP_004508066.1|  PREDICTED: protein notum homolog                   232   5e-67   
gb|AFK35535.1|  unknown                                                 232   5e-67   
ref|XP_009805042.1|  PREDICTED: protein notum homolog                   232   6e-67   
gb|EEC71941.1|  hypothetical protein OsI_04755                          231   6e-67   
ref|XP_006658006.1|  PREDICTED: protein notum homolog                   232   6e-67   
ref|XP_006444639.1|  hypothetical protein CICLE_v10020385mg             232   6e-67   
ref|XP_006378039.1|  hypothetical protein POPTR_0010s00700g             232   6e-67   
ref|NP_001045062.1|  Os01g0892600                                       231   6e-67   
ref|XP_003626089.1|  Pectin acetylesterase                              232   6e-67   
ref|XP_004494501.1|  PREDICTED: uncharacterized protein LOC101497...    232   7e-67   
gb|EAY76796.1|  hypothetical protein OsI_04753                          231   7e-67   
ref|XP_010511331.1|  PREDICTED: protein notum homolog                   232   8e-67   
ref|XP_008381630.1|  PREDICTED: uncharacterized protein LOC103444483    233   8e-67   
ref|XP_003626125.1|  Notum-like protein                                 231   8e-67   
ref|XP_010475792.1|  PREDICTED: uncharacterized protein LOC104755150    231   9e-67   
ref|XP_006577186.1|  PREDICTED: protein notum homolog isoform X2        233   9e-67   
ref|XP_004230372.1|  PREDICTED: protein notum homolog                   231   1e-66   
emb|CDP05188.1|  unnamed protein product                                231   1e-66   
ref|XP_010918537.1|  PREDICTED: protein notum homolog isoform X2        231   1e-66   
gb|KFK26428.1|  hypothetical protein AALP_AA8G247000                    231   1e-66   
ref|XP_004968648.1|  PREDICTED: protein notum homolog                   232   1e-66   
tpg|DAA56406.1|  TPA: hypothetical protein ZEAMMB73_392919              232   1e-66   
ref|XP_007145058.1|  hypothetical protein PHAVU_007G206300g             231   1e-66   
ref|XP_008800309.1|  PREDICTED: protein notum homolog isoform X2        230   1e-66   
ref|XP_003626088.1|  Pectin acetylesterase                              232   1e-66   
ref|XP_004234401.1|  PREDICTED: uncharacterized protein LOC101253061    230   1e-66   
gb|EYU37452.1|  hypothetical protein MIMGU_mgv1a007583mg                228   1e-66   
ref|XP_004983743.1|  PREDICTED: protein notum homolog isoform X3        229   2e-66   



>ref|XP_009590663.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana tomentosiformis]
Length=401

 Score =   311 bits (798),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/350 (43%), Positives = 223/350 (64%), Gaps = 9/350 (3%)
 Frame = -3

Query  1234  QQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSS  1055
             Q+    ++YF  ++TI+++A+S GAVCLDGSPPAY   +G G G + WI+ L GG WC +
Sbjct  32    QEKGIDHAYFV-DTTIVQNALSKGAVCLDGSPPAYHLDRGFGHGVRNWIILLSGGAWCRN  90

Query  1054  ISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGD  875
             I++C NR  + LGSS       + F F GI   + +EN +F NWNKV V YCDG  FTGD
Sbjct  91    ITDCLNRSKTDLGSSKHM----TPFIFLGIFSKSKSENPDFYNWNKVFVRYCDGGGFTGD  146

Query  874   VETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRF  695
             +E+++P T LHFRG RIFDAV+EDLL  KG++DA +  L+GGSA G   +++CDRF N  
Sbjct  147   IESIDPATNLHFRGARIFDAVIEDLLA-KGLKDAKNAILSGGSANGYPAVLYCDRFHNLL  205

Query  694   RNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMF  515
               +  VKCL + G+F+H K+P  A   ES FR ++ LH ST VLP+ C    +   LC F
Sbjct  206   HKAHRVKCLVDAGYFIHVKNPRLANVFESLFRDVVTLHGSTKVLPKSCTSKMK-PELCFF  264

Query  514   PQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKHISATQYKALKELRLQMLVAL  335
             P+++ +DI+TP F ++S +DSY +++ + +   + +++++ + +Q    KELR + L AL
Sbjct  265   PENIQQDIKTPFFTVMSAFDSYQVDNIIGSDIGDCIRARNCTESQNNDFKELRSEFLSAL  324

Query  334   RETDSPS-RGLFVSNCFGHTQLIFYWNH-PGFEVNYRKDVEVVRDWYFDR  191
              + + P  RG F+ +   HTQL  +WN      +N    +EV  DWY+DR
Sbjct  325   PKPNDPKQRGAFIDSFNRHTQLELWWNKVNATPINNLTTIEVFGDWYYDR  374



>ref|XP_009589915.1| PREDICTED: uncharacterized protein LOC104087209 isoform X2 [Nicotiana 
tomentosiformis]
Length=399

 Score =   308 bits (788),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 167/366 (46%), Positives = 230/366 (63%), Gaps = 14/366 (4%)
 Frame = -3

Query  1225  QTANSYF-TTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSIS  1049
             QT+N      + TILESAVS GAVCLDGSPPA+ + KG GEG   WI+Y  GGEWC ++ 
Sbjct  32    QTSNENLGMVDLTILESAVSKGAVCLDGSPPAFYYDKGHGEGANNWIIYFRGGEWCYNVI  91

Query  1048  ECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVE  869
             +C NR  +  GSS       S   F GIL  N   N +F NWN+V+V YCDG+SFTGDVE
Sbjct  92    DCLNRTKTEKGSSKLAPKQRS---FYGILSNNKTLNPDFYNWNRVMVIYCDGASFTGDVE  148

Query  868   TVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRN  689
              V+P T LHFRG RIF A++E  L  KGM+DA +  L GGSAGGL  ++HCDRF     N
Sbjct  149   IVDPVTNLHFRGARIFHALIEHFLA-KGMKDAKNAILAGGSAGGLPALLHCDRFRALLPN  207

Query  688   STTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQ  509
             S  VKCL++G +FLH K+  +   ++    G+I LH+S  +LP  C    + + LC+FPQ
Sbjct  208   SARVKCLADGSYFLHKKNMKEIPFMDIVNEGLITLHHSAKMLPSSCISKMRPS-LCLFPQ  266

Query  508   HVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKHISATQYKALKELRLQMLVAL-R  332
             +  ++I+TP FI+ S +D++ IN T   G+YE + +   SAT  K L++ + + L AL +
Sbjct  267   YFQQEIQTPFFIVNSMFDTFQINKTF-LGYYEDLNNNTCSATLVKTLQDFKQEFLSALPK  325

Query  331   ETD-SPSRGLFVSNCFGHTQLI--FYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQS  161
             ++D S SRG+F+ +C  H+Q++    WN  GF V+ +   E   DWYFDR + VQ ++  
Sbjct  326   QSDCSSSRGMFIDSCLIHSQILSGVGWN--GFTVHNKTIAEAFSDWYFDR-SSVQLIDTP  382

Query  160   TLVKDC  143
              L  +C
Sbjct  383   DLPLNC  388



>ref|XP_009589914.1| PREDICTED: uncharacterized protein LOC104087209 isoform X1 [Nicotiana 
tomentosiformis]
Length=400

 Score =   308 bits (788),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 167/366 (46%), Positives = 230/366 (63%), Gaps = 14/366 (4%)
 Frame = -3

Query  1225  QTANSYF-TTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSIS  1049
             QT+N      + TILESAVS GAVCLDGSPPA+ + KG GEG   WI+Y  GGEWC ++ 
Sbjct  33    QTSNENLGMVDLTILESAVSKGAVCLDGSPPAFYYDKGHGEGANNWIIYFRGGEWCYNVI  92

Query  1048  ECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVE  869
             +C NR  +  GSS       S   F GIL  N   N +F NWN+V+V YCDG+SFTGDVE
Sbjct  93    DCLNRTKTEKGSSKLAPKQRS---FYGILSNNKTLNPDFYNWNRVMVIYCDGASFTGDVE  149

Query  868   TVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRN  689
              V+P T LHFRG RIF A++E  L  KGM+DA +  L GGSAGGL  ++HCDRF     N
Sbjct  150   IVDPVTNLHFRGARIFHALIEHFLA-KGMKDAKNAILAGGSAGGLPALLHCDRFRALLPN  208

Query  688   STTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQ  509
             S  VKCL++G +FLH K+  +   ++    G+I LH+S  +LP  C    + + LC+FPQ
Sbjct  209   SARVKCLADGSYFLHKKNMKEIPFMDIVNEGLITLHHSAKMLPSSCISKMRPS-LCLFPQ  267

Query  508   HVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKHISATQYKALKELRLQMLVAL-R  332
             +  ++I+TP FI+ S +D++ IN T   G+YE + +   SAT  K L++ + + L AL +
Sbjct  268   YFQQEIQTPFFIVNSMFDTFQINKTF-LGYYEDLNNNTCSATLVKTLQDFKQEFLSALPK  326

Query  331   ETD-SPSRGLFVSNCFGHTQLI--FYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQS  161
             ++D S SRG+F+ +C  H+Q++    WN  GF V+ +   E   DWYFDR + VQ ++  
Sbjct  327   QSDCSSSRGMFIDSCLIHSQILSGVGWN--GFTVHNKTIAEAFSDWYFDR-SSVQLIDTP  383

Query  160   TLVKDC  143
              L  +C
Sbjct  384   DLPLNC  389



>ref|XP_004244682.2| PREDICTED: uncharacterized protein LOC101248898 [Solanum lycopersicum]
Length=390

 Score =   306 bits (785),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 163/377 (43%), Positives = 231/377 (61%), Gaps = 12/377 (3%)
 Frame = -3

Query  1258  ILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYL  1079
             I  +++L+ +          N TILESAVS GAVCLDG+PPAY + KG GEG   WI+Y 
Sbjct  14    IFCLIMLNDKVVIGEGETMVNLTILESAVSKGAVCLDGTPPAYYYEKGYGEGANNWIIYF  73

Query  1078  LGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYC  899
              GGEWC ++ +C  R T+  GSS       S   F GIL  N   N +F NWN+V+V YC
Sbjct  74    RGGEWCYNVIDCVARTTTEKGSSKYALKQRS---FYGILSNNKTINPDFYNWNRVMVIYC  130

Query  898   DGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIH  719
             DGSSFTGDVE V+P   LHFRG RIF A++E+ L  KGM++A +  L+GGSAGGL  +IH
Sbjct  131   DGSSFTGDVELVDPINKLHFRGARIFLALIENFL-EKGMKNAKNAILSGGSAGGLPALIH  189

Query  718   CDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNH  539
             CDRF     NS  VKCL++G +FLH +   +   +++   G+I LH+ST +LP  C    
Sbjct  190   CDRFKALLPNSARVKCLADGSYFLHREQMKEMAFMDTVNEGLIKLHHSTNMLPSSCTSKM  249

Query  538   QLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKHISATQYKALKEL  359
               + LC+FPQ+  + I+TP FI+ S +D++ IN T   G+YE + S   S +  K L++ 
Sbjct  250   NPS-LCLFPQYFQEGIKTPFFIVNSMFDTFQINKTFP-GYYENLFSNTCSTSLVKTLQDF  307

Query  358   RLQMLVAL-RETDSPSRGLFVSNCFGHTQLI--FYWNHPGFEVNYRKDVEVVRDWYFDRI  188
             +   + AL ++++S SRG+F+ +C  H+Q+     WN  GF V  +   +   DWYFD+ 
Sbjct  308   KQDFINALPKQSNSSSRGMFIDSCLIHSQITSGVGWN--GFSVYNKTIAKTFSDWYFDK-  364

Query  187   NHVQEVEQSTLVKDCPN  137
             +H Q +++  L  +C N
Sbjct  365   SHEQLIDKPDLPLNCYN  381



>ref|XP_009803843.1| PREDICTED: uncharacterized protein LOC104249167 [Nicotiana sylvestris]
 ref|XP_009803844.1| PREDICTED: uncharacterized protein LOC104249167 [Nicotiana sylvestris]
Length=396

 Score =   305 bits (781),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 164/366 (45%), Positives = 229/366 (63%), Gaps = 14/366 (4%)
 Frame = -3

Query  1225  QTANSYF-TTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSIS  1049
             QT+N      + TILESAVS GAVCLDGSPPA+ + KG GEG   WI+Y  GGEWC ++ 
Sbjct  29    QTSNENLGMVDITILESAVSKGAVCLDGSPPAFYYDKGHGEGANNWIIYFRGGEWCYNVL  88

Query  1048  ECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVE  869
             +C NR  +  GSS       S   F GIL  N  EN +F NWN+V+V YCDGSSFTGDVE
Sbjct  89    DCLNRTKTEKGSSKLAPKQRS---FYGILGNNKTENPDFYNWNRVMVIYCDGSSFTGDVE  145

Query  868   TVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRN  689
              V+P T LHFRG R+F A++E  LV  GM+DA +  L+GGSAGGL  ++HCDRF     N
Sbjct  146   IVDPVTNLHFRGARVFHALIEHFLV-IGMKDAKNAILSGGSAGGLPALLHCDRFRALLPN  204

Query  688   STTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQ  509
             S  VKCL++G +FLH K+  +   ++    G+I LH+S  +LP  C    + + LC+FPQ
Sbjct  205   SARVKCLADGSYFLHKKNMKEIPFMDIVNEGLITLHHSAKMLPSSCTSKMRPS-LCLFPQ  263

Query  508   HVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKHISATQYKALKELRLQMLVALRE  329
             +  ++I+TP FI+ S +D++ IN T   G+YE + +   SAT  K L++ + + L AL +
Sbjct  264   YFQQEIQTPFFIVNSMFDTFQINKTFP-GYYEDLNNNTCSATLVKTLQDFKQEFLSALPK  322

Query  328   TD--SPSRGLFVSNCFGHTQLI--FYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQS  161
                 S SRG+F+ +C  H+Q++    WN  GF V+ +   E   +WYFD ++ VQ ++  
Sbjct  323   QSNCSSSRGMFIDSCLIHSQILSGVGWN--GFTVHNKTIAEAFSNWYFD-LSPVQLIDTP  379

Query  160   TLVKDC  143
              +  +C
Sbjct  380   DMPLNC  385



>ref|XP_010314003.1| PREDICTED: protein notum homolog isoform X1 [Solanum lycopersicum]
Length=404

 Score =   300 bits (767),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 151/353 (43%), Positives = 216/353 (61%), Gaps = 9/353 (3%)
 Frame = -3

Query  1243  VLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEW  1064
             +L Q+    ++YF  + TI+++AVS GAVCLDGSPPAY    G G G + WI+ L GG W
Sbjct  32    LLKQEKHADHAYFV-DITIVQNAVSKGAVCLDGSPPAYHLDPGFGHGVRNWIILLSGGAW  90

Query  1063  CSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSF  884
             C + ++C NR  + LGSS         F F GI   +  EN +F NWNKV V YCDG +F
Sbjct  91    CRNTTDCLNRSKTDLGSSTLML----PFIFLGIFSKSKTENPDFYNWNKVFVRYCDGGAF  146

Query  883   TGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFA  704
             TGD+E V+P T LHFRG RIFDA++EDLL  KG++DA +  L+GGSA G   +++CD F 
Sbjct  147   TGDIENVDPATNLHFRGARIFDAIIEDLLA-KGLKDAKNAILSGGSANGYPAMLYCDHFH  205

Query  703   NRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYL  524
             +    +  VKCL + G+F+  K+P      ES F+ ++ LH ST VLP+ C    +   L
Sbjct  206   SLLPKAHRVKCLVDAGYFIRVKNPLLTNVFESIFKDVVTLHGSTKVLPKSCTSRMK-PEL  264

Query  523   CMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKHISATQYKALKELRLQML  344
             C FP+++ +DI+TP F ++S +DSY +N  +     E +++++ +  Q  A KELR + L
Sbjct  265   CFFPENIQRDIKTPFFTVMSAFDSYQVNSIIGFDIGEYIQARNCTENQNNAFKELRSEFL  324

Query  343   VALRETDSPS-RGLFVSNCFGHTQLIFYWNH-PGFEVNYRKDVEVVRDWYFDR  191
              AL + + P  RG+F+ +   HTQL  +WN      VN    ++V  DWY+DR
Sbjct  325   RALPKANDPKQRGVFIDSFNRHTQLELWWNKINATPVNNLTTIKVFGDWYYDR  377



>ref|XP_010314004.1| PREDICTED: protein notum homolog isoform X2 [Solanum lycopersicum]
Length=401

 Score =   299 bits (766),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 151/353 (43%), Positives = 216/353 (61%), Gaps = 9/353 (3%)
 Frame = -3

Query  1243  VLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEW  1064
             +L Q+    ++YF  + TI+++AVS GAVCLDGSPPAY    G G G + WI+ L GG W
Sbjct  29    LLKQEKHADHAYFV-DITIVQNAVSKGAVCLDGSPPAYHLDPGFGHGVRNWIILLSGGAW  87

Query  1063  CSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSF  884
             C + ++C NR  + LGSS         F F GI   +  EN +F NWNKV V YCDG +F
Sbjct  88    CRNTTDCLNRSKTDLGSSTLML----PFIFLGIFSKSKTENPDFYNWNKVFVRYCDGGAF  143

Query  883   TGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFA  704
             TGD+E V+P T LHFRG RIFDA++EDLL  KG++DA +  L+GGSA G   +++CD F 
Sbjct  144   TGDIENVDPATNLHFRGARIFDAIIEDLLA-KGLKDAKNAILSGGSANGYPAMLYCDHFH  202

Query  703   NRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYL  524
             +    +  VKCL + G+F+  K+P      ES F+ ++ LH ST VLP+ C    +   L
Sbjct  203   SLLPKAHRVKCLVDAGYFIRVKNPLLTNVFESIFKDVVTLHGSTKVLPKSCTSRMK-PEL  261

Query  523   CMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKHISATQYKALKELRLQML  344
             C FP+++ +DI+TP F ++S +DSY +N  +     E +++++ +  Q  A KELR + L
Sbjct  262   CFFPENIQRDIKTPFFTVMSAFDSYQVNSIIGFDIGEYIQARNCTENQNNAFKELRSEFL  321

Query  343   VALRETDSPS-RGLFVSNCFGHTQLIFYWNH-PGFEVNYRKDVEVVRDWYFDR  191
              AL + + P  RG+F+ +   HTQL  +WN      VN    ++V  DWY+DR
Sbjct  322   RALPKANDPKQRGVFIDSFNRHTQLELWWNKINATPVNNLTTIKVFGDWYYDR  374



>ref|XP_006365947.1| PREDICTED: uncharacterized protein LOC102601254 [Solanum tuberosum]
Length=401

 Score =   297 bits (761),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 150/352 (43%), Positives = 216/352 (61%), Gaps = 9/352 (3%)
 Frame = -3

Query  1240  LHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWC  1061
             L Q+    ++YF  + TI++++VS GAVCLDGSPPAY   +G G G + WI+ L GG WC
Sbjct  30    LKQEKGADHAYFV-DKTIVQNSVSKGAVCLDGSPPAYHLDRGFGHGLRNWIILLSGGAWC  88

Query  1060  SSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFT  881
              + ++C NR  + LGSS         F F GI   +  EN +F NWNKV V YCDG +FT
Sbjct  89    RNTTDCLNRSKTDLGSSTLML----PFIFLGIFSKSKRENPDFYNWNKVFVRYCDGGAFT  144

Query  880   GDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFAN  701
             GD+E V+P T LHFRG RIFDA++EDLL  KG++DA +  L+GGSA G   +++CD F +
Sbjct  145   GDIENVDPATNLHFRGARIFDAIIEDLLA-KGLKDAKNAILSGGSANGYPAMLYCDHFRS  203

Query  700   RFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLC  521
                 +  VKCL + G+F+  K+P  A   ES FR ++ LH ST VLP+ C    +   LC
Sbjct  204   LLHKAHRVKCLVDAGYFIRVKNPLLANVFESIFRDVVTLHGSTKVLPKSCTSRMK-PELC  262

Query  520   MFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKHISATQYKALKELRLQMLV  341
              F +++ +DI+TP F ++S +DSY +N  + +   E +++++ + +Q  A KELR + L 
Sbjct  263   FFLENIQRDIKTPFFTVMSAFDSYQVNSIIGSDIGEYIQARNCTESQNNAFKELRSEFLR  322

Query  340   ALRETDSPS-RGLFVSNCFGHTQLIFYWNHPGFEVNYR-KDVEVVRDWYFDR  191
             AL + + P  RG F+ +   HTQL  +WN       Y    ++V  DWY+DR
Sbjct  323   ALPKANDPKQRGAFIDSFNRHTQLELWWNKINATPVYNLTTIKVFGDWYYDR  374



>ref|XP_006361594.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=518

 Score =   296 bits (758),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 153/342 (45%), Positives = 216/342 (63%), Gaps = 12/342 (4%)
 Frame = -3

Query  1159  VCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAF  980
             VCLDG+PPAY + KG GEG   WI+Y  GGEWC ++ +C  R T+  GSS    +     
Sbjct  175   VCLDGTPPAYYYEKGHGEGANNWIIYFRGGEWCYNVMDCLARATTERGSSK---YAPKQR  231

Query  979   NFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDL  800
             +F GIL  N   N +F NWN+V+V YCDGSSFTGDVE V+P T LHFRG RIF A++E+ 
Sbjct  232   SFYGILSNNKTINPDFYNWNRVMVIYCDGSSFTGDVEIVDPITNLHFRGARIFLALIENF  291

Query  799   LVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQ  620
             L  KGM++A +  L+GGSAGGL  +IHCDRF     NS  VKCL++G +FLH KH  +  
Sbjct  292   L-EKGMKNAKNAILSGGSAGGLPALIHCDRFKALLPNSARVKCLADGSYFLHRKHKKEMS  350

Query  619   DLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLIN  440
              +++   G+I LH+S  +LP  C      + LC+FPQ+  + I+TP FI+ S +D++ IN
Sbjct  351   FMDTVNEGLIKLHHSANMLPSSCTSKMNPS-LCLFPQYFQQGIKTPFFIVNSMFDTFQIN  409

Query  439   HTLSTGFYEAVKSKHISATQYKALKELRLQMLVAL-RETDSPSRGLFVSNCFGHTQLI--  269
              T   G+YE + S   SA+  K L++ +   L AL ++++S SRG+F+ +C  H+Q+   
Sbjct  410   KTFP-GYYEDLFSNTCSASLVKTLQDFKQDFLNALPKQSNSSSRGMFIDSCLIHSQITSG  468

Query  268   FYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTLVKDC  143
               WN  GF V+ +   +   DWYFDR +H Q +++  L  +C
Sbjct  469   VGWN--GFSVHNKSIAKAFSDWYFDR-SHEQLIDKPDLPLNC  507



>ref|XP_009624847.1| PREDICTED: protein notum homolog isoform X2 [Nicotiana tomentosiformis]
Length=388

 Score =   285 bits (729),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 153/375 (41%), Positives = 217/375 (58%), Gaps = 15/375 (4%)
 Frame = -3

Query  1267  TTFILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWI  1088
             T FI     + Q P   N       TI+ SAVS GAVCLDGSPPAY F  G GEG   W+
Sbjct  19    TIFITECAKVTQNPDVYN----VTKTIVHSAVSKGAVCLDGSPPAYHFDPGFGEGVGNWL  74

Query  1087  VYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVV  908
             V L GG WC+++ +C NR  S +GSS   +       FKGI   N + N +F NWNKV V
Sbjct  75    VQLSGGGWCTNVKDCLNRSKSDVGSSSYMHPQP----FKGIFSKNQSANPDFYNWNKVFV  130

Query  907   HYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAV  728
              YCDG SFTGDVE V+P T LHFRG RIF AV+E+LL  KG+++A +  L G SAGG   
Sbjct  131   RYCDGGSFTGDVEYVDPATNLHFRGARIFTAVLEELLA-KGLKNAKNAILAGSSAGGYPA  189

Query  727   IIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCR  548
             I++CDRF N   N++ VKCL + G+F+H K+P   +  ES ++G+  L  S   LP+ C 
Sbjct  190   ILYCDRFRNLLPNTSRVKCLVDSGYFVHFKNPVLGRPFESIYKGVATLQGSAKTLPKSCT  249

Query  547   KNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKHISATQYKAL  368
                +   LC+F +++ +DI+TP+FI +S +D+ +  +TL    Y  +++   +A+Q K  
Sbjct  250   SKMK-PELCLFAENIQQDIKTPIFISMSAFDNIMTQYTLGGTIYGCIQNGTCTASQNKTF  308

Query  367   KELRLQMLVALRETDSPS-RGLFVSNCFGHTQL---IFYWNHPGFEVNYRKDVEVVRDWY  200
             +E+R   L A+ + ++P  RG+F+     HT L     +       V+     +   DWY
Sbjct  309   QEMRSDFLSAIPKGNNPKLRGVFIDVVHHHTSLQKQTRWSPEKPIVVHNLAAPKAFSDWY  368

Query  199   FDRINHVQEVEQSTL  155
             FDR N+   +++  L
Sbjct  369   FDR-NYTYLIDEHNL  382



>ref|XP_009799834.1| PREDICTED: protein notum homolog [Nicotiana sylvestris]
Length=392

 Score =   283 bits (725),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 145/371 (39%), Positives = 220/371 (59%), Gaps = 12/371 (3%)
 Frame = -3

Query  1285  MGTLLNTTFILLI---VVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKG  1115
             M T     F L++    ++  +  T   ++    TI+++AVS GAVCLDGSPPAY F  G
Sbjct  3     MATRCLQLFCLIVCSLAIIKTESATDLDFYEVKKTIVKNAVSKGAVCLDGSPPAYHFEPG  62

Query  1114  IGEGRQRWIVYLLGGEWCSSISECTNR-KTSHLGSSHRQYWNDSAFNFKGILDFNCAENS  938
              GEG   W V L GG WC+S+  C  R + + +GS+         F F+GI   N + N 
Sbjct  63    FGEGVGNWFVQLAGGAWCTSVETCKERIRDNKVGSTTIM----GPFTFQGIYSKNQSANP  118

Query  937   EFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFL  758
             +F NWNKV+V YCDG +FTGDVE V+P T LHFRG RIF+AVVED+L  KG+++A +  L
Sbjct  119   DFYNWNKVLVRYCDGGAFTGDVEYVDPATNLHFRGARIFEAVVEDVLA-KGLKNAKNAIL  177

Query  757   TGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHN  578
              G SAGG   +++CD F +   N+  VKC  +GG+F+H+K+  +A+  E  + G++ LH 
Sbjct  178   AGSSAGGYPAMLYCDHFRSLLPNTPRVKCFVDGGYFIHAKNQKQARGFEEIYNGLVTLHG  237

Query  577   STAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSK  398
             S   LP+ C    +   LC+FP+++ ++I+ PLFI +S +D + IN T+    ++ +++ 
Sbjct  238   SGKTLPKSCTSKMK-PLLCLFPENMQQNIKIPLFIAMSAFDIFQINTTVEPNLHDVIENG  296

Query  397   HISATQYKALKELRLQMLVALRETDSPS-RGLFVSNCFGHTQLIFYWN-HPGFEVNYRKD  224
               + +Q KA +E R + L  L + ++P  RG+F+ +   HT L+  W+      +N    
Sbjct  297   TCTTSQNKAFREFRSEFLSTLPKPNNPKMRGVFIDSVNHHTSLLTRWSPENATMINNLSL  356

Query  223   VEVVRDWYFDR  191
              +   DWYFDR
Sbjct  357   PKAFGDWYFDR  367



>ref|XP_009624845.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana tomentosiformis]
Length=390

 Score =   281 bits (720),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 153/377 (41%), Positives = 218/377 (58%), Gaps = 17/377 (5%)
 Frame = -3

Query  1267  TTFILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWI  1088
             T FI     + Q P   N       TI+ SAVS GAVCLDGSPPAY F  G GEG   W+
Sbjct  19    TIFITECAKVTQNPDVYN----VTKTIVHSAVSKGAVCLDGSPPAYHFDPGFGEGVGNWL  74

Query  1087  VYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVV  908
             V L GG WC+++ +C NR  S +GSS   +       FKGI   N + N +F NWNKV V
Sbjct  75    VQLSGGGWCTNVKDCLNRSKSDVGSSSYMHPQP----FKGIFSKNQSANPDFYNWNKVFV  130

Query  907   HYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAV  728
              YCDG SFTGDVE V+P T LHFRG RIF AV+E+LL  KG+++A +  L G SAGG   
Sbjct  131   RYCDGGSFTGDVEYVDPATNLHFRGARIFTAVLEELLA-KGLKNAKNAILAGSSAGGYPA  189

Query  727   IIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGI--IDLHNSTAVLPEP  554
             I++CDRF N   N++ VKCL + G+F+H K+P   +  ES ++G+  + L  S   LP+ 
Sbjct  190   ILYCDRFRNLLPNTSRVKCLVDSGYFVHFKNPVLGRPFESIYKGVATLQLQGSAKTLPKS  249

Query  553   CRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKHISATQYK  374
             C    +   LC+F +++ +DI+TP+FI +S +D+ +  +TL    Y  +++   +A+Q K
Sbjct  250   CTSKMK-PELCLFAENIQQDIKTPIFISMSAFDNIMTQYTLGGTIYGCIQNGTCTASQNK  308

Query  373   ALKELRLQMLVALRETDSPS-RGLFVSNCFGHTQL---IFYWNHPGFEVNYRKDVEVVRD  206
               +E+R   L A+ + ++P  RG+F+     HT L     +       V+     +   D
Sbjct  309   TFQEMRSDFLSAIPKGNNPKLRGVFIDVVHHHTSLQKQTRWSPEKPIVVHNLAAPKAFSD  368

Query  205   WYFDRINHVQEVEQSTL  155
             WYFDR N+   +++  L
Sbjct  369   WYFDR-NYTYLIDEHNL  384



>ref|XP_010248193.1| PREDICTED: uncharacterized protein LOC104591101 [Nelumbo nucifera]
Length=394

 Score =   281 bits (719),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 159/387 (41%), Positives = 223/387 (58%), Gaps = 35/387 (9%)
 Frame = -3

Query  1219  ANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECT  1040
             AN YF    T +++AV+ GAVCLDGSPPAY    G G G   W++ L GG WC++ + C 
Sbjct  22    ANGYFV-GITYVDNAVAKGAVCLDGSPPAYHMAPGFGSGVNNWLILLEGGAWCNNATTCL  80

Query  1039  NRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVN  860
              RK + LGSS          +F G L      N +F NWNKV V YCDGSSFTGDVE V+
Sbjct  81    ARKNTRLGSSKEMV---KQLSFSGFLSDKEKFNPDFFNWNKVKVRYCDGSSFTGDVEAVD  137

Query  859   PTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTT  680
             P T L++RG+RIF+AVV+DLL  KGM++A +  L+G SAGGL+VI+HCD+F      ST 
Sbjct  138   PATNLYYRGQRIFNAVVDDLL-EKGMKNAQNALLSGCSAGGLSVILHCDKFRELLPQSTK  196

Query  679   VKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVA  500
             VKC+++ GFF+++K  A  + ++  F  ++  H S   LP  C        LC FPQ+VA
Sbjct  197   VKCMADAGFFINAKTIAGTEYIKEFFSDVVTTHQSAKNLPASCTSKGDXT-LCFFPQNVA  255

Query  499   KDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKH--------ISATQYKALKELRLQML  344
               + TPLFI+ + YDSY + + L+ G  +   + H         S TQ +A++  R + L
Sbjct  256   PQVTTPLFILNAAYDSYQVKNILAPGIADPHGTWHDCKLDITKCSDTQLQAIQGFRKEFL  315

Query  343   VALRETD-SPSRGLFVSNCFGHTQLIFYWNHPGFEVNY-RKDVEV---------VRDWYF  197
              A++  + SP++GLF+++C+ H Q        G +  + R+D  V         V DWYF
Sbjct  316   NAIKGVEGSPTKGLFINSCYSHCQ-------SGMQETWLREDSPVLDNMSISKAVGDWYF  368

Query  196   DRINHVQEVEQSTLV--KDCPNNTFIE  122
             DR   VQ++EQ      K C N  F +
Sbjct  369   DR-GTVQKIEQCEYPCDKSCHNRVFTD  394



>ref|XP_009778395.1| PREDICTED: protein notum homolog [Nicotiana sylvestris]
Length=397

 Score =   281 bits (719),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 144/367 (39%), Positives = 221/367 (60%), Gaps = 21/367 (6%)
 Frame = -3

Query  1225  QTANSY----FTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCS  1058
             + A SY    +    T++ +AVS GAVCLDGSPPAY F  G G+G  +W+V+L GG WC+
Sbjct  29    ENATSYIDQGYYVEKTVVHNAVSKGAVCLDGSPPAYHFEPGFGDGVGKWLVHLSGGAWCT  88

Query  1057  SISECTNRKTSHLGSSH--RQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSF  884
             ++ EC NR  S  GSS+  + +W      F+GI     + N +F NWNKV V YCDG +F
Sbjct  89    TVEECLNRSKSDFGSSNYMKPWW------FQGIYSKTQSVNPDFYNWNKVFVRYCDGGAF  142

Query  883   TGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFA  704
             TG+ E V+P T LHFRG RIF AV+ED+L  KG+++A    L G SA G   +++CDRF 
Sbjct  143   TGNAEYVDPATNLHFRGARIFKAVMEDVLA-KGLKNAQSALLIGSSAAGYPAMLYCDRFR  201

Query  703   NRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYL  524
                 N+  VKC+ + G+F+H K P +A++    ++ I++LH S   LP+ C K  +   +
Sbjct  202   KLLPNTPRVKCMVDAGYFIHVKDPHQARNFTEMYKAIVNLHGSAKTLPKSCTKKMK-PEM  260

Query  523   CMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKHISATQYKALKELRLQML  344
             C FP+++   I+TPL+I +S +D + IN T+  G    ++  + +AT+ K  +E RL+ L
Sbjct  261   CFFPENMQHKIKTPLYIAMSAFDKFQINTTIYDGINICIEGGNCTATENKLFREFRLEFL  320

Query  343   VALRETDSPS-RGLFVSNCFGHTQLIFYWNHPGFEVNYRKDVEVVR---DWYFDRINHVQ  176
              AL + ++P  RG F+     HTQ+  +W+     V   K++ +++   DWY+DR N+  
Sbjct  321   NALPKANNPKLRGAFIDARNHHTQVQGWWSPK--NVTTVKNLNLMKAFADWYYDR-NYTY  377

Query  175   EVEQSTL  155
              +++  L
Sbjct  378   VIDERDL  384



>ref|XP_009797876.1| PREDICTED: protein notum homolog isoform X2 [Nicotiana sylvestris]
Length=388

 Score =   281 bits (718),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 156/382 (41%), Positives = 223/382 (58%), Gaps = 14/382 (4%)
 Frame = -3

Query  1261  FILLIVVLHQQPQTAN-SYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIV  1085
             F L IV+      T N   +    TI+ SAVS GAVCLDGSPPAY F  G G+G   W+V
Sbjct  16    FTLTIVITECAKVTQNPDVYNITKTIIHSAVSKGAVCLDGSPPAYHFDPGFGDGVGNWLV  75

Query  1084  YLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVH  905
              L GG WC+++ EC +R  S LGSS+  Y N     F+G    N + N EF NWNKV V 
Sbjct  76    QLSGGGWCTNVKECLDRAKSDLGSSN--YMNPQ--EFQGFFSKNQSANPEFYNWNKVFVR  131

Query  904   YCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVI  725
             YCDG SFTGDVE V+P T LHFRG RIF  V+E+LL  KG+++A +  L G SAGG   +
Sbjct  132   YCDGGSFTGDVEYVDPATKLHFRGARIFTVVLEELLA-KGLKNAKNAILAGSSAGGYPAM  190

Query  724   IHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRK  545
             ++CD F N   N++ VKCL + G+F+H K+    +  ES ++GI  L  S   LP+ C  
Sbjct  191   LYCDGFRNSLPNTSRVKCLVDSGYFVHFKNTVLGRPFESIYKGIATLQGSAKTLPKSCTS  250

Query  544   NHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKHISATQYKALK  365
               +   LC+F +++ +DI+TP+FI +S +D+ +  +TL  G Y  ++    +A+Q K L+
Sbjct  251   KMK-PELCLFAENIQQDIKTPIFISMSAFDNIMTQYTLGGGIYGCIQEGTCTASQNKTLQ  309

Query  364   ELRLQMLVALRETDSPS-RGLFVSNCFGHTQL--IFYWNH-PGFEVNYRKDVEVVRDWYF  197
             E+R   L A+ + ++P  RG+F+     HT L     W+      V+     +   DWYF
Sbjct  310   EMRSDFLNAIPKGNNPKLRGVFIDVVHHHTSLQKQTRWSPVKPIVVHNLAAPKAFADWYF  369

Query  196   DRINHVQEVEQSTLVKDCPNNT  131
             DR N+   +++ +L    PN++
Sbjct  370   DR-NYTYLIDERSL--PLPNDS  388



>ref|XP_010244169.1| PREDICTED: protein notum homolog [Nelumbo nucifera]
Length=401

 Score =   281 bits (718),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 154/383 (40%), Positives = 213/383 (56%), Gaps = 31/383 (8%)
 Frame = -3

Query  1207  FTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKT  1028
             F    T L+SAV+ GAVCLDGSPPAY    G G G   W+V+  GG WC++++ C  RK 
Sbjct  28    FNVGITYLQSAVAKGAVCLDGSPPAYHMSPGFGAGVNNWLVFFEGGSWCNNVTSCLARKN  87

Query  1027  SHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTG  848
             + LGSS +        +F GIL      N +F NWNK+ V YCDGSSFTGDVE VNP T 
Sbjct  88    TRLGSSKQM---TKEVSFSGILSNKEKFNPDFYNWNKIKVRYCDGSSFTGDVEAVNPATN  144

Query  847   LHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCL  668
             LHFRG+RIF AV+EDLL  KGM++A +  LTG SAGGL  I+HCDRF      ST VKC+
Sbjct  145   LHFRGQRIFLAVIEDLLA-KGMKNAKNALLTGCSAGGLTAILHCDRFRTLLPASTKVKCM  203

Query  667   SNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIR  488
             ++ GFF+++K  A    +++ +  ++  H S   LP  C        LC FPQ+VA  I 
Sbjct  204   ADAGFFINAKSVAGTSHIQAFYNDVVATHQSAKNLPASCTSRFNPG-LCFFPQYVAPQIS  262

Query  487   TPLFIMVSTYDSYLINHTLSTGFYEAVKSKH--------ISATQYKALKELRLQMLVAL-  335
             TPLFI+ + YDS+ + + L+ G  +   + H         S++Q + ++  R++ L  L 
Sbjct  263   TPLFILNAAYDSWQVKNILAPGVADPHGTWHDCKLDITKCSSSQLQIMQGFRMEFLSTLT  322

Query  334   RETDSPSRGLFVSNCFGHTQLIFYWNHPGFEVNYRKD----------VEVVRDWYFDRIN  185
             R   SP++ LF+++C+ H Q        G +  + +D           + V DWYFDR  
Sbjct  323   RLMGSPTKALFINSCYSHCQT-------GTQETWLRDDSPVLDKTSISKAVGDWYFDRSG  375

Query  184   HVQEVEQSTLVKDCPNNTFIEEE  116
               +        K C N  F  +E
Sbjct  376   FQKIDCPYPCDKSCHNRVFDSDE  398



>ref|XP_006385137.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 ref|XP_006385139.1| pectinacetylesterase family protein [Populus trichocarpa]
 gb|ERP62934.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62936.1| pectinacetylesterase family protein [Populus trichocarpa]
Length=399

 Score =   280 bits (717),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 155/365 (42%), Positives = 222/365 (61%), Gaps = 29/365 (8%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T ++SAV+ GAVCLDGSPPAY + KG G G   W+++  GG WC++++ C +RK +HLGS
Sbjct  30    TYVKSAVAKGAVCLDGSPPAYHWDKGFGTGINSWLIHFEGGGWCNNVTSCLSRKKTHLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S           F GI++     N +F NWN+V + YCDGSSFTGDV+ VNP T LHFRG
Sbjct  90    SKLM---GQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQAVNPATNLHFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RI+ AV+EDLL  KG+++A +  L+G SAGGLA I+HCD F    R  T VKCLS+ G+
Sbjct  147   ARIWLAVIEDLLP-KGLKNAENALLSGCSAGGLASILHCDSFRALLRMGTKVKCLSDAGY  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+  K  + A  +++ F  I+ LH S   LP  C    + ++ C FPQ+VA  +RTPLFI
Sbjct  206   FIKVKDVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSVLKPSF-CFFPQYVAPQVRTPLFI  264

Query  472   MVSTYDSYLINHTLST------GFYEAVK--SKHISATQYKALKELRLQMLVAL-RETDS  320
             + + YDS+ I + L+       G +++ K    + S  Q K++++ RLQ L AL + T+S
Sbjct  265   LNAAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQFLNALNKSTNS  324

Query  319   PSRGLFVSNCFGHTQL-----IFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTL  155
              SRGL++ +C+ H Q       F  + P   +  +K  + V DW++DR N  Q++     
Sbjct  325   SSRGLYIDSCYAHCQTETQEKWFMEDSP--VLGKKKIAKAVGDWFYDR-NPFQKI-----  376

Query  154   VKDCP  140
               DCP
Sbjct  377   --DCP  379



>ref|XP_011028483.1| PREDICTED: uncharacterized protein LOC105128479 isoform X3 [Populus 
euphratica]
 ref|XP_011028484.1| PREDICTED: uncharacterized protein LOC105128479 isoform X3 [Populus 
euphratica]
Length=427

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 155/365 (42%), Positives = 222/365 (61%), Gaps = 29/365 (8%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T ++SAV+ GAVCLDGSPPAY + KG G G   W+++  GG WC++++ C +RK +HLGS
Sbjct  30    TYVKSAVAKGAVCLDGSPPAYHWDKGSGTGINSWLIHFEGGGWCNNVTSCLSRKKTHLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S           F GI++     N +F NWN+V + YCDGSSFTGDV+ VNP T LHFRG
Sbjct  90    SKLM---GQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQAVNPATNLHFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RI+ AV+EDLL  KG+++A +  L+G SAGGLA I+HCD F    R  T VKCLS+ G+
Sbjct  147   ARIWLAVIEDLLP-KGLKNAENALLSGCSAGGLASILHCDSFRALLRMGTKVKCLSDAGY  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+  K  + A  +++ F  I+ LH S   LP  C    + ++ C FPQ+VA  +RTPLFI
Sbjct  206   FIKVKDVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSMLKPSF-CFFPQYVAPQVRTPLFI  264

Query  472   MVSTYDSYLINHTLST------GFYEAVK--SKHISATQYKALKELRLQMLVALR-ETDS  320
             + + YDS+ I + L+       G +++ K    + S  Q K++++ RLQ L AL+  T+S
Sbjct  265   LNAAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQFLNALKTSTNS  324

Query  319   PSRGLFVSNCFGHTQL-----IFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTL  155
              SRGL++ +C+ H Q       F  + P   +  +K  + V DW++DR N  Q++     
Sbjct  325   SSRGLYIDSCYAHCQTETQEKWFMEDSP--VLGKKKIAKAVGDWFYDR-NPFQKI-----  376

Query  154   VKDCP  140
               DCP
Sbjct  377   --DCP  379



>ref|XP_006385134.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62931.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
Length=430

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 155/365 (42%), Positives = 222/365 (61%), Gaps = 29/365 (8%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T ++SAV+ GAVCLDGSPPAY + KG G G   W+++  GG WC++++ C +RK +HLGS
Sbjct  33    TYVKSAVAKGAVCLDGSPPAYHWDKGFGTGINSWLIHFEGGGWCNNVTSCLSRKKTHLGS  92

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S           F GI++     N +F NWN+V + YCDGSSFTGDV+ VNP T LHFRG
Sbjct  93    SKLM---GQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQAVNPATNLHFRG  149

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RI+ AV+EDLL  KG+++A +  L+G SAGGLA I+HCD F    R  T VKCLS+ G+
Sbjct  150   ARIWLAVIEDLLP-KGLKNAENALLSGCSAGGLASILHCDSFRALLRMGTKVKCLSDAGY  208

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+  K  + A  +++ F  I+ LH S   LP  C    + ++ C FPQ+VA  +RTPLFI
Sbjct  209   FIKVKDVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSVLKPSF-CFFPQYVAPQVRTPLFI  267

Query  472   MVSTYDSYLINHTLST------GFYEAVK--SKHISATQYKALKELRLQMLVAL-RETDS  320
             + + YDS+ I + L+       G +++ K    + S  Q K++++ RLQ L AL + T+S
Sbjct  268   LNAAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQFLNALNKSTNS  327

Query  319   PSRGLFVSNCFGHTQL-----IFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTL  155
              SRGL++ +C+ H Q       F  + P   +  +K  + V DW++DR N  Q++     
Sbjct  328   SSRGLYIDSCYAHCQTETQEKWFMEDSP--VLGKKKIAKAVGDWFYDR-NPFQKI-----  379

Query  154   VKDCP  140
               DCP
Sbjct  380   --DCP  382



>ref|XP_006385138.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62935.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
Length=402

 Score =   280 bits (716),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 155/365 (42%), Positives = 222/365 (61%), Gaps = 29/365 (8%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T ++SAV+ GAVCLDGSPPAY + KG G G   W+++  GG WC++++ C +RK +HLGS
Sbjct  33    TYVKSAVAKGAVCLDGSPPAYHWDKGFGTGINSWLIHFEGGGWCNNVTSCLSRKKTHLGS  92

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S           F GI++     N +F NWN+V + YCDGSSFTGDV+ VNP T LHFRG
Sbjct  93    SKLM---GQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQAVNPATNLHFRG  149

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RI+ AV+EDLL  KG+++A +  L+G SAGGLA I+HCD F    R  T VKCLS+ G+
Sbjct  150   ARIWLAVIEDLLP-KGLKNAENALLSGCSAGGLASILHCDSFRALLRMGTKVKCLSDAGY  208

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+  K  + A  +++ F  I+ LH S   LP  C    + ++ C FPQ+VA  +RTPLFI
Sbjct  209   FIKVKDVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSVLKPSF-CFFPQYVAPQVRTPLFI  267

Query  472   MVSTYDSYLINHTLST------GFYEAVK--SKHISATQYKALKELRLQMLVAL-RETDS  320
             + + YDS+ I + L+       G +++ K    + S  Q K++++ RLQ L AL + T+S
Sbjct  268   LNAAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQFLNALNKSTNS  327

Query  319   PSRGLFVSNCFGHTQL-----IFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTL  155
              SRGL++ +C+ H Q       F  + P   +  +K  + V DW++DR N  Q++     
Sbjct  328   SSRGLYIDSCYAHCQTETQEKWFMEDSP--VLGKKKIAKAVGDWFYDR-NPFQKI-----  379

Query  154   VKDCP  140
               DCP
Sbjct  380   --DCP  382



>ref|XP_011082149.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
 ref|XP_011082150.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
 ref|XP_011082151.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
Length=398

 Score =   280 bits (716),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 156/401 (39%), Positives = 230/401 (57%), Gaps = 21/401 (5%)
 Frame = -3

Query  1282  GTLLNTTFILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEG  1103
             G LL    IL+ +++  + ++    F  + T + SAV+ GAVCLDGSPPAY   +G G G
Sbjct  3     GRLLKCLHILVFMMIVLRTES----FYVDITYVRSAVAKGAVCLDGSPPAYHLDRGYGTG  58

Query  1102  RQRWIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNW  923
                W+V++ GG WC++++ C  RK + LGSS           F GIL+     N +F NW
Sbjct  59    INNWLVHIEGGGWCNNVTTCLARKNNRLGSSKYMV---KQLAFSGILNNKANFNPDFYNW  115

Query  922   NKVVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSA  743
             N+V V YCDG+SFTGDVE VNP T LH+RG R+F AV+EDLL  KGM++A +  L+G SA
Sbjct  116   NRVKVRYCDGASFTGDVEAVNPVTKLHYRGARVFLAVMEDLLA-KGMKNAENAVLSGCSA  174

Query  742   GGLAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVL  563
             GGLA I+HCD F       T VKC S+ G+F+++K  + AQ +E+ +  ++  H S   L
Sbjct  175   GGLAAILHCDSFKALLPMGTKVKCFSDAGYFINTKDVSGAQHIEAFYHDVVSTHGSAKNL  234

Query  562   PEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKH----  395
             P  C    + + LC FPQ+VA++IRTPLFI+ + YDS+ I + L+ G  +   + H    
Sbjct  235   PRSCTSRMKPS-LCFFPQYVAREIRTPLFIINAAYDSWQIKNILAPGVADPHGTWHNCKT  293

Query  394   ----ISATQYKALKELRLQMLVALRETD-SPSRGLFVSNCFGHTQLIF---YWNHPGFEV  239
                  SATQ + ++  RL+ + AL     S SRG F+++C+ H Q      ++     ++
Sbjct  294   DINKCSATQLQTMQGFRLEFIRALYGLGVSTSRGYFINSCYAHCQTEMQETWYRSDSPKL  353

Query  238   NYRKDVEVVRDWYFDRINHVQEVEQSTLVKDCPNNTFIEEE  116
             N +   + V DW++DR    +        + C N  F  +E
Sbjct  354   NNKTIAKAVGDWFYDRSPFQKGDCPYPCDRTCHNRVFDPQE  394



>ref|XP_006432881.1| hypothetical protein CICLE_v10001426mg [Citrus clementina]
 gb|ESR46121.1| hypothetical protein CICLE_v10001426mg [Citrus clementina]
Length=392

 Score =   280 bits (715),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 162/398 (41%), Positives = 230/398 (58%), Gaps = 24/398 (6%)
 Frame = -3

Query  1285  MGTLLNTTFILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGE  1106
             MG   N     L+++       A + F  + T +E AV+ GAVCLDGSPPAY F KG G 
Sbjct  7     MGQWFNLLVCALLIL------KAQACFNVSITYVEDAVAKGAVCLDGSPPAYHFDKGFGA  60

Query  1105  GRQRWIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCN  926
             G   W+V++ GG WC+++++C+NR+ S  GSS  +Y    A NF GIL      N +F +
Sbjct  61    GINNWLVHIDGGAWCNNVADCSNRRDSSHGSS--KYMVKEA-NFTGILSNEQKFNPDFYD  117

Query  925   WNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGS  746
             WN+V V YCDG+SFTGDVE VNP T LHFRG R+F+AV+EDLL  KGM++A +  LTG S
Sbjct  118   WNRVKVRYCDGASFTGDVEAVNPETNLHFRGARVFEAVMEDLLA-KGMKNAQNAILTGCS  176

Query  745   AGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAV  566
             AGGL  I+HCD F   F  +T VKC ++ G+F++ K  + A  +E  ++ ++ LH S   
Sbjct  177   AGGLTSILHCDNFRALFPVNTRVKCFADAGYFVNVKDVSGASHIEEFYKQVVALHGSAKH  236

Query  565   LPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTL------STGFYEAVK  404
             LP  C        LC FPQ+VA  ++TPLFI+ S YDS+ I + L        G +   K
Sbjct  237   LPASCTSRLSPG-LCFFPQNVAGQVKTPLFIINSAYDSWQIRNILVPDNADPKGTWRRCK  295

Query  403   S--KHISATQYKALKELRLQMLVALRET-DSPSRGLFVSNCFGHTQLIFY--WNHPGFEV  239
                K  S+TQ + ++  R+Q L AL    +S SRG+ + +C+ H + +F   W      V
Sbjct  296   KDIKTCSSTQLQTMQGFRVQFLNALAGLGNSSSRGMLIDSCYTHCRTVFQEAWLSADSPV  355

Query  238   NYRKDV-EVVRDWYFDRINHVQEVEQSTLVKDCPNNTF  128
               +  + + V DWY+DR N  Q+++        P + F
Sbjct  356   LDKTPIAKAVGDWYYDR-NPFQKIDCPYPCNPLPESCF  392



>gb|KDP28068.1| hypothetical protein JCGZ_19476 [Jatropha curcas]
Length=400

 Score =   279 bits (713),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 154/356 (43%), Positives = 216/356 (61%), Gaps = 22/356 (6%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T + +AV+ GAVCLDGSPPAY   KG G G   W+V+  GG WC++++ C +RK + LGS
Sbjct  31    TYVRNAVAKGAVCLDGSPPAYHLDKGFGTGINNWLVHFEGGGWCNNVTTCLSRKNTRLGS  90

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +     +   F GIL+     N +F NWN+V + YCDGSSFTGDV+ VNP T LHFRG
Sbjct  91    SKQM---ATQIAFSGILNNRRQFNPDFYNWNRVKIRYCDGSSFTGDVQKVNPATNLHFRG  147

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RI+ AVVEDLL  KGM++A +  L+G SAGGLA I+HCD F       T VKCLS+ G+
Sbjct  148   ARIWLAVVEDLLA-KGMKNAENALLSGCSAGGLASILHCDSFQALLPMGTNVKCLSDAGY  206

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F++ +  + A  +++ F  ++ LH S   LP  C    + A LC FPQ+V + IRTPLFI
Sbjct  207   FINVRDVSGAPHIQNYFNEVVSLHGSAKNLPLSCTSRLKPA-LCFFPQYVVQQIRTPLFI  265

Query  472   MVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVAL-RETDS  320
             + + YDS+ I + L+ G  +         +   + S  Q K +++ RLQ L AL R T S
Sbjct  266   LNAAYDSWQIKNILAPGVADPHGAWKGCKLDISNCSLLQLKTMQDFRLQFLNALYRSTTS  325

Query  319   PSRGLFVSNCFGHTQ-----LIFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVE  167
              SRGL++ +C+ H Q       F  + P   +   K  + V DW++DRI+ VQ+++
Sbjct  326   SSRGLYIDSCYIHCQSETQETWFMADSP--VLGRSKIAKAVGDWFYDRIS-VQKID  378



>ref|XP_006385133.1| pectinacetylesterase family protein [Populus trichocarpa]
 gb|ERP62930.1| pectinacetylesterase family protein [Populus trichocarpa]
Length=394

 Score =   278 bits (712),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 146/347 (42%), Positives = 207/347 (60%), Gaps = 18/347 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             TI+E+AVS GAVCLDGSPP Y F KG G G   W+V++ GG WC S+  C +R+ +  GS
Sbjct  30    TIVETAVSSGAVCLDGSPPGYHFDKGSGSGIDNWLVHMEGGGWCESVESCVSRRDTFRGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +    +    F GIL    A N +F NWN++ V YCDGSSFTGDVE V+P T L+FRG
Sbjct  90    SSKM---EKTMGFSGILGSKQAANPDFYNWNRIKVRYCDGSSFTGDVEAVDPETKLYFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R++ AV+++LL  KGMQ+A +  L+G SAGGLA I+HCD+F +    +  VKC+S+ G+
Sbjct  147   ERVWQAVIDELLA-KGMQNARNAILSGCSAGGLAAILHCDKFQSLLPATARVKCVSDAGY  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+H    +    +ES F  ++  H S   LP  C        LC FPQ+VA+ +RTPLFI
Sbjct  206   FIHGTDISGGSRIESFFGQVVKTHGSAKNLPASCTSKMN-PELCFFPQYVAQTMRTPLFI  264

Query  472   MVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRE--TD  323
             + S YDS+ I + L+    ++ K         K  SA+Q + +++ R Q L A+      
Sbjct  265   INSAYDSWQIKNILAPTAVDSKKEWKDCKLDLKKCSASQLQTVQDYRTQFLKAVDTGLGS  324

Query  322   SPSRGLFVSNCFGHTQ---LIFYWNHPGFEVNYRKDVEVVRDWYFDR  191
             S +RGL++ +C+ H Q   +  + N    EV   K  + V DW++DR
Sbjct  325   SSTRGLWIDSCYAHCQSGSVSTWLNDKSPEVGDTKMGKAVGDWFYDR  371



>ref|XP_011028476.1| PREDICTED: protein notum homolog [Populus euphratica]
 ref|XP_011028477.1| PREDICTED: protein notum homolog [Populus euphratica]
Length=394

 Score =   278 bits (712),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 146/347 (42%), Positives = 207/347 (60%), Gaps = 18/347 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             TI+E+AVS GAVCLDGSPP Y F KG G G   W+V++ GG WC S+  C +R+ +  GS
Sbjct  30    TIVETAVSRGAVCLDGSPPGYHFDKGSGSGIDNWLVHMEGGGWCESVESCVSRRDTFRGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +    +    F GIL    A N +F NWN++ V YCDGSSFTGDVE V+P T L+FRG
Sbjct  90    SSKM---EKTMGFSGILGSKQAANPDFYNWNRIKVRYCDGSSFTGDVEAVDPETKLYFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R++ AV+++LL  KGMQ+A +  L+G SAGGLA I+HCD+F +    +  VKC+S+ G+
Sbjct  147   ERVWQAVIDELLA-KGMQNARNAILSGCSAGGLAAILHCDKFQSLLPATARVKCVSDAGY  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+H    +    +ES F  ++  H S   LP  C        LC FPQ+VA+ +RTPLFI
Sbjct  206   FIHGTDISGGSRIESFFGQVVKTHGSAKNLPASCTSKMN-PELCFFPQYVAQTMRTPLFI  264

Query  472   MVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRE--TD  323
             + S YDS+ I + L+    ++ K         K  SA+Q + +++ R Q L A+      
Sbjct  265   INSAYDSWQIKNILAPTAVDSKKEWKDCKLDLKKCSASQLQTVQDYRAQFLKAVNTGLGS  324

Query  322   SPSRGLFVSNCFGHTQ---LIFYWNHPGFEVNYRKDVEVVRDWYFDR  191
             S +RGL++ +C+ H Q   +  + N    EV   K  + V DW++DR
Sbjct  325   SSTRGLWIDSCYAHCQSGSVSTWLNDKSPEVGDTKMGKAVGDWFYDR  371



>gb|EYU37448.1| hypothetical protein MIMGU_mgv1a007102mg [Erythranthe guttata]
Length=419

 Score =   278 bits (712),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 158/393 (40%), Positives = 227/393 (58%), Gaps = 33/393 (8%)
 Frame = -3

Query  1198  NSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNR-KTSH  1022
             N T + SAV  GAVCLDG+PPAY    G G+G   W+VYL GG WC+S   C  R K   
Sbjct  36    NITYVNSAVEKGAVCLDGTPPAYYHSVGFGDGADNWLVYLEGGAWCNSTETCLERVKIKW  95

Query  1021  LGSSHRQYWNDSAFNF-KGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGL  845
             L S+  +     A  +  GI   N   N  F NWNKV++ YCDG+SFTGDVE V+PTT L
Sbjct  96    LASTSTR----PAIRYVSGIFTVNQTFNQAFYNWNKVIIVYCDGASFTGDVEEVDPTTNL  151

Query  844   HFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLS  665
             H+RG RIF AV++DLL  KGM++A +  LTG SAGGLA I++CDRF +   ++T VKC+S
Sbjct  152   HYRGARIFRAVIDDLLA-KGMKNAKNAVLTGSSAGGLATILNCDRFRSLVPHATRVKCIS  210

Query  664   NGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRT  485
             + GFF+HSK+   A + E+ F  + +LH     LP+ C        LC+FP++V KD++T
Sbjct  211   DSGFFIHSKNMPGANEREAYFTQVAELHGMAKALPQSCASKMNPG-LCLFPEYVIKDMQT  269

Query  484   PLFIMVSTYDSYLINHTLSTGFYEAVKSKH---------ISATQYKALKELRLQMLVALR  332
             PLFI+ S +D Y I   L+  F    K +           +++Q + +K+ R   L  L+
Sbjct  270   PLFILDSLFDLYQIKEMLAP-FVGGCKEQWDDCTTNLTLCTSSQLQIMKDHRTAFLETLQ  328

Query  331   ETDSPSRGLFVSNCFGHTQLIFYWNHPGFEVNY-------RKDV-EVVRDWYFDRINHVQ  176
             E +SPS G+FV  CF HT ++   +  G+  ++       +K + E + DWY+DR +  Q
Sbjct  329   EVESPSLGIFVHTCFLHTHVL---DKDGWRCSFVARNVLAKKTIEEAIDDWYYDR-SSFQ  384

Query  175   EVEQSTLVKDCPNNTFIEEEGA*IKGVCMYVMH  77
             +++  T V   P N  +  +   +   C++  H
Sbjct  385   QIDTYTTV---PRNCTVSRDNDIMNQRCLHPKH  414



>ref|XP_009605804.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=385

 Score =   277 bits (709),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 146/357 (41%), Positives = 216/357 (61%), Gaps = 10/357 (3%)
 Frame = -3

Query  1252  LIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLG  1073
             L ++  +  +   SY  T  TIL++AVS GAVCLDGSPPAY F  G G+G   WIV L G
Sbjct  18    LAIIKSECAKDLGSYNVT-KTILKNAVSKGAVCLDGSPPAYHFEPGFGKGIGNWIVQLSG  76

Query  1072  GEWCSSISECTNRK-TSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCD  896
             G WC+++ EC +R    ++GS++   + DS +NF+GI   N   N +F NWNKV V YCD
Sbjct  77    GAWCTNVKECQDRIWDKNVGSTN---FTDS-WNFQGIYSENSTANPDFYNWNKVFVRYCD  132

Query  895   GSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHC  716
             G +FTGDVE V+  T LHFRG RIF+A +E+LL  KG+++A +  L G SAGG   +++C
Sbjct  133   GGAFTGDVEYVDHVTNLHFRGARIFEAAMEELLA-KGLKNAKNAILAGSSAGGYPTMLYC  191

Query  715   DRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQ  536
             D F +   N+  VKCL + G+F+H+K+P +A+  E  +  ++ LH ST  LP+ C     
Sbjct  192   DHFRSLLPNTLRVKCLVDSGYFIHAKNPMQARGFEKIYNSLLTLHGSTKALPKSCTSKMN  251

Query  535   LAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKHISATQYKALKELR  356
                LC FP+++ + I+TPLFI +S +D Y +  T+       V+++  +  Q KA +E R
Sbjct  252   -PLLCFFPENMQQHIKTPLFIAMSAFDYYQMKTTIDPNADRCVENRTCTERQNKAFREFR  310

Query  355   LQMLVALRETDSPS-RGLFVSNCFGHTQLIFYWN-HPGFEVNYRKDVEVVRDWYFDR  191
              + L AL ++++P  RG+F+ +   H+ L + W       +N     +   DWYFDR
Sbjct  311   SEFLSALPKSNNPKLRGVFIDSVIHHSALSYRWTLENAIMINNLSAPKAFADWYFDR  367



>ref|XP_009797875.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana sylvestris]
Length=390

 Score =   277 bits (709),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 156/384 (41%), Positives = 224/384 (58%), Gaps = 16/384 (4%)
 Frame = -3

Query  1261  FILLIVVLHQQPQTAN-SYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIV  1085
             F L IV+      T N   +    TI+ SAVS GAVCLDGSPPAY F  G G+G   W+V
Sbjct  16    FTLTIVITECAKVTQNPDVYNITKTIIHSAVSKGAVCLDGSPPAYHFDPGFGDGVGNWLV  75

Query  1084  YLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVH  905
              L GG WC+++ EC +R  S LGSS+  Y N     F+G    N + N EF NWNKV V 
Sbjct  76    QLSGGGWCTNVKECLDRAKSDLGSSN--YMNPQ--EFQGFFSKNQSANPEFYNWNKVFVR  131

Query  904   YCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVI  725
             YCDG SFTGDVE V+P T LHFRG RIF  V+E+LL  KG+++A +  L G SAGG   +
Sbjct  132   YCDGGSFTGDVEYVDPATKLHFRGARIFTVVLEELLA-KGLKNAKNAILAGSSAGGYPAM  190

Query  724   IHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGI--IDLHNSTAVLPEPC  551
             ++CD F N   N++ VKCL + G+F+H K+    +  ES ++GI  + L  S   LP+ C
Sbjct  191   LYCDGFRNSLPNTSRVKCLVDSGYFVHFKNTVLGRPFESIYKGIATLQLQGSAKTLPKSC  250

Query  550   RKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKHISATQYKA  371
                 +   LC+F +++ +DI+TP+FI +S +D+ +  +TL  G Y  ++    +A+Q K 
Sbjct  251   TSKMK-PELCLFAENIQQDIKTPIFISMSAFDNIMTQYTLGGGIYGCIQEGTCTASQNKT  309

Query  370   LKELRLQMLVALRETDSPS-RGLFVSNCFGHTQL--IFYWNH-PGFEVNYRKDVEVVRDW  203
             L+E+R   L A+ + ++P  RG+F+     HT L     W+      V+     +   DW
Sbjct  310   LQEMRSDFLNAIPKGNNPKLRGVFIDVVHHHTSLQKQTRWSPVKPIVVHNLAAPKAFADW  369

Query  202   YFDRINHVQEVEQSTLVKDCPNNT  131
             YFDR N+   +++ +L    PN++
Sbjct  370   YFDR-NYTYLIDERSL--PLPNDS  390



>gb|KCW72723.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=392

 Score =   277 bits (709),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 149/367 (41%), Positives = 211/367 (57%), Gaps = 17/367 (5%)
 Frame = -3

Query  1252  LIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLG  1073
             L V+L  Q    +  F    T +++AV+ GAVCLDGSPPAY F KG+G G   W++   G
Sbjct  10    LCVILSIQILIKSEAFNVGITYVQNAVAKGAVCLDGSPPAYHFDKGVGAGANNWLILFEG  69

Query  1072  GEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDG  893
             G WC++++ C  R+ + LGSS +        +F GIL      N +F NWNK+ V YCDG
Sbjct  70    GAWCNNVTTCLARRDTRLGSSKQMV---KELSFSGILSNKQKFNPDFYNWNKIKVRYCDG  126

Query  892   SSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCD  713
             +SFTGDVE VNP T LHFRG R F A+VEDL+ +KGM +A +  L G SAGGL  I++CD
Sbjct  127   ASFTGDVEAVNPATNLHFRGARAFVAIVEDLM-SKGMSNAQNAILAGCSAGGLTAILNCD  185

Query  712   RFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQL  533
             RF       T VKCL++ G+F+++K  + A  +E+ +  ++  H S   LP  C    + 
Sbjct  186   RFRALVPARTKVKCLADAGYFINAKDVSGASHIENFYSEVVATHGSAKNLPTSCTSKMKP  245

Query  532   AYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYE--------AVKSKHISATQY  377
               LC FPQ+V   I+TPLFI+ + YDS+ I + L+ G  +         +  K  S  Q 
Sbjct  246   G-LCFFPQNVVPQIQTPLFIINAAYDSWQIKNILAPGVADRHGTWRSCKLDIKKCSPNQL  304

Query  376   KALKELRLQMLVALRETD-SPSRGLFVSNCFGHTQLIFY--WNHPGFEVNYRKDV-EVVR  209
             K +++ RL+ L AL     SPSRG+F+ +C+ H Q      W      V  +  + + V 
Sbjct  305   KIMQDFRLEFLRALSAVGTSPSRGMFIDSCYAHCQAGTQETWLRNDSPVVAKTSIAKAVG  364

Query  208   DWYFDRI  188
             DWY++RI
Sbjct  365   DWYYERI  371



>ref|XP_011028482.1| PREDICTED: uncharacterized protein LOC105128479 isoform X2 [Populus 
euphratica]
Length=481

 Score =   280 bits (716),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 155/365 (42%), Positives = 222/365 (61%), Gaps = 29/365 (8%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T ++SAV+ GAVCLDGSPPAY + KG G G   W+++  GG WC++++ C +RK +HLGS
Sbjct  112   TYVKSAVAKGAVCLDGSPPAYHWDKGSGTGINSWLIHFEGGGWCNNVTSCLSRKKTHLGS  171

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S           F GI++     N +F NWN+V + YCDGSSFTGDV+ VNP T LHFRG
Sbjct  172   SKLM---GQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQAVNPATNLHFRG  228

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RI+ AV+EDLL  KG+++A +  L+G SAGGLA I+HCD F    R  T VKCLS+ G+
Sbjct  229   ARIWLAVIEDLL-PKGLKNAENALLSGCSAGGLASILHCDSFRALLRMGTKVKCLSDAGY  287

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+  K  + A  +++ F  I+ LH S   LP  C    + ++ C FPQ+VA  +RTPLFI
Sbjct  288   FIKVKDVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSMLKPSF-CFFPQYVAPQVRTPLFI  346

Query  472   MVSTYDSYLINHTLST------GFYEAVK--SKHISATQYKALKELRLQMLVALR-ETDS  320
             + + YDS+ I + L+       G +++ K    + S  Q K++++ RLQ L AL+  T+S
Sbjct  347   LNAAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQFLNALKTSTNS  406

Query  319   PSRGLFVSNCFGHTQL-----IFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTL  155
              SRGL++ +C+ H Q       F  + P   +  +K  + V DW++DR N  Q++     
Sbjct  407   SSRGLYIDSCYAHCQTETQEKWFMEDSP--VLGKKKIAKAVGDWFYDR-NPFQKI-----  458

Query  154   VKDCP  140
               DCP
Sbjct  459   --DCP  461



>ref|XP_002519912.1| pectin acetylesterase, putative [Ricinus communis]
 gb|EEF42516.1| pectin acetylesterase, putative [Ricinus communis]
Length=452

 Score =   279 bits (713),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 151/364 (41%), Positives = 217/364 (60%), Gaps = 26/364 (7%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             TI+E+A + GAVCLDGSPPAY + KG G G   WIV++ GG WC  +  C+ RK ++ GS
Sbjct  88    TIVETAKARGAVCLDGSPPAYHYDKGYGTGANNWIVHMEGGGWCDDLESCSQRKDTYKGS  147

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +    +    F GIL    + N +F NWN++ + YCDGSSFTGDVE V+  T LHFRG
Sbjct  148   SLKM---EKTMGFSGILGGKQSANPDFYNWNRIKIKYCDGSSFTGDVEVVDAKTNLHFRG  204

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RI+ AV++DLL  KGM++A +  L+G SAGGLA I+HCD+F +    S  VKC+S+ GF
Sbjct  205   ERIWQAVIDDLLA-KGMRNAQNAILSGCSAGGLAAILHCDKFRSLLPASARVKCVSDAGF  263

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+H K  A  + +E+ F  ++ LH S   LP  C    +   LC FPQ+VA+ +RTPLF+
Sbjct  264   FIHGKDVAGGRHIENFFGSVVRLHGSAKSLPASCTAKMR-PELCFFPQYVAQTMRTPLFL  322

Query  472   MVSTYDSYLINHTLS------TGFYEAVK--SKHISATQYKALKELRLQMLVALRE--TD  323
             + S YDS+ I + L+       G +++ K   K  SA Q + +++ R Q + AL    T+
Sbjct  323   INSAYDSWQIKNVLAPSAVDKKGSWKSCKLDLKKCSAAQLQTVQDFRTQFIGALSGGVTN  382

Query  322   SPSRGLFVSNCFGHTQ---LIFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTLV  152
              P+ G F+++C+ H Q   L  +       V+  K  + V DW++DR    Q++      
Sbjct  383   KPANGYFINSCYAHCQSGSLATWLADKSPVVSNTKIGKAVGDWFYDRAT-FQKI------  435

Query  151   KDCP  140
              DCP
Sbjct  436   -DCP  438



>ref|XP_011028479.1| PREDICTED: uncharacterized protein LOC105128479 isoform X1 [Populus 
euphratica]
 ref|XP_011028480.1| PREDICTED: uncharacterized protein LOC105128479 isoform X1 [Populus 
euphratica]
 ref|XP_011028481.1| PREDICTED: uncharacterized protein LOC105128479 isoform X1 [Populus 
euphratica]
Length=509

 Score =   280 bits (717),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 155/365 (42%), Positives = 222/365 (61%), Gaps = 29/365 (8%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T ++SAV+ GAVCLDGSPPAY + KG G G   W+++  GG WC++++ C +RK +HLGS
Sbjct  112   TYVKSAVAKGAVCLDGSPPAYHWDKGSGTGINSWLIHFEGGGWCNNVTSCLSRKKTHLGS  171

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S           F GI++     N +F NWN+V + YCDGSSFTGDV+ VNP T LHFRG
Sbjct  172   SKLM---GQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQAVNPATNLHFRG  228

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RI+ AV+EDLL  KG+++A +  L+G SAGGLA I+HCD F    R  T VKCLS+ G+
Sbjct  229   ARIWLAVIEDLL-PKGLKNAENALLSGCSAGGLASILHCDSFRALLRMGTKVKCLSDAGY  287

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+  K  + A  +++ F  I+ LH S   LP  C    + ++ C FPQ+VA  +RTPLFI
Sbjct  288   FIKVKDVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSMLKPSF-CFFPQYVAPQVRTPLFI  346

Query  472   MVSTYDSYLINHTLST------GFYEAVK--SKHISATQYKALKELRLQMLVALR-ETDS  320
             + + YDS+ I + L+       G +++ K    + S  Q K++++ RLQ L AL+  T+S
Sbjct  347   LNAAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQFLNALKTSTNS  406

Query  319   PSRGLFVSNCFGHTQL-----IFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTL  155
              SRGL++ +C+ H Q       F  + P   +  +K  + V DW++DR N  Q++     
Sbjct  407   SSRGLYIDSCYAHCQTETQEKWFMEDSP--VLGKKKIAKAVGDWFYDR-NPFQKI-----  458

Query  154   VKDCP  140
               DCP
Sbjct  459   --DCP  461



>gb|KCW72721.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=392

 Score =   277 bits (708),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/374 (40%), Positives = 213/374 (57%), Gaps = 31/374 (8%)
 Frame = -3

Query  1252  LIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLG  1073
             L V+L  Q    +  F    T +++AV+ GAVCLDGSPPAY F KG+G G   W++   G
Sbjct  10    LCVILSIQILIKSEAFNVGITYVQNAVAKGAVCLDGSPPAYHFDKGVGAGANNWLILFEG  69

Query  1072  GEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDG  893
             G WC++++ C  R+ + LGSS +        +F GIL      N +F NWNK+ V YCDG
Sbjct  70    GAWCNNVTTCLARRDTRLGSSKQMV---KELSFSGILSNKQKFNPDFYNWNKIKVRYCDG  126

Query  892   SSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCD  713
             +SFTGDVE VNP T LHFRG R F A+VEDL+ +KGM +A +  L+G SAGGLA I++CD
Sbjct  127   ASFTGDVEAVNPATNLHFRGARAFVAIVEDLM-SKGMSNAQNAILSGCSAGGLAAILNCD  185

Query  712   RFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQL  533
             RF       T VKCL++ G+F+++K  + A  +E+ +  ++  H S   LP  C    + 
Sbjct  186   RFRALMPARTKVKCLADAGYFINAKDVSGASHIENFYSEVVATHGSAKNLPTSCTSKMKP  245

Query  532   AYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEA--------VKSKHISATQY  377
               LC FPQ+V   I+TPLFI+ + YD++ I + L+ G  +         +  K  S  Q 
Sbjct  246   G-LCFFPQNVVPQIQTPLFIINAAYDAWQIKNILAPGVADPHGTWNSCKLDIKKCSPNQL  304

Query  376   KALKELRLQMLVALRETD-SPSRGLFVSNCFGHTQLIFYWNHPGFEVNYRKD--------  224
             K +++ RL+ L AL     SPSRG+F+ +C  H Q        G E  + ++        
Sbjct  305   KIMQDFRLEFLRALSAVGTSPSRGMFIDSCNTHCQA-------GTEATWLRNDSPIVAKT  357

Query  223   --VEVVRDWYFDRI  188
                + V DWY++RI
Sbjct  358   SIAKAVGDWYYERI  371



>ref|XP_004244767.2| PREDICTED: protein notum homolog [Solanum lycopersicum]
Length=387

 Score =   276 bits (707),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 155/354 (44%), Positives = 217/354 (61%), Gaps = 13/354 (4%)
 Frame = -3

Query  1237  HQQPQTAN--SYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEW  1064
             +QQ  T N   YF    TI+++AVS GAVCLDGSPPAY   +G GEG Q W+++L GG W
Sbjct  28    NQQKDTYNYDEYFV-GKTIVKNAVSKGAVCLDGSPPAYYMDRGFGEGAQSWMIHLSGGGW  86

Query  1063  CSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSF  884
             C  + +C NR T+  GSS         F F+G    N   N +  NWNKV+V YCDG +F
Sbjct  87    CRDVRDCQNRSTTSFGSSKYMV----PFKFRGHFSNNKIANPDLFNWNKVMVAYCDGGAF  142

Query  883   TGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFA  704
             TGDVETV+P T LHFRG RIF AV+EDLL ++G+ DA +  L G SAG    +++CDRF+
Sbjct  143   TGDVETVDPGTNLHFRGARIFSAVMEDLL-SRGLNDAKNALLIGSSAGAYPAMLYCDRFS  201

Query  703   NRFRNSTTVKCLSNGGFFLH-SKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAY  527
                 N+  +KCL++ G+F+  +K+  K +  ES ++ ++ LH S   LP+ C    +   
Sbjct  202   KLLPNTPRLKCLTDSGYFIDVNKNLQKGKGFESIYKELVTLHGSAKALPKSCTSRMK-PE  260

Query  526   LCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKHISATQYKALKELRLQM  347
             LC FPQ+V + I+TPL+ ++S +D   +  +L   +Y A+K  + SA Q K L+ELRL++
Sbjct  261   LCFFPQNVQQYIKTPLYTIMSPFDIVQVGTSLGD-YYNAIKQNNCSANQKKNLRELRLEL  319

Query  346   LVAL-RETDSPSRGLFVSNCFGHTQLIFYWNHPGFE-VNYRKDVEVVRDWYFDR  191
             L  L   +D+ SRG F+ + F HT+L  YWN      VN    ++   DWYFDR
Sbjct  320   LSKLPNASDTKSRGAFIDSQFHHTRLQSYWNPQNVSVVNNVTMIKAFGDWYFDR  373



>gb|KDP28066.1| hypothetical protein JCGZ_19474 [Jatropha curcas]
Length=395

 Score =   276 bits (707),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 144/347 (41%), Positives = 215/347 (62%), Gaps = 18/347 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             TI+E+A + GAVCLDGSPPAY F KG G G   WIV++ GG WC  I  C  R+ ++ GS
Sbjct  31    TIVETAKTRGAVCLDGSPPAYHFDKGYGSGANNWIVHMEGGGWCDDIESCLERRDTYKGS  90

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +    +    F GIL    A N +F NWN++ + YCDGSSFTGDVE V+P T L+FRG
Sbjct  91    SLKM---EKTMGFSGILGSKQAANPDFYNWNRIKIKYCDGSSFTGDVEAVDPKTKLYFRG  147

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RI+ AV++DLL  KGM++A +  L+G SAGGLA I+HCD+F +    S  VKC+S+ G+
Sbjct  148   ERIWRAVIDDLLA-KGMRNAQNAILSGCSAGGLASILHCDKFRSLLPASAKVKCVSDAGY  206

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+H K  A   ++E+ +  ++ LH S   LP  C    +   LC FPQ+VA+ ++TPLF+
Sbjct  207   FIHGKDIAGGYEIENFYGRVVRLHGSAKNLPTSCTSRMR-PELCFFPQNVAQTMQTPLFV  265

Query  472   MVSTYDSYLINHTLS------TGFYEAVKS--KHISATQYKALKELRLQMLVALRE--TD  323
             + S YDS+ I + L+       G +++ K+  K  SA+Q + +++ RLQ + AL     +
Sbjct  266   INSAYDSWQIKNILAPSAVDKKGSFKSCKTDLKKCSASQLQTVQDFRLQFINALNSGVAN  325

Query  322   SPSRGLFVSNCFGHTQ---LIFYWNHPGFEVNYRKDVEVVRDWYFDR  191
              P+ G+F+++C  H Q   +  +++     ++  K  + V DW++DR
Sbjct  326   KPANGMFINSCHAHCQSGSVSTWFDAKSPVLSNTKIGKAVGDWFYDR  372



>ref|XP_010056136.1| PREDICTED: protein notum homolog [Eucalyptus grandis]
 gb|KCW72724.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
 gb|KCW72725.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=399

 Score =   276 bits (707),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 152/383 (40%), Positives = 217/383 (57%), Gaps = 25/383 (7%)
 Frame = -3

Query  1252  LIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLG  1073
             L V+L  Q    +  F    T +++AV+ GAVCLDGSPPAY F KG+G G   W++   G
Sbjct  10    LCVILSIQILIKSEAFNVGITYVQNAVAKGAVCLDGSPPAYHFDKGVGAGANNWLILFEG  69

Query  1072  GEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDG  893
             G WC++++ C  R+ + LGSS +        +F GIL      N +F NWNK+ V YCDG
Sbjct  70    GAWCNNVTTCLARRDTRLGSSKQMV---KELSFSGILSNKQKFNPDFYNWNKIKVRYCDG  126

Query  892   SSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCD  713
             +SFTGDVE VNP T LHFRG R F A+VEDL+ +KGM +A +  L G SAGGL  I++CD
Sbjct  127   ASFTGDVEAVNPATNLHFRGARAFVAIVEDLM-SKGMSNAQNAILAGCSAGGLTAILNCD  185

Query  712   RFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQL  533
             RF       T VKCL++ G+F+++K  + A  +E+ +  ++  H S   LP  C    + 
Sbjct  186   RFRALVPARTKVKCLADAGYFINAKDVSGASHIENFYSEVVATHGSAKNLPTSCTSKMKP  245

Query  532   AYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYE--------AVKSKHISATQY  377
               LC FPQ+V   I+TPLFI+ + YDS+ I + L+ G  +         +  K  S  Q 
Sbjct  246   G-LCFFPQNVVPQIQTPLFIINAAYDSWQIKNILAPGVADRHGTWRSCKLDIKKCSPNQL  304

Query  376   KALKELRLQMLVALRETD-SPSRGLFVSNCFGHTQLIFY--WNHPGFEVNYRKDV-EVVR  209
             K +++ RL+ L AL     SPSRG+F+ +C+ H Q      W      V  +  + + V 
Sbjct  305   KIMQDFRLEFLRALSAVGTSPSRGMFIDSCYAHCQAGTQETWLRNDSPVVAKTSIAKAVG  364

Query  208   DWYFDRINHVQEVEQSTLVKDCP  140
             DWY++R+   Q++       DCP
Sbjct  365   DWYYERLTF-QKI-------DCP  379



>gb|KCW72720.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
Length=420

 Score =   277 bits (708),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 152/366 (42%), Positives = 214/366 (58%), Gaps = 17/366 (5%)
 Frame = -3

Query  1252  LIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLG  1073
             L VVL  Q    +     + T +++AV+ GAVCLDGSPPAY F KG+G G   W+V   G
Sbjct  19    LWVVLSIQILLKSEATNVSITYVQNAVAKGAVCLDGSPPAYHFNKGLGTGANNWLVQFEG  78

Query  1072  GEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDG  893
             G WC++++ C  R+ + LGSS           F GIL  N + N +F NWN++ V YCDG
Sbjct  79    GGWCNNVTTCLARRDTRLGSSKEMV---KEVAFSGILSNNHSFNPDFYNWNRIKVRYCDG  135

Query  892   SSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCD  713
             +SFTGDVE V+P T LHFRG R F A++EDLL +KGM DA +  L+G SAGGL  I+HCD
Sbjct  136   ASFTGDVEAVDPATKLHFRGARAFVAIIEDLL-SKGMSDAENAILSGCSAGGLTSILHCD  194

Query  712   RFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQL  533
             RF      S TVKC+++ G+F+++K  + AQ +E+ +  ++  H S   LP  C    + 
Sbjct  195   RFRALMPTSATVKCVADAGYFINAKDISGAQHIETFYSEVVATHGSAKNLPTSCTSRLRP  254

Query  532   AYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKH--------ISATQY  377
               LC FPQ+V K I+TPLFI+ + YD++ I + L+ G  +   + H         S  Q 
Sbjct  255   G-LCFFPQNVVKQIQTPLFILNAAYDAWQIKNILAPGVADPHGTWHSCKLDINNCSLDQL  313

Query  376   KALKELRLQMLVAL-RETDSPSRGLFVSNCFGHTQ--LIFYWNHPGFEVNYRKDV-EVVR  209
             + +++ R Q L AL R   SPSRG+F+ +C+ H Q  +   W      V     + + V 
Sbjct  314   QIMQDFRQQFLDALSRVGTSPSRGIFIDSCYAHCQSEMQETWLRDDSPVLIETSIAKAVG  373

Query  208   DWYFDR  191
             DWY+DR
Sbjct  374   DWYYDR  379



>ref|XP_009600038.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=370

 Score =   275 bits (704),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 132/333 (40%), Positives = 206/333 (62%), Gaps = 8/333 (2%)
 Frame = -3

Query  1249  IVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGG  1070
             + ++  +  T   ++    TI+++AVS GAVCLDGSPPAY F  G GEG + W V L GG
Sbjct  18    LAIIKTESATDLDFYEVKKTIVKNAVSKGAVCLDGSPPAYHFEPGFGEGVENWFVQLSGG  77

Query  1069  EWCSSISECTNR-KTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDG  893
              WC+S+  C +R + + +GS+         + F+GI   N + N +F NWNKV+V YCDG
Sbjct  78    AWCTSVEACKDRSRDNKVGSTTTM----GPYTFQGIYSKNQSANPDFYNWNKVLVRYCDG  133

Query  892   SSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCD  713
              +FTGDVE V+P T LHFRG RIF+AV+ED+L  KG+++A +  L G SAGG   +++CD
Sbjct  134   GAFTGDVEYVDPATNLHFRGARIFEAVMEDVLA-KGLKNAKNAILAGSSAGGYPAMLYCD  192

Query  712   RFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQL  533
             RF +   N+  VKC  + G+F+H+K+  +A+  E  +  ++ LH S   LP+ C    + 
Sbjct  193   RFRSLLPNTPRVKCFVDAGYFIHAKNQKQARGFEDIYNTLVTLHGSAKTLPKSCTSKMK-  251

Query  532   AYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKHISATQYKALKELRL  353
               LC FP+ + ++I+TPLFI +S +D + IN T+    ++ +++   + +Q KA +E R 
Sbjct  252   PLLCFFPESMQQNIKTPLFIAMSAFDIFQINTTVEPHLHDVIENGTCTTSQNKAFREFRS  311

Query  352   QMLVALRETDSPS-RGLFVSNCFGHTQLIFYWN  257
             + L  L + ++P  RG+F+ +   HT L+  W+
Sbjct  312   EFLSTLPKPNNPKLRGVFIDSVNHHTSLLIRWS  344



>ref|XP_009779347.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana sylvestris]
Length=386

 Score =   275 bits (704),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 148/357 (41%), Positives = 214/357 (60%), Gaps = 10/357 (3%)
 Frame = -3

Query  1252  LIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLG  1073
             L ++  +  +   SY  T  TIL++AVS GAVCLDGSPPAY F  G G+G   WIV L G
Sbjct  16    LAIIKSECAKDLGSYNVT-KTILKNAVSKGAVCLDGSPPAYHFEPGFGKGVGNWIVQLSG  74

Query  1072  GEWCSSISECTNR-KTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCD  896
             G WC++++EC +R    ++GS++   + DS + F+GI   N   N +F NWNKV V YCD
Sbjct  75    GAWCTNVTECQDRILDKNVGSTN---FTDS-WTFQGIYSENPTANPDFYNWNKVFVRYCD  130

Query  895   GSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHC  716
             G +FTGDVE V+  T LHFRG RIF+AV+EDLL  KG+++A +  L G SAGG   +++C
Sbjct  131   GGAFTGDVEYVDHVTNLHFRGARIFEAVMEDLLA-KGLKNAKNAILAGSSAGGYPTMLYC  189

Query  715   DRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQ  536
             D F +   N+  VKCL + G+F+H K+P +A   E  +  ++ LH ST  LP+ C     
Sbjct  190   DHFRSLLPNTPRVKCLVDSGYFIHVKNPMQASGFEKIYNSLLTLHGSTKALPKSCTSKMN  249

Query  535   LAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKHISATQYKALKELR  356
                LC FP+++ + I+TPLFI +S +D Y I  T+       V+++  +  Q KA +E R
Sbjct  250   PP-LCFFPENMQQHIKTPLFIAMSAFDYYQIKTTIDPNADRCVENRTCTECQNKAFREFR  308

Query  355   LQMLVALRETDSPS-RGLFVSNCFGHTQLIFYWN-HPGFEVNYRKDVEVVRDWYFDR  191
              + L AL  +++P  RG+F+ +   H+ L + W       +N     +   DWYFDR
Sbjct  309   SEFLSALPISNNPKLRGVFIDSVIHHSALSYRWTPENAILINNLSAPKAFADWYFDR  365



>ref|XP_006432880.1| hypothetical protein CICLE_v10001467mg [Citrus clementina]
 ref|XP_006471635.1| PREDICTED: protein notum homolog isoform X1 [Citrus sinensis]
 ref|XP_006471636.1| PREDICTED: protein notum homolog isoform X2 [Citrus sinensis]
 gb|ESR46120.1| hypothetical protein CICLE_v10001467mg [Citrus clementina]
 gb|KDO40407.1| hypothetical protein CISIN_1g016608mg [Citrus sinensis]
 gb|KDO40408.1| hypothetical protein CISIN_1g016608mg [Citrus sinensis]
Length=386

 Score =   275 bits (704),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 158/398 (40%), Positives = 228/398 (57%), Gaps = 24/398 (6%)
 Frame = -3

Query  1285  MGTLLNTTFILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGE  1106
             MG   N     LIV+       A + F  + T +E+AV+ GAVCLDGSPPAY F KG G 
Sbjct  1     MGQWFNLLVCALIVL------KAQAGFNVSITYVENAVAKGAVCLDGSPPAYHFDKGFGA  54

Query  1105  GRQRWIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCN  926
             G   W+V++ GG WC+++ +C+ R+ S  GSS          NF GIL      N +F +
Sbjct  55    GINNWLVHIDGGAWCNNVEDCSKRRDSSYGSSKHMV---KEANFTGILSNEQKFNPDFYD  111

Query  925   WNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGS  746
             WN+V V YCDG+SFTGDVE VNP T LHFRG R+F+AV+EDLL  KGM++A +  LTG S
Sbjct  112   WNRVRVRYCDGASFTGDVEAVNPETNLHFRGARVFEAVMEDLLA-KGMKNAQNAILTGCS  170

Query  745   AGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAV  566
             AGGL  I+HCD F   F   T VKC ++ G+F+++K  +    +E  ++ ++ LH S   
Sbjct  171   AGGLTSILHCDNFRALFPVDTRVKCFADAGYFVNAKDVSGESHIEEFYKQVVALHGSAKH  230

Query  565   LPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTL------STGFYEAVK  404
             LP  C        LC FP++VA  I+TPLFI+ S YDS+ I++ L        G + + K
Sbjct  231   LPASCTSRLSPG-LCFFPENVAGQIKTPLFIINSAYDSWQISNILVPEDADPKGAWSSCK  289

Query  403   S--KHISATQYKALKELRLQMLVALRET-DSPSRGLFVSNCFGHTQLIF---YWNHPGFE  242
                K  S+TQ + ++  R+Q L AL    +S SRG+FV +C+ H +  +   +++     
Sbjct  290   VDIKTCSSTQLQTMQGFRVQFLNALAGLGNSSSRGMFVDSCYTHCRTDYQETWFSADSPV  349

Query  241   VNYRKDVEVVRDWYFDRINHVQEVEQSTLVKDCPNNTF  128
             ++     + V DWY+DR +  Q+++        P + F
Sbjct  350   LDKTPIAKAVGDWYYDR-SPFQKIDCPYPCNPLPESCF  386



>gb|ADR82372.1| pectin acetylesterase [Populus trichocarpa]
Length=394

 Score =   275 bits (704),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 145/347 (42%), Positives = 206/347 (59%), Gaps = 18/347 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             TI+E+AVS GAVCLDGS P Y F KG G G   W+V++ GG WC S+  C +R+ +  GS
Sbjct  30    TIIETAVSSGAVCLDGSQPGYHFDKGSGSGIDNWLVHMEGGGWCESVESCVSRRDTFRGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +    +    F GIL    A N +F NWN++ V YCDGSSFTGDVE V+P T L+FRG
Sbjct  90    SSKM---EKTMGFSGILGSKQAANPDFYNWNRIKVRYCDGSSFTGDVEAVDPETKLYFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R++ AV+++LL  KGMQ+A +  L+G SAGGLA I+HCD+F +    +  VKC+S+ G+
Sbjct  147   ERVWQAVIDELLA-KGMQNARNAILSGCSAGGLAAILHCDKFQSLLPATARVKCVSDAGY  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+H    +    +ES F  ++  H S   LP  C        LC FPQ+VA+ +RTPLFI
Sbjct  206   FIHGTDISGGSRIESFFGQVVKTHGSAKNLPASCTSKMN-PELCFFPQYVAQTMRTPLFI  264

Query  472   MVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRE--TD  323
             + S YDS+ I + L+    ++ K         K  SA+Q + +++ R Q L A+      
Sbjct  265   INSAYDSWQIKNILAPTAVDSKKEWKDCKLDLKKCSASQLQTVQDYRTQFLKAVDTGLGS  324

Query  322   SPSRGLFVSNCFGHTQ---LIFYWNHPGFEVNYRKDVEVVRDWYFDR  191
             S +RGL++ +C+ H Q   +  + N    EV   K  + V DW++DR
Sbjct  325   SSTRGLWIDSCYAHCQSGSVSTWLNDKSPEVGDTKMGKAVGDWFYDR  371



>ref|XP_006494119.1| PREDICTED: protein notum homolog isoform X1 [Citrus sinensis]
 ref|XP_006494120.1| PREDICTED: protein notum homolog isoform X2 [Citrus sinensis]
Length=392

 Score =   275 bits (703),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 161/398 (40%), Positives = 229/398 (58%), Gaps = 24/398 (6%)
 Frame = -3

Query  1285  MGTLLNTTFILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGE  1106
             MG   N     L+++       A + F  + T +E AV+ GAVCLDGSPPAY F KG G 
Sbjct  7     MGQWFNLLVCALLIL------KAQACFNVSITYVEDAVAKGAVCLDGSPPAYHFDKGFGA  60

Query  1105  GRQRWIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCN  926
             G   W+V++ GG WC+++++C+NR+ S  GSS  +Y    A NF GIL      N +F +
Sbjct  61    GINNWLVHIDGGAWCNNVADCSNRRDSSYGSS--KYMVKEA-NFTGILSNEQNFNPDFYD  117

Query  925   WNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGS  746
             WN+V V YCDG+SFTGDVE VNP T LHFRG R+F+AV+EDLL  KGM++A +  LTG S
Sbjct  118   WNRVKVRYCDGASFTGDVEAVNPETNLHFRGARVFEAVMEDLLA-KGMKNAQNAILTGCS  176

Query  745   AGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAV  566
             AGGL  I+HCD F   F   T VKC ++ G+F++ K  + A  +   ++ ++ LH S   
Sbjct  177   AGGLTSILHCDNFRALFPVDTRVKCFADAGYFVNVKDVSGASHIVEFYKQVVALHGSAKH  236

Query  565   LPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTL------STGFYEAVK  404
             LP  C        LC FPQ+VA  ++TPLFI+ S YDS+ I + L        G + + K
Sbjct  237   LPASCTSRLSPG-LCFFPQNVAGQVKTPLFIINSAYDSWQITNILVPDDADPKGTWSSCK  295

Query  403   S--KHISATQYKALKELRLQMLVALRET-DSPSRGLFVSNCFGH--TQLIFYWNHPGFEV  239
                K  S+TQ + ++  R+Q L AL E  +S SRG+ + +C+ H  T+    W      V
Sbjct  296   VDIKTCSSTQLQTMQGFRVQFLNALAELGNSSSRGMLIDSCYTHCRTEYQEAWLSADSPV  355

Query  238   NYRKDV-EVVRDWYFDRINHVQEVEQSTLVKDCPNNTF  128
               +  + + V DWY+DR +  Q+++        P + F
Sbjct  356   LDKTPIAKAVGDWYYDR-SPFQKIDCPYPCNPLPESCF  392



>ref|XP_009589853.1| PREDICTED: uncharacterized protein LOC104087156 isoform X1 [Nicotiana 
tomentosiformis]
Length=381

 Score =   275 bits (702),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 150/372 (40%), Positives = 216/372 (58%), Gaps = 12/372 (3%)
 Frame = -3

Query  1261  FILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVY  1082
             F++ IV+L    Q +  +   N+TIL +A+  GAVCLDGS PAYL  +G G G   W+V+
Sbjct  2     FLIFIVLLLTVSQVSADFLIVNTTILHNAIGKGAVCLDGSAPAYLIDRGSGYGVNNWLVH  61

Query  1081  LLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHY  902
             + GG WCS+ISEC  R  +  GSS      +  + F+GIL     EN +F NWN+V V Y
Sbjct  62    IEGGGWCSTISECIERTGTRYGSSIHM---EDQYYFQGILSNKPNENPDFFNWNRVKVKY  118

Query  901   CDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVII  722
             CDG+SFTGDV+ V+P TGLHFRG R+F A++EDLL  KGM  A +  L+G SAGGL  I+
Sbjct  119   CDGASFTGDVQEVDPVTGLHFRGARVFLAIMEDLLY-KGMWKAENAILSGTSAGGLTAIL  177

Query  721   HCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKN  542
             HCD+F + F  S  VKC+S+ GFF++ K       +E  +  ++ LH S+  LP  C  +
Sbjct  178   HCDKFRSFFSPSARVKCISDAGFFVNIKTILGESHIEQLYERVVTLHGSSKNLPRSCTSS  237

Query  541   HQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKHI---SATQYKA  371
             +    LC FP++V + IRTPLFI+ S YDS+ IN++L          K I   S +Q + 
Sbjct  238   YLDPSLCFFPEYVVQYIRTPLFIINSAYDSWQINNSLVPYNEWTYCKKDINVCSPSQIQT  297

Query  370   LKELRLQMLVALRETDSPS--RGLFVSNCFGH--TQLIFYWNHPGFEVNYRKDV-EVVRD  206
              ++ R+  + A+     P+   G F+++C  H   +   YW +P       K + + V +
Sbjct  298   FQDFRVIFIRAVINGIRPTSLSGYFITSCHSHKGIETPSYWFYPNSPTLANKAIAQAVGE  357

Query  205   WYFDRINHVQEV  170
             W+F      QE+
Sbjct  358   WFFVESIRFQEI  369



>gb|KCW72722.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=392

 Score =   275 bits (703),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 149/374 (40%), Positives = 211/374 (56%), Gaps = 31/374 (8%)
 Frame = -3

Query  1252  LIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLG  1073
             L V+L  Q    +  F    T +++AV+ GAVCLDGSPPAY F KG+G G   W++   G
Sbjct  10    LCVILSIQILIKSEAFNVGITYVQNAVAKGAVCLDGSPPAYHFDKGVGAGANNWLILFEG  69

Query  1072  GEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDG  893
             G WC++++ C  R+ + LGSS +        +F GIL      N +F NWNK+ V YCDG
Sbjct  70    GAWCNNVTTCLARRDTRLGSSKQMV---KELSFSGILSNKQKFNPDFYNWNKIKVRYCDG  126

Query  892   SSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCD  713
             +SFTGDVE VNP T LHFRG R F A+VEDL+ +KGM +A +  L G SAGGL  I++CD
Sbjct  127   ASFTGDVEAVNPATNLHFRGARAFVAIVEDLM-SKGMSNAQNAILAGCSAGGLTAILNCD  185

Query  712   RFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQL  533
             RF       T VKCL++ G+F+++K  + A  +E+ +  ++  H S   LP  C    + 
Sbjct  186   RFRALVPARTKVKCLADAGYFINAKDVSGASHIENFYSEVVATHGSAKNLPTSCTSKMKP  245

Query  532   AYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYE--------AVKSKHISATQY  377
               LC FPQ+V   I+TPLFI+ + YDS+ I + L+ G  +         +  K  S  Q 
Sbjct  246   G-LCFFPQNVVPQIQTPLFIINAAYDSWQIKNILAPGVADRHGTWRSCKLDIKKCSPNQL  304

Query  376   KALKELRLQMLVALRETD-SPSRGLFVSNCFGHTQLIFYWNHPGFEVNYRKD--------  224
             K +++ RL+ L AL     SPSRG+F+ +C  H Q        G E  + ++        
Sbjct  305   KIMQDFRLEFLRALSAVGTSPSRGMFIDSCNTHCQ-------AGTEATWLRNDSPIVAKT  357

Query  223   --VEVVRDWYFDRI  188
                + V DWY++RI
Sbjct  358   SIAKAVGDWYYERI  371



>ref|XP_010056129.1| PREDICTED: protein notum homolog isoform X1 [Eucalyptus grandis]
 ref|XP_010056130.1| PREDICTED: protein notum homolog isoform X1 [Eucalyptus grandis]
Length=445

 Score =   276 bits (707),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 152/366 (42%), Positives = 214/366 (58%), Gaps = 17/366 (5%)
 Frame = -3

Query  1252  LIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLG  1073
             L VVL  Q    +     + T +++AV+ GAVCLDGSPPAY F KG+G G   W+V   G
Sbjct  16    LWVVLSIQILLKSEATNVSITYVQNAVAKGAVCLDGSPPAYHFNKGLGTGANNWLVQFEG  75

Query  1072  GEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDG  893
             G WC++++ C  R+ + LGSS           F GIL  N + N +F NWN++ V YCDG
Sbjct  76    GGWCNNVTTCLARRDTRLGSSKEMV---KEVAFSGILSNNHSFNPDFYNWNRIKVRYCDG  132

Query  892   SSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCD  713
             +SFTGDVE V+P T LHFRG R F A++EDLL +KGM DA +  L+G SAGGL  I+HCD
Sbjct  133   ASFTGDVEAVDPATKLHFRGARAFVAIIEDLL-SKGMSDAENAILSGCSAGGLTSILHCD  191

Query  712   RFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQL  533
             RF      S TVKC+++ G+F+++K  + AQ +E+ +  ++  H S   LP  C    + 
Sbjct  192   RFRALMPTSATVKCVADAGYFINAKDISGAQHIETFYSEVVATHGSAKNLPTSCTSRLRP  251

Query  532   AYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKH--------ISATQY  377
               LC FPQ+V K I+TPLFI+ + YD++ I + L+ G  +   + H         S  Q 
Sbjct  252   G-LCFFPQNVVKQIQTPLFILNAAYDAWQIKNILAPGVADPHGTWHSCKLDINNCSLDQL  310

Query  376   KALKELRLQMLVAL-RETDSPSRGLFVSNCFGHTQ--LIFYWNHPGFEVNYRKDV-EVVR  209
             + +++ R Q L AL R   SPSRG+F+ +C+ H Q  +   W      V     + + V 
Sbjct  311   QIMQDFRQQFLDALSRVGTSPSRGIFIDSCYAHCQSEMQETWLRDDSPVLIETSIAKAVG  370

Query  208   DWYFDR  191
             DWY+DR
Sbjct  371   DWYYDR  376



>ref|XP_010056132.1| PREDICTED: protein notum homolog isoform X3 [Eucalyptus grandis]
 gb|KCW72716.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
 gb|KCW72717.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
Length=439

 Score =   276 bits (706),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 152/366 (42%), Positives = 214/366 (58%), Gaps = 17/366 (5%)
 Frame = -3

Query  1252  LIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLG  1073
             L VVL  Q    +     + T +++AV+ GAVCLDGSPPAY F KG+G G   W+V   G
Sbjct  10    LWVVLSIQILLKSEATNVSITYVQNAVAKGAVCLDGSPPAYHFNKGLGTGANNWLVQFEG  69

Query  1072  GEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDG  893
             G WC++++ C  R+ + LGSS           F GIL  N + N +F NWN++ V YCDG
Sbjct  70    GGWCNNVTTCLARRDTRLGSSKEMV---KEVAFSGILSNNHSFNPDFYNWNRIKVRYCDG  126

Query  892   SSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCD  713
             +SFTGDVE V+P T LHFRG R F A++EDLL +KGM DA +  L+G SAGGL  I+HCD
Sbjct  127   ASFTGDVEAVDPATKLHFRGARAFVAIIEDLL-SKGMSDAENAILSGCSAGGLTSILHCD  185

Query  712   RFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQL  533
             RF      S TVKC+++ G+F+++K  + AQ +E+ +  ++  H S   LP  C    + 
Sbjct  186   RFRALMPTSATVKCVADAGYFINAKDISGAQHIETFYSEVVATHGSAKNLPTSCTSRLRP  245

Query  532   AYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKH--------ISATQY  377
               LC FPQ+V K I+TPLFI+ + YD++ I + L+ G  +   + H         S  Q 
Sbjct  246   G-LCFFPQNVVKQIQTPLFILNAAYDAWQIKNILAPGVADPHGTWHSCKLDINNCSLDQL  304

Query  376   KALKELRLQMLVAL-RETDSPSRGLFVSNCFGHTQ--LIFYWNHPGFEVNYRKDV-EVVR  209
             + +++ R Q L AL R   SPSRG+F+ +C+ H Q  +   W      V     + + V 
Sbjct  305   QIMQDFRQQFLDALSRVGTSPSRGIFIDSCYAHCQSEMQETWLRDDSPVLIETSIAKAVG  364

Query  208   DWYFDR  191
             DWY+DR
Sbjct  365   DWYYDR  370



>ref|XP_010056135.1| PREDICTED: protein notum homolog [Eucalyptus grandis]
Length=392

 Score =   274 bits (701),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 147/374 (39%), Positives = 215/374 (57%), Gaps = 31/374 (8%)
 Frame = -3

Query  1252  LIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLG  1073
             L V+L  Q    +     + T +++AV+ GAVCLDGSPPAY F KG+G G   W++++ G
Sbjct  10    LCVILSIQILLKSEAINVSITYVQNAVAKGAVCLDGSPPAYHFDKGVGAGANNWLIFVEG  69

Query  1072  GEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDG  893
             G WC++++ C  R+ + +GSS +        +F GIL      N +F NWNK+ V YCDG
Sbjct  70    GGWCNNVTTCLARRDTRVGSSKQMV---KELSFSGILSNKQKFNPDFYNWNKIKVRYCDG  126

Query  892   SSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCD  713
             +SFTGDVE VNP T LHFRG R F A+VEDL+ +KGM +A +  L+G SAGGLA I++CD
Sbjct  127   ASFTGDVEAVNPATNLHFRGARAFVAIVEDLM-SKGMSNAQNAILSGCSAGGLAAILNCD  185

Query  712   RFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQL  533
             RF       T VKCL++ G+F+++K  + A  +E+ +  ++  H S   LP  C    + 
Sbjct  186   RFRALMPARTKVKCLADAGYFINAKDVSGASHIENFYSEVVATHGSAKNLPTSCTSKMKP  245

Query  532   AYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEA--------VKSKHISATQY  377
               LC FPQ+V   I+TPLFI+ + YD++ I + L+ G  +         +  K  S  Q 
Sbjct  246   G-LCFFPQNVVPQIQTPLFIINAAYDAWQIKNILAPGVADPHGTWNSCKLDIKKCSPNQL  304

Query  376   KALKELRLQMLVALRETD-SPSRGLFVSNCFGHTQLIFYWNHPGFEVNYRKD--------  224
             K +++ RL+ L AL     SPSRG+F+ +C  H Q        G E  + ++        
Sbjct  305   KIMQDFRLEFLRALSAVGTSPSRGMFIDSCNTHCQA-------GTEATWLRNDSPIVAKT  357

Query  223   --VEVVRDWYFDRI  188
                + V DWY++RI
Sbjct  358   SIAKAVGDWYYERI  371



>gb|KHG23648.1| Notum [Gossypium arboreum]
Length=395

 Score =   274 bits (701),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 157/366 (43%), Positives = 220/366 (60%), Gaps = 32/366 (9%)
 Frame = -3

Query  1207  FTTNS-----TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISEC  1043
             FTTN      T ++SAV+ GAVCLDG+PPAY + KG G G   W++ L GG WC+++S C
Sbjct  21    FTTNGAYVPITYVQSAVAKGAVCLDGTPPAYHWDKGYGTGINSWLIQLEGGGWCNNVSSC  80

Query  1042  TNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETV  863
               RK +HLGSS R         F GIL+     N  F NWN++ V YCDGSSFTGDV  V
Sbjct  81    LVRKNTHLGSSKRMV---KQIPFSGILN-----NKHFYNWNRIKVRYCDGSSFTGDVAAV  132

Query  862   NPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNST  683
             NP   LHFRG R++ AV+EDLL +KGM++A +  L+G SAGGLA I+HCD F       T
Sbjct  133   NPVANLHFRGARVWLAVMEDLL-SKGMRNAENAILSGCSAGGLASILHCDSFRALLPMGT  191

Query  682   TVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHV  503
              VKC+S+ G+F++++  +    +++ F  ++  H S   L   C    +   LC FPQ++
Sbjct  192   KVKCISDAGYFINTRDVSGGHYIQTFFDQLVATHGSAKNLLPSCTSRMKPG-LCFFPQYI  250

Query  502   AKDIRTPLFIMVSTYDSYLINHTLSTGF------YEAVK--SKHISATQYKALKELRLQM  347
             A+ IRTPLFI+ + YDS+ I + L+ G       +E+ K   K+   +Q K +++ RLQ 
Sbjct  251   AQQIRTPLFIINAAYDSWQIRNILAPGIADPHGHWESCKLDIKNCLPSQIKVMQDFRLQF  310

Query  346   LVA-LRETDSPSRGLFVSNCFGHTQ-----LIFYWNHPGFEVNYRKDVEVVRDWYFDRIN  185
             LVA LR   S SRG+F+ +CF H Q     L F  + P   +N  K  + V DW++DR N
Sbjct  311   LVALLRLGKSASRGMFIDSCFAHCQTEMQELWFMQDSP--LLNKTKIGKAVGDWFYDR-N  367

Query  184   HVQEVE  167
               Q+++
Sbjct  368   PFQKID  373



>ref|XP_011012520.1| PREDICTED: protein notum homolog [Populus euphratica]
Length=394

 Score =   274 bits (701),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 145/347 (42%), Positives = 207/347 (60%), Gaps = 18/347 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             TI+++AV+ GAVCLDGSPP Y F KG G G   W+V++ GG WC S+  C +R+ ++ GS
Sbjct  30    TIVQTAVARGAVCLDGSPPGYHFEKGSGSGINNWLVHMEGGGWCESVESCVSRRDTYKGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +    +    F GIL    A N +F NWN++ + YCDGSSFTGDVE V+P T L+FRG
Sbjct  90    SLKM---EKTMGFSGILGSKQAANPDFYNWNRIKIRYCDGSSFTGDVEAVDPKTKLYFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RI+ AV++DLL  KGM++A +  L+G SAGGLA I+HCD+F +    S  VKC+S+ G+
Sbjct  147   ERIWQAVIDDLLA-KGMRNARNAILSGCSAGGLAAILHCDKFQSLLPASARVKCVSDAGY  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+H    +    +ES F  ++  H S   LP  C    +   LC FPQ+VA+ +RTPLFI
Sbjct  206   FIHGTDISGGSRIESFFGQVVKTHGSAKNLPASCTSKTR-PELCFFPQYVAQTMRTPLFI  264

Query  472   MVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRE--TD  323
             + S YDS+ I + L+    ++ K         K  SATQ + ++  R Q L A+      
Sbjct  265   INSAYDSWQIKNILAPTAVDSKKEWKNCKLDLKKCSATQLQTVQNYRTQFLKAVNTGLGS  324

Query  322   SPSRGLFVSNCFGHTQ---LIFYWNHPGFEVNYRKDVEVVRDWYFDR  191
             S SRGL++++C+ H Q   +  +       V   K  + V DW++DR
Sbjct  325   SSSRGLWINSCYAHCQSGSVSTWLADKSPVVGNAKIGKAVGDWFYDR  371



>ref|XP_010056131.1| PREDICTED: protein notum homolog isoform X2 [Eucalyptus grandis]
Length=448

 Score =   276 bits (705),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 152/366 (42%), Positives = 214/366 (58%), Gaps = 17/366 (5%)
 Frame = -3

Query  1252  LIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLG  1073
             L VVL  Q    +     + T +++AV+ GAVCLDGSPPAY F KG+G G   W+V   G
Sbjct  19    LWVVLSIQILLKSEATNVSITYVQNAVAKGAVCLDGSPPAYHFNKGLGTGANNWLVQFEG  78

Query  1072  GEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDG  893
             G WC++++ C  R+ + LGSS           F GIL  N + N +F NWN++ V YCDG
Sbjct  79    GGWCNNVTTCLARRDTRLGSSKEMV---KEVAFSGILSNNHSFNPDFYNWNRIKVRYCDG  135

Query  892   SSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCD  713
             +SFTGDVE V+P T LHFRG R F A++EDLL +KGM DA +  L+G SAGGL  I+HCD
Sbjct  136   ASFTGDVEAVDPATKLHFRGARAFVAIIEDLL-SKGMSDAENAILSGCSAGGLTSILHCD  194

Query  712   RFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQL  533
             RF      S TVKC+++ G+F+++K  + AQ +E+ +  ++  H S   LP  C    + 
Sbjct  195   RFRALMPTSATVKCVADAGYFINAKDISGAQHIETFYSEVVATHGSAKNLPTSCTSRLRP  254

Query  532   AYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKH--------ISATQY  377
               LC FPQ+V K I+TPLFI+ + YD++ I + L+ G  +   + H         S  Q 
Sbjct  255   G-LCFFPQNVVKQIQTPLFILNAAYDAWQIKNILAPGVADPHGTWHSCKLDINNCSLDQL  313

Query  376   KALKELRLQMLVAL-RETDSPSRGLFVSNCFGHTQ--LIFYWNHPGFEVNYRKDV-EVVR  209
             + +++ R Q L AL R   SPSRG+F+ +C+ H Q  +   W      V     + + V 
Sbjct  314   QIMQDFRQQFLDALSRVGTSPSRGIFIDSCYAHCQSEMQETWLRDDSPVLIETSIAKAVG  373

Query  208   DWYFDR  191
             DWY+DR
Sbjct  374   DWYYDR  379



>gb|ACF05806.1| PAE [Litchi chinensis]
Length=399

 Score =   274 bits (701),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 145/351 (41%), Positives = 210/351 (60%), Gaps = 17/351 (5%)
 Frame = -3

Query  1207  FTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKT  1028
             F    T +E+AV+ GAVCLDGSPPAY   KG G G   W+V++ GG WC++++ C +RK 
Sbjct  25    FDVGITYVENAVAKGAVCLDGSPPAYHLDKGFGAGINNWLVHIEGGGWCNNVTTCLSRKN  84

Query  1027  SHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTG  848
             + LGSS +         F G+L      N +F NWN++ V YCDG+SFTGDVE VNP T 
Sbjct  85    TRLGSSKKMV---KVVAFSGMLSNKQKFNPDFYNWNRIKVRYCDGASFTGDVEAVNPATN  141

Query  847   LHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCL  668
             LHFRG R+F A++EDLL  KGM++A +  L+G SAGGL  I+HCD+F      ST VKC 
Sbjct  142   LHFRGARVFLAIIEDLLA-KGMKNAKNAVLSGCSAGGLTSILHCDKFQTLLPTSTKVKCF  200

Query  667   SNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIR  488
             ++ G+F+++K  + AQ +E+ +  ++  H S   LP  C    +   LC FPQ++A+ I+
Sbjct  201   ADAGYFINTKDVSGAQHIEAFYNEVVATHGSAKNLPASCTSRLKPG-LCFFPQYMARQIQ  259

Query  487   TPLFIMVSTYDSYLINHTLSTGFYEAVKSKH--------ISATQYKALKELRLQMLVALR  332
             TPLFI+ + YDS+ I + L+ G  +   + H         S  Q + ++  RLQ L AL 
Sbjct  260   TPLFIINAAYDSWQIKNILAPGVADPHGTWHSCKLDINNCSPNQLQTMQSFRLQFLDALS  319

Query  331   ET-DSPSRGLFVSNCFGH--TQLIFYWNHPGFEVNYRKDV-EVVRDWYFDR  191
                +S S+GLF+ +C+ H  T++   W      V  +  + + V DWY+DR
Sbjct  320   GLGNSTSKGLFIDSCYAHCQTEMQETWLRDDSPVLGKTTIAKAVGDWYYDR  370



>ref|XP_009607289.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=399

 Score =   274 bits (701),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 139/357 (39%), Positives = 214/357 (60%), Gaps = 17/357 (5%)
 Frame = -3

Query  1207  FTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKT  1028
             +    T++ +AVS GAVCLDGSPPAY F  G G+G  +W+V+L GG WC+++ EC NR  
Sbjct  39    YYVEKTVVHNAVSKGAVCLDGSPPAYHFEPGFGDGVGKWLVHLSGGAWCTTVEECLNRSK  98

Query  1027  SHLGSSH--RQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPT  854
             S  GSS   + +W      F GI     + N +F NWNKV V YCDG +FTG+ E V+P 
Sbjct  99    SDFGSSKYMKPWW------FIGIYSKTQSVNPDFYNWNKVFVRYCDGGAFTGNAEYVDPA  152

Query  853   TGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVK  674
             T LHFRG RIF AV+ED+L  KG+++A    L G SA G   +++CDRF     N+  VK
Sbjct  153   TNLHFRGARIFKAVMEDVLA-KGLKNAQSALLIGSSAAGYPAMLYCDRFHKLLPNTPRVK  211

Query  673   CLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKD  494
             C+ + G+F+H K P +A++    ++ I++LH S   LP+ C    +   +C FP+++   
Sbjct  212   CMVDAGYFIHVKDPHQARNFTQMYKAIVNLHGSAKTLPKSCISKMK-PEMCFFPENMQHK  270

Query  493   IRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKHISATQYKALKELRLQMLVALRETDSPS  314
             I+TPL+I +S +D + IN T+  G    ++  + +AT+ K  ++ RL+ L AL + ++P 
Sbjct  271   IKTPLYIAMSAFDKFQINTTIYDGVNTCIEGGNCTATENKLFRDFRLEFLNALPKGNNPK  330

Query  313   -RGLFVSNCFGHTQLIFYWNHPGFEVNYRKDVEVVR---DWYFDRINHVQEVEQSTL  155
              RG F+     HTQ+  +W+     V   K++ +++   DWY+DR N+   +++  L
Sbjct  331   LRGAFIDARNHHTQVQGWWSPK--NVTTVKNLNLMKAFGDWYYDR-NYTYVIDERDL  384



>ref|XP_007040902.1| Pectinacetylesterase family protein [Theobroma cacao]
 gb|EOY25403.1| Pectinacetylesterase family protein [Theobroma cacao]
Length=401

 Score =   274 bits (700),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 151/354 (43%), Positives = 216/354 (61%), Gaps = 18/354 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T ++SAV+ GAVCLDGSPPAY + +G G G   W++ L GG WC++++ C  RK +HLGS
Sbjct  30    TYVQSAVAKGAVCLDGSPPAYHWDRGYGTGINSWLIQLEGGGWCNNVTSCLVRKNTHLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S R         F GIL+     N +F NWN+V V YCDGSSFTGDV  VNP T LHFRG
Sbjct  90    SKRMV---KQIPFSGILNNKHQFNPDFYNWNRVKVRYCDGSSFTGDVAAVNPVTNLHFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R++ AV+EDLL  KGM++A +  L+G SAGGLA I+HCD F       T VKCLS+ G+
Sbjct  147   ARVWLAVMEDLLA-KGMRNAENAVLSGCSAGGLASILHCDSFPALLPMGTKVKCLSDAGY  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+++K  +    +E+ F  ++  H S   L   C    +   LC FP+++A+ I+TPLF 
Sbjct  206   FINAKDVSGGHYIEAFFNQLVATHGSAKNLLPSCTSRMRPG-LCFFPEYMAQQIQTPLFF  264

Query  472   MVSTYDSYLINHTLST------GFYEAVK--SKHISATQYKALKELRLQMLVA-LRETDS  320
             + + YDS+ I + L+       G++E+ K   K+   +Q K +++ RLQ LVA LR   S
Sbjct  265   INAAYDSWQIRNILAPGIADPRGYWESCKLDIKNCLPSQIKTMQDFRLQFLVALLRLGKS  324

Query  319   PSRGLFVSNCFGH--TQLIFYWNHPGFE-VNYRKDVEVVRDWYFDRINHVQEVE  167
              SRG+F+ +C+ H  T++   W  P    +N     + V DW++DR N  Q+++
Sbjct  325   SSRGMFIDSCYAHCQTEMQGLWLMPDSPLLNKTSIAKAVGDWFYDR-NPFQKID  377



>ref|XP_002519911.1| pectin acetylesterase, putative [Ricinus communis]
 gb|EEF42515.1| pectin acetylesterase, putative [Ricinus communis]
Length=399

 Score =   273 bits (699),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 150/365 (41%), Positives = 217/365 (59%), Gaps = 29/365 (8%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T +++AV+ GAVCLDGSPPAY   KG G G   W+V+  GG WC++I+ C +RK + LGS
Sbjct  30    TYVKNAVAKGAVCLDGSPPAYHLDKGFGTGINSWLVHFEGGGWCNNITTCLSRKNTRLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +         F GI+      N +F NWN+V + YCDGSSFTGDV+ VNP T LHFRG
Sbjct  90    SKQM---GPQIAFSGIMSNRRRYNPDFYNWNRVKIRYCDGSSFTGDVQAVNPATNLHFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RI+ AV+E+LL  KGM++A +  L+G SAGGLA I+HCD F       T VKCLS+ G+
Sbjct  147   ARIWLAVIEELLA-KGMKNAENALLSGCSAGGLASILHCDGFRALLPMGTNVKCLSDAGY  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F++++  + A  +++ F  ++ LH S   LP  C    + A LC FPQ++ + IRTPLFI
Sbjct  206   FINARDVSGAAHIQTYFNEVVSLHGSAKNLPLSCTSRLKPA-LCFFPQYLVQQIRTPLFI  264

Query  472   MVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVAL-RETDS  320
             + + YDS+ I + L+ G  +   S         + S  Q K +++ R++ L AL R  +S
Sbjct  265   LNAAYDSWQIKNILAPGVADPRGSWNSCKLDINNCSPIQLKTMQDFRMRFLSALYRSANS  324

Query  319   PSRGLFVSNCFGHTQ-----LIFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTL  155
              S+GL++ +C+ H Q       F  + P   ++  K  + V DW++DRI   Q++     
Sbjct  325   SSKGLYIDSCYAHCQTETQETWFMADSP--VLSKTKIAKAVGDWFYDRI-PFQKI-----  376

Query  154   VKDCP  140
               DCP
Sbjct  377   --DCP  379



>gb|KCW72726.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=373

 Score =   272 bits (696),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 141/335 (42%), Positives = 198/335 (59%), Gaps = 14/335 (4%)
 Frame = -3

Query  1252  LIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLG  1073
             L V+L  Q    +  F    T +++AV+ GAVCLDGSPPAY F KG+G G   W++   G
Sbjct  10    LCVILSIQILIKSEAFNVGITYVQNAVAKGAVCLDGSPPAYHFDKGVGAGANNWLILFEG  69

Query  1072  GEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDG  893
             G WC++++ C  R+ + LGSS +        +F GIL      N +F NWNK+ V YCDG
Sbjct  70    GAWCNNVTTCLARRDTRLGSSKQMV---KELSFSGILSNKQKFNPDFYNWNKIKVRYCDG  126

Query  892   SSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCD  713
             +SFTGDVE VNP T LHFRG R F A+VEDL+ +KGM +A +  L G SAGGL  I++CD
Sbjct  127   ASFTGDVEAVNPATNLHFRGARAFVAIVEDLM-SKGMSNAQNAILAGCSAGGLTAILNCD  185

Query  712   RFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQL  533
             RF       T VKCL++ G+F+++K  + A  +E+ +  ++  H S   LP  C    + 
Sbjct  186   RFRALVPARTKVKCLADAGYFINAKDVSGASHIENFYSEVVATHGSAKNLPTSCTSKMKP  245

Query  532   AYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYE--------AVKSKHISATQY  377
               LC FPQ+V   I+TPLFI+ + YDS+ I + L+ G  +         +  K  S  Q 
Sbjct  246   G-LCFFPQNVVPQIQTPLFIINAAYDSWQIKNILAPGVADRHGTWRSCKLDIKKCSPNQL  304

Query  376   KALKELRLQMLVALRET-DSPSRGLFVSNCFGHTQ  275
             K +++ RL+ L AL     SPSRG+F+ +C+ H Q
Sbjct  305   KIMQDFRLEFLRALSAVGTSPSRGMFIDSCYAHCQ  339



>ref|XP_010644665.1| PREDICTED: uncharacterized protein LOC100245856 [Vitis vinifera]
 emb|CBI29219.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   273 bits (698),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 144/351 (41%), Positives = 213/351 (61%), Gaps = 17/351 (5%)
 Frame = -3

Query  1207  FTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKT  1028
             F    T ++SAV+ GAVCLDGSPPAY   KG G G   W+V++ GG WC++ S C  R+ 
Sbjct  25    FYVGITYVDSAVAKGAVCLDGSPPAYHMDKGFGAGINNWLVHIEGGGWCNNASTCLARRD  84

Query  1027  SHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTG  848
             + LGSS +         F GIL      N +F NWNK+ V YCDG+SFTGDVE V+P T 
Sbjct  85    NRLGSSKQMV---KQIAFSGILSNKQKFNPDFYNWNKIKVRYCDGASFTGDVEAVDPKTN  141

Query  847   LHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCL  668
             LH+RG R+F AV+EDL+  KGM++A +  L+G SAGGL  I+HCD+F      ST VKC 
Sbjct  142   LHYRGARVFLAVIEDLMA-KGMKNAANAVLSGCSAGGLTAILHCDKFRALLPVSTKVKCF  200

Query  667   SNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIR  488
             ++ G+F+++K  + A  +E  +  ++  H S   LP  C  + +   LC FPQ++A+ I+
Sbjct  201   ADAGYFINAKDVSGAAHIEGFYSEVVATHGSAKNLPPSCTSSLRPG-LCFFPQNMAQQIK  259

Query  487   TPLFIMVSTYDSYLINHTLSTGF--------YEAVKSKHISATQYKALKELRLQMLVALR  332
             TPLFI+ + YDS+ I + L+ G         Y  +  K  S++Q +A+++ R+Q L A++
Sbjct  260   TPLFIINAAYDSWQIKNILAPGVADPHGTWHYCKLDIKDCSSSQLEAMQDFRVQFLSAIK  319

Query  331   E-TDSPSRGLFVSNCFGH--TQLIFYWNHPGFEVNYRKDV-EVVRDWYFDR  191
                 SPS+G+F+++C+ H  T++   W      V  +  + + V DWY+DR
Sbjct  320   GLIGSPSKGMFINSCYAHCQTEMQETWLRDDSPVLGKTTIAKAVGDWYYDR  370



>ref|XP_006385136.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62933.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
Length=391

 Score =   272 bits (695),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 142/315 (45%), Positives = 201/315 (64%), Gaps = 14/315 (4%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T ++SAV+ GAVCLDGSPPAY + KG G G   W+++  GG WC++++ C +RK +HLGS
Sbjct  33    TYVKSAVAKGAVCLDGSPPAYHWDKGFGTGINSWLIHFEGGGWCNNVTSCLSRKKTHLGS  92

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S           F GI++     N +F NWN+V + YCDGSSFTGDV+ VNP T LHFRG
Sbjct  93    SKLM---GQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQAVNPATNLHFRG  149

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RI+ AV+EDLL  KG+++A +  L+G SAGGLA I+HCD F    R  T VKCLS+ G+
Sbjct  150   ARIWLAVIEDLL-PKGLKNAENALLSGCSAGGLASILHCDSFRALLRMGTKVKCLSDAGY  208

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+  K  + A  +++ F  I+ LH S   LP  C    + ++ C FPQ+VA  +RTPLFI
Sbjct  209   FIKVKDVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSVLKPSF-CFFPQYVAPQVRTPLFI  267

Query  472   MVSTYDSYLINHTLST------GFYEAVK--SKHISATQYKALKELRLQMLVAL-RETDS  320
             + + YDS+ I + L+       G +++ K    + S  Q K++++ RLQ L AL + T+S
Sbjct  268   LNAAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQFLNALNKSTNS  327

Query  319   PSRGLFVSNCFGHTQ  275
              SRGL++ +C+ H Q
Sbjct  328   SSRGLYIDSCYAHCQ  342



>ref|XP_002303225.2| pectinacetylesterase family protein [Populus trichocarpa]
 gb|ABK93778.1| unknown [Populus trichocarpa]
 gb|ABK95483.1| unknown [Populus trichocarpa]
 gb|EEE78204.2| pectinacetylesterase family protein [Populus trichocarpa]
Length=394

 Score =   272 bits (696),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 145/347 (42%), Positives = 207/347 (60%), Gaps = 18/347 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             TI+++AV+ GAVCLDGSPP Y F KG G G   W+V++ GG WC S+  C +R+ ++ GS
Sbjct  30    TIVQAAVARGAVCLDGSPPGYHFEKGSGSGINNWLVHMEGGGWCESVESCVSRRDTYKGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +    +    F GIL    A N +F NWN++ + YCDGSSFTGDVE V+P T L+FRG
Sbjct  90    SLKM---EKTMGFSGILGSKQAANPDFYNWNRIKIRYCDGSSFTGDVEAVDPKTKLYFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RI+ AV++DLL  KGM++A +  L+G SAGGLA I+HCD+F +    S  VKC+S+ G+
Sbjct  147   ERIWQAVIDDLLA-KGMRNARNAILSGCSAGGLAAILHCDKFQSLLPASARVKCVSDAGY  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+H    +    +ES F  ++  H S   LP  C    +   LC FPQ+VA+ +RTPLFI
Sbjct  206   FIHGTDISGGSRIESFFGQVVKTHGSAKHLPASCTSKTR-PELCFFPQYVAQAMRTPLFI  264

Query  472   MVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALR--ETD  323
             + S YDS+ I + L+    ++ K         K  SATQ + ++  R Q L A+      
Sbjct  265   INSAYDSWQIKNILAPTAVDSKKEWKNCKLDLKKCSATQLQTVQNYRTQFLKAVNIGLGS  324

Query  322   SPSRGLFVSNCFGHTQ---LIFYWNHPGFEVNYRKDVEVVRDWYFDR  191
             S SRGL++++C+ H Q   +  +       V   K  + V DW++DR
Sbjct  325   SSSRGLWINSCYAHCQSGSVSTWLADKSPVVGNVKIGKAVGDWFYDR  371



>ref|NP_001047850.1| Os02g0702400 [Oryza sativa Japonica Group]
 dbj|BAD07550.1| putative pectin acetylesterase [Oryza sativa Japonica Group]
 dbj|BAD08059.1| putative pectin acetylesterase [Oryza sativa Japonica Group]
 dbj|BAF09764.1| Os02g0702400 [Oryza sativa Japonica Group]
 dbj|BAG91018.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57637.1| hypothetical protein OsJ_08062 [Oryza sativa Japonica Group]
Length=397

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 155/365 (42%), Positives = 205/365 (56%), Gaps = 29/365 (8%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T + SAV+ GAVCLDGSPPAY   +G G G   W+V+  GG WCS+++ C  RK + LGS
Sbjct  30    TYVASAVAKGAVCLDGSPPAYHLARGFGSGVNSWLVHFEGGGWCSNVTTCLQRKRTRLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +         F GIL      N +F NWNKV V YCDGSSFTGDVE V+P T LH+RG
Sbjct  90    SKQMA---KQIAFSGILSNTPDYNPDFYNWNKVKVRYCDGSSFTGDVEKVDPATKLHYRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R++ AV++DLL  KGM  A +  ++G SAGGL  I+HCDRF + F   T VKCLS+ GF
Sbjct  147   ARVWQAVMDDLLA-KGMNSANNALISGCSAGGLTSILHCDRFRDLFPVDTKVKCLSDAGF  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F++ K  A  + + + F G+   H S   LP  C        +C FPQ+  K I+TPLFI
Sbjct  206   FINEKDIAGVEYIVAFFNGVATTHGSAKNLPSACTSRLSPG-MCFFPQNEVKQIQTPLFI  264

Query  472   MVSTYDSYLINHTLSTGFYEAVKSKH--------ISATQYKALKELRLQMLVALRETDSP  317
             + + YDS+ + + L  GF +     H          A+Q + L+  R   L AL+E  +P
Sbjct  265   LNAAYDSWQVRNILVPGFADPHGKWHSCKHDIDQCPASQLQILQGFRDDFLKALKEQGTP  324

Query  316   S-RGLFVSNCFGHTQ-----LIFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTL  155
             S RGLF+++CF H Q       F    P  E     D   V DW++DR N  Q++     
Sbjct  325   STRGLFINSCFVHCQSETQETWFASGSPMLETKTIAD--AVGDWFYDR-NPFQKI-----  376

Query  154   VKDCP  140
               DCP
Sbjct  377   --DCP  379



>ref|XP_010536210.1| PREDICTED: uncharacterized protein LOC104811251 [Tarenaya hassleriana]
Length=391

 Score =   271 bits (694),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 147/346 (42%), Positives = 202/346 (58%), Gaps = 17/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T L+SAV+ GAVCLDGSPPAY F KG G G   WIV++ GG WC+ I+ C+ RK +  GS
Sbjct  27    TYLDSAVAKGAVCLDGSPPAYHFDKGSGSGVNNWIVHMEGGGWCNDIASCSERKNTMKGS  86

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S    + +  F F GIL    + N +F NWN++ V YCDGSSFTGDVE VNP+  L FRG
Sbjct  87    SK---FMNKDFGFSGILGSKQSSNPDFYNWNRIKVRYCDGSSFTGDVEAVNPSNKLFFRG  143

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R++ AV++DL+  KGM  A +  L+G SAG LA I+HCD+F     +S  VKC+S+ G+
Sbjct  144   ARVWRAVIDDLMA-KGMNKAQNAILSGCSAGALAAILHCDQFRAILPSSANVKCVSDAGY  202

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+H K  +    +ES +  ++ LH S   LPE C    +   LC FPQ+VA  +RTPLF+
Sbjct  203   FIHGKDISGGSYIESYYSKVVALHGSAKGLPESCTSTTK-PELCFFPQYVAPSMRTPLFV  261

Query  472   MVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRETDS-  320
             + + +DS+ I + L+    +  K         K  +A Q + ++  R QML AL    S 
Sbjct  262   VNAAFDSWQIKNVLAPTAVDKSKEWKNCKLDLKKCTAAQLQTVQGFRDQMLNALAPVQSM  321

Query  319   PSRGLFVSNCFGHTQ---LIFYWNHPGFEVNYRKDVEVVRDWYFDR  191
              S GLF+ +C  H Q      +    G  V+  K  + V DW+ DR
Sbjct  322   ASGGLFLDSCHAHCQGGSAASWSGSQGPSVDDTKIAKAVGDWFNDR  367



>ref|XP_009590664.1| PREDICTED: uncharacterized protein LOC104087809 isoform X2 [Nicotiana 
tomentosiformis]
Length=375

 Score =   271 bits (692),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 142/350 (41%), Positives = 205/350 (59%), Gaps = 35/350 (10%)
 Frame = -3

Query  1234  QQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSS  1055
             Q+    ++YF  ++TI+++A+S GAVCLDGSPPAY   +G G G + WI+ L GG WC +
Sbjct  32    QEKGIDHAYFV-DTTIVQNALSKGAVCLDGSPPAYHLDRGFGHGVRNWIILLSGGAWCRN  90

Query  1054  ISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGD  875
             I++C NR  + LGSS       + F F GI   + +EN +F NWNKV V YCDG  FTGD
Sbjct  91    ITDCLNRSKTDLGSSKHM----TPFIFLGIFSKSKSENPDFYNWNKVFVRYCDGGGFTGD  146

Query  874   VETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRF  695
             +E+++P T LHFRG RIFDAV+EDLL  KG++DA +  L+GGSA G   +++CDRF N  
Sbjct  147   IESIDPATNLHFRGARIFDAVIEDLLA-KGLKDAKNAILSGGSANGYPAVLYCDRFHNLL  205

Query  694   RNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMF  515
               +  VKCL + G+F+H K+P  A   ES FR ++ LH ST VLP+ C          M 
Sbjct  206   HKAHRVKCLVDAGYFIHVKNPRLANVFESLFRDVVTLHGSTKVLPKSCTSK-------MK  258

Query  514   PQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKHISATQYKALKELRLQMLVAL  335
             P+                    L+++ + +   + +++++ + +Q    KELR + L AL
Sbjct  259   PE--------------------LVDNIIGSDIGDCIRARNCTESQNNDFKELRSEFLSAL  298

Query  334   RETDSPS-RGLFVSNCFGHTQLIFYWNH-PGFEVNYRKDVEVVRDWYFDR  191
              + + P  RG F+ +   HTQL  +WN      +N    +EV  DWY+DR
Sbjct  299   PKPNDPKQRGAFIDSFNRHTQLELWWNKVNATPINNLTTIEVFGDWYYDR  348



>emb|CDY26383.1| BnaA02g23870D [Brassica napus]
Length=391

 Score =   271 bits (692),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 143/346 (41%), Positives = 204/346 (59%), Gaps = 17/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T LESAV+ GAVCLDGS PAY F KG G G   WIV++ GG WC+ I+ C  RKT+  GS
Sbjct  27    TYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVKRKTTMKGS  86

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S    + +  F F GIL    + N +F NWN++ V YCDGSSFTGD+E V+PT  L FRG
Sbjct  87    SK---FMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAVDPTNKLFFRG  143

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R++ AV++DL+  KGM +A +  L+G SAG LA I+HCD+F +    +  VKC+S+ GF
Sbjct  144   ARVWRAVIDDLMA-KGMNNAQNAILSGCSAGALAAILHCDQFKSILPTTAKVKCVSDAGF  202

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+H K  +    +ES +  ++  H S   LP  C  + +   LC FPQ+V K ++TPLF+
Sbjct  203   FIHGKDISGGSYIESYYSKVVSTHGSAKSLPASCTSSMK-PELCFFPQYVVKTMQTPLFV  261

Query  472   MVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRET-DS  320
             + + +DS+ I + L+    +  K         K  +A Q + ++E R QML AL     +
Sbjct  262   INAAFDSWQIKNVLAPTSVDKRKEWKDCKLDLKKCTAAQLQTVQEYRDQMLAALAPVRAT  321

Query  319   PSRGLFVSNCFGHTQ---LIFYWNHPGFEVNYRKDVEVVRDWYFDR  191
              +RGLF+ +C  H Q      +    G +V   K  + V DW+++R
Sbjct  322   TTRGLFLDSCHAHCQGGSAATWSGAQGPQVGNTKMAKAVGDWFYER  367



>ref|XP_006878664.1| hypothetical protein AMTR_s00011p00266820 [Amborella trichopoda]
 gb|ERM94809.1| hypothetical protein AMTR_s00011p00266820 [Amborella trichopoda]
Length=398

 Score =   271 bits (693),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 145/357 (41%), Positives = 215/357 (60%), Gaps = 29/357 (8%)
 Frame = -3

Query  1207  FTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKT  1028
             F  + T + +AV+ GAVCLDGSPPAY   KG G G   W+V++ GG WCS+++ C +RK 
Sbjct  24    FFVDITYVTTAVAKGAVCLDGSPPAYHLDKGSGSGINNWLVHVEGGGWCSNVTTCFSRKN  83

Query  1027  SHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTG  848
             + LGSS++         F G+L    + N +F NWN+V V YCDG+SFTGDVE V+P T 
Sbjct  84    TRLGSSNQMV---KQLAFSGLLGNKASMNPDFYNWNRVKVRYCDGASFTGDVEEVDPATK  140

Query  847   LHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCL  668
             LHFRG RI+ AV+EDLL  KGM++A +  L+G SAGGL  I+HCD F         VKC+
Sbjct  141   LHFRGGRIWLAVIEDLLA-KGMRNAENAILSGCSAGGLTSILHCDSFRALLPIGAKVKCV  199

Query  667   SNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIR  488
             ++ G+F+++K  ++A  ++S F  ++ LH+S   LP+ C    + + LC FPQ++A+ IR
Sbjct  200   ADAGYFINAKDVSQADHIQSFFDDVVTLHDSAKNLPQSCTSRLKPS-LCFFPQYMAQGIR  258

Query  487   TPLFIMVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALR  332
             TP F++ + YDS+ + +TL+ G  +         +  K  +A+Q + L++ RL+ L AL+
Sbjct  259   TPFFLLNAAYDSWQVKNTLAPGVADPHGTWHNCKLDIKKCTASQLQTLQDFRLEFLSALK  318

Query  331   ET-DSPSRGLFVSNCFGHTQLIFYWNHPGFEVNYRKDVEV---------VRDWYFDR  191
                 SPS G+F+++C+ H Q          E   R D  V         V DW++DR
Sbjct  319   GVGSSPSIGMFINSCYAHCQSEVQ------ETWLRDDSPVLGGTSIAKAVGDWFYDR  369



>ref|XP_007040900.1| Pectinacetylesterase family protein [Theobroma cacao]
 gb|EOY25401.1| Pectinacetylesterase family protein [Theobroma cacao]
Length=399

 Score =   271 bits (692),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 147/364 (40%), Positives = 212/364 (58%), Gaps = 27/364 (7%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T L+SAV+ GAVCLDGSPPAY F  G G G   W+V++ GG WC  +  C +R+ + LGS
Sbjct  31    TYLQSAVAKGAVCLDGSPPAYHFDPGSGAGVNNWLVHMEGGGWCEDVERCLSRRNTDLGS  90

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +       F F G+L      N +F NWN++ V YCDGSSFTGDVE   P   L FRG
Sbjct  91    SEQMV---KQFGFSGLLSSQQKSNPDFYNWNRIKVRYCDGSSFTGDVEA--PVNNLFFRG  145

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RI++A++EDLL  KGM++A +  L+G SAGGLA I+HCDRF      +T VKC+S+ GF
Sbjct  146   NRIWEAIIEDLLA-KGMRNAKNAILSGCSAGGLASILHCDRFRALLPAATKVKCISDAGF  204

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQL-AYLCMFPQHVAKDIRTPLF  476
             F+H+K  +  Q +E+ +  +  LH S   LP  C     +   LC FPQ+V + ++TP+F
Sbjct  205   FIHAKDVSGGQHIENFYSQVAKLHGSVKSLPASCTSRMSMKPELCFFPQYVVQTMQTPIF  264

Query  475   IMVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRET-D  323
              + + YDS+ I + L+    ++ K+        K  +  Q K +++ R Q L AL    +
Sbjct  265   FINAAYDSWQIKNILAPTAADSGKAWKSCKLDLKKCTPGQLKIIQDFRAQFLSALTGAGN  324

Query  322   SPSRGLFVSNCFGHTQL---IFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTLV  152
             S SRG+F+ +C+ H Q    I + ++    V   K  + V DWY++R + VQ++      
Sbjct  325   SSSRGMFIDSCYAHCQAGKQITWSSNNSPAVGNTKIAKAVGDWYYER-SPVQKI------  377

Query  151   KDCP  140
              DCP
Sbjct  378   -DCP  380



>ref|XP_004509522.1| PREDICTED: uncharacterized protein LOC101493258 isoform X1 [Cicer 
arietinum]
 ref|XP_004509523.1| PREDICTED: uncharacterized protein LOC101493258 isoform X2 [Cicer 
arietinum]
Length=400

 Score =   270 bits (689),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 142/346 (41%), Positives = 202/346 (58%), Gaps = 17/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T ++SAV+ GAVCLDGSPPAY F KG+G G   WIV+  GG WC+++S C +R+ + LGS
Sbjct  31    TYVQSAVAKGAVCLDGSPPAYHFDKGVGAGIDNWIVHFEGGGWCNNVSTCLDRRDTRLGS  90

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +    D   +F G        N +F +WN++ V YCDG+SFTGDVE V+P T LHFRG
Sbjct  91    SKKM---DKQLSFSGFFSNGKKFNPDFYDWNRIKVRYCDGASFTGDVEAVDPATNLHFRG  147

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RIF AV+EDLL  KGM++A +  L+G SAGGL  I+ CDRF      +  VKC+S+ G+
Sbjct  148   ARIFVAVIEDLLA-KGMKNAKNAILSGCSAGGLTSILQCDRFKTLLPAAAKVKCVSDAGY  206

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F++ K  + AQ +E  +  ++  H S   LP+ C        LC FPQ+VA  I+TP+F 
Sbjct  207   FINVKAVSGAQHIEQFYSQVVQTHGSAKNLPQSCTSRLSPG-LCFFPQNVAAQIKTPIFF  265

Query  472   MVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALRE-TDS  320
             + + YDS+ I + L+ G  +         +   + S  Q   ++  R Q L A+   ++S
Sbjct  266   VNAAYDSWQIKNILAPGVADPHGTWRNCKLDINNCSPNQLTTMQGFRTQFLQAISGLSNS  325

Query  319   PSRGLFVSNCFGHTQ--LIFYWNHPGFEVNYRKDV-EVVRDWYFDR  191
             PS+GLF+  C+ H Q  +   W      V     + + V DWY+DR
Sbjct  326   PSKGLFIDGCYAHCQTGMQETWMRSDSPVLANTTIAKAVGDWYYDR  371



>gb|EYU29129.1| hypothetical protein MIMGU_mgv1a023759mg [Erythranthe guttata]
Length=384

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 147/366 (40%), Positives = 217/366 (59%), Gaps = 23/366 (6%)
 Frame = -3

Query  1252  LIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLG  1073
             +I+VL    +T +SY   + T +ESAV+ GAVCLDGSPPAY   KG G+G   W+++L G
Sbjct  1     MIIVL----RTESSY--VDITYVESAVAKGAVCLDGSPPAYHLDKGSGDGTNNWLIHLEG  54

Query  1072  GEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDG  893
             G WC++++ C +R   HLGSS       +   F GI + +   N +F NWN+VVV YCDG
Sbjct  55    GGWCNNVTTCISRANGHLGSSKHM---SNRTMFFGIANNDPQFNPDFYNWNRVVVRYCDG  111

Query  892   SSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCD  713
             +SFTGD+E V+P T L++RG R+F AV+EDLL +KGM++A +V LTG SAGGLA ++HCD
Sbjct  112   ASFTGDIEAVDPATNLYYRGARVFVAVMEDLL-DKGMKNAKNVILTGCSAGGLASMLHCD  170

Query  712   RFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQL  533
             RF +     T VKC+++ GFFL+ K  +  +  E     +++ H S   LP  C    + 
Sbjct  171   RFKDLLPMGTNVKCMADAGFFLNVKDVSGNRRFEDFINDVVETHGSAKNLPLSCTSKMKP  230

Query  532   AYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKHISATQYKALKELRL  353
               LC FPQ V ++I+TPLFI+ + YD++ I + L+    +     +   T  +     +L
Sbjct  231   G-LCFFPQQVVQEIQTPLFIVNAAYDAWQIKNVLAPAIADPSGIWYNCTTDIRNCSTAQL  289

Query  352   QMLVALRET---------DSPSRGLFVSNCFGH--TQLIFYWNHPGF-EVNYRKDVEVVR  209
             Q L   R+           S +RG F+++CF H  T++   W  P   ++N +   + V 
Sbjct  290   QTLHGFRKEFLNEFSAIGTSITRGYFINSCFAHCQTEMQITWFKPNSPKLNNKTIAKAVG  349

Query  208   DWYFDR  191
             DW+FDR
Sbjct  350   DWFFDR  355



>ref|XP_009128780.1| PREDICTED: uncharacterized protein LOC103853624 [Brassica rapa]
Length=391

 Score =   269 bits (687),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 142/346 (41%), Positives = 203/346 (59%), Gaps = 17/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T LESAV+ GAVCLDGS PAY F KG G G   WIV++ GG WC+ I+ C  RKT+  GS
Sbjct  27    TYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVKRKTTMKGS  86

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S    + +  F F GIL    + N +F NWN++ V YCDGSSFTGD+E V+PT  L FRG
Sbjct  87    SK---FMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAVDPTNKLFFRG  143

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R++ AV++DL+  KGM +A +  L+G SAG LA I+HCD+F +    +  VKC+S+ GF
Sbjct  144   ARVWRAVIDDLMA-KGMSNAQNAILSGCSAGALAAILHCDQFKSILPTTAKVKCVSDAGF  202

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+H K  +    +ES +  ++  H S   LP  C  + +   LC FPQ+V K ++TPLF+
Sbjct  203   FIHGKDISGGSYIESYYSKVVSTHGSAKSLPASCTSSMK-PELCFFPQYVVKTMQTPLFV  261

Query  472   MVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRETDS-  320
             + + +DS+ I + L+    +  K         K  +A Q + ++  R QML AL    + 
Sbjct  262   INAAFDSWQIKNVLAPTSVDKRKEWKDCKLDLKKCTAAQLQTVQGYRDQMLAALAPVQAT  321

Query  319   PSRGLFVSNCFGHTQ---LIFYWNHPGFEVNYRKDVEVVRDWYFDR  191
              +RGLF+ +C  H Q      +    G +V   K  + V DW+++R
Sbjct  322   TTRGLFLDSCHAHCQGGSAATWSGAQGPQVGNTKMAKAVGDWFYER  367



>ref|XP_010676220.1| PREDICTED: uncharacterized protein LOC104892094 [Beta vulgaris 
subsp. vulgaris]
Length=439

 Score =   270 bits (690),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 152/372 (41%), Positives = 220/372 (59%), Gaps = 19/372 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T + SAV+ GAVCLDGS PAY   +G G G   W+V++ GG WC++I+ C  RK SHLGS
Sbjct  30    TKVRSAVAKGAVCLDGSAPAYHLHRGHGTGINSWLVHVEGGGWCNNITTCLERKYSHLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +    D    F GIL  N   N +F NWN+V + YCDG+SFTG+VE VNP T LHFRG
Sbjct  90    SWKM---DKQLAFSGILSNNPMFNPDFYNWNRVKIRYCDGASFTGNVEAVNPITKLHFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RI+ AV+EDLL+ KGM++A +  L+G SAGGL  I+HCD F         VKCLS+ G+
Sbjct  147   ARIWHAVIEDLLL-KGMRNAKNAILSGCSAGGLTSILHCDSFRALLPVGARVKCLSDAGY  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F++ K  + A  + S F  I++LH S   LP  C ++ +   +C FPQ++AK  RTPLFI
Sbjct  206   FINVKDVSGASHVASYFNQIVNLHGSAKSLPASCTRSLK-PVMCFFPQYMAKRTRTPLFI  264

Query  472   MVSTYDSYLINHTLST------GFYEAVK--SKHISATQYKALKELRLQMLVALRET-DS  320
             + + YDS+ I + L+       G +   K   K+ S  Q   +++ R + L A+ +   S
Sbjct  265   LNAAYDSWQIKNILAPVVADPRGLWSDCKIDIKNCSTNQLSVMQDFRSEFLNAISKLGKS  324

Query  319   PSRGLFVSNCFGHTQLIF---YWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTLVK  149
             PSRGLF+++C+ H Q      +++H    ++     + V DW+++R   +Q ++ +    
Sbjct  325   PSRGLFINSCYAHCQTEMQETWFSHHSPVLHKTTIAKAVGDWFYNR-RQLQMIDCAYPCD  383

Query  148   -DCPNNTFIEEE  116
               C N  F  +E
Sbjct  384   GSCQNRIFEPQE  395



>ref|XP_009592441.1| PREDICTED: uncharacterized protein LOC104089292 [Nicotiana tomentosiformis]
Length=394

 Score =   268 bits (686),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 151/365 (41%), Positives = 209/365 (57%), Gaps = 25/365 (7%)
 Frame = -3

Query  1198  NSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHL  1019
             N TILESAV+ GAVCLDG+PPAY   +G G G   W++ + GG WC +I+ C  RK S L
Sbjct  26    NITILESAVATGAVCLDGTPPAYHLDRGSGTGLNNWVISIEGGGWCQNITHCLERKNSRL  85

Query  1018  GSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHF  839
             GSS +         F GI+  +   N EF NWN+V V YCDG SFTGDVE V+P TGLH+
Sbjct  86    GSSAKM---GKQVAFSGIMSNDPKFNPEFYNWNRVSVRYCDGGSFTGDVEAVDPATGLHY  142

Query  838   RGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNG  659
             RG RIF A++ DLL ++GM  A +  L+G SAGGLA I+HCD F      S  VKC S+ 
Sbjct  143   RGARIFKAIMADLL-SQGMSTAENAILSGCSAGGLASILHCDNFRALLPKSARVKCFSDA  201

Query  658   GFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPL  479
             G+F++ K  +    +E  F  ++ LH S   LP  C    + + LC FPQ+VA  ++TPL
Sbjct  202   GYFVNLKDISGEAYIEEYFNDVVTLHGSAKNLPPSCTSKLKPS-LCFFPQNVAHQLQTPL  260

Query  478   FIMVSTYDSYLINHTL------STGFYEAVKS--KHISATQYKALKELRLQMLVALRET-  326
             FI+ + YD + + + L       TG +   K+  ++ + ++ K L+  RL  L  L    
Sbjct  261   FIINAAYDHWQVRNILVPSTADPTGAWTNCKADMRNCTLSELKVLQGFRLNFLKVLEGLG  320

Query  325   DSPSRGLFVSNCFGH--TQLIFYWNHPGFEVNYRKDV-EVVRDWYFDRINHVQEVEQSTL  155
              S +RG ++++CF H  TQ   YW  P     + K + E   DW+++R N  QE+     
Sbjct  321   PSSTRGYYINSCFSHCQTQQQAYWFGPNSPRLFNKTIAEATGDWFWER-NQFQEI-----  374

Query  154   VKDCP  140
               DCP
Sbjct  375   --DCP  377



>emb|CDP15690.1| unnamed protein product [Coffea canephora]
Length=399

 Score =   268 bits (686),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 143/351 (41%), Positives = 205/351 (58%), Gaps = 17/351 (5%)
 Frame = -3

Query  1207  FTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKT  1028
             F  + T +ESAV+ GAVCLDGSPPAY   +G G G   W+V++ GG WC++++ C +RK 
Sbjct  25    FFVDITYVESAVAKGAVCLDGSPPAYHLDRGFGAGINSWLVHIEGGGWCNNVTTCLDRKN  84

Query  1027  SHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTG  848
             + LGSS +         F GIL      N +F NWN+V V YCDGSSFTGDVE VNP T 
Sbjct  85    TRLGSSKQMA---KQLAFSGILANKPKFNPDFYNWNRVKVRYCDGSSFTGDVEAVNPATN  141

Query  847   LHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCL  668
             LH+RG R+F AV+EDLL  KGM++A    L+G SAGGL  I+HCD F       T VKC 
Sbjct  142   LHYRGARVFVAVIEDLLA-KGMRNAESAVLSGCSAGGLTSILHCDSFKALLPLGTKVKCF  200

Query  667   SNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIR  488
             ++ G+F+++K  +  Q +E+ +  +++ H S   LP  C    +   LC FPQ++A++IR
Sbjct  201   ADAGYFINAKDVSGVQHIEAFYNDVVNTHGSAKNLPATCTSRMKPG-LCFFPQYMAQEIR  259

Query  487   TPLFIMVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALR  332
             TPLFI  + YDS+ I + L+ G  +         +     SA+Q + ++  RL+ L A+ 
Sbjct  260   TPLFITNAAYDSWQIKNILAPGVADPHGLWHNCKLDITRCSASQLQIIQGFRLEFLSAVN  319

Query  331   ETD-SPSRGLFVSNCFGHTQLIF---YWNHPGFEVNYRKDVEVVRDWYFDR  191
                 S SRG F++ C+ H Q      +       +N +   + V DW++DR
Sbjct  320   GLGTSSSRGYFINGCYAHCQTEMQETWLRDDSPRLNDKTIAKAVGDWFYDR  370



>ref|XP_009108427.1| PREDICTED: protein notum homolog [Brassica rapa]
Length=397

 Score =   268 bits (686),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 150/366 (41%), Positives = 217/366 (59%), Gaps = 27/366 (7%)
 Frame = -3

Query  1198  NSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHL  1019
             N T + +AV+ GAVCLDGSPPAY   +G G G   W++ L GG WC +++ C +R  + L
Sbjct  26    NITFVRNAVAKGAVCLDGSPPAYHIDRGSGTGINSWLIQLEGGGWCHNVTNCISRMHTKL  85

Query  1018  GSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHF  839
             GSS +   N     F  IL      N +F NWN+V V YCDGSSFTGDV+TVNP T LHF
Sbjct  86    GSSKKMVEN---LAFSAILSNKEQRNPDFYNWNRVKVRYCDGSSFTGDVKTVNPATNLHF  142

Query  838   RGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNG  659
             RG R++ AV+++LL  KGM++A +  L+G SAGGLA ++HCD F       T VKCLS+ 
Sbjct  143   RGARVWLAVMQELLA-KGMRNAENAVLSGCSAGGLASLMHCDSFRALLPMGTNVKCLSDA  201

Query  658   GFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPL  479
             GFFL+++  + AQ ++S F  ++ LH S   LP  C      A +C FPQ+VA+ IRTP+
Sbjct  202   GFFLNTRDVSGAQYIKSYFNDVVTLHGSAKNLPRSCTSRLNPA-MCFFPQYVARQIRTPV  260

Query  478   FIMVSTYDSYLINHTLST------GFYEAVK--SKHISATQYKALKELRLQMLVA-LRET  326
             F++ + YDS+ I + L+       G +++ +   K+   +Q K +++ RL+ L A +   
Sbjct  261   FVLNAAYDSWQIKNILAPRAADPEGKWQSCQLDIKNCQRSQLKVMQDFRLEFLSAVIGLG  320

Query  325   DSPSRGLFVSNCFGH----TQLIFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQST  158
              S SRG+F+ +C+ H    TQ  ++W      +N     + V DW +DR N  Q++    
Sbjct  321   RSASRGMFIDSCYTHCQTETQTSWFWQDSPI-LNRTTIAKAVGDWVYDR-NLFQKI----  374

Query  157   LVKDCP  140
                DCP
Sbjct  375   ---DCP  377



>emb|CDX87799.1| BnaC02g31500D [Brassica napus]
Length=391

 Score =   268 bits (685),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 147/378 (39%), Positives = 213/378 (56%), Gaps = 25/378 (7%)
 Frame = -3

Query  1288  KMGTLLNTTFILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIG  1109
             ++  L ++  +L IVV+               T LESAV+ GAVCLDGS PAY F KG G
Sbjct  3     RLKQLWSSIMVLAIVVIGAG--------AVPITYLESAVAKGAVCLDGSAPAYHFDKGSG  54

Query  1108  EGRQRWIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFC  929
              G   WIV++ GG WC+ I+ C  RKT+  GSS    + +  F F GIL    + N +F 
Sbjct  55    SGVNNWIVHMEGGGWCTDIATCVKRKTTMKGSSK---FMNKDFGFSGILGGKQSTNPDFY  111

Query  928   NWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGG  749
             NWN++ V YCDGSSFTGD+E V+PT  L FRG R++ AV++DL+  KGM +A +  L+G 
Sbjct  112   NWNRIKVRYCDGSSFTGDIEAVDPTNKLFFRGARVWRAVIDDLMA-KGMSNAQNAILSGC  170

Query  748   SAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTA  569
             SAG LA I+HCD F +    +  VKC+S+ GFF+H K  +    +ES +  ++  H S  
Sbjct  171   SAGALAAILHCDEFKSILPTTAKVKCVSDAGFFIHGKDISGGSYIESYYSKVVSTHGSAK  230

Query  568   VLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKS----  401
              LP  C  + +   LC FPQ+V K ++TPLF++ + +DS+ I + L+    +  K     
Sbjct  231   SLPASCTSSMK-PELCFFPQYVVKTMQTPLFVINAAFDSWQIKNVLAPTSVDKRKEWKDC  289

Query  400   ----KHISATQYKALKELRLQMLVALRET-DSPSRGLFVSNCFGHTQ---LIFYWNHPGF  245
                 K  +A Q + ++  R QML AL     + +RGLF+ +C  H Q      +    G 
Sbjct  290   KLDLKKCTAAQLQTVQGYRDQMLAALAPVRATTTRGLFLDSCHAHCQGGSAATWSGAQGP  349

Query  244   EVNYRKDVEVVRDWYFDR  191
             +V   K  + V DW+++R
Sbjct  350   QVGNTKMAKAVGDWFYER  367



>ref|XP_006355154.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=409

 Score =   269 bits (687),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 140/356 (39%), Positives = 209/356 (59%), Gaps = 21/356 (6%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             TI+++AVS GAVCLDGSPPAY F  G G+G Q W+V L GGEWC ++  C  R  S  GS
Sbjct  42    TIVKNAVSKGAVCLDGSPPAYHFEPGFGDGAQTWLVQLSGGEWCRTVEACLERSKSEFGS  101

Query  1012  SH--RQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHF  839
             S+    +W      F G+   N + N EF NWNKV + YCDG  FTGDVE V+P T LHF
Sbjct  102   SNLMNSWW------FTGMFSKNQSGNPEFYNWNKVFIRYCDGGGFTGDVEYVDPATKLHF  155

Query  838   RGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNG  659
             RG RIF AV+++LL  KG++ A    L G SAGG   +++CD F     N+  VKC+++ 
Sbjct  156   RGARIFKAVMDELL-EKGLKTAKSALLGGSSAGGFPAMLYCDYFRTLLPNTPRVKCMNDA  214

Query  658   GFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPL  479
             G+F+++K P +A +    +  ++ LH S   LP+ C        LC FP+++ + ++TPL
Sbjct  215   GYFINAKEPFRA-NFTELYTALVTLHGSAKALPKECTSKMS-PELCFFPENMQQYVKTPL  272

Query  478   FIMVSTYDSYLINHTLSTGFYEAVKSKHISATQYKALKELRLQMLVALRETDSPS-RGLF  302
             FI  S YD Y IN++++ G    + S + +AT  +   E R + L AL +  +P  +G+F
Sbjct  273   FIASSAYDKYQINNSIAVGINTCIGSSNCTATTNQTFLEFRSRFLNALPKPTNPKLKGVF  332

Query  301   VSNCFGHTQLIFYWNHPGFEVNYRKDVEVVR---DWYFDR----INHVQEVEQSTL  155
             + +   H+Q+ F+W+   F +    ++ + +   DW++DR    + H  E+  S L
Sbjct  333   IDSFNHHSQVQFWWSP--FNITTINNLTLSKAFADWFYDRNYTYVIHEHELPISAL  386



>ref|XP_007209217.1| hypothetical protein PRUPE_ppa006718mg [Prunus persica]
 gb|EMJ10416.1| hypothetical protein PRUPE_ppa006718mg [Prunus persica]
 gb|AIA21744.1| pectin acetylesterase [Prunus persica]
Length=398

 Score =   268 bits (685),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 145/371 (39%), Positives = 216/371 (58%), Gaps = 17/371 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T++E+AV+ GAVCLDGS PAY F KG G G   W+V++ GG WC+S+  C +RK ++ GS
Sbjct  30    TLVENAVAKGAVCLDGSAPAYHFDKGFGAGINNWLVHVEGGGWCNSVETCLDRKNTYRGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S++    + + +F G+L      N +F NWN++ V YCDGSSFTGDVE VNP T LHFRG
Sbjct  90    SNKM---EKSMSFSGVLGNKQKFNPDFYNWNRIKVRYCDGSSFTGDVEAVNPATNLHFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R+F A+++DLL  KGM++A    L+G SAGGLA I++CD F +     T VKCL++ G+
Sbjct  147   ARVFRAIIDDLLA-KGMKNAQSALLSGCSAGGLASILNCDNFRSLLPVGTKVKCLADAGY  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+++K  + +Q +++ +  ++ LH S   LP  C        LC FPQ+V    RTP+F+
Sbjct  206   FINAKTVSGSQQIQAFYSEVVALHGSAKNLPASCTSKLSPG-LCFFPQNVVPVTRTPIFL  264

Query  472   MVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALR-ETDS  320
             + + YDS+ I + L+ G  +   +        K+ S +Q + ++E RLQ L AL   + S
Sbjct  265   VNAAYDSWQIKNILAPGIADPKGAWKKCKLDIKNCSPSQLQTMQEYRLQFLGALSHASSS  324

Query  319   PSRGLFVSNCFGHTQLIFY--WNHPGFEVNYRKDV-EVVRDWYFDRINHVQEVEQSTLVK  149
              + GLF+ +C+ H Q+     W      V  +  + + V DWY DR    +         
Sbjct  325   TTHGLFIDSCYAHCQIGTQETWLAADSPVLSKTTIGKAVGDWYTDRTPFQKIDCAYPCNP  384

Query  148   DCPNNTFIEEE  116
              C N  F  +E
Sbjct  385   TCKNRVFDSDE  395



>emb|CDY09289.1| BnaC03g63190D [Brassica napus]
Length=397

 Score =   268 bits (684),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 150/366 (41%), Positives = 216/366 (59%), Gaps = 27/366 (7%)
 Frame = -3

Query  1198  NSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHL  1019
             N T + +AV+ GAVCLDGSPPAY   +G G G   W++ L GG WC +++ C +R  + L
Sbjct  26    NITFVRNAVAKGAVCLDGSPPAYHLDRGSGTGINSWLIQLEGGGWCHNVTNCISRMHTKL  85

Query  1018  GSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHF  839
             GSS +   N     F  IL      N +F NWN+V V YCDGSSFTGDV+TVNP T LHF
Sbjct  86    GSSKKMVEN---LAFSAILSNKEQRNPDFYNWNRVKVRYCDGSSFTGDVKTVNPATNLHF  142

Query  838   RGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNG  659
             RG R++ AV+ +LL  KGM++A +  L+G SAGGLA ++HCD F       T VKCLS+ 
Sbjct  143   RGARVWLAVMRELLA-KGMRNAENAVLSGCSAGGLASLMHCDSFRALLPMGTNVKCLSDA  201

Query  658   GFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPL  479
             GFFL+++  + AQ ++S F  ++ LH S   LP  C      A +C FPQ+VA+ IRTP+
Sbjct  202   GFFLNTRDVSGAQYIKSYFNDVVTLHGSAKNLPRSCTSRLTPA-MCFFPQYVARQIRTPV  260

Query  478   FIMVSTYDSYLINHTLST------GFYEAVK--SKHISATQYKALKELRLQMLVA-LRET  326
             F++ + YDS+ I + L+       G +++ +   K+   +Q K +++ RL+ L A +   
Sbjct  261   FVLNAAYDSWQIKNILAPRAADPDGKWQSCQLDIKNCQRSQLKVMQDFRLEFLSAVIGLG  320

Query  325   DSPSRGLFVSNCFGH----TQLIFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQST  158
              S SRG+F+ +C+ H    TQ  ++W      +N     + V DW +DR N  Q++    
Sbjct  321   RSASRGMFIDSCYTHCQTETQTSWFWQDSPI-LNRTTIAKAVGDWVYDR-NLFQKI----  374

Query  157   LVKDCP  140
                DCP
Sbjct  375   ---DCP  377



>ref|XP_009601364.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=392

 Score =   267 bits (683),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 150/383 (39%), Positives = 221/383 (58%), Gaps = 18/383 (5%)
 Frame = -3

Query  1261  FILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVY  1082
             F+L+  V+  + +   +      T+++ A S GAVCLDGSP AY + KG G+G   W+V+
Sbjct  14    FLLICSVMKVKAEVLPN--KVAKTLVQDAFSKGAVCLDGSPAAYHYDKGYGDGVNNWVVW  71

Query  1081  LLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHY  902
             L GG WC  + +C  R     G S+     DS  +F G+L  +   N EF NW+++++ Y
Sbjct  72    LEGGGWCKRVEDCGRRFNYSNGFSNHM---DSK-SFYGLLSNSKTSNPEFYNWHRIMIRY  127

Query  901   CDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVII  722
             CDGSS+TGDVE V+  T  H+RG RIF A++E+LL  KGM++A +  L+G SAGGL  + 
Sbjct  128   CDGSSYTGDVELVDKATNQHYRGARIFQAIMEELLA-KGMKNAKNAILSGCSAGGLGTMF  186

Query  721   HCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKN  542
             HCDRF +   ++  VKCLS+G +FL      +A+ LES +RG+++LHNS  +LP  C   
Sbjct  187   HCDRFRSLLPSTVRVKCLSDGAYFLLDNDFKRAKILESTYRGVVNLHNSAKMLPPSCTSR  246

Query  541   HQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTL-----STGFYEAVKS--KHISAT  383
                   C FPQH+ +DI+TPLFI+ S YDS+ I  T+        F E  K      S  
Sbjct  247   MNPTS-CFFPQHIQQDIKTPLFILNSAYDSWQIVDTVIPFADRQDFAENCKKNLSKCSPD  305

Query  382   QYKALKELRLQMLVALRETDSPS-RGLFVSNCFGHTQL--IFYWNHPGFEVNYRKDVEVV  212
             Q K L+    + L AL ++ SPS RG+++++C  H Q    + WN     +N +   +V 
Sbjct  306   QQKMLQGFGAEFLSALPKSYSPSQRGMYINSCLMHCQTDHDWSWNSNSDLLNNKTIAKVF  365

Query  211   RDWYFDRINHVQEVEQSTLVKDC  143
              DW+F+R    + V+Q  L + C
Sbjct  366   GDWFFERDPSREMVKQQDLPQIC  388



>ref|XP_010266384.1| PREDICTED: uncharacterized protein LOC104603916 isoform X2 [Nelumbo 
nucifera]
 ref|XP_010266385.1| PREDICTED: uncharacterized protein LOC104603916 isoform X2 [Nelumbo 
nucifera]
Length=391

 Score =   267 bits (682),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 144/366 (39%), Positives = 214/366 (58%), Gaps = 16/366 (4%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T ++S+V+ GAVCLDGSPPAY   KG G G   W+V++ GG WC++++ C  RK +HLGS
Sbjct  28    TYIKSSVAKGAVCLDGSPPAYHLDKGFGSGINNWLVHIEGGGWCTNVTTCLFRKNTHLGS  87

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +     +   F GIL  N   N +F NWN++ V YCDG+SFTGD+E V+P T LH+RG
Sbjct  88    SKKMV---TEIAFSGILSNNKQFNPDFYNWNRIKVRYCDGASFTGDLEKVDPVTNLHYRG  144

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RI+ AV+EDLL  KGM++A +  L+G SAGGLA I+HCD F       T VKCL++ G+
Sbjct  145   ARIWLAVIEDLL-KKGMKNAEYALLSGCSAGGLASILHCDSFHALLSIGTKVKCLADAGY  203

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F++ K  +  + ++S F  ++  H S   LP  C    + + +C FPQ++   IRTPLF+
Sbjct  204   FVNLKEISGREHIKSYFNDVVTTHGSVKNLPTYCTSTMKPS-MCFFPQYIVHGIRTPLFL  262

Query  472   MVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALRETDSP  317
             + + YDS+ I + L  G  +         +  K+ S+ Q + ++  R++ L AL    S 
Sbjct  263   LNAAYDSWQIRNILVPGVADPHGYWLSCKLDIKNCSSIQLQTMQGFRMEFLSALLGQRSS  322

Query  316   SRGLFVSNCFGHTQ--LIFYWNHPGFEV-NYRKDVEVVRDWYFDRINHVQEVEQSTLVKD  146
             SRG+F+++C+ H Q  +   W      V +     + V DWY+DR +  +        K 
Sbjct  323   SRGMFINSCYAHCQSEMQETWLQDDSPVLDNTPIAKAVGDWYYDRRSFQKIDCPYPCDKS  382

Query  145   CPNNTF  128
             C N+ F
Sbjct  383   CHNHVF  388



>ref|XP_006471634.1| PREDICTED: uncharacterized protein LOC102628021 [Citrus sinensis]
 gb|KDO40413.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=399

 Score =   267 bits (682),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 150/378 (40%), Positives = 210/378 (56%), Gaps = 24/378 (6%)
 Frame = -3

Query  1288  KMGTLLNTTFILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIG  1109
             +MG  LN     LI++           F    T +E+AV  GAVCLDGSPPAY F KG G
Sbjct  5     RMGQWLNLLVCALILLKADG-------FNVGITYVENAVVKGAVCLDGSPPAYHFDKGFG  57

Query  1108  EGRQRWIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFC  929
              G   W+V++ GG WC++++ C  RK + LGSS +         F G+L      N +F 
Sbjct  58    AGINNWLVHIEGGGWCNNVTTCLERKKTRLGSSKQMV---KVVAFSGMLSNKQKFNPDFY  114

Query  928   NWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGG  749
             NWN++ V YCDG+SFTGDVE VNP   LHFRG R+F AV+EDL+  KGM++A +  L+G 
Sbjct  115   NWNRIKVRYCDGASFTGDVEAVNPANNLHFRGARVFQAVMEDLMA-KGMKNAQNAVLSGC  173

Query  748   SAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTA  569
             SAGGL  I+HCD F   F   T VKC ++ G+F+++K  + A  +E  +  ++  H S  
Sbjct  174   SAGGLTSILHCDNFRALFPVGTKVKCFADAGYFINAKDVSGASHIEQFYAQVVATHGSAK  233

Query  568   VLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKH--  395
              LP  C        LC FPQ++A+ I TPLFI+ + YDS+ I + L+ G  +   + H  
Sbjct  234   HLPASCTSRLSPG-LCFFPQYMARQITTPLFIINAAYDSWQIKNILAPGVADPHGTWHSC  292

Query  394   ------ISATQYKALKELRLQMLVALRETD-SPSRGLFVSNCFGH--TQLIFYWNHPGFE  242
                    S TQ + ++  R Q L AL     S SRG+F+  C+ H  T++   W      
Sbjct  293   KLDINNCSPTQLQTMQSFRTQFLNALAGLGISSSRGMFIDACYAHCQTEMQETWLRTDSP  352

Query  241   VNYRKDV-EVVRDWYFDR  191
             V  +  + + V DWY+DR
Sbjct  353   VLGKMSIAKAVGDWYYDR  370



>ref|XP_009132797.1| PREDICTED: protein notum homolog [Brassica rapa]
Length=397

 Score =   266 bits (681),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 150/368 (41%), Positives = 217/368 (59%), Gaps = 20/368 (5%)
 Frame = -3

Query  1255  LLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLL  1076
             L++VV       A   F  N T + +AV+ GAVCLDGSPPAY   +G G G   W++ L 
Sbjct  8     LVLVVCSLAILKAEGLFV-NITFVRNAVARGAVCLDGSPPAYHLHRGSGTGINSWLIQLE  66

Query  1075  GGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCD  896
             GG WC++++ C +R  + LGSS +   N     F  IL      N +F NWN+V V YCD
Sbjct  67    GGGWCNNVTNCLSRMHTRLGSSKKMVEN---LAFSAILSNKKQYNPDFYNWNRVKVRYCD  123

Query  895   GSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHC  716
             GSSFTGDV+ VNP T LHFRG R++ AV+++LL  KGM++A +  L+G SAGGLA ++HC
Sbjct  124   GSSFTGDVQAVNPATNLHFRGARVWLAVMQELLA-KGMRNAENAVLSGCSAGGLASLMHC  182

Query  715   DRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQ  536
             D F       T VKCLS+ GFFL+++  + AQ ++S F+ ++ LH S   LP  C     
Sbjct  183   DSFRALLPMGTKVKCLSDAGFFLNTRDVSGAQYIKSYFKDVVALHGSAKNLPRTCTSRLT  242

Query  535   LAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLST------GFYEAVK--SKHISATQ  380
              A +C FPQ+VA+ IRTP+FI+ + YDS+ I + L+       G +++ +   K+    Q
Sbjct  243   PA-MCFFPQYVARQIRTPVFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIKNCQPNQ  301

Query  379   YKALKELRLQMLVA-LRETDSPSRGLFVSNCFGH----TQLIFYWNHPGFEVNYRKDVEV  215
              K +++ RL+ L A +    S SRG+F+ +C+ H    TQ  ++W      +N     + 
Sbjct  302   LKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFWQDSPI-LNRTTIAKA  360

Query  214   VRDWYFDR  191
             V DW +DR
Sbjct  361   VGDWVYDR  368



>ref|XP_011073252.1| PREDICTED: protein notum homolog isoform X2 [Sesamum indicum]
Length=398

 Score =   266 bits (681),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 153/394 (39%), Positives = 224/394 (57%), Gaps = 25/394 (6%)
 Frame = -3

Query  1258  ILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYL  1079
             + L++VL  +       F  + T ++SAV+ GAVCLDGSPPAY   KG G G   W+V++
Sbjct  13    VCLMIVLRTES------FFVDITYVQSAVAKGAVCLDGSPPAYHIDKGSGAGINNWLVHV  66

Query  1078  LGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYC  899
              GG WC++++ C  R  + LGSS           F GI       N +F NWN++ V YC
Sbjct  67    EGGGWCNNVTTCLARTKTRLGSSKLM---AKQIAFSGIFSNKPQFNPDFYNWNRIKVRYC  123

Query  898   DGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIH  719
             DG+SFTGDVE V+P T L++RG R+F AV+EDLL  KGM++A +  L+G SAGGL  I+H
Sbjct  124   DGASFTGDVEVVDPATKLYYRGARVFVAVIEDLLA-KGMKNAENAILSGCSAGGLTSILH  182

Query  718   CDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNH  539
             CD F       T VKC S+ GFF+++K  + A  ++  +  ++  H S   LP+ C    
Sbjct  183   CDNFKALLPVGTKVKCFSDAGFFINAKDVSGAPHIQDFYNDVVTTHGSAKNLPQSCTSRM  242

Query  538   QLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKH--------ISAT  383
             + + LC FPQ++A+ IRTPLFI+ + YDS+ I + L+ G  +     H         S T
Sbjct  243   KPS-LCFFPQNMAQGIRTPLFIVNAAYDSWQIKNILAPGVADPHGLWHDCKTDIVKCSTT  301

Query  382   QYKALKELRLQMLVALRET-DSPSRGLFVSNCFGH--TQLIFYWNHPGFEVNYRKDV-EV  215
             Q + ++E RLQ L AL     S SRG F++ C+ H  T++   W      + Y K + + 
Sbjct  302   QLQTMQEFRLQFLNALSGLGSSTSRGYFINGCYAHCQTEMQETWFRGDSPLLYNKTIAKA  361

Query  214   VRDWYFDRINHVQEVE-QSTLVKDCPNNTFIEEE  116
             V DW++DR +  Q+++      K C N  F ++E
Sbjct  362   VGDWFYDR-SPFQKIDCPYPCDKTCHNRVFDQQE  394



>ref|XP_006413980.1| hypothetical protein EUTSA_v10025385mg [Eutrema salsugineum]
 gb|ESQ55433.1| hypothetical protein EUTSA_v10025385mg [Eutrema salsugineum]
Length=397

 Score =   266 bits (681),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 146/349 (42%), Positives = 206/349 (59%), Gaps = 19/349 (5%)
 Frame = -3

Query  1198  NSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHL  1019
             N T + +AV+ GAVCLDGSPPAY   +G G G   W++ L GG WC++++ C +R  + L
Sbjct  26    NITFVRNAVAKGAVCLDGSPPAYHLDRGFGTGINSWLIQLEGGGWCNNVTNCVSRMHTRL  85

Query  1018  GSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHF  839
             GSS R         F  IL      N +F NWN+V V YCDGSSFTGDV+ VNP T LHF
Sbjct  86    GSSKRMV---EKLAFSAILSNKRQYNPDFYNWNRVKVRYCDGSSFTGDVQAVNPATNLHF  142

Query  838   RGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNG  659
             RG R++ AV+++LL  KGM +A +  L+G SAGGLA ++HCD F         VKCLS+ 
Sbjct  143   RGARVWLAVMQELLA-KGMINAENAVLSGCSAGGLATLMHCDSFRALLPMGAKVKCLSDA  201

Query  658   GFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPL  479
             GFFL+++  A AQ ++S F  ++ LH S   LP  C      A +C FPQ+VA+ IRTPL
Sbjct  202   GFFLNTRDVAGAQYIKSYFNDVVTLHGSAKNLPRSCTSRLTPA-MCFFPQYVARQIRTPL  260

Query  478   FIMVSTYDSYLINHTLST------GFYEAVK--SKHISATQYKALKELRLQMLVA-LRET  326
             FI+ + YDS+ I + L+       G +++ +   K+    Q K +++ RL+ L A +   
Sbjct  261   FILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIKNCQPNQLKVMQDFRLEFLRAVIGLG  320

Query  325   DSPSRGLFVSNCFGH----TQLIFYWNHPGFEVNYRKDVEVVRDWYFDR  191
              S SRG+F+ +C+ H    TQ  ++W      +N     + V DW +DR
Sbjct  321   RSSSRGMFIDSCYTHCQTETQTSWFWQDSPI-LNRTTIAKAVGDWVYDR  368



>ref|XP_011082152.1| PREDICTED: protein notum homolog isoform X2 [Sesamum indicum]
Length=378

 Score =   266 bits (679),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 144/360 (40%), Positives = 208/360 (58%), Gaps = 17/360 (5%)
 Frame = -3

Query  1159  VCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAF  980
             VCLDGSPPAY   +G G G   W+V++ GG WC++++ C  RK + LGSS          
Sbjct  20    VCLDGSPPAYHLDRGYGTGINNWLVHIEGGGWCNNVTTCLARKNNRLGSSKYMV---KQL  76

Query  979   NFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDL  800
              F GIL+     N +F NWN+V V YCDG+SFTGDVE VNP T LH+RG R+F AV+EDL
Sbjct  77    AFSGILNNKANFNPDFYNWNRVKVRYCDGASFTGDVEAVNPVTKLHYRGARVFLAVMEDL  136

Query  799   LVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQ  620
             L  KGM++A +  L+G SAGGLA I+HCD F       T VKC S+ G+F+++K  + AQ
Sbjct  137   LA-KGMKNAENAVLSGCSAGGLAAILHCDSFKALLPMGTKVKCFSDAGYFINTKDVSGAQ  195

Query  619   DLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLIN  440
              +E+ +  ++  H S   LP  C    + + LC FPQ+VA++IRTPLFI+ + YDS+ I 
Sbjct  196   HIEAFYHDVVSTHGSAKNLPRSCTSRMKPS-LCFFPQYVAREIRTPLFIINAAYDSWQIK  254

Query  439   HTLSTGFYEAVKSKH--------ISATQYKALKELRLQMLVALRETD-SPSRGLFVSNCF  287
             + L+ G  +   + H         SATQ + ++  RL+ + AL     S SRG F+++C+
Sbjct  255   NILAPGVADPHGTWHNCKTDINKCSATQLQTMQGFRLEFIRALYGLGVSTSRGYFINSCY  314

Query  286   GHTQLIF---YWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTLVKDCPNNTFIEEE  116
              H Q      ++     ++N +   + V DW++DR    +        + C N  F  +E
Sbjct  315   AHCQTEMQETWYRSDSPKLNNKTIAKAVGDWFYDRSPFQKGDCPYPCDRTCHNRVFDPQE  374



>ref|XP_010529277.1| PREDICTED: protein notum homolog [Tarenaya hassleriana]
Length=401

 Score =   266 bits (681),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 150/375 (40%), Positives = 216/375 (58%), Gaps = 21/375 (6%)
 Frame = -3

Query  1198  NSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHL  1019
             N T +++A++ GAVCLDGSPPAY   KG G G   W++ L GG WC++++ C  R  + L
Sbjct  28    NITYVKTAMAKGAVCLDGSPPAYHLDKGSGTGINNWLIQLEGGGWCNNVTNCIARMHTRL  87

Query  1018  GSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHF  839
             GSS +         F  IL      N +F NWN+V + YCDGSSFTGDV+TV+P T LHF
Sbjct  88    GSSKQMA---KQIAFSAILSNRKQYNPDFYNWNRVKIRYCDGSSFTGDVQTVDPATNLHF  144

Query  838   RGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNG  659
             RG R++ AV+EDLL  KGM +A +  L+G SAGGLA ++HCD F       T VKCLS+ 
Sbjct  145   RGARVWLAVMEDLLA-KGMINAENAVLSGCSAGGLASMLHCDSFRALLPMGTKVKCLSDA  203

Query  658   GFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPL  479
             GFF++++  +  Q +   F+ ++ LH S   LP  C      A LC FPQ+VA+ IRTPL
Sbjct  204   GFFVNTRDVSGVQYIRQYFKDVVTLHGSAKNLPPSCTSKLNPA-LCFFPQYVARRIRTPL  262

Query  478   FIMVSTYDSYLINHTLS------TGFYEAVK--SKHISATQYKALKELRLQMLVALRET-  326
             F++ + YDS+ I + L+       G +++ +   K+    Q K +++ RLQ L A+    
Sbjct  263   FLLNAAYDSWQIKNILAPRAADPNGKWQSCELDIKNCQPNQIKVMQDFRLQFLSAVTGLG  322

Query  325   DSPSRGLFVSNCFGH----TQLIFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQST  158
              SPSRG+F+ +C+ H    TQ  ++W      +N       V DW +DR    Q+++   
Sbjct  323   KSPSRGMFIVSCYTHCQTETQTSWFWTDSP-RLNRTTIARAVGDWVYDR-KLFQKIDCPY  380

Query  157   LVKD-CPNNTFIEEE  116
                  C N  F+ +E
Sbjct  381   PCNPTCHNRVFLPQE  395



>gb|KCW72718.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
 gb|KCW72719.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
Length=403

 Score =   266 bits (680),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 143/336 (43%), Positives = 199/336 (59%), Gaps = 17/336 (5%)
 Frame = -3

Query  1162  AVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSA  983
             AVCLDGSPPAY F KG+G G   W+V   GG WC++++ C  R+ + LGSS         
Sbjct  4     AVCLDGSPPAYHFNKGLGTGANNWLVQFEGGGWCNNVTTCLARRDTRLGSSKEMV---KE  60

Query  982   FNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVED  803
               F GIL  N + N +F NWN++ V YCDG+SFTGDVE V+P T LHFRG R F A++ED
Sbjct  61    VAFSGILSNNHSFNPDFYNWNRIKVRYCDGASFTGDVEAVDPATKLHFRGARAFVAIIED  120

Query  802   LLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKA  623
             LL +KGM DA +  L+G SAGGL  I+HCDRF      S TVKC+++ G+F+++K  + A
Sbjct  121   LL-SKGMSDAENAILSGCSAGGLTSILHCDRFRALMPTSATVKCVADAGYFINAKDISGA  179

Query  622   QDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLI  443
             Q +E+ +  ++  H S   LP  C    +   LC FPQ+V K I+TPLFI+ + YD++ I
Sbjct  180   QHIETFYSEVVATHGSAKNLPTSCTSRLRPG-LCFFPQNVVKQIQTPLFILNAAYDAWQI  238

Query  442   NHTLSTGFYEAVKSKH--------ISATQYKALKELRLQMLVAL-RETDSPSRGLFVSNC  290
              + L+ G  +   + H         S  Q + +++ R Q L AL R   SPSRG+F+ +C
Sbjct  239   KNILAPGVADPHGTWHSCKLDINNCSLDQLQIMQDFRQQFLDALSRVGTSPSRGIFIDSC  298

Query  289   FGHTQ--LIFYWNHPGFEVNYRKDV-EVVRDWYFDR  191
             + H Q  +   W      V     + + V DWY+DR
Sbjct  299   YAHCQSEMQETWLRDDSPVLIETSIAKAVGDWYYDR  334



>ref|XP_010266383.1| PREDICTED: uncharacterized protein LOC104603916 isoform X1 [Nelumbo 
nucifera]
Length=434

 Score =   267 bits (683),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 144/366 (39%), Positives = 214/366 (58%), Gaps = 16/366 (4%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T ++S+V+ GAVCLDGSPPAY   KG G G   W+V++ GG WC++++ C  RK +HLGS
Sbjct  71    TYIKSSVAKGAVCLDGSPPAYHLDKGFGSGINNWLVHIEGGGWCTNVTTCLFRKNTHLGS  130

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +     +   F GIL  N   N +F NWN++ V YCDG+SFTGD+E V+P T LH+RG
Sbjct  131   SKKMV---TEIAFSGILSNNKQFNPDFYNWNRIKVRYCDGASFTGDLEKVDPVTNLHYRG  187

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RI+ AV+EDLL  KGM++A +  L+G SAGGLA I+HCD F       T VKCL++ G+
Sbjct  188   ARIWLAVIEDLL-KKGMKNAEYALLSGCSAGGLASILHCDSFHALLSIGTKVKCLADAGY  246

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F++ K  +  + ++S F  ++  H S   LP  C    + + +C FPQ++   IRTPLF+
Sbjct  247   FVNLKEISGREHIKSYFNDVVTTHGSVKNLPTYCTSTMKPS-MCFFPQYIVHGIRTPLFL  305

Query  472   MVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALRETDSP  317
             + + YDS+ I + L  G  +         +  K+ S+ Q + ++  R++ L AL    S 
Sbjct  306   LNAAYDSWQIRNILVPGVADPHGYWLSCKLDIKNCSSIQLQTMQGFRMEFLSALLGQRSS  365

Query  316   SRGLFVSNCFGHTQ--LIFYWNHPGFEV-NYRKDVEVVRDWYFDRINHVQEVEQSTLVKD  146
             SRG+F+++C+ H Q  +   W      V +     + V DWY+DR +  +        K 
Sbjct  366   SRGMFINSCYAHCQSEMQETWLQDDSPVLDNTPIAKAVGDWYYDRRSFQKIDCPYPCDKS  425

Query  145   CPNNTF  128
             C N+ F
Sbjct  426   CHNHVF  431



>emb|CDX78933.1| BnaA01g10000D [Brassica napus]
Length=452

 Score =   268 bits (684),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 151/379 (40%), Positives = 221/379 (58%), Gaps = 20/379 (5%)
 Frame = -3

Query  1288  KMGTLLNTTFILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIG  1109
             ++  + N    L++VV       A   F  N T + +AV+ GAVCLDGSPPAY   +G G
Sbjct  52    RVSKMFNFKQWLVLVVCSLAILKAEGLFV-NITFVRNAVARGAVCLDGSPPAYHLHRGSG  110

Query  1108  EGRQRWIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFC  929
              G   W++ L GG WC++++ C +R  + LGSS +   N     F  IL      N +F 
Sbjct  111   TGINSWLIQLEGGGWCNNVTNCLSRMHTRLGSSKKMVEN---LAFSAILSNKKQYNPDFY  167

Query  928   NWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGG  749
             NWN+V V YCDGSSFTGDV+ VNP T LHFRG R++ AV+++LL  KGM++A +  L+G 
Sbjct  168   NWNRVKVRYCDGSSFTGDVQAVNPATNLHFRGARVWLAVMQELLA-KGMRNAENAVLSGC  226

Query  748   SAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTA  569
             SAGGLA ++HCD F       T VKCLS+ GFFL+++  + AQ ++S F+ ++ LH S  
Sbjct  227   SAGGLASLMHCDSFRALLPMGTKVKCLSDAGFFLNTRDVSGAQYIKSYFKDVVALHGSAK  286

Query  568   VLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLST------GFYEAV  407
              LP  C      A +C FPQ+VA+ IRTP+FI+ + YDS+ I + L+       G +++ 
Sbjct  287   NLPRTCTSRLTPA-MCFFPQYVARQIRTPVFILNAAYDSWQIKNILAPRAADPYGKWQSC  345

Query  406   K--SKHISATQYKALKELRLQMLVA-LRETDSPSRGLFVSNCFGH----TQLIFYWNHPG  248
             +   K+    Q K +++ RL+ L A +    S SRG+F+ +C+ H    TQ  ++W    
Sbjct  346   QLDIKNCQPNQLKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFWQDSP  405

Query  247   FEVNYRKDVEVVRDWYFDR  191
               +N     + V DW +DR
Sbjct  406   I-LNRTTIAKAVGDWVYDR  423



>ref|XP_006359967.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=384

 Score =   265 bits (677),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 148/365 (41%), Positives = 212/365 (58%), Gaps = 18/365 (5%)
 Frame = -3

Query  1198  NSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHL  1019
             N TIL +A + GAVCLDGSPPAY F +G   G   WI+YL GG WC ++++C  R     
Sbjct  24    NITILHNATTQGAVCLDGSPPAYYFDRGFDAGVSNWIIYLQGGGWCENLNDCHYRTFQPA  83

Query  1018  GSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHF  839
             GSS           F GIL+     N +F NWN+V V+YCDGSSFTGDVE V+P   L+F
Sbjct  84    GSSKLM---QGKTQFGGILNNTPQYNPDFYNWNRVWVNYCDGSSFTGDVEDVDPGNKLYF  140

Query  838   RGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRN-STTVKCLSN  662
             RG RI  AV++DL + KG+Q+A +  L+G SAGGLA I++CD+F   F N S  VKC+++
Sbjct  141   RGARILKAVLQDLSL-KGLQNAKNAILSGSSAGGLATILNCDKFKAFFSNDSIKVKCVAS  199

Query  661   GGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTP  482
              GFF++    + A +++  ++ + DLH S   LP  C    + + LC FPQHV  ++ TP
Sbjct  200   AGFFININTISGAPNIQKMYQNVEDLHGSVKNLPMSCTSKMEPS-LCFFPQHVVPNVETP  258

Query  481   LFIMVSTYDSYLINHTLSTG------FYEAVKSKHISAT--QYKALKELRLQMLVAL-RE  329
             LFI  S YDS+ IN++L          ++  K++  S T  Q   +K+  ++ + A    
Sbjct  259   LFIFNSAYDSWQINNSLIPSDLDPQHVWDQCKNQINSCTFSQRTIIKDFGVEFMKAFGGG  318

Query  328   TDSPSRGLFVSNCFGHTQLIF--YWNHPGFEVNYRKDV-EVVRDWYFDRINHVQEVEQST  158
             T S +RG F+++C  H  +I+  YW        Y K + E V DW+FDR  + Q ++   
Sbjct  319   TPSSTRGYFITSCHIHQDIIWDKYWFDTSGPTIYNKTIAEAVGDWFFDRTGNHQHIDPYP  378

Query  157   LVKDC  143
               +DC
Sbjct  379   FARDC  383



>ref|XP_011073171.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
Length=422

 Score =   266 bits (680),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 153/394 (39%), Positives = 224/394 (57%), Gaps = 25/394 (6%)
 Frame = -3

Query  1258  ILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYL  1079
             + L++VL  +       F  + T ++SAV+ GAVCLDGSPPAY   KG G G   W+V++
Sbjct  37    VCLMIVLRTES------FFVDITYVQSAVAKGAVCLDGSPPAYHIDKGSGAGINNWLVHV  90

Query  1078  LGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYC  899
              GG WC++++ C  R  + LGSS           F GI       N +F NWN++ V YC
Sbjct  91    EGGGWCNNVTTCLARTKTRLGSSKLM---AKQIAFSGIFSNKPQFNPDFYNWNRIKVRYC  147

Query  898   DGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIH  719
             DG+SFTGDVE V+P T L++RG R+F AV+EDLL  KGM++A +  L+G SAGGL  I+H
Sbjct  148   DGASFTGDVEVVDPATKLYYRGARVFVAVIEDLLA-KGMKNAENAILSGCSAGGLTSILH  206

Query  718   CDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNH  539
             CD F       T VKC S+ GFF+++K  + A  ++  +  ++  H S   LP+ C    
Sbjct  207   CDNFKALLPVGTKVKCFSDAGFFINAKDVSGAPHIQDFYNDVVTTHGSAKNLPQSCTSRM  266

Query  538   QLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKH--------ISAT  383
             + + LC FPQ++A+ IRTPLFI+ + YDS+ I + L+ G  +     H         S T
Sbjct  267   KPS-LCFFPQNMAQGIRTPLFIVNAAYDSWQIKNILAPGVADPHGLWHDCKTDIVKCSTT  325

Query  382   QYKALKELRLQMLVALRET-DSPSRGLFVSNCFGH--TQLIFYWNHPGFEVNYRKDV-EV  215
             Q + ++E RLQ L AL     S SRG F++ C+ H  T++   W      + Y K + + 
Sbjct  326   QLQTMQEFRLQFLNALSGLGSSTSRGYFINGCYAHCQTEMQETWFRGDSPLLYNKTIAKA  385

Query  214   VRDWYFDRINHVQEVE-QSTLVKDCPNNTFIEEE  116
             V DW++DR +  Q+++      K C N  F ++E
Sbjct  386   VGDWFYDR-SPFQKIDCPYPCDKTCHNRVFDQQE  418



>ref|XP_010325697.1| PREDICTED: uncharacterized protein LOC101260962 [Solanum lycopersicum]
Length=608

 Score =   271 bits (693),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 154/374 (41%), Positives = 218/374 (58%), Gaps = 22/374 (6%)
 Frame = -3

Query  1222  TANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISEC  1043
             T ++Y   N T+L SA + GAVCLDGSPPAY   +G G G   W++YL GG WC++IS+C
Sbjct  242   TDDNYSYINITVLHSATAQGAVCLDGSPPAYHLDRGHGTGLHSWVIYLDGGGWCNNISDC  301

Query  1042  TNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETV  863
              NR T  LGSS +      +F F GIL     EN EF NWN+V V YCDG+SFTGDVE +
Sbjct  302   LNRSTKFLGSSTKM--KRQSF-FGGILHNTSKENPEFHNWNRVRVKYCDGASFTGDVEQI  358

Query  862   NPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNST  683
             NP   L+FRG RIF A++EDL   KGM++A +  LTG SAGGLA I++CD+F +    S 
Sbjct  359   NPENKLYFRGARIFKAIMEDLWC-KGMKNAENAILTGTSAGGLATILNCDKFKSLLPGSA  417

Query  682   TVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHV  503
              VKC+++ GFF+  K       ++  +  I+ LH S   LP  C    + + LC FPQ+V
Sbjct  418   RVKCVASAGFFIDGKTITGTSHIQEMYEEIVSLHGSAKNLPSACTSAMEPS-LCFFPQNV  476

Query  502   AKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKS-----KHISATQYKALKELR------  356
                I+TPLFI+ S YDS+ IN+TL   + +   +     K+IS+     L  +R      
Sbjct  477   VSYIQTPLFIINSVYDSWQINNTLVPSYLDPQHAWKGCIKNISSCTSSQLIIIRAFGVEF  536

Query  355   LQMLVALRETDSPSRGLFVSNCFGHTQLI---FYWNHPGFEVNYRKDVEVVRDWYFDRIN  185
             L++  AL      +RG F+++C+ H  ++   +++N     +  +   E V DWYF+R  
Sbjct  537   LKIFGALPPCF--TRGYFLTSCYSHGDILSTSYWYNTTSPRLLSKTIAEAVGDWYFERAG  594

Query  184   HVQEVEQSTLVKDC  143
               Q ++    VK+C
Sbjct  595   -FQHIDPYPDVKNC  607



>ref|XP_008238012.1| PREDICTED: protein notum homolog isoform X2 [Prunus mume]
Length=400

 Score =   265 bits (678),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 145/346 (42%), Positives = 203/346 (59%), Gaps = 17/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T + SA++ GAVCLDGSPPAY   KG G G   W+V++ GG WC++++ C  RK + LGS
Sbjct  30    TYVHSAIAKGAVCLDGSPPAYHHDKGFGSGINNWLVHIEGGGWCNNVTTCLGRKNTRLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +      A  F GIL      N +F NWN++ V YCDG+SFTGDV  VNP TGL+FRG
Sbjct  90    SKQML---KAIAFSGILSNRKMFNPDFYNWNRIKVRYCDGASFTGDVAAVNPATGLYFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RIF AV+EDLL  KGM +A +  L+G SAGGL  I+HCD F       T VKC+S+ G+
Sbjct  147   ARIFRAVIEDLLA-KGMGNAQNAILSGCSAGGLTSILHCDNFHALLPVGTNVKCVSDAGY  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F++ K  + AQ +E  F  +++ H S   LP  C    +   LC FPQ++A  IRT +F 
Sbjct  206   FINVKDVSGAQHIEEFFSQVVETHGSARNLPPSCTSKLRPG-LCFFPQYMASQIRTRIFF  264

Query  472   MVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVAL-RETDS  320
             + + YDS+ I + L+ G  +         +  K+ S TQ KA+++ R+Q L A+   T  
Sbjct  265   VNAAYDSWQIKNILAPGVADPHGTWHECKLDIKNCSPTQLKAMQDFRVQFLSAIGGMTGC  324

Query  319   PSRGLFVSNCFGH--TQLIFYWNHPGFEV-NYRKDVEVVRDWYFDR  191
             P +G+F+ +C+ H  T+L   W      V N     + V DW++ R
Sbjct  325   PLKGMFIDSCYAHCQTELQETWLMADSPVLNKTTIAQAVGDWFYGR  370



>gb|AAM65412.1| pectin acetylesterase [Arabidopsis thaliana]
Length=391

 Score =   265 bits (677),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 146/390 (37%), Positives = 219/390 (56%), Gaps = 26/390 (7%)
 Frame = -3

Query  1288  KMGTLLNTTFILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIG  1109
             ++  + ++  +L +VV+  +            T LESAV+ GAVCLDGS PAY F KG G
Sbjct  3     RLKQMWSSILVLAVVVIGAR--------AVPITYLESAVAKGAVCLDGSAPAYHFDKGSG  54

Query  1108  EGRQRWIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFC  929
              G   WIV++ GG WC+ I+ C  RK++  GSS      +  F F GIL    + N +F 
Sbjct  55    SGVNNWIVHMEGGGWCTDIATCVQRKSTMKGSSKLM---NKDFGFSGILGGKQSTNPDFY  111

Query  928   NWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGG  749
             NWN++ V YCDGSSFTGD+E V+P   L FRG R++ AV++DL+  KGM +A +  L+G 
Sbjct  112   NWNRIKVRYCDGSSFTGDIEAVDPANKLFFRGARVWRAVIDDLMA-KGMSNAQNAILSGC  170

Query  748   SAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTA  569
             SAG LA I+HCD+F +    +  VKC+S+ G+F+H K       ++S +  ++  H S  
Sbjct  171   SAGALAAILHCDQFKSTLPKTAKVKCVSDAGYFIHGKDITGGSYIQSYYAKVVATHGSAK  230

Query  568   VLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKS----  401
              LP  C  + +   LC FPQ+VAK ++TPLF++ + +DS+ I + L+    +  K+    
Sbjct  231   SLPASCTSSMK-PELCFFPQYVAKTLQTPLFVINAAFDSWQIKNVLAPTSVDKSKAWKTC  289

Query  400   ----KHISATQYKALKELRLQMLVALRETDSP-SRGLFVSNCFGHTQ---LIFYWNHPGF  245
                 K  +A Q + ++  R Q+L AL    S  + GLF+ +C  H Q      +    G 
Sbjct  290   KLDLKKCTAAQLQTVQGYRDQVLAALAPVQSATTNGLFLDSCHAHCQGGSAATWSGDKGP  349

Query  244   EVNYRKDVEVVRDWYFDRINHVQEVEQSTL  155
              V   K  + V DW+F+R +  Q V+ S+L
Sbjct  350   TVANTKMAKAVGDWFFER-STFQNVDCSSL  378



>gb|KDO40410.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=437

 Score =   266 bits (681),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 150/378 (40%), Positives = 210/378 (56%), Gaps = 24/378 (6%)
 Frame = -3

Query  1288  KMGTLLNTTFILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIG  1109
             +MG  LN     LI++           F    T +E+AV  GAVCLDGSPPAY F KG G
Sbjct  43    RMGQWLNLLVCALILLKADG-------FNVGITYVENAVVKGAVCLDGSPPAYHFDKGFG  95

Query  1108  EGRQRWIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFC  929
              G   W+V++ GG WC++++ C  RK + LGSS +         F G+L      N +F 
Sbjct  96    AGINNWLVHIEGGGWCNNVTTCLERKKTRLGSSKQMV---KVVAFSGMLSNKQKFNPDFY  152

Query  928   NWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGG  749
             NWN++ V YCDG+SFTGDVE VNP   LHFRG R+F AV+EDL+  KGM++A +  L+G 
Sbjct  153   NWNRIKVRYCDGASFTGDVEAVNPANNLHFRGARVFQAVMEDLMA-KGMKNAQNAVLSGC  211

Query  748   SAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTA  569
             SAGGL  I+HCD F   F   T VKC ++ G+F+++K  + A  +E  +  ++  H S  
Sbjct  212   SAGGLTSILHCDNFRALFPVGTKVKCFADAGYFINAKDVSGASHIEQFYAQVVATHGSAK  271

Query  568   VLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKH--  395
              LP  C        LC FPQ++A+ I TPLFI+ + YDS+ I + L+ G  +   + H  
Sbjct  272   HLPASCTSRLSPG-LCFFPQYMARQITTPLFIINAAYDSWQIKNILAPGVADPHGTWHSC  330

Query  394   ------ISATQYKALKELRLQMLVALRETD-SPSRGLFVSNCFGH--TQLIFYWNHPGFE  242
                    S TQ + ++  R Q L AL     S SRG+F+  C+ H  T++   W      
Sbjct  331   KLDINNCSPTQLQTMQSFRTQFLNALAGLGISSSRGMFIDACYAHCQTEMQETWLRTDSP  390

Query  241   VNYRKDV-EVVRDWYFDR  191
             V  +  + + V DWY+DR
Sbjct  391   VLGKMSIAKAVGDWYYDR  408



>ref|XP_009784099.1| PREDICTED: protein notum homolog [Nicotiana sylvestris]
Length=392

 Score =   265 bits (677),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 146/360 (41%), Positives = 212/360 (59%), Gaps = 16/360 (4%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T+++ A S GAVCLDGSP AY + +G G+G   WIV+L GG WC S+ +C  R     GS
Sbjct  35    TLVQDAFSKGAVCLDGSPAAYHYDQGSGDGVNNWIVWLEGGGWCRSVEDCGQRFNYSNGS  94

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S+       + +F G+L  +   N +F NW+++++ YCDGSS+TGDVE V+  T  H+RG
Sbjct  95    SNHI----DSKSFYGLLSNSKTSNPDFYNWHRIMIRYCDGSSYTGDVELVDKVTNQHYRG  150

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RIF A++++LL  KGM++AT+  L+G SAGGL  + HCDRF +   ++  VKCLS+G +
Sbjct  151   ARIFQAIMDELLA-KGMKNATNAILSGCSAGGLGTMFHCDRFRSLLPSTARVKCLSDGAY  209

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             FL      +   LES + G+++LHNS  VLP  C      A  C FPQH+ +DI+TPLFI
Sbjct  210   FLLDNDFKRVNILESTYDGVVNLHNSAKVLPPSCTSRMNPAS-CFFPQHIQEDIKTPLFI  268

Query  472   MVSTYDSYLINHTL-----STGFYEAVKSK--HISATQYKALKELRLQMLVALRETDSPS  314
             + S YDS+ I  T+        F E  K      S  Q K L+    + L AL ++ SPS
Sbjct  269   LNSAYDSWQIVDTVIPFADRQDFAENCKKNLSKCSPHQQKLLQGFGAEFLSALPKSYSPS  328

Query  313   -RGLFVSNCFGHTQL--IFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTLVKDC  143
              RG+++++C  H Q    + WN     +N +   +V  DW+F+R    + V+Q  L + C
Sbjct  329   QRGMYINSCLMHCQTDHDWSWNSNSDLLNNKTIAKVFGDWFFERDPSQEMVKQHDLPQIC  388



>emb|CDX99377.1| BnaC01g11750D [Brassica napus]
Length=452

 Score =   267 bits (682),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 150/379 (40%), Positives = 221/379 (58%), Gaps = 20/379 (5%)
 Frame = -3

Query  1288  KMGTLLNTTFILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIG  1109
             ++  + N    +++VV       A   F  N T + +AV+ GAVCLDGSPPAY   +G G
Sbjct  52    RVSKMFNFKQWVILVVCSLAILKAEGLFV-NITFVRNAVARGAVCLDGSPPAYHLHRGSG  110

Query  1108  EGRQRWIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFC  929
              G   W++ L GG WC++++ C +R  + LGSS +   N     F  IL      N +F 
Sbjct  111   TGINSWLIQLEGGGWCNNVTNCLSRMHTRLGSSKKMVEN---LAFSAILSNKKQYNPDFY  167

Query  928   NWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGG  749
             NWN+V V YCDGSSFTGDV+ VNP T LHFRG R++ AV+++LL  KGM++A +  L+G 
Sbjct  168   NWNRVKVRYCDGSSFTGDVQAVNPATNLHFRGARVWLAVMQELLA-KGMRNAENAVLSGC  226

Query  748   SAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTA  569
             SAGGLA ++HCD F       T VKCLS+ GFFL+++  + AQ ++S F+ ++ LH S  
Sbjct  227   SAGGLASLMHCDSFRALLPMGTKVKCLSDAGFFLNTRDVSGAQYIKSYFKDVVALHGSAK  286

Query  568   VLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLST------GFYEAV  407
              LP  C      A +C FPQ+VA+ IRTP+FI+ + YDS+ I + L+       G +++ 
Sbjct  287   NLPRTCTSRLTPA-MCFFPQYVARQIRTPVFILNAAYDSWQIKNILAPRAADPYGKWQSC  345

Query  406   K--SKHISATQYKALKELRLQMLVA-LRETDSPSRGLFVSNCFGH----TQLIFYWNHPG  248
             +   K+    Q K +++ RL+ L A +    S SRG+F+ +C+ H    TQ  ++W    
Sbjct  346   QLDIKNCQPNQLKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFWQDSP  405

Query  247   FEVNYRKDVEVVRDWYFDR  191
               +N     + V DW +DR
Sbjct  406   I-LNRTTIAKAVGDWVYDR  423



>ref|XP_010536189.1| PREDICTED: uncharacterized protein LOC104811235 isoform X1 [Tarenaya 
hassleriana]
Length=391

 Score =   265 bits (676),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 143/346 (41%), Positives = 196/346 (57%), Gaps = 17/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T L SAV+ GAVCLDGSPPAY F KG G G   WIV++ GG WC+ I+ C+ RK +  GS
Sbjct  27    TYLNSAVARGAVCLDGSPPAYHFDKGFGSGVNNWIVHMEGGGWCNDIASCSERKNTMKGS  86

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S      +  F F GIL    + N +F NWN++ V YCDGSSFTGDVE VNP+  L FRG
Sbjct  87    SKLM---NKDFGFSGILGSQQSTNPDFYNWNRIKVRYCDGSSFTGDVEAVNPSNKLFFRG  143

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R++ AV++DL+  KGM  A +  L+G SAG LA I+HCD+F      +  VKC+S+ G+
Sbjct  144   ARVWRAVIDDLMA-KGMNKAQNAILSGCSAGALAAILHCDQFHAILPRTAKVKCVSDAGY  202

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+H K       +ES +  ++ LH S   LP  C    +   LC FPQ+V   +RTPLF+
Sbjct  203   FIHGKDITGGSYIESYYSKVVALHGSAKTLPVSCTSRMK-PELCFFPQYVVPSMRTPLFV  261

Query  472   MVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRETDS-  320
             + + +DS+ I + L+    +  K         K  +  Q + ++  R Q+L AL    S 
Sbjct  262   VNAAFDSWQIKNVLAPSAVDKRKEWKDCKLDLKKCTPAQLRTVQGFRDQILRALAPVHST  321

Query  319   PSRGLFVSNCFGHTQ---LIFYWNHPGFEVNYRKDVEVVRDWYFDR  191
              SRGLF+ +C  H Q      +    G  V   K  + V DW++DR
Sbjct  322   TSRGLFLDSCHAHCQGGSAASWSGSKGPSVGNTKIAKAVGDWFYDR  367



>ref|XP_002867940.1| hypothetical protein ARALYDRAFT_492921 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44199.1| hypothetical protein ARALYDRAFT_492921 [Arabidopsis lyrata subsp. 
lyrata]
Length=391

 Score =   265 bits (676),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 147/366 (40%), Positives = 209/366 (57%), Gaps = 25/366 (7%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T L+SAV+ GAVCLDGS PAY F KG G G   WIV++ GG WC+ ++ C  RK +  GS
Sbjct  27    TYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCNERKGTMKGS  86

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S  ++ N   F F GIL    + N +F NWN++ V YCDGSSFTG+VE VNP   L FRG
Sbjct  87    S--KFMNKD-FGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVEAVNPANKLFFRG  143

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R++ AV++DL+  KGM++A +  L+G SAG LA I+HCD F      + +VKC+S+ G+
Sbjct  144   ARVWRAVIDDLMA-KGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTASVKCVSDAGY  202

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+H K       +ES +  ++ LH S   LP  C    +   LC FPQ+V   +RTPLF+
Sbjct  203   FIHGKDITGGSYIESYYSKVVALHGSAKSLPVSCTSKMK-PELCFFPQYVVPSMRTPLFV  261

Query  472   MVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRETDS-  320
             + + +DS+ I + L+    +  K         K  SA Q K ++  R QM+ AL    S 
Sbjct  262   INAAFDSWQIKNVLAPTAVDKGKQWKNCKLDLKKCSAAQLKTVQGFRDQMMRALSPVHST  321

Query  319   PSRGLFVSNCFGHTQ---LIFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTLVK  149
             PSRGLF+ +C  H Q      +    G +V   +  + V +W++ R +  Q++       
Sbjct  322   PSRGLFLDSCHAHCQGGSAASWSGDKGPQVANTRIAKAVGNWFYGR-SAFQKI-------  373

Query  148   DCPNNT  131
             DCP+ T
Sbjct  374   DCPSPT  379



>ref|NP_199341.1| pectinacetylesterase family protein [Arabidopsis thaliana]
 dbj|BAB10249.1| pectin acetylesterase [Arabidopsis thaliana]
 gb|AAL15296.1| AT5g45280/K9E15_6 [Arabidopsis thaliana]
 gb|AED95226.1| pectinacetylesterase family protein [Arabidopsis thaliana]
Length=391

 Score =   265 bits (676),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 144/358 (40%), Positives = 208/358 (58%), Gaps = 18/358 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T LESAV+ GAVCLDGS PAY F KG G G   WIV++ GG WC+ I+ C  RK++  GS
Sbjct  27    TYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQRKSTMKGS  86

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S      +  F F GIL    + N +F NWN++ V YCDGSSFTGD+E V+PT  L FRG
Sbjct  87    SKLM---NKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAVDPTHKLFFRG  143

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R++ AV++DL+  KGM +A +  L+G SAG LA I+HCD+F +    +  VKC+S+ G+
Sbjct  144   ARVWRAVIDDLMA-KGMSNAQNAILSGCSAGALAAILHCDQFKSTLPKTAKVKCVSDAGY  202

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+H K       ++S +  ++  H S   LP  C  + +   LC FPQ+VAK ++TPLF+
Sbjct  203   FIHGKDITGGSYIQSYYAKVVATHGSAKSLPASCTSSMK-PDLCFFPQYVAKTLQTPLFV  261

Query  472   MVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRETDSP  317
             + + +DS+ I + L+    +  K+        K  +A Q + ++  R Q+L AL    S 
Sbjct  262   INAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLKKCTAAQLQTVQGYRDQVLAALAPVRSA  321

Query  316   -SRGLFVSNCFGHTQ---LIFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTL  155
              + GLF+ +C  H Q      +    G  V   K  + V DW+F+R +  Q V+ S+L
Sbjct  322   TTNGLFLDSCHAHCQGGSAATWSGDKGPTVANTKMAKAVGDWFFER-STFQNVDCSSL  378



>ref|XP_006398195.1| hypothetical protein EUTSA_v10000914mg [Eutrema salsugineum]
 gb|ESQ39648.1| hypothetical protein EUTSA_v10000914mg [Eutrema salsugineum]
Length=391

 Score =   265 bits (676),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 146/364 (40%), Positives = 209/364 (57%), Gaps = 25/364 (7%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T LESAV+ GAVCLDGS PAY F KG G G   WIV++ GG WC+ I+ C  RK++  GS
Sbjct  27    TYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVKRKSTMKGS  86

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S    + +  F F GIL    + N +F NWN++ V YCDGSSFTGD+E V+PT  L FRG
Sbjct  87    SK---FMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAVDPTNKLFFRG  143

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R++ AV++DL+  KGM +A +  L+G SAG LA I+HCD F +    +  VKC+S+ GF
Sbjct  144   ARVWRAVIDDLMA-KGMSNAQNAILSGCSAGALAAILHCDEFKSIIPKTAKVKCVSDAGF  202

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+H K  +    +ES +  ++  H S   LP  C  + +   LC FPQ+V K ++TPLF+
Sbjct  203   FIHGKDISGGSYIESYYGKVVATHGSAKSLPVSCTSSMK-PELCFFPQYVVKTMQTPLFV  261

Query  472   MVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRET-DS  320
             + + +DS+ I + L+    +  K         K  +A Q + ++  R QML AL     +
Sbjct  262   INAAFDSWQIKNVLAPTSVDKRKEWKTCKLDLKKCTAAQLQTVQGYRDQMLAALAPVRAT  321

Query  319   PSRGLFVSNCFGHTQ---LIFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTLVK  149
              +RGLF+ +C  H Q      +    G +V   K  + V DW+++R +  Q V       
Sbjct  322   TTRGLFLDSCHAHCQGGSAATWSGAQGPQVGDTKMAKAVGDWFYER-STFQNV-------  373

Query  148   DCPN  137
             DCP+
Sbjct  374   DCPS  377



>ref|XP_009759657.1| PREDICTED: uncharacterized protein LOC104212153 [Nicotiana sylvestris]
Length=429

 Score =   265 bits (678),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 146/370 (39%), Positives = 207/370 (56%), Gaps = 22/370 (6%)
 Frame = -3

Query  1255  LLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLL  1076
             +L+ VL+    T       N+TIL SA++ GAVCLDGS PA+ F  G G G   W+++L 
Sbjct  15    VLLSVLYLWTTTEAEDLYVNTTILYSAIAKGAVCLDGSAPAFHFYPGTGSGVYSWLIHLQ  74

Query  1075  GGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCD  896
             GG WC + S+C NR  S L S H         +F G+L  +   N +F NWN V + YCD
Sbjct  75    GGGWCETTSDCQNRARSDLSSKHAPI----VAHFSGVLSNDPQLNPDFYNWNLVKIRYCD  130

Query  895   GSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHC  716
             GSS+TGD+E V+P T LH+RG RIF+A++E+LL  KGM  A +  L+G SAGGL  I+HC
Sbjct  131   GSSYTGDIEEVDPDTNLHYRGARIFEAIMEELLYRKGMIYAQNAILSGTSAGGLGAILHC  190

Query  715   DRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQ  536
             D+F   F  +  VKC+S+  FFL+ K       +E  ++ ++ LH S   LP  C  +  
Sbjct  191   DKFRYFFPLTVRVKCISDAAFFLNVKTITGEPQIEEYYKRVVALHGSAKNLPLSCTLSLN  250

Query  535   LAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKHI-----------S  389
                LC FPQ+ A+   TPLFI+ S YD++ INH+L          +H+           S
Sbjct  251   DPSLCFFPQYAAQHTYTPLFIINSAYDAFQINHSL---IPSEADPQHVWDYCKGNLNSCS  307

Query  388   ATQYKALKELRLQMLVALRET-DSPSRGLFVSNCFGH--TQLIFYWNHPGFEVNYRKDV-  221
              +Q + +++ RL  L AL E   S +RG F+S+C  H   ++  YW++        K + 
Sbjct  308   PSQLQTIQDFRLTFLEALNELGPSTTRGYFISSCHSHHGIEIQSYWSYTNSPTLANKTIA  367

Query  220   EVVRDWYFDR  191
             E V  W+FDR
Sbjct  368   EAVGGWFFDR  377



>ref|XP_002867938.1| pectinacetylesterase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44197.1| pectinacetylesterase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=380

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 145/349 (42%), Positives = 208/349 (60%), Gaps = 19/349 (5%)
 Frame = -3

Query  1198  NSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHL  1019
             N T + +AV+ GAVCLDGSPPAY   +G G G   W++ L GG WC++++ C +R  + L
Sbjct  9     NITYVRNAVAKGAVCLDGSPPAYHLDRGSGTGINSWLIQLEGGGWCNNVTNCVSRMHTRL  68

Query  1018  GSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHF  839
             GSS +   N     F  IL      N +F NWN+V V YCDGSSFTGDV+ VNP T LHF
Sbjct  69    GSSKKMVEN---LAFSAILSNKKQYNPDFYNWNRVKVRYCDGSSFTGDVQAVNPATNLHF  125

Query  838   RGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNG  659
             RG R++ AV+++LL  KGM +A +  L+G SAGGLA ++HCD F       T VKCLS+ 
Sbjct  126   RGARVWLAVMQELLA-KGMINAENAVLSGCSAGGLASLMHCDSFRALLPMGTKVKCLSDA  184

Query  658   GFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPL  479
             GFFL+++  +  Q ++S F  ++ LH S   LP  C      A +C FPQ+VA+ IRTPL
Sbjct  185   GFFLNTRDVSGVQYIKSYFEDVVTLHGSAKNLPRSCTSRLTPA-MCFFPQYVARQIRTPL  243

Query  478   FIMVSTYDSYLINHTLST------GFYEAVK--SKHISATQYKALKELRLQMLVA-LRET  326
             FI+ + YDS+ I + L+       G +++ +   K+   +Q K +++ RL+ L A +   
Sbjct  244   FILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIKNCHPSQIKVMQDFRLEFLSAVIGLG  303

Query  325   DSPSRGLFVSNCFGH----TQLIFYWNHPGFEVNYRKDVEVVRDWYFDR  191
              S SRG+F+ +C+ H    TQ  ++W      +N     + V DW +DR
Sbjct  304   RSSSRGMFIDSCYTHCQTETQTSWFWQDSPI-LNRTTIAKAVGDWVYDR  351



>ref|XP_009589854.1| PREDICTED: uncharacterized protein LOC104087156 isoform X2 [Nicotiana 
tomentosiformis]
Length=300

 Score =   261 bits (667),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/277 (47%), Positives = 178/277 (64%), Gaps = 4/277 (1%)
 Frame = -3

Query  1261  FILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVY  1082
             F++ IV+L    Q +  +   N+TIL +A+  GAVCLDGS PAYL  +G G G   W+V+
Sbjct  2     FLIFIVLLLTVSQVSADFLIVNTTILHNAIGKGAVCLDGSAPAYLIDRGSGYGVNNWLVH  61

Query  1081  LLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHY  902
             + GG WCS+ISEC  R  +  GSS      +  + F+GIL     EN +F NWN+V V Y
Sbjct  62    IEGGGWCSTISECIERTGTRYGSSIHM---EDQYYFQGILSNKPNENPDFFNWNRVKVKY  118

Query  901   CDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVII  722
             CDG+SFTGDV+ V+P TGLHFRG R+F A++EDLL  KGM  A +  L+G SAGGL  I+
Sbjct  119   CDGASFTGDVQEVDPVTGLHFRGARVFLAIMEDLLY-KGMWKAENAILSGTSAGGLTAIL  177

Query  721   HCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKN  542
             HCD+F + F  S  VKC+S+ GFF++ K       +E  +  ++ LH S+  LP  C  +
Sbjct  178   HCDKFRSFFSPSARVKCISDAGFFVNIKTILGESHIEQLYERVVTLHGSSKNLPRSCTSS  237

Query  541   HQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTL  431
             +    LC FP++V + IRTPLFI+ S YDS+ IN++L
Sbjct  238   YLDPSLCFFPEYVVQYIRTPLFIINSAYDSWQINNSL  274



>ref|XP_006280604.1| hypothetical protein CARUB_v10026563mg [Capsella rubella]
 gb|EOA13502.1| hypothetical protein CARUB_v10026563mg [Capsella rubella]
Length=391

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 146/390 (37%), Positives = 221/390 (57%), Gaps = 26/390 (7%)
 Frame = -3

Query  1288  KMGTLLNTTFILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIG  1109
             ++  L ++  +L +VV+  +            T LESAV+ GAVCLDGS PAY F KG G
Sbjct  3     RLKQLWSSLLVLAVVVIGAR--------AVPITYLESAVAKGAVCLDGSAPAYHFDKGSG  54

Query  1108  EGRQRWIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFC  929
              G   WIV++ GG WC+ I+ C  RK++  GSS      +  F F GIL    + N +F 
Sbjct  55    SGVNNWIVHMEGGGWCTDIATCVQRKSTMKGSSKLM---NKDFGFSGILGGKQSTNPDFY  111

Query  928   NWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGG  749
             NWN++ V YCDGSSFTGD+E V+PT  L FRG R++ AV++DL+  KGM +A +  L+G 
Sbjct  112   NWNRIKVRYCDGSSFTGDIEAVDPTNKLFFRGARVWRAVIDDLMA-KGMSNAQNAILSGC  170

Query  748   SAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTA  569
             SAG LA I+HCD+F +    +  VKC+S+ G+F+H K  +    ++S +  ++  H S  
Sbjct  171   SAGALAAILHCDQFKSILPKTAKVKCVSDAGYFIHGKDISGGSYIQSYYGKVVATHGSAK  230

Query  568   VLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKS----  401
              LP  C    +   LC FPQ+VAK ++TPLF++ + +DS+ I + L+    +  K+    
Sbjct  231   SLPASCTSTMK-PELCFFPQYVAKTLQTPLFVINAAFDSWQIKNVLAPTSVDKSKAWKTC  289

Query  400   ----KHISATQYKALKELRLQMLVALRETDS-PSRGLFVSNCFGHTQ---LIFYWNHPGF  245
                 K  +A+Q + ++  R Q+L AL    +  + GLF+ +C  H Q      +    G 
Sbjct  290   KLDLKKCTASQLQTVQGYRDQVLAALAPVRADTTSGLFLDSCHAHCQGGSAATWSGDKGP  349

Query  244   EVNYRKDVEVVRDWYFDRINHVQEVEQSTL  155
              V   K  + V DW+F+R +  Q ++ S+L
Sbjct  350   TVANTKMAKAVGDWFFER-STFQNIDCSSL  378



>gb|ACJ85294.1| unknown [Medicago truncatula]
 gb|AFK37076.1| unknown [Medicago truncatula]
Length=393

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 150/390 (38%), Positives = 214/390 (55%), Gaps = 27/390 (7%)
 Frame = -3

Query  1273  LNTTFILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQR  1094
             ++  F L+I  L     T     T   T ++SAV+ GAVCLDGSPPAY F KG   G   
Sbjct  6     MDQLFSLVICTLLLLKATEG--VTVPITFVQSAVAKGAVCLDGSPPAYHFDKGFEAGIDN  63

Query  1093  WIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKV  914
             WIV+  GG WC++ + C +R  + LG S +    D   +F G        N +F NWN++
Sbjct  64    WIVHFEGGGWCNNATTCLDRIDTRLGPSKKM---DKTLSFSGFFSSGKKFNPDFYNWNRI  120

Query  913   VVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGL  734
              V YCDGSSFTGDVE V+P T LH+RG RIF AV+EDLL  KGM++A +  L+G SAGGL
Sbjct  121   KVRYCDGSSFTGDVEAVDPKTNLHYRGGRIFVAVIEDLLA-KGMKNAKNAILSGCSAGGL  179

Query  733   AVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEP  554
               I+ CDRF      +  VKC+S+ G+F++ K  + A  +E  +  ++  H S   LP  
Sbjct  180   TSILQCDRFRTLLPAAAKVKCVSDAGYFINVKAVSGASHIEQFYSQVVQTHGSAKNLPSS  239

Query  553   CRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEA--------VKSK  398
             C        LC FPQ+VA  I+TP+F + + YDS+ I + L+ G  +         +  K
Sbjct  240   CTSRLSPG-LCFFPQNVAAQIKTPIFFVNAAYDSWQIKNILAPGVADPHGTWRNCKLDIK  298

Query  397   HISATQYKALKELRLQMLVALR-ETDSPSRGLFVSNCFGHTQ--LIFYWNHPGFEVNYRK  227
               SA Q   ++  R + L A+   ++SPS+G+F+  C+ H Q  +   W    F V  + 
Sbjct  299   SCSANQLSTMQGFRTEFLKAISVVSNSPSKGMFIDGCYSHRQTGMQETWMRTDFPVLAKT  358

Query  226   DV-EVVRDWYFDRINHVQEVEQSTLVKDCP  140
              + + V DWY+DR +  Q++       DCP
Sbjct  359   TIAKAVGDWYYDR-STFQQI-------DCP  380



>ref|NP_567585.1| pectinacetylesterase family protein [Arabidopsis thaliana]
 gb|AAK96722.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
 gb|AAL47339.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
 gb|AAM64921.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
 dbj|BAF00825.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
 gb|AEE84177.1| pectinacetylesterase family protein [Arabidopsis thaliana]
Length=391

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 147/366 (40%), Positives = 209/366 (57%), Gaps = 25/366 (7%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T L+SAV+ GAVCLDGS PAY F KG G G   WIV++ GG WC+ ++ C  RK +  GS
Sbjct  27    TYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCNERKGTMKGS  86

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S  ++ N   F F GIL    + N +F NWN++ V YCDGSSFTG+VE VNP   L FRG
Sbjct  87    S--KFMNKD-FGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVEAVNPANKLFFRG  143

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R++ AVV+DL+  KGM++A +  L+G SAG LA I+HCD F      + +VKC+S+ G+
Sbjct  144   ARVWRAVVDDLMA-KGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTASVKCVSDAGY  202

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+H K       ++S +  ++ LH S   LP  C    +   LC FPQ+V   +RTPLF+
Sbjct  203   FIHGKDITGGSYIQSYYSKVVALHGSAKSLPVSCTSKMK-PELCFFPQYVVPSMRTPLFV  261

Query  472   MVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRETDS-  320
             + + +DS+ I + L+    +  K         K  SA Q K ++  R QM+ AL    S 
Sbjct  262   INAAFDSWQIKNVLAPTAVDKGKEWKNCKLDLKKCSAAQLKTVQGFRDQMMRALSPVHST  321

Query  319   PSRGLFVSNCFGHTQ---LIFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTLVK  149
             PSRGLF+ +C  H Q      +    G +V   +  + V +W++ R +  Q++       
Sbjct  322   PSRGLFLDSCHAHCQGGSAASWSGDKGPQVANTRIAKAVGNWFYGR-SAFQKI-------  373

Query  148   DCPNNT  131
             DCP+ T
Sbjct  374   DCPSPT  379



>ref|XP_004300391.1| PREDICTED: protein notum homolog [Fragaria vesca subsp. vesca]
Length=399

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 150/364 (41%), Positives = 210/364 (58%), Gaps = 26/364 (7%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             TIL++AV+ GAVCLDGSPPAY + KG G G   W+V++ GG WC +++ C  RK + LGS
Sbjct  30    TILQTAVAKGAVCLDGSPPAYHWDKGFGSGLNNWLVHIEGGGWCHNVTNCLGRKNTRLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +         F GIL    + N  F NWN++ V YCDGSSFTGDV  V+P TGL+FRG
Sbjct  90    SKKML---KEIPFSGILSNRQSLNPGFYNWNRIKVRYCDGSSFTGDVAAVDPATGLYFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNS-TTVKCLSNGG  656
              R+F AV+ DLL  KGM  A +  L+G SAGGL  I+HCD F   F  S T VKC+S+ G
Sbjct  147   ARVFRAVMADLLA-KGMGKAVNAVLSGCSAGGLTSILHCDNFRALFLPSGTKVKCVSDAG  205

Query  655   FFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLF  476
             +F++ K  + AQ ++  F  I+  H S   LP  C    +   LC FPQ+V   IRTP+F
Sbjct  206   YFINVKDISGAQHVQEYFTDIVTTHGSAKNLPPSCTSKLR-PDLCFFPQYVVPQIRTPIF  264

Query  475   IMVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALRE-TD  323
              + + YDS+ I + +  G  +         +  K+ S TQ K ++  RLQ L A+   ++
Sbjct  265   YVNAAYDSWQIKNIVVPGVADPHGTWRNCKLDIKNCSPTQLKTMQNFRLQFLSAIGGVSN  324

Query  322   SPSRGLFVSNCFGH--TQLIFYWNHPGFE-VNYRKDVEVVRDWYFDRINHVQEVEQSTLV  152
             S  +G+F+ +C+ H  T+L   W+ P    +N       V DW++DR +  Q++      
Sbjct  325   SAVKGMFIDSCYLHCQTELQETWSMPNSPLLNKTTIARAVGDWFYDRTS-FQKI------  377

Query  151   KDCP  140
              DCP
Sbjct  378   -DCP  380



>dbj|BAJ97261.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00807.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=393

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 150/372 (40%), Positives = 209/372 (56%), Gaps = 29/372 (8%)
 Frame = -3

Query  1186  LESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGSSH  1007
             ++SAV+ GAVCLDGSPP Y F  G G G   W+V++ GG WC +  EC  RK +  GSS 
Sbjct  34    VKSAVAKGAVCLDGSPPVYHFSPGSGSGADNWVVHMEGGGWCKTPEECAVRKGNFRGSSK  93

Query  1006  RQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRR  827
                      +F GIL  +   N +F NWN+V V YCDGSSFTGDVE V+ +T LH+RG R
Sbjct  94    YM----KPLSFSGILGGSQQYNPDFYNWNRVKVRYCDGSSFTGDVEEVDSSTNLHYRGAR  149

Query  826   IFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFL  647
             ++DA++EDLL N+GM  A +  L+G SAGGLA I+HCD+F +    S +VKC+S+ G+F+
Sbjct  150   VWDAIIEDLL-NRGMSKAKNAILSGCSAGGLAAILHCDKFNDLLPPSASVKCVSDAGYFI  208

Query  646   HSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMV  467
                     + + + F+ +++LH S   LP  C  +     LC FPQHV   ++TPLFI+ 
Sbjct  209   DGTDITGNKFVRTSFKNVVNLHGSVKNLPSSC-TSRTSPELCFFPQHVLPTLKTPLFILN  267

Query  466   STYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVAL-RETDSPS  314
             + YDS+ I + L     +  K         K  S++Q   L+  R + L AL +   SPS
Sbjct  268   AAYDSWQIRNILVPSAADKKKEWAKCKLDIKGCSSSQLVTLQHFRDEFLSALPKPGQSPS  327

Query  313   RGLFVSNCFGHTQ--LIFYWNHPGFEVNYRKDV-EVVRDWYFDRINHVQEVEQSTLVKDC  143
              G+F+ +CF H Q      WN  G     +  + + V DW+FDR      V Q     DC
Sbjct  328   VGMFIDSCFAHCQSGAQDSWNADGSPSLQKTKIGKAVGDWFFDR-----AVSQRI---DC  379

Query  142   P---NNTFIEEE  116
             P   N + I+ E
Sbjct  380   PYPCNQSCIDNE  391



>ref|XP_010439718.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=397

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 144/349 (41%), Positives = 209/349 (60%), Gaps = 19/349 (5%)
 Frame = -3

Query  1198  NSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHL  1019
             N T + +AV+ GAVCLDGSPPAY   +G G G   W++ L GG WC++++ C +R  + L
Sbjct  26    NITYVRNAVAKGAVCLDGSPPAYHLDRGSGTGVNSWLIQLEGGGWCNNVTNCLSRMHTRL  85

Query  1018  GSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHF  839
             GSS +   N     F  IL      N +F NWN+V V YCDGSSFTGDV+ VNP T LHF
Sbjct  86    GSSKKMVEN---LAFSAILSNKKQYNPDFYNWNRVKVRYCDGSSFTGDVQAVNPATNLHF  142

Query  838   RGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNG  659
             RG RI+ AV+++LL  KGM++A +  L+G SAGGLA ++HCD F       + VKCLS+ 
Sbjct  143   RGARIWLAVMQELLA-KGMRNAENAVLSGCSAGGLASLMHCDSFRALLPMGSRVKCLSDA  201

Query  658   GFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPL  479
             GFFL+++  +  Q ++  F+ ++ LH S   LP  C      A +C FPQ+VA+ IRTPL
Sbjct  202   GFFLNTRDVSGVQYIKQYFQDVVTLHGSAKNLPRSCTSRLTPA-MCFFPQYVARQIRTPL  260

Query  478   FIMVSTYDSYLINHTLST------GFYEAVK--SKHISATQYKALKELRLQMLVALRETD  323
             FI+ + YDS+ I + L+       G +++ +   K+   +Q K +++ RL+ L A+    
Sbjct  261   FILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIKNCHPSQLKVMQDFRLEFLSAVISLG  320

Query  322   -SPSRGLFVSNCFGH----TQLIFYWNHPGFEVNYRKDVEVVRDWYFDR  191
              S SRG+F+ +C+ H    TQ  ++W      +N     + V DW +DR
Sbjct  321   RSSSRGMFIDSCYTHCQTETQTSWFWQDSPI-LNRTTIAKAVGDWVYDR  368



>ref|XP_009797415.1| PREDICTED: uncharacterized protein LOC104243851 [Nicotiana sylvestris]
Length=388

 Score =   263 bits (673),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 151/386 (39%), Positives = 213/386 (55%), Gaps = 31/386 (8%)
 Frame = -3

Query  1261  FILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVY  1082
             FI L+++   +          N TILESAV+ G VCLDG+PPAY   +G G G   W++ 
Sbjct  9     FISLLIICRTES------LLVNITILESAVAKGGVCLDGTPPAYHLDRGSGTGLDNWVIS  62

Query  1081  LLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHY  902
             + GG WC +I+ C  RK S LGSS +         F GI+  +   N EF NWN+V V Y
Sbjct  63    IEGGGWCQNITHCLQRKNSRLGSSAKM---GKQVAFSGIMSNDPKFNPEFYNWNRVSVRY  119

Query  901   CDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVII  722
             CDG SFTGDVE V+P TGLH+RG RIF+A++ DLL  +GM    +  L+G SAGGLA I+
Sbjct  120   CDGGSFTGDVEAVDPATGLHYRGARIFEAIMADLLA-QGMSTVENAILSGCSAGGLASIL  178

Query  721   HCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKN  542
             HCD F      +  VKC S+ G+F++ K  +    +E  F  ++ LH S   LP  C   
Sbjct  179   HCDNFRALLPKTARVKCFSDAGYFVNLKDISGEAYIEEYFNDVVTLHGSAKNLPPSCTSK  238

Query  541   HQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTL------STGFYEAVKS--KHISA  386
                + LC FPQ+VA  I+TPLFI+ + YD + + + L       TG +   K+  ++ + 
Sbjct  239   LNPS-LCFFPQNVAHQIQTPLFIINAAYDHWQVRNILVPSTADPTGAWTNCKADMRNCTL  297

Query  385   TQYKALKELRLQMLVALRET-DSPSRGLFVSNCFGH--TQLIFYWNHPGFEVNYRKDV-E  218
             ++ + L+  RL  L  L     S +RG ++++CF H  TQ   YW  P     + K + E
Sbjct  298   SELQVLQGFRLNFLKVLEGLGPSSTRGYYINSCFSHCQTQQQAYWFGPNSPRLFNKTIAE  357

Query  217   VVRDWYFDRINHVQEVEQSTLVKDCP  140
                DW+++R N  QE+       DCP
Sbjct  358   ATGDWFWER-NQFQEI-------DCP  375



>ref|XP_007209211.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
 ref|XP_007209212.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
 gb|EMJ10410.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
 gb|EMJ10411.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
Length=400

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 143/346 (41%), Positives = 203/346 (59%), Gaps = 17/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T + SA++ GAVCLDGSPPAY   KG G G   W+V++ GG WC++++ C  RK + LGS
Sbjct  30    TYVHSAIAKGAVCLDGSPPAYHHDKGFGSGINNWLVHIEGGGWCNNVTNCLGRKNTRLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +      A  F GIL      N +F NWN++ V YCDG+SFTGDV  VNP TGL+FRG
Sbjct  90    SKQML---KAIAFSGILSNRKMFNPDFYNWNRIKVRYCDGASFTGDVAAVNPATGLYFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RIF AV+EDLL  KGM +A +  L+G SAGGL  I+HCD F       T VKC+S+ G+
Sbjct  147   ARIFRAVIEDLLA-KGMGNAQNAILSGCSAGGLTSILHCDNFHALLPAGTNVKCVSDAGY  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F++ K  + AQ +E  F  +++ H S   LP  C    +   LC FPQ++A  I+T +F 
Sbjct  206   FINVKDVSGAQHIEELFSQVVETHGSARNLPPSCTSKLRPG-LCFFPQYMASQIQTRIFF  264

Query  472   MVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVAL-RETDS  320
             + + YDS+ I + L+ G  +         +  K+ S TQ KA+++ R+Q L A+   T  
Sbjct  265   VNAAYDSWQIKNILAPGVADPHGTWHECKLDIKNCSPTQLKAMQDFRVQFLSAVGGMTGC  324

Query  319   PSRGLFVSNCFGH--TQLIFYWNHPGFEV-NYRKDVEVVRDWYFDR  191
             P +G+F+ +C+ H  T++   W      V N     + V DW++ R
Sbjct  325   PLKGMFIDSCYAHCQTEMQETWLMADSPVLNKTTIAQAVGDWFYGR  370



>ref|XP_010235850.1| PREDICTED: protein notum homolog isoform X1 [Brachypodium distachyon]
 ref|XP_010235851.1| PREDICTED: protein notum homolog isoform X1 [Brachypodium distachyon]
Length=395

 Score =   263 bits (673),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 153/366 (42%), Positives = 202/366 (55%), Gaps = 23/366 (6%)
 Frame = -3

Query  1207  FTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKT  1028
             F  + T ++SAV+ GAVCLDGS PAY   +G G G   W+V+  GG WCS+++ C  RK 
Sbjct  27    FFVDITYVDSAVAKGAVCLDGSAPAYHLARGFGSGVDSWLVHFEGGGWCSNVTTCLERKN  86

Query  1027  SHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTG  848
             + LGSS           F GIL      N +F NWNKV V YCDGSSFTGD E V+PTT 
Sbjct  87    TRLGSSKEMA---KQVAFSGILSNTPDHNPDFYNWNKVRVRYCDGSSFTGDKEEVDPTTK  143

Query  847   LHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCL  668
             LH+RG R++ AV+EDLL  KGM  A +  ++G SAGGL  ++HCDRF +R      VKCL
Sbjct  144   LHYRGARVWQAVMEDLLA-KGMDRAENALISGCSAGGLTSVLHCDRFRDRMPVEANVKCL  202

Query  667   SNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIR  488
             S+ GFF+  K  A  +     F  ++  H S   LP  C        +C+FPQ+  K I+
Sbjct  203   SDAGFFIDVKDIAGEKHAADFFNDVVTTHGSAKNLPSSCTSKLPPG-MCLFPQNEVKQIQ  261

Query  487   TPLFIMVSTYDSYLINHTLSTGFYEA--VKSKH----ISATQYKALKELRLQMLVALRET  326
             TPLFI+ + YDS+ + + L  G  +      KH     S  Q K L+  R   L AL E 
Sbjct  262   TPLFILNAAYDSWQVRNILVPGGSDPHWRSCKHDINQCSEKQLKTLQGFRDDFLKALEEQ  321

Query  325   -DSPSRGLFVSNCFGHTQ--LIFYWNHPGFEV-NYRKDVEVVRDWYFDRINHVQEVEQST  158
               S SRGLF+++CF H Q  +   W  P   V   +K    + DW++DR +  QE+    
Sbjct  322   GSSSSRGLFINSCFAHCQSEIQEIWFAPDSPVLGNKKIANAIGDWFYDR-SPFQEI----  376

Query  157   LVKDCP  140
                DCP
Sbjct  377   ---DCP  379



>ref|NP_193677.2| putative pectinacetylesterase [Arabidopsis thaliana]
 gb|AAT70429.1| At4g19420 [Arabidopsis thaliana]
 gb|AAU45212.1| At4g19420 [Arabidopsis thaliana]
 gb|AEE84180.1| putative pectinacetylesterase [Arabidopsis thaliana]
Length=397

 Score =   263 bits (673),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 144/349 (41%), Positives = 208/349 (60%), Gaps = 19/349 (5%)
 Frame = -3

Query  1198  NSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHL  1019
             N T + +AV+ GAVCLDGSPPAY   +G G G   W++ L GG WC++++ C +R  + L
Sbjct  26    NITFVRNAVAKGAVCLDGSPPAYHLDRGSGTGINSWLIQLEGGGWCNNVTNCVSRMHTRL  85

Query  1018  GSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHF  839
             GSS +   N     F  IL      N +F NWN+V V YCDG+SFTGDVE VNP T LHF
Sbjct  86    GSSKKMVEN---LAFSAILSNKKQYNPDFYNWNRVKVRYCDGASFTGDVEAVNPATNLHF  142

Query  838   RGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNG  659
             RG R++ AV+++LL  KGM +A +  L+G SAGGLA ++HCD F       T VKCLS+ 
Sbjct  143   RGARVWLAVMQELLA-KGMINAENAVLSGCSAGGLASLMHCDSFRALLPMGTKVKCLSDA  201

Query  658   GFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPL  479
             GFFL+++  +  Q +++ F  ++ LH S   LP  C      A +C FPQ+VA+ IRTPL
Sbjct  202   GFFLNTRDVSGVQYIKTYFEDVVTLHGSAKNLPRSCTSRLTPA-MCFFPQYVARQIRTPL  260

Query  478   FIMVSTYDSYLINHTLST------GFYEAVK--SKHISATQYKALKELRLQMLVALRETD  323
             FI+ + YDS+ I + L+       G +++ +   K+   +Q K +++ RL+ L A+    
Sbjct  261   FILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIKNCHPSQIKVMQDFRLEFLSAVIGLG  320

Query  322   -SPSRGLFVSNCFGH----TQLIFYWNHPGFEVNYRKDVEVVRDWYFDR  191
              S SRG+F+ +C+ H    TQ  ++W      +N     + V DW +DR
Sbjct  321   RSSSRGMFIDSCYTHCQTETQTSWFWQDSPI-LNRTTIAKAVGDWVYDR  368



>ref|XP_009350399.1| PREDICTED: protein notum homolog [Pyrus x bretschneideri]
Length=398

 Score =   263 bits (673),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 140/346 (40%), Positives = 209/346 (60%), Gaps = 17/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T++E+AV+ GAVCLDGS PAY F KG G G   W+V++ GG WC+S++ C +RK ++ GS
Sbjct  30    TLVENAVAKGAVCLDGSAPAYHFDKGFGAGINNWLVHIEGGGWCNSVATCLDRKNNYRGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +    +   +F G+L      N +F NWN++ V YCDGSSFTGDVE V+P T LHFRG
Sbjct  90    STKM---EKTMSFSGVLGNKQQTNPDFYNWNRIKVRYCDGSSFTGDVEAVDPATNLHFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R+F A+++DLL  KGM++A    L+G SAGGLA I+HCD F +     T VKCL++ G+
Sbjct  147   ARVFRAIIDDLLA-KGMKNAQTALLSGCSAGGLASILHCDNFHSLLPVGTKVKCLADAGY  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+++K  + +Q +++ +  ++ LH S   LP  C        LC FPQ+V    RTP+F 
Sbjct  206   FINAKTLSGSQYIQTFYSEVVALHGSAKNLPASCTSRMSPG-LCFFPQNVVPQTRTPIFF  264

Query  472   MVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALR-ETDS  320
             + + YDS+ I + L+ G  +         +  K+ S +Q + ++E RLQ L A+   + S
Sbjct  265   VNAAYDSWQIKNILAPGVADPKGAWKNCKLSIKNCSPSQLQTMQEYRLQFLNAIAGASSS  324

Query  319   PSRGLFVSNCFGHTQLIFY--WNHPGFEVNYRKDV-EVVRDWYFDR  191
              S GLF+ +C+ H Q+     W      +  +  + + V DWY+DR
Sbjct  325   SSNGLFIDSCYAHCQIGTQETWLATDSPMLSKTTIAKAVGDWYYDR  370



>emb|CAA67728.1| pectinacetylesterase precursor [Vigna radiata var. radiata]
Length=399

 Score =   263 bits (672),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 148/377 (39%), Positives = 208/377 (55%), Gaps = 29/377 (8%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T +E+AV+ GAVCLDGSPPAY F KG G G   WIV+  GG WC++++ C +R+ + LGS
Sbjct  30    TFVENAVAKGAVCLDGSPPAYHFHKGSGAGINNWIVHFEGGGWCNNVTSCLSRRDTRLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +    D+  +F G    +   N +F +WN++ V YCDGSSFTGDVE V+P T LHFRG
Sbjct  90    SKKM---DTQLSFSGFFSNSKKFNPDFYDWNRIKVRYCDGSSFTGDVEAVDPATNLHFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R+F AVV+DLL  KGM++A +  ++G SAGGLA I++CDRF +    +T VKCL++ G+
Sbjct  147   SRVFAAVVDDLLA-KGMKNAQNAIISGCSAGGLAAILNCDRFKSLLPRTTKVKCLADAGY  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F++ K  + AQ +E  +  ++  H S   LP  C    +   LC FPQ+V   I TP+F 
Sbjct  206   FINVKDVSGAQRIEEFYSQVVQTHGSAKNLPASCTSRLRPG-LCFFPQNVVSQISTPIFF  264

Query  472   MVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALRET-DS  320
             + + YDS+ I + L+ G  +         +  K  S+ Q  A++  R   L A     +S
Sbjct  265   VNAAYDSWQIKNILAPGAADPHGTWRECKLDIKKCSSNQLSAMQVFRTDFLRAFGAVGNS  324

Query  319   PSRGLFVSNCFGHTQLIFYWNHPGFEVNYRKDVEV---------VRDWYFDRINHVQEVE  167
             PS+G F+  C+ H Q          E   R D  V         V DWY+DR    Q   
Sbjct  325   PSKGHFIDGCYAHCQTGTQ------ETWLRNDSPVLGSTTIAKAVGDWYYDRKPFKQIDC  378

Query  166   QSTLVKDCPNNTFIEEE  116
                    C N  F + E
Sbjct  379   AYPCNPTCHNRIFDQNE  395



>ref|XP_010434420.1| PREDICTED: protein notum homolog [Camelina sativa]
 ref|XP_010434421.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=397

 Score =   263 bits (672),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 144/349 (41%), Positives = 209/349 (60%), Gaps = 19/349 (5%)
 Frame = -3

Query  1198  NSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHL  1019
             N T + +AV+ GAVCLDGSPPAY   +G G G   W++ L GG WC++++ C +R  + L
Sbjct  26    NITYVRNAVAKGAVCLDGSPPAYHLDRGSGTGINSWLIQLEGGGWCNNVTNCLSRMHTRL  85

Query  1018  GSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHF  839
             GSS +   N     F  IL      N +F NWN+V V YCDGSSFTGDV+ VNP T LHF
Sbjct  86    GSSKKMVEN---LAFSAILSNKKQYNPDFYNWNRVKVRYCDGSSFTGDVQAVNPATNLHF  142

Query  838   RGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNG  659
             RG RI+ AV+++LL  KGM++A +  L+G SAGGLA ++HCD F       + VKCLS+ 
Sbjct  143   RGARIWLAVMQELLA-KGMRNAENAVLSGCSAGGLASLMHCDSFRALLPMGSRVKCLSDA  201

Query  658   GFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPL  479
             GFFL+++  +  Q ++  F+ ++ LH S   LP  C      A +C FPQ+VA+ IRTPL
Sbjct  202   GFFLNTRDVSGVQYIKQYFQDVVTLHGSAKNLPRSCTSRLTPA-MCFFPQYVARQIRTPL  260

Query  478   FIMVSTYDSYLINHTLST------GFYEAVK--SKHISATQYKALKELRLQMLVA-LRET  326
             FI+ + YDS+ I + L+       G +++ +   K+   +Q K +++ RL+ L A +   
Sbjct  261   FILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIKNCHPSQLKVMQDFRLEFLSAVIGLG  320

Query  325   DSPSRGLFVSNCFGH----TQLIFYWNHPGFEVNYRKDVEVVRDWYFDR  191
              S SRG+F+ +C+ H    TQ  ++W      +N     + V DW +DR
Sbjct  321   RSSSRGMFIDSCYTHCQTETQTSWFWQDSPI-LNRTTIAKAVGDWVYDR  368



>ref|XP_009776988.1| PREDICTED: uncharacterized protein LOC104226656 isoform X2 [Nicotiana 
sylvestris]
Length=386

 Score =   262 bits (670),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 152/384 (40%), Positives = 218/384 (57%), Gaps = 25/384 (7%)
 Frame = -3

Query  1273  LNTTFILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQR  1094
             +   +++L+ +L     T  +     +T LESA++ GAVCLDGS PA+ F  G G G   
Sbjct  1     MAAVYVVLVSLLFIW-TTTEANLIVYTTFLESAIAKGAVCLDGSAPAFNFHPGTGSGVYN  59

Query  1093  WIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFN-FKGILDFNCAENSEFCNWNK  917
             W++ L GG WC S S+C +R T+  G+S     N S    F G+L  +   N +F NWN+
Sbjct  60    WLIQLQGGGWCDSASDCQDRATNGYGTSK----NISKIGYFMGVLSNDSQLNPDFYNWNR  115

Query  916   VVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGG  737
             + V YCDGSS+TGD+E V+P T LHFRG RIF A++++LL +KGM  A +  L+G SAGG
Sbjct  116   IKVRYCDGSSYTGDIEEVDPATNLHFRGARIFKAIMDELLYHKGMIYAENAILSGTSAGG  175

Query  736   LAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPE  557
             L  I+HCD+F   F  +  VKC+S+ GFF+++K       ++  F+ ++ LH S   LP 
Sbjct  176   LGAILHCDKFRLFFSLTARVKCISDAGFFINAKTITDEPHIKEYFKRVVALHGSAKNLPL  235

Query  556   PCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKHI-----  392
              C        LC FPQ+ A+ I TPLFI+ S YDS+ IN++L     +    +H+     
Sbjct  236   SCTFLSLDPSLCFFPQYAAQHICTPLFIINSAYDSWQINNSLVP---QEADPRHVWDFCK  292

Query  391   ------SATQYKALKELRLQMLVALRET-DSPSRGLFVSNCFGH--TQLIFYWNHPGFEV  239
                   S +Q + L++ RL  L AL E   S SRG F+S+C  H   +   YW++     
Sbjct  293   GNINNCSLSQIQTLQDFRLTFLEALNELGPSTSRGYFISSCHSHKGIEAQAYWSYNNSPT  352

Query  238   NYRKDV-EVVRDWYFDRINHVQEV  170
                K + E V DW+FDR +  QEV
Sbjct  353   LANKTIAEAVGDWFFDR-SGFQEV  375



>ref|XP_010449357.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=397

 Score =   263 bits (671),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 144/349 (41%), Positives = 209/349 (60%), Gaps = 19/349 (5%)
 Frame = -3

Query  1198  NSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHL  1019
             N T + +AV+ GAVCLDGSPPAY   +G G G   W++ L GG WC++++ C +R  + L
Sbjct  26    NITYVRNAVAKGAVCLDGSPPAYHLHRGSGTGVNSWLIQLEGGGWCNNVTNCLSRMHTRL  85

Query  1018  GSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHF  839
             GSS +   N     F  IL      N +F NWN+V V YCDGSSFTGDV+ VNP T LHF
Sbjct  86    GSSKKMVEN---LAFSAILSNKKQYNPDFYNWNRVKVRYCDGSSFTGDVQAVNPATNLHF  142

Query  838   RGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNG  659
             RG RI+ AV+++LL  KGM++A +  L+G SAGGLA ++HCD F       + VKCLS+ 
Sbjct  143   RGARIWLAVMQELLA-KGMRNAENAVLSGCSAGGLASLMHCDSFRALLPMGSRVKCLSDA  201

Query  658   GFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPL  479
             GFFL+++  +  Q ++  F+ ++ LH S   LP  C      A +C FPQ+VA+ IRTPL
Sbjct  202   GFFLNTRDVSGVQYIKQYFQDVVTLHGSAKNLPRSCTSRLTPA-MCFFPQYVARQIRTPL  260

Query  478   FIMVSTYDSYLINHTLST------GFYEAVK--SKHISATQYKALKELRLQMLVA-LRET  326
             FI+ + YDS+ I + L+       G +++ +   K+   +Q K +++ RL+ L A +   
Sbjct  261   FILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIKNCHPSQLKVMQDFRLEFLSAVIGLG  320

Query  325   DSPSRGLFVSNCFGH----TQLIFYWNHPGFEVNYRKDVEVVRDWYFDR  191
              S SRG+F+ +C+ H    TQ  ++W      +N     + V DW +DR
Sbjct  321   RSSSRGMFIDSCYTHCQTETQTSWFWQDSPI-LNRTTIAKAVGDWVYDR  368



>gb|KEH20327.1| pectinacetylesterase family protein [Medicago truncatula]
Length=393

 Score =   262 bits (670),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 145/367 (40%), Positives = 206/367 (56%), Gaps = 25/367 (7%)
 Frame = -3

Query  1204  TTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTS  1025
             T   T ++SAV+ GAVCLDGSPPAY F KG   G   WIV+  GG WC++ + C +R  +
Sbjct  27    TVPITFVQSAVAKGAVCLDGSPPAYHFDKGFEAGIDNWIVHFEGGGWCNNATTCLDRIDT  86

Query  1024  HLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGL  845
              LGSS +    D   +F G        N +F NWN++ V YCDGSSFTGDVE V+P T L
Sbjct  87    RLGSSKKM---DKTLSFSGFFSSGKKFNPDFYNWNRIKVRYCDGSSFTGDVEAVDPKTNL  143

Query  844   HFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLS  665
             H+RG RIF AV+EDLL  KGM++A +  L+G SAGGL  I+ CDRF      +  VKC+S
Sbjct  144   HYRGGRIFVAVIEDLLA-KGMKNAKNAILSGCSAGGLTSILQCDRFRTLLPAAAKVKCVS  202

Query  664   NGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRT  485
             + G+F++ K  + A  +E  +  ++  H S   LP  C        LC FPQ+VA  I+T
Sbjct  203   DAGYFINVKAVSGASHIEQFYSQVVQTHGSAKNLPSSCTSRLSPG-LCFFPQNVAAQIKT  261

Query  484   PLFIMVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALR-  332
             P+F + + YDS+ I + L+ G  +         +  K  SA Q   ++  R + L A+  
Sbjct  262   PIFFVNAAYDSWQIKNILAPGVADPHGTWRNCKLDIKSCSANQLSTMQGFRTEFLKAISV  321

Query  331   ETDSPSRGLFVSNCFGHTQ--LIFYWNHPGFEVNYRKDV-EVVRDWYFDRINHVQEVEQS  161
              ++SPS+G+F+  C+ H Q  +   W      V  +  + + V DWY+DR +  Q++   
Sbjct  322   VSNSPSKGMFIDGCYSHCQTGMQETWMRTDSPVLAKTTIAKAVGDWYYDR-STFQQI---  377

Query  160   TLVKDCP  140
                 DCP
Sbjct  378   ----DCP  380



>ref|XP_010911666.1| PREDICTED: protein notum homolog [Elaeis guineensis]
Length=388

 Score =   262 bits (670),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 143/380 (38%), Positives = 213/380 (56%), Gaps = 33/380 (9%)
 Frame = -3

Query  1207  FTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKT  1028
             F    T+++ AV+ GAVCLDGSPPAY F  G G G   W+V++ GG WCS++ EC  R  
Sbjct  24    FDVPLTLVQDAVAKGAVCLDGSPPAYHFAPGFGSGVDNWLVHMEGGGWCSNVEECKQRTK  83

Query  1027  SHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTG  848
             +  GSS          +F GIL      + +F NWNKV + YCDGSSFTGD+E VNP T 
Sbjct  84    NFRGSSKYM----EQLSFSGILGNKQTSSPDFYNWNKVKIRYCDGSSFTGDIEAVNPATN  139

Query  847   LHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCL  668
             LHFRG R++ A++++LL  KGM  A +  L+G SAGGLA I+HCD F +      TVKC 
Sbjct  140   LHFRGARVWRAIMDELLA-KGMNKAQNALLSGCSAGGLASILHCDSFRDLLPAGATVKCF  198

Query  667   SNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIR  488
             S+ G+F+ +K  +  + ++  +  ++ +H S   LP  C  +   + +C FPQ+V + +R
Sbjct  199   SDAGYFIDAKDVSGKESIKDFYSQVVTIHGSAKNLPSSCTSSFPPS-MCFFPQYVVQSMR  257

Query  487   TPLFIMVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALR  332
             TPLFI+ + YD++ I + L+    +  K         K  S++Q + L++ R + L AL 
Sbjct  258   TPLFILNAAYDAWQIKNILAPSPSDPSKVWGECKLDIKKCSSSQLQVLQDFRSEFLHAL-  316

Query  331   ETDSPSRGLFVSNCFGHTQ-----LIFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVE  167
               +SPS GLF+ +C+ H Q          N P   ++     + V DW++ R + +Q++ 
Sbjct  317   PANSPSTGLFIDSCYSHCQSGAQETWLSSNSPA--IDKMSIAKAVGDWFYGR-SAIQKI-  372

Query  166   QSTLVKDCP---NNTFIEEE  116
                   DCP   N T +  E
Sbjct  373   ------DCPYPCNPTCVNRE  386



>ref|XP_002865253.1| pectin acetylesterase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41512.1| pectin acetylesterase [Arabidopsis lyrata subsp. lyrata]
Length=391

 Score =   262 bits (670),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 147/385 (38%), Positives = 219/385 (57%), Gaps = 25/385 (6%)
 Frame = -3

Query  1273  LNTTFILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQR  1094
             L ++F++L VV+        +Y       LESAV+ GAVCLDGS PAY F KG G G   
Sbjct  7     LWSSFLVLAVVVIGARAVPITY-------LESAVAKGAVCLDGSAPAYHFDKGSGSGANN  59

Query  1093  WIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKV  914
             WIV++ GG WC+ I+ C  RK++  GSS      +  F F GIL    + N +F NWN++
Sbjct  60    WIVHMEGGGWCTDIATCVQRKSTMKGSSKLM---NKDFGFSGILGGKQSTNPDFYNWNRI  116

Query  913   VVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGL  734
              V YCDGSSFTGD+E V+PT  L FRG R++ AV++DL+  KGM +A +  L+G SAG L
Sbjct  117   KVRYCDGSSFTGDIEAVDPTNKLFFRGARVWRAVIDDLMA-KGMSNAQNAILSGCSAGAL  175

Query  733   AVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEP  554
             A I+HCD+F +    +  VKC+S+ G+F+H K       ++S +  ++  H S   LP  
Sbjct  176   AAILHCDQFKSILPKTAKVKCVSDAGYFIHGKDITGGSYIQSYYAKVVATHGSAKSLPVS  235

Query  553   CRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKS--------K  398
             C  + +   LC FPQ+VA+ ++TPLF++ + +DS+ I + L+    +  K+        K
Sbjct  236   CTSSMK-PELCFFPQYVAQTLQTPLFVINAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLK  294

Query  397   HISATQYKALKELRLQMLVALRETDS-PSRGLFVSNCFGHTQ---LIFYWNHPGFEVNYR  230
               +A Q + ++  R Q+L AL    S  + GLF+ +C  H Q      +    G  V   
Sbjct  295   KCTAAQLQTVQGYRDQVLAALAPVRSDTTSGLFLDSCHAHCQGGSAATWSGDGGPTVANT  354

Query  229   KDVEVVRDWYFDRINHVQEVEQSTL  155
             K  + V DW+F+R +  Q ++ S+L
Sbjct  355   KMAKAVGDWFFER-STFQNIDCSSL  378



>ref|XP_009397056.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009397057.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=393

 Score =   262 bits (670),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 137/345 (40%), Positives = 201/345 (58%), Gaps = 17/345 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T+L SAV+ GAVCLDGSPPAY F  G G G   W+V++ GG WC ++ EC  RK +  GS
Sbjct  33    TLLHSAVAKGAVCLDGSPPAYHFSPGSGSGANNWLVHMEGGGWCRNVEECLERKNNFRGS  92

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S+         +F GIL  +   N +F NWN++ + YCDGSSFTGDVE V+P T LH+RG
Sbjct  93    SNHM----KPLSFSGILGNSKKSNPDFYNWNRIKIRYCDGSSFTGDVERVDPATNLHYRG  148

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R++ A++EDLL+ KGM  A +  L+G SAGGLA I+HCD+F +    S  VKC S+ G+
Sbjct  149   ARVWLAIMEDLLL-KGMNRAENALLSGCSAGGLASILHCDKFRSLLPASAKVKCFSDAGY  207

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+  K  +    + S +  +++LH S   LP  C      + +C FPQ+V   + TPLFI
Sbjct  208   FIDGKDISGTTSVRSLYNDVVNLHGSGKNLPSSCTSRLSPS-MCFFPQNVVPKMSTPLFI  266

Query  472   MVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRETDSP  317
             + + YD++ I +TL+    +  KS        K  S+ Q + ++E R + L AL  + +P
Sbjct  267   LNAAYDAWQIKNTLAPSSADPRKSWNACKLNIKSCSSDQLEKMQEFRSEFLRALPASGNP  326

Query  316   SRGLFVSNCFGHTQLIFYWNHPGFE---VNYRKDVEVVRDWYFDR  191
             S G+F+ +C+ H Q        G +   ++     + V DW++ R
Sbjct  327   STGMFIISCYAHCQSGSQDTWLGADSPMIDKMPIAKAVGDWFYGR  371



>ref|XP_003628995.1| Notum-like protein [Medicago truncatula]
Length=396

 Score =   262 bits (670),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 145/367 (40%), Positives = 206/367 (56%), Gaps = 25/367 (7%)
 Frame = -3

Query  1204  TTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTS  1025
             T   T ++SAV+ GAVCLDGSPPAY F KG   G   WIV+  GG WC++ + C +R  +
Sbjct  30    TVPITFVQSAVAKGAVCLDGSPPAYHFDKGFEAGIDNWIVHFEGGGWCNNATTCLDRIDT  89

Query  1024  HLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGL  845
              LGSS +    D   +F G        N +F NWN++ V YCDGSSFTGDVE V+P T L
Sbjct  90    RLGSSKKM---DKTLSFSGFFSSGKKFNPDFYNWNRIKVRYCDGSSFTGDVEAVDPKTNL  146

Query  844   HFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLS  665
             H+RG RIF AV+EDLL  KGM++A +  L+G SAGGL  I+ CDRF      +  VKC+S
Sbjct  147   HYRGGRIFVAVIEDLLA-KGMKNAKNAILSGCSAGGLTSILQCDRFRTLLPAAAKVKCVS  205

Query  664   NGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRT  485
             + G+F++ K  + A  +E  +  ++  H S   LP  C        LC FPQ+VA  I+T
Sbjct  206   DAGYFINVKAVSGASHIEQFYSQVVQTHGSAKNLPSSCTSRLSPG-LCFFPQNVAAQIKT  264

Query  484   PLFIMVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALR-  332
             P+F + + YDS+ I + L+ G  +         +  K  SA Q   ++  R + L A+  
Sbjct  265   PIFFVNAAYDSWQIKNILAPGVADPHGTWRNCKLDIKSCSANQLSTMQGFRTEFLKAISV  324

Query  331   ETDSPSRGLFVSNCFGHTQ--LIFYWNHPGFEVNYRKDV-EVVRDWYFDRINHVQEVEQS  161
              ++SPS+G+F+  C+ H Q  +   W      V  +  + + V DWY+DR +  Q++   
Sbjct  325   VSNSPSKGMFIDGCYSHCQTGMQETWMRTDSPVLAKTTIAKAVGDWYYDR-STFQQI---  380

Query  160   TLVKDCP  140
                 DCP
Sbjct  381   ----DCP  383



>ref|XP_004172255.1| PREDICTED: protein notum homolog [Cucumis sativus]
 gb|KGN53459.1| hypothetical protein Csa_4G056500 [Cucumis sativus]
Length=398

 Score =   262 bits (670),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 138/346 (40%), Positives = 206/346 (60%), Gaps = 17/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T ++ AV  GAVCLDGSPPAY F  G G G   W++ L GG WC++++ C  R+ + LGS
Sbjct  30    TYVQDAVIKGAVCLDGSPPAYHFSDGFGSGINNWLIQLEGGGWCNNVTTCLQRRDTRLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +     +   F GIL      N +F NWN++ V YCDGSSFTGDVE V+  T LHFRG
Sbjct  90    SKKMV---TQLAFSGILSNKPQFNPDFYNWNRIKVRYCDGSSFTGDVEAVDSATNLHFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R+F A++++LL  KGM++A +  L+G SAGGL+ I+HCD F +    +T VKCLS+ G+
Sbjct  147   ARVFRAIIDNLLA-KGMKNAKNAILSGCSAGGLSSILHCDNFKSLLPPTTKVKCLSDAGY  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+++K  + AQ +E  +  ++  H S   LP  C    +   +C FPQ+V + I+TP+F+
Sbjct  206   FINAKDVSGAQHIEGFYSDVVTTHGSAKNLPISCTSKMK-PEMCFFPQNVVQLIQTPIFL  264

Query  472   MVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALRETDSP  317
             + + YDS+ I + L+ G  +         +  K+ S  Q + +++ R+Q L AL    S 
Sbjct  265   VNAAYDSWQIKNILAPGVADPHGTWHECKLDIKNCSPIQLRTMQDFRVQFLSALNGVGSS  324

Query  316   -SRGLFVSNCFGH--TQLIFYWNHPGFEVNYRKDV-EVVRDWYFDR  191
              SRGLF+ +C+ H  T++   W      V  +  + + V DW+FDR
Sbjct  325   LSRGLFIDSCYAHCQTEMQETWLRTDSPVLSKTTIAKAVGDWFFDR  370



>gb|EYU37455.1| hypothetical protein MIMGU_mgv1a007934mg [Erythranthe guttata]
Length=390

 Score =   262 bits (669),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 143/367 (39%), Positives = 208/367 (57%), Gaps = 26/367 (7%)
 Frame = -3

Query  1198  NSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHL  1019
             N T +++AV+ GAVCLDGSPPAY   +G G G   W+V + GG WC++++ C  RKT+ L
Sbjct  22    NITYVQTAVAKGAVCLDGSPPAYHLDRGFGAGVNNWLVQIEGGGWCNNVTTCLARKTNRL  81

Query  1018  GSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHF  839
             GSS +         F  IL      N +F NWN+V + YCDGSSFTGDVE V+P T L++
Sbjct  82    GSSKQMI---KQLAFSAILSDKPQFNPDFYNWNRVKIRYCDGSSFTGDVEAVDPVTKLYY  138

Query  838   RGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNG  659
             RG R+F AV+E+LL  KGM++A +  L+G SAGGLA I+HCD F       T VKC S+ 
Sbjct  139   RGARVFVAVMEELLA-KGMKNAQNAVLSGCSAGGLASILHCDSFKALLPVRTKVKCFSDA  197

Query  658   GFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPL  479
             G+F+++K  + A  +E+ F  ++  H S   LP  C    + + LC FPQ+V+K+IRTPL
Sbjct  198   GYFINTKDISAADHIEAYFNDVVTTHGSAKNLPISCTSKMKPS-LCFFPQYVSKEIRTPL  256

Query  478   FIMVSTYDSYLINHTLSTGFYEAVKSKH--------ISATQYKALKELRLQMLVALRETD  323
             F++ + YDS+ I + L+ G  +     H         S  Q + ++  RL+ L A+    
Sbjct  257   FVINAAYDSWQIKNILAPGVADPHGIWHDCKTDITKCSTDQLRTMQGFRLEFLKAISSGL  316

Query  322   SP---SRGLFVSNCFGHTQLIFYWNHPGFE---VNYRKDVEVVRDWYFDRINHVQEVEQS  161
              P   +RG F+++C+ H Q     N    +   +N +   + V DW++D     Q     
Sbjct  317   GPLINTRGYFINSCYAHCQTEMQENWFAIDSPKLNNKTIAKAVGDWFYDTSEPFQR----  372

Query  160   TLVKDCP  140
                 DCP
Sbjct  373   ---GDCP  376



>ref|XP_010233620.1| PREDICTED: protein notum homolog [Brachypodium distachyon]
Length=391

 Score =   262 bits (669),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 149/380 (39%), Positives = 210/380 (55%), Gaps = 23/380 (6%)
 Frame = -3

Query  1249  IVVLHQQPQTANSYFT-----TNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIV  1085
             + V HQQP       +        T+L  A   GAVCLDG+P AY   +G G G   W++
Sbjct  1     MAVDHQQPAAPPPVSSRLPEPVALTLLAGAQEKGAVCLDGTPAAYHLLRGSGAGSNSWLI  60

Query  1084  YLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVH  905
             +L GG WCS++SEC+NR+ S LGSS  ++     F   GIL  +  +N +F NWN+  V 
Sbjct  61    HLEGGGWCSTVSECSNRRMSQLGSS--KFMKPLQFGGYGILGSDQLQNPDFYNWNRAYVR  118

Query  904   YCDGSSFTGDVE-TVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAV  728
             YCDG SF+GD E      T LHFRG R+++AV+++L+  KG+ +AT   LTG SAGGLA 
Sbjct  119   YCDGGSFSGDSEGQAQDGTTLHFRGLRVYEAVIDELM-GKGLANATQALLTGCSAGGLAT  177

Query  727   IIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCR  548
             I+HCD F+ RF +  +VKCL + GFFL +K  +  +   S + G++ L N   VLP+ C 
Sbjct  178   ILHCDDFSARFPHKVSVKCLPDAGFFLDAKDISGERSFWSVYDGVVHLQNVKQVLPKDCL  237

Query  547   KNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKS--------KHI  392
              + +    C FP  + K IRTP+FI+ S YDS+ I + L  G     KS         + 
Sbjct  238   ASKEPTE-CFFPAEIIKSIRTPMFILNSAYDSWQIQNVLVPGSSAPDKSWLSCKGNIINC  296

Query  391   SATQYKALKELRLQMLVALRET--DSPSRGLFVSNCFGHTQLIF--YWNHP-GFEVNYRK  227
             ++TQ + L   R  M+  L+    D    GLF+ +CF H Q +F   WN P    +    
Sbjct  297   NSTQIEVLHGFRNAMVDDLKLVVEDKQDWGLFIDSCFTHCQTLFGISWNSPISPRLGNES  356

Query  226   DVEVVRDWYFDRINHVQEVE  167
               E V +WYF R   V+E++
Sbjct  357   IAEAVGNWYFGRSKRVREID  376



>ref|XP_010494620.1| PREDICTED: uncharacterized protein LOC104771742 [Camelina sativa]
Length=391

 Score =   261 bits (668),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 145/390 (37%), Positives = 219/390 (56%), Gaps = 26/390 (7%)
 Frame = -3

Query  1288  KMGTLLNTTFILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIG  1109
             K+  L ++  +L +VV+  +            T LESAV+ GAVCLDGS PAY F KG G
Sbjct  3     KLKQLWSSFLVLAVVVIGAR--------AVPITYLESAVAKGAVCLDGSAPAYHFDKGSG  54

Query  1108  EGRQRWIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFC  929
              G   WIV++ GG WC+ I+ C  RK++  GSS      +  F F GIL    + N +F 
Sbjct  55    SGVNNWIVHMEGGGWCTDIATCVQRKSTMKGSSKLM---NKDFGFSGILGGKQSTNPDFY  111

Query  928   NWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGG  749
             NWN++ V YCDGSSFTGD+E V+P   L FRG R++ AV++DL+  KGM +A +  L+G 
Sbjct  112   NWNRIKVRYCDGSSFTGDIEAVDPANKLFFRGARVWRAVIDDLMA-KGMSNAQNAILSGC  170

Query  748   SAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTA  569
             SAG LA I+HCD+F +    +  VKC+S+ G+F+H K  +    ++S +  ++  H S  
Sbjct  171   SAGALAAILHCDQFKSILPKTAKVKCVSDAGYFIHGKDISGGSYIQSYYGKVVATHGSAK  230

Query  568   VLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKS----  401
              LP  C    +   LC FPQ+VAK ++TPLF++ + +DS+ I + L+    +  K+    
Sbjct  231   SLPASCTSTMK-PELCFFPQYVAKTLQTPLFVINAAFDSWQIKNVLAPTSVDKSKAWKTC  289

Query  400   ----KHISATQYKALKELRLQMLVALRETDSP-SRGLFVSNCFGHTQ---LIFYWNHPGF  245
                 K  +A Q + ++  R Q+L AL    +  + GLF+ +C  H Q      +    G 
Sbjct  290   KLDLKKCTAAQLQTVQGYRDQVLAALAPVRAATTSGLFLDSCHAHCQGGSAATWSGDKGP  349

Query  244   EVNYRKDVEVVRDWYFDRINHVQEVEQSTL  155
              V   K  + V DW+++R +  Q ++ S+L
Sbjct  350   TVANTKMAKAVGDWFYER-STFQNIDCSSL  378



>ref|XP_008451860.1| PREDICTED: protein notum homolog isoform X1 [Cucumis melo]
Length=401

 Score =   261 bits (668),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 137/346 (40%), Positives = 206/346 (60%), Gaps = 17/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T ++ A   GAVCLDGSPPAY F  G G G   W++ L GG WC++++ C  R+ + LGS
Sbjct  33    TYVQDAGIKGAVCLDGSPPAYHFSDGFGSGINNWLIQLEGGGWCNNVTTCLQRRDTRLGS  92

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +     +   F GIL      N +F NWN++ V YCDGSSFTGDVE V+P T LHFRG
Sbjct  93    SKKMV---TQLAFSGILSNKPQFNPDFYNWNRIKVRYCDGSSFTGDVEAVDPATNLHFRG  149

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R+F A++++LL  KGM++A +  L+G SAGGL+ I+HCD F +    +T VKCLS+ G+
Sbjct  150   ARVFRAIIDNLLA-KGMKNAKNAILSGCSAGGLSSILHCDNFKSLLPPTTKVKCLSDAGY  208

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+++K  + AQ +E  +  ++  H S   LP  C    +   +C FPQ+V + I+TP+F+
Sbjct  209   FINAKDVSGAQHIEGFYSDVVTTHGSAKNLPISCTSKMK-PEMCFFPQNVVQLIQTPIFL  267

Query  472   MVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALRETDSP  317
             + + YDS+ I + L+ G  +         +  K+ S  Q + +++ R+Q L AL    S 
Sbjct  268   VNAAYDSWQIKNILAPGVADPHGTWHECKLDIKNCSPIQLRIMQDFRVQFLSALTGVGSS  327

Query  316   -SRGLFVSNCFGH--TQLIFYWNHPGFEVNYRKDV-EVVRDWYFDR  191
              SRGLF+ +C+ H  T++   W      +  +  + + V DW+FDR
Sbjct  328   LSRGLFIDSCYAHCQTEMQETWLRSDSPMLSKTPIAKAVGDWFFDR  373



>ref|XP_009612887.1| PREDICTED: uncharacterized protein LOC104106115 [Nicotiana tomentosiformis]
Length=389

 Score =   261 bits (667),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 150/364 (41%), Positives = 211/364 (58%), Gaps = 18/364 (5%)
 Frame = -3

Query  1198  NSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHL  1019
             N TIL SA++ GAVCLDGSPPAY   KG G G   WI+ + GG WC SI +C +R T+ L
Sbjct  29    NITILNSAIAEGAVCLDGSPPAYHLDKGYGSGLSSWIIVMDGGAWCQSIPDCLSRSTTEL  88

Query  1018  GSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHF  839
             GSS +Q  N S   F GIL  N   N +F NWN+V V YCDGSSFTGD+E V+P   L F
Sbjct  89    GSS-KQMKNGS--RFAGILYNNPQNNPDFYNWNRVRVKYCDGSSFTGDIEQVDPDNKLFF  145

Query  838   RGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNG  659
             RG RIF A+++DL  +KGMQ+A +  L+G SAGGLA I++CD+F +   N   VKC+++ 
Sbjct  146   RGARIFKAIMKDLW-SKGMQNAENAILSGVSAGGLATILNCDKFKSLLPNDAKVKCVADA  204

Query  658   GFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPL  479
             GFF++ K  +   D++  ++ ++ LH S   LP  C    + + LC FPQ+V   + TPL
Sbjct  205   GFFINGKTISGTSDIQEMYQRVVTLHGSAKNLPPSCTSAMEPS-LCFFPQNVVPYVETPL  263

Query  478   FIMVSTYDSYLINHTLSTGFYEAVK-----SKHISA---TQYKALKELRLQMLVALRETD  323
             FI+ S YDS+ I + L   + +         K IS    +Q   ++   ++ L A    D
Sbjct  264   FIINSHYDSWQIENILVPKYLDPQHVWDDCKKQISNCTFSQRLIIQVFGVEFLKAFEGLD  323

Query  322   -SPSRGLFVSNCFGHTQLIF--YWNHPGFEVNYRKDV-EVVRDWYFDRINHVQEVEQSTL  155
              S +RG F+++C  H  ++   +W  P       K + E V DW+FDR    Q ++    
Sbjct  324   PSFTRGYFITSCHIHGAIMSTNFWLSPTSPRLLHKTIGEAVGDWFFDRAG-FQYIDLYPC  382

Query  154   VKDC  143
              +DC
Sbjct  383   ARDC  386



>ref|XP_006573492.1| PREDICTED: protein notum homolog isoform X2 [Glycine max]
Length=400

 Score =   261 bits (668),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 140/346 (40%), Positives = 199/346 (58%), Gaps = 17/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             TI+++AV+ GAVCLDGSPPAY F KG G G   W+V   GG WC++++ C  RKT+ LGS
Sbjct  30    TIVQNAVAKGAVCLDGSPPAYHFDKGFGSGINNWLVAFEGGGWCNNVTTCLARKTNRLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +         F GIL+     N +F NWN++ V YCDGSSFTGDVE VNP T LHFRG
Sbjct  90    SKQMA---KQIAFSGILNNRAMFNPDFYNWNRIKVRYCDGSSFTGDVEAVNPVTKLHFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RIF+AV+EDLL  KGM++A +  ++G SAGGL  ++HCDRF         VKCLS+ G+
Sbjct  147   ARIFNAVMEDLLA-KGMKNARNAIISGCSAGGLTSVLHCDRFRALLPRGARVKCLSDAGY  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+++K     Q +E  F  ++  H S   LP+ C  +   A LC FPQ++   I TP+F 
Sbjct  206   FINAKDVLGEQHIEQYFSQVVVTHGSARSLPQSC-TSRLSAKLCFFPQYLVSRITTPIFF  264

Query  472   MVSTYDSYLINHTLSTGFYEAVKSKH--------ISATQYKALKELRLQMLVALRET-DS  320
             + + YDS+ I + L+ G  +     H         S  Q   ++  R + L A+    +S
Sbjct  265   VNAAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSPDQLDLMQGFRTEFLRAITVLGNS  324

Query  319   PSRGLFVSNCFGHTQLIF---YWNHPGFEVNYRKDVEVVRDWYFDR  191
              S+G+F+ +C+ H Q      +      E+      + V DW+++R
Sbjct  325   SSKGMFIDSCYAHCQTEMQETWLRSDSPELKKTTIAKAVADWFYER  370



>ref|XP_008451861.1| PREDICTED: protein notum homolog isoform X2 [Cucumis melo]
Length=398

 Score =   261 bits (667),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 137/346 (40%), Positives = 206/346 (60%), Gaps = 17/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T ++ A   GAVCLDGSPPAY F  G G G   W++ L GG WC++++ C  R+ + LGS
Sbjct  30    TYVQDAGIKGAVCLDGSPPAYHFSDGFGSGINNWLIQLEGGGWCNNVTTCLQRRDTRLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +     +   F GIL      N +F NWN++ V YCDGSSFTGDVE V+P T LHFRG
Sbjct  90    SKKMV---TQLAFSGILSNKPQFNPDFYNWNRIKVRYCDGSSFTGDVEAVDPATNLHFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R+F A++++LL  KGM++A +  L+G SAGGL+ I+HCD F +    +T VKCLS+ G+
Sbjct  147   ARVFRAIIDNLLA-KGMKNAKNAILSGCSAGGLSSILHCDNFKSLLPPTTKVKCLSDAGY  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+++K  + AQ +E  +  ++  H S   LP  C    +   +C FPQ+V + I+TP+F+
Sbjct  206   FINAKDVSGAQHIEGFYSDVVTTHGSAKNLPISCTSKMK-PEMCFFPQNVVQLIQTPIFL  264

Query  472   MVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALRETDSP  317
             + + YDS+ I + L+ G  +         +  K+ S  Q + +++ R+Q L AL    S 
Sbjct  265   VNAAYDSWQIKNILAPGVADPHGTWHECKLDIKNCSPIQLRIMQDFRVQFLSALTGVGSS  324

Query  316   -SRGLFVSNCFGH--TQLIFYWNHPGFEVNYRKDV-EVVRDWYFDR  191
              SRGLF+ +C+ H  T++   W      +  +  + + V DW+FDR
Sbjct  325   LSRGLFIDSCYAHCQTEMQETWLRSDSPMLSKTPIAKAVGDWFFDR  370



>gb|AET03471.2| pectinacetylesterase family protein [Medicago truncatula]
Length=424

 Score =   262 bits (669),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 145/367 (40%), Positives = 206/367 (56%), Gaps = 25/367 (7%)
 Frame = -3

Query  1204  TTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTS  1025
             T   T ++SAV+ GAVCLDGSPPAY F KG   G   WIV+  GG WC++ + C +R  +
Sbjct  58    TVPITFVQSAVAKGAVCLDGSPPAYHFDKGFEAGIDNWIVHFEGGGWCNNATTCLDRIDT  117

Query  1024  HLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGL  845
              LGSS +    D   +F G        N +F NWN++ V YCDGSSFTGDVE V+P T L
Sbjct  118   RLGSSKKM---DKTLSFSGFFSSGKKFNPDFYNWNRIKVRYCDGSSFTGDVEAVDPKTNL  174

Query  844   HFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLS  665
             H+RG RIF AV+EDLL  KGM++A +  L+G SAGGL  I+ CDRF      +  VKC+S
Sbjct  175   HYRGGRIFVAVIEDLLA-KGMKNAKNAILSGCSAGGLTSILQCDRFRTLLPAAAKVKCVS  233

Query  664   NGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRT  485
             + G+F++ K  + A  +E  +  ++  H S   LP  C        LC FPQ+VA  I+T
Sbjct  234   DAGYFINVKAVSGASHIEQFYSQVVQTHGSAKNLPSSCTSRLSPG-LCFFPQNVAAQIKT  292

Query  484   PLFIMVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALR-  332
             P+F + + YDS+ I + L+ G  +         +  K  SA Q   ++  R + L A+  
Sbjct  293   PIFFVNAAYDSWQIKNILAPGVADPHGTWRNCKLDIKSCSANQLSTMQGFRTEFLKAISV  352

Query  331   ETDSPSRGLFVSNCFGHTQ--LIFYWNHPGFEVNYRKDV-EVVRDWYFDRINHVQEVEQS  161
              ++SPS+G+F+  C+ H Q  +   W      V  +  + + V DWY+DR +  Q++   
Sbjct  353   VSNSPSKGMFIDGCYSHCQTGMQETWMRTDSPVLAKTTIAKAVGDWYYDR-STFQQI---  408

Query  160   TLVKDCP  140
                 DCP
Sbjct  409   ----DCP  411



>ref|XP_008808358.1| PREDICTED: protein notum homolog [Phoenix dactylifera]
Length=397

 Score =   261 bits (667),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 160/397 (40%), Positives = 224/397 (56%), Gaps = 36/397 (9%)
 Frame = -3

Query  1288  KMGTLLNTTFILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIG  1109
             K+ T +     LLI +       A  YF  + T +ESAV+ GAVCLDGSPPAY    G G
Sbjct  5     KLRTWIYALICLLIFL------KAEGYFV-DITYVESAVAKGAVCLDGSPPAYHLSPGFG  57

Query  1108  EGRQRWIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFC  929
              G   W+V++ GG WC++++ C  RK++ LGSS RQ     AF+  GIL+     N +F 
Sbjct  58    SGVNNWLVHIEGGGWCNNVTTCLARKSTRLGSS-RQMVKQIAFS--GILNNRQTFNPDFY  114

Query  928   NWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGG  749
             NWNKV V YCDGSSFTGDV+ VNPTT LH+RG R++ AV+EDLL  +GM  A + FL+G 
Sbjct  115   NWNKVKVRYCDGSSFTGDVKRVNPTTNLHYRGARVWLAVMEDLLA-RGMSKAENAFLSGC  173

Query  748   SAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTA  569
             SAGGL  I+HCD F       T VKCLS+ G+F++ K     + +++ F  ++  H S  
Sbjct  174   SAGGLTSILHCDNFRALLPLGTRVKCLSDAGYFINLKDITGTEHIKAFFNDVVTTHGSAQ  233

Query  568   VLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKH--  395
              LP  C  +     +C FPQ++ + IRTPLFI+ + YDS+ I + L  G  +   + H  
Sbjct  234   NLPSSC-TSRLTPSMCFFPQNMVQKIRTPLFILNAAYDSWQIKNILVPGVADPHGTWHDC  292

Query  394   ------ISATQYKALKELRLQMLVALRE-TDSPSRGLFVSNCFGHTQ--LIFYW---NHP  251
                    S++Q + ++  R Q L AL     S S G+F+++C+ H Q  +   W   N P
Sbjct  293   KLDIQQCSSSQLQIMQGFRTQFLNALAGFGSSSSTGMFINSCYAHCQSEMQETWLSSNSP  352

Query  250   GFEVNYRKDVEVVRDWYFDRINHVQEVEQSTLVKDCP  140
               E       + V DW++DRI   Q++       DCP
Sbjct  353   VLE--KIPIAKAVGDWFYDRI-AFQKI-------DCP  379



>ref|XP_009627060.1| PREDICTED: uncharacterized protein LOC104117690 [Nicotiana tomentosiformis]
 ref|XP_009627061.1| PREDICTED: uncharacterized protein LOC104117690 [Nicotiana tomentosiformis]
Length=402

 Score =   261 bits (667),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 144/370 (39%), Positives = 207/370 (56%), Gaps = 39/370 (11%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T L+SAV+ GAVCLDGSPPAY F KG G G   W + L GG WC++ + C +R  + LGS
Sbjct  30    TYLQSAVAKGAVCLDGSPPAYHFDKGFGAGVNNWFIQLEGGAWCNNATTCLSRTKTRLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S          +F GIL      N +F NWN++ + YCDGSSFTGDVE V+P T +++RG
Sbjct  90    SKLMV---KTVSFSGILSNKAKFNPDFYNWNRIRIRYCDGSSFTGDVEAVDPKTKVYYRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RIF AV+ED L  KGM++A +  L G SAG LA I+HCDRF         VKCLS+ GF
Sbjct  147   ARIFSAVMEDFLA-KGMKNAQNAILAGCSAGSLAAILHCDRFKGLLPPGAKVKCLSDAGF  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+++K  + A  +E  +  +++ H S   LP+ C    +   LC FPQ+VA+ I+TPLF+
Sbjct  206   FINAKTISGAPHIEQFYSDVVNTHGSAKNLPQSCTSRLKPG-LCFFPQNVAQQIKTPLFL  264

Query  472   MVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALRET-DS  320
             + + YDS+ I + L+ G  +         +     S+ Q + ++  R + L AL     S
Sbjct  265   VNAAYDSWQIKNILAPGVADPRGTWRNCKLDILKCSSAQLETMQGYRTEFLKALNGLGPS  324

Query  319   PSRGLFVSNCFGHTQLIFYWNHPGFEVNYRKD----------VEVVRDWYFDRINHVQEV  170
              +RG ++++C+ H Q        G +  + +D           + V DW++DR N  QE+
Sbjct  325   STRGYYINSCYAHCQT-------GTQETWLRDDSPRLASTTIAKAVGDWFYDR-NQFQEI  376

Query  169   EQSTLVKDCP  140
                    DCP
Sbjct  377   -------DCP  379



>ref|XP_010481611.1| PREDICTED: uncharacterized protein LOC104760390 [Camelina sativa]
Length=391

 Score =   261 bits (666),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 140/358 (39%), Positives = 208/358 (58%), Gaps = 18/358 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T LESAV+ GAVCLDGS PAY F KG G G   WIV++ GG WC+ I+ C  RK++  GS
Sbjct  27    TYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQRKSTMKGS  86

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S      +  F F GIL    + N +F NWN++ V YCDGSSFTGD+E V+P   L FRG
Sbjct  87    SKLM---NKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAVDPANKLFFRG  143

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R++ AV++DL+  KGM++A +  L+G SAG LA I+HCD+F +    +  VKC+S+ G+
Sbjct  144   ARVWRAVIDDLMA-KGMRNAQNAILSGCSAGALAAILHCDQFKSILPKTAKVKCVSDAGY  202

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+H K  +    ++S +  ++  H S   LP  C    +   LC FPQ+VAK ++TPLF+
Sbjct  203   FIHGKDISGGSYIQSYYGKVVATHGSAKSLPASCTSTMK-PELCFFPQYVAKTLQTPLFV  261

Query  472   MVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRETDSP  317
             + + +DS+ I + L+    +  K+        K  +A Q + ++  R Q+L AL    + 
Sbjct  262   INAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLKKCTAAQLQTVQGYRDQVLAALAPVRAA  321

Query  316   -SRGLFVSNCFGHTQ---LIFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTL  155
              + GLF+ +C  H Q      +    G  V   K  + V DW+++R +  Q ++ S+L
Sbjct  322   TTSGLFLDSCHAHCQGGSAATWSGDKGPTVANTKMAKAVGDWFYER-STFQNIDCSSL  378



>ref|XP_010244170.1| PREDICTED: uncharacterized protein LOC104588061 [Nelumbo nucifera]
Length=399

 Score =   261 bits (666),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 136/346 (39%), Positives = 209/346 (60%), Gaps = 17/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T +E+AV+ GAVCLDGSPPAY   KG G G   W+V++ GG WC++++ C  RK + LGS
Sbjct  30    TYVETAVAKGAVCLDGSPPAYHLDKGFGSGINNWLVHIEGGGWCNNVTTCLARKNTRLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +     +   F GIL      N +F NWN+V V YCDG+SFTGDVE V+PTT LH+RG
Sbjct  90    SKQML---TEIAFSGILSNKQQFNPDFYNWNRVKVRYCDGASFTGDVEAVDPTTNLHYRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R++ AV+EDLL  KGM++A +  L+G SAGGL  I+HCD F         VKCL++ G+
Sbjct  147   ARVWLAVIEDLL-EKGMKNAEYALLSGCSAGGLTSILHCDSFRALLPMGVKVKCLADAGY  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+++K  +  + +++ +  ++  H S+  LP  C    + + +C FPQ++ + IRTPLF+
Sbjct  206   FINAKDVSGTEHIQAFYDDVVTTHGSSKNLPASCTSTMKPS-MCFFPQYMEQGIRTPLFL  264

Query  472   MVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALRET-DS  320
             + + YDS+ I + L+ G  +         +  K+ S +Q + ++  R++ L AL    +S
Sbjct  265   LNAAYDSWQIKNILAPGVADPHGYWHNCKLDIKNCSPSQIQTMQGFRVEFLNALSGLGNS  324

Query  319   PSRGLFVSNCFGHTQ--LIFYWNHPGFEVNYRKDV-EVVRDWYFDR  191
               RG+F+++C+ H Q  +   W      V  +  + + V DWY+DR
Sbjct  325   SPRGMFINSCYAHCQSEMQETWLRDDSPVLDKTPIAKAVGDWYYDR  370



>emb|CDX99378.1| BnaC01g11740D [Brassica napus]
Length=391

 Score =   260 bits (665),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 146/364 (40%), Positives = 207/364 (57%), Gaps = 25/364 (7%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T L+SAV+ GAVCLDGS PAY F KG G G   WIV++ GG WC+ ++ C  RK +  GS
Sbjct  27    TYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCIKRKGTMKGS  86

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S  ++ N   F F GIL      N +F NWN++ V YCDGSSFTG+VE VNP   L FRG
Sbjct  87    S--KFMNKD-FGFSGILGGKQNTNPDFYNWNRIKVRYCDGSSFTGNVEAVNPANKLFFRG  143

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R++ AV++DL+  KGM++A +  L+G SAG LA I+HCD F      +  VKC+S+ G+
Sbjct  144   ARVWRAVIDDLMA-KGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTARVKCVSDAGY  202

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+H K  +    ++S +  ++ LH S   LP  C    +   LC FPQ+V   +RTPLF+
Sbjct  203   FIHGKDISGGSYIQSYYSKVVALHGSAKSLPVSCTSKMK-PELCFFPQYVVPSMRTPLFV  261

Query  472   MVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRETDS-  320
             + + +DS+ I + L+    +  K         K  SA Q K ++  R QM+ AL    S 
Sbjct  262   INAAFDSWQIKNVLAPTGVDKRKEWANCKLDLKKCSAAQLKTVQGFRDQMMRALSPIHST  321

Query  319   PSRGLFVSNCFGHTQ---LIFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTLVK  149
             PSRGLF+ +C  H Q      +    G +V   K  + V +W++ R +  Q++       
Sbjct  322   PSRGLFLDSCHAHCQGGSAASWSGAKGPQVANTKISKAVGNWFYGR-SAFQKI-------  373

Query  148   DCPN  137
             DCP+
Sbjct  374   DCPS  377



>dbj|BAJ90066.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=392

 Score =   260 bits (665),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 159/385 (41%), Positives = 222/385 (58%), Gaps = 31/385 (8%)
 Frame = -3

Query  1255  LLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLL  1076
             L+++VL     +A S      TIL SAV+ GAVC+DG+PPAY    G G G++ WIV L 
Sbjct  15    LVVLVLGA---SAPSVPAVPITILTSAVAKGAVCMDGTPPAYHMDPGSGAGKKSWIVNLE  71

Query  1075  GGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCD  896
             GG WC S+  C  RK S LGSS+     +    F+GIL  N AEN +F +WN+V+V YCD
Sbjct  72    GGGWCESVMACMYRKGSRLGSSNLM---ERQLEFRGILSSNPAENPDFYSWNRVMVRYCD  128

Query  895   GSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHC  716
             G+SFTG  E  N  + ++FRG+RI++AV++ LL + GM  A  V L GGSAGGL+ I+HC
Sbjct  129   GASFTG--EGYNAGSKVYFRGQRIWNAVMQHLL-SIGMSSADQVLLAGGSAGGLSAILHC  185

Query  715   DRFANRFRN-STTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNH  539
             D+F   F   STTVKCL++ G FL +   +  + L S F GI+  H     LP  C   H
Sbjct  186   DQFGTFFAGRSTTVKCLADAGLFLDAVDISGGRTLRSYFGGIVATHGVAQNLPRSC-TGH  244

Query  538   QLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLS------TGFYEAVKSKHIS--AT  383
               A  C FPQ++   I TP+F++ + YD++ I+ +L+       G + A KS  ++  A+
Sbjct  245   LDATSCFFPQNIIGSINTPIFLLNAAYDTWQIHESLAPDVADHNGTWRACKSNRLACNAS  304

Query  382   QYKALKELRLQMLVALRE-TDSPSRGLFVSNCFGHTQ--LIFYWNHPGFEVNYRKDV-EV  215
             Q K L+  R QM+  ++  + S S GLF+++CF H Q  +   WN  G    + K + + 
Sbjct  305   QMKVLQAFRDQMVGIVQGLSRSKSYGLFINSCFTHGQSKVPATWNANGSPTIHNKSIAKS  364

Query  214   VRDWYFDRINHVQEVEQSTLVKDCP  140
             V DWYF R     EV       DCP
Sbjct  365   VSDWYFGR----AEVR----AIDCP  381



>gb|KDO40409.1| hypothetical protein CISIN_1g016608mg [Citrus sinensis]
Length=372

 Score =   260 bits (664),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 145/357 (41%), Positives = 209/357 (59%), Gaps = 18/357 (5%)
 Frame = -3

Query  1162  AVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSA  983
             AVCLDGSPPAY F KG G G   W+V++ GG WC+++ +C+ R+ S  GSS         
Sbjct  22    AVCLDGSPPAYHFDKGFGAGINNWLVHIDGGAWCNNVEDCSKRRDSSYGSSKHMV---KE  78

Query  982   FNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVED  803
              NF GIL      N +F +WN+V V YCDG+SFTGDVE VNP T LHFRG R+F+AV+ED
Sbjct  79    ANFTGILSNEQKFNPDFYDWNRVRVRYCDGASFTGDVEAVNPETNLHFRGARVFEAVMED  138

Query  802   LLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKA  623
             LL  KGM++A +  LTG SAGGL  I+HCD F   F   T VKC ++ G+F+++K  +  
Sbjct  139   LLA-KGMKNAQNAILTGCSAGGLTSILHCDNFRALFPVDTRVKCFADAGYFVNAKDVSGE  197

Query  622   QDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLI  443
               +E  ++ ++ LH S   LP  C        LC FP++VA  I+TPLFI+ S YDS+ I
Sbjct  198   SHIEEFYKQVVALHGSAKHLPASCTSRLSPG-LCFFPENVAGQIKTPLFIINSAYDSWQI  256

Query  442   NHTL------STGFYEAVKS--KHISATQYKALKELRLQMLVALRET-DSPSRGLFVSNC  290
             ++ L        G + + K   K  S+TQ + ++  R+Q L AL    +S SRG+FV +C
Sbjct  257   SNILVPEDADPKGAWSSCKVDIKTCSSTQLQTMQGFRVQFLNALAGLGNSSSRGMFVDSC  316

Query  289   FGHTQLIF---YWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTLVKDCPNNTF  128
             + H +  +   +++     ++     + V DWY+DR +  Q+++        P + F
Sbjct  317   YTHCRTDYQETWFSADSPVLDKTPIAKAVGDWYYDR-SPFQKIDCPYPCNPLPESCF  372



>ref|XP_008238011.1| PREDICTED: protein notum homolog isoform X1 [Prunus mume]
Length=401

 Score =   261 bits (666),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 145/347 (42%), Positives = 203/347 (59%), Gaps = 18/347 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T + SA++ GAVCLDGSPPAY   KG G G   W+V++ GG WC++++ C  RK + LGS
Sbjct  30    TYVHSAIAKGAVCLDGSPPAYHHDKGFGSGINNWLVHIEGGGWCNNVTTCLGRKNTRLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNP-TTGLHFR  836
             S +      A  F GIL      N +F NWN++ V YCDG+SFTGDV  VNP  TGL+FR
Sbjct  90    SKQML---KAIAFSGILSNRKMFNPDFYNWNRIKVRYCDGASFTGDVAAVNPQATGLYFR  146

Query  835   GRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGG  656
             G RIF AV+EDLL  KGM +A +  L+G SAGGL  I+HCD F       T VKC+S+ G
Sbjct  147   GARIFRAVIEDLLA-KGMGNAQNAILSGCSAGGLTSILHCDNFHALLPVGTNVKCVSDAG  205

Query  655   FFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLF  476
             +F++ K  + AQ +E  F  +++ H S   LP  C    +   LC FPQ++A  IRT +F
Sbjct  206   YFINVKDVSGAQHIEEFFSQVVETHGSARNLPPSCTSKLRPG-LCFFPQYMASQIRTRIF  264

Query  475   IMVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVAL-RETD  323
              + + YDS+ I + L+ G  +         +  K+ S TQ KA+++ R+Q L A+   T 
Sbjct  265   FVNAAYDSWQIKNILAPGVADPHGTWHECKLDIKNCSPTQLKAMQDFRVQFLSAIGGMTG  324

Query  322   SPSRGLFVSNCFGH--TQLIFYWNHPGFEV-NYRKDVEVVRDWYFDR  191
              P +G+F+ +C+ H  T+L   W      V N     + V DW++ R
Sbjct  325   CPLKGMFIDSCYAHCQTELQETWLMADSPVLNKTTIAQAVGDWFYGR  371



>ref|XP_006573491.1| PREDICTED: protein notum homolog isoform X1 [Glycine max]
Length=447

 Score =   262 bits (670),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 141/346 (41%), Positives = 201/346 (58%), Gaps = 17/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             TI+++AV+ GAVCLDGSPPAY F KG G G   W+V   GG WC++++ C  RKT+ LGS
Sbjct  30    TIVQNAVAKGAVCLDGSPPAYHFDKGFGSGINNWLVAFEGGGWCNNVTTCLARKTNRLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +         F GIL+     N +F NWN++ V YCDGSSFTGDVE VNP T LHFRG
Sbjct  90    SKQMA---KQIAFSGILNNRAMFNPDFYNWNRIKVRYCDGSSFTGDVEAVNPVTKLHFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RIF+AV+EDLL  KGM++A +  ++G SAGGL  ++HCDRF         VKCLS+ G+
Sbjct  147   ARIFNAVMEDLLA-KGMKNARNAIISGCSAGGLTSVLHCDRFRALLPRGARVKCLSDAGY  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+++K     Q +E  F  ++  H S   LP+ C  +   A LC FPQ++   I TP+F 
Sbjct  206   FINAKDVLGEQHIEQYFSQVVVTHGSARSLPQSC-TSRLSAKLCFFPQYLVSRITTPIFF  264

Query  472   MVSTYDSYLINHTLSTGFYEAVKSKH--------ISATQYKALKELRLQMLVALRET-DS  320
             + + YDS+ I + L+ G  +     H         S  Q   ++  R + L A+    +S
Sbjct  265   VNAAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSPDQLDLMQGFRTEFLRAITVLGNS  324

Query  319   PSRGLFVSNCFGH--TQLIFYW-NHPGFEVNYRKDVEVVRDWYFDR  191
              S+G+F+ +C+ H  T++   W      E+      + V DW+++R
Sbjct  325   SSKGMFIDSCYAHCQTEMQETWLRSDSPELKKTTIAKAVADWFYER  370



>ref|XP_008355284.1| PREDICTED: uncharacterized protein LOC103418943 [Malus domestica]
Length=398

 Score =   261 bits (666),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 139/346 (40%), Positives = 209/346 (60%), Gaps = 17/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T++E+AV+ GAVCLDGS PAY F KG G G   W+V++ GG WC+S++ C +RK ++ GS
Sbjct  30    TLVENAVAKGAVCLDGSAPAYHFDKGFGAGINNWLVHVEGGGWCNSVATCLDRKNNYRGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +    +   +F G+L      N +F NWN++ V YCDGSSFTGDVE V+P T LHFRG
Sbjct  90    STKM---EKTMSFSGVLGNKQQTNPDFYNWNRIKVRYCDGSSFTGDVEAVDPATNLHFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R+F A+++DLL  KGM++A    L+G SAGGLA I++CD F +     T VKCL++ G+
Sbjct  147   ARVFRAIIDDLLA-KGMKNAQTALLSGCSAGGLASILNCDNFHSLLPVGTKVKCLADAGY  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+++K  + +Q +++ +  ++ LH S   LP  C        LC FPQ+V    RTP+F 
Sbjct  206   FINAKTVSGSQYIQTFYSEVVALHGSAKNLPASCTSRMSPG-LCFFPQNVVPQTRTPIFF  264

Query  472   MVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALR-ETDS  320
             + + YDS+ I + L+ G  +         +  K+ S +Q + ++E RLQ L A+   + S
Sbjct  265   VNAAYDSWQIKNILAPGVADPKGAWKNCKLSIKNCSPSQLQTMQEYRLQFLNAVAGASSS  324

Query  319   PSRGLFVSNCFGHTQLIFY--WNHPGFEVNYRKDV-EVVRDWYFDR  191
              S GLF+ +C+ H Q+     W      +  +  + + V DWY+DR
Sbjct  325   SSNGLFIDSCYAHCQIGTQETWLATDSPMLSKTTIAKAVGDWYYDR  370



>ref|XP_006363875.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=402

 Score =   261 bits (666),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 153/372 (41%), Positives = 206/372 (55%), Gaps = 37/372 (10%)
 Frame = -3

Query  1201  TNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSH  1022
              N T + S V+ GAVCLDGSPPAY   KG G G   W++ + GG WC++IS C +RK + 
Sbjct  27    VNITYVLSGVAKGAVCLDGSPPAYHHDKGFGTGVNSWLIQMEGGGWCNNISTCLSRKNTR  86

Query  1021  LGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLH  842
             LGSS +   N     F GIL      N +F NWN+V V YCDGSSFTGDV+ VNP T LH
Sbjct  87    LGSSKQMVEN---LAFSGILSNLPQFNPDFYNWNRVKVGYCDGSSFTGDVQAVNPITNLH  143

Query  841   FRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSN  662
             FRG R+F AV+EDLL  KGM++A +  L+G SAGGL  I+HCD F         VKC S+
Sbjct  144   FRGARVFLAVMEDLLA-KGMKNAENAILSGCSAGGLTSILHCDSFKALLPMGAKVKCFSD  202

Query  661   GGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTP  482
              G+F+ +K  + A  +E  FR ++ LH S   LP  C    +   LC FPQ+VA+ +RTP
Sbjct  203   AGYFIDAKDISGAPHIEEYFRDVVSLHGSAKNLPPVCTSRLK-PDLCFFPQNVAQHVRTP  261

Query  481   LFIMVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALRET  326
             LF++ + YDS+ I + L+ G  +         +     S+ Q + +   RL  L AL   
Sbjct  262   LFLVNAAYDSWQIKNILAPGVADPYGFWLNCKLDILKCSSRQLQIMHGYRLLFLRALNAL  321

Query  325   -DSPSRGLFVSNCFGHTQLIFYWNHPGFEVNYRKD---------VEVVRDWYFDRINHVQ  176
               S SRG F+++CF H Q          E  YR D          + + DW++D+ N  Q
Sbjct  322   GPSSSRGYFINSCFAHCQTEVQ------ETWYRADSPKLANKTIAKALGDWFYDK-NPFQ  374

Query  175   EVEQSTLVKDCP  140
             ++       DCP
Sbjct  375   KI-------DCP  379



>ref|XP_010441760.1| PREDICTED: uncharacterized protein LOC104724893 [Camelina sativa]
Length=391

 Score =   260 bits (665),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 140/358 (39%), Positives = 207/358 (58%), Gaps = 18/358 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T LESAV+ GAVCLDGS PAY F KG G G   WIV++ GG WC+ I+ C  RK++  GS
Sbjct  27    TYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQRKSTMKGS  86

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S      +  F F GIL    + N +F NWN++ V YCDGSSFTGD+E V+P   L FRG
Sbjct  87    SKLM---NKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAVDPANKLFFRG  143

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R++ AV++DL+  KGM +A +  L+G SAG LA I+HCD+F +    +  VKC+S+ G+
Sbjct  144   ARVWRAVIDDLMA-KGMNNAQNAILSGCSAGALAAILHCDQFKSILPKTAKVKCVSDAGY  202

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+H K  +    ++S +  ++  H S   LP  C    +   LC FPQ+VAK ++TPLF+
Sbjct  203   FIHGKDISGGSYIQSYYGKVVATHGSAKSLPASCTSTMK-PELCFFPQYVAKALQTPLFV  261

Query  472   MVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRETDSP  317
             + + +DS+ I + L+    +  K+        K  +A Q + ++  R Q+L AL    + 
Sbjct  262   INAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLKKCTAAQLQTVQGYRDQVLAALAPVRAA  321

Query  316   -SRGLFVSNCFGHTQ---LIFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTL  155
              + GLF+ +C  H Q      +    G  V   K  + V DW+++R +  Q ++ S+L
Sbjct  322   TTSGLFLDSCHAHCQGGSAATWSGDKGPTVANTKMAKAVGDWFYER-STFQNIDCSSL  378



>ref|XP_010327577.1| PREDICTED: uncharacterized protein LOC101244626 [Solanum lycopersicum]
Length=398

 Score =   260 bits (665),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 146/369 (40%), Positives = 208/369 (56%), Gaps = 33/369 (9%)
 Frame = -3

Query  1198  NSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHL  1019
             N TILESAV+ GAVCLDG+PPAY   +G G G   W++ L GG WC +++ C  RK + L
Sbjct  24    NITILESAVAKGAVCLDGTPPAYHLDRGSGSGVNSWVISLEGGGWCQNVTSCLTRKNTRL  83

Query  1018  GSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHF  839
             GSS +    D    F G++  +   N EF +WN+V V YCDG SFTGDVE ++P T LH+
Sbjct  84    GSSAKM---DHQLPFSGMMSNDPKFNPEFHSWNRVSVRYCDGGSFTGDVEAIDPATRLHY  140

Query  838   RGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNG  659
             RG RIF A++E+LL  +GM+ + +  L+G SAGGLA I+HCD F     N+  VKC S+ 
Sbjct  141   RGARIFKAIMEELLA-QGMKKSQNAILSGCSAGGLATILHCDNFRMLLPNNVKVKCFSDA  199

Query  658   GFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPL  479
             G+F+H    +    +E  F  ++ LH S   LP  C    +   LC FP++VA+ I+TPL
Sbjct  200   GYFIHRNDISGKPYIEQYFNDVVTLHGSAKSLPSSCTSKLKPG-LCFFPENVAQQIKTPL  258

Query  478   FIMVSTYDSYLINHTL------STGFYEAVKS--KHISATQYKALKELRLQMLVALRET-  326
             FI+ + YD + + + L        G + + K+  K+ +  Q K L+  R   L AL    
Sbjct  259   FIINAAYDHWQVRNILVAPGSDPKGAWTSCKANIKNCTPNQLKILQGFRKDFLKALDGLG  318

Query  325   DSPSRGLFVSNCFGH--TQLIFYW---NHPGFEVNYRKDVEVVRDWYF--DRINHVQEVE  167
              S +RG ++++CF H  +Q   YW   N P   +  +   E VRDW+   D+  H+    
Sbjct  319   PSSTRGYYINSCFSHCQSQQQAYWFGLNSP--RLFNKTIAEAVRDWFLETDQYRHI----  372

Query  166   QSTLVKDCP  140
                   DCP
Sbjct  373   ------DCP  375



>ref|XP_010318089.1| PREDICTED: protein notum homolog [Solanum lycopersicum]
Length=407

 Score =   261 bits (666),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 132/338 (39%), Positives = 197/338 (58%), Gaps = 13/338 (4%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             TI+++AV+ GAVCLDGSPPAY F  G G+G + W+V L GGEWC  +  C +R  S LGS
Sbjct  41    TIVKNAVAKGAVCLDGSPPAYHFEPGFGDGAETWLVQLSGGEWCRDVEACLDRSKSDLGS  100

Query  1012  SH--RQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHF  839
             S+    +W      F G+   N + N EF NWNKV + YCDG  FTGDVE V+P T LHF
Sbjct  101   SNVMGSWW------FTGMFSKNQSGNPEFYNWNKVFIRYCDGGGFTGDVEYVDPATKLHF  154

Query  838   RGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNG  659
             RG RIF AV+++LL  KG++ A    L+G SAGG   ++HCD F     N+  VKC+++ 
Sbjct  155   RGARIFKAVLDELL-EKGLKTAKSALLSGSSAGGFPAMLHCDYFRTLLPNTPRVKCMNDA  213

Query  658   GFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPL  479
             G+F++ K P    +    +  ++ LH S   LP+ C        LC FP+++ + ++TPL
Sbjct  214   GYFINPKEPF-LTNFTELYTSLVTLHGSAKALPKECTSKMS-PELCFFPENMQQYVKTPL  271

Query  478   FIMVSTYDSYLINHTLSTGFYEAVKSKHISATQYKALKELRLQMLVALRETDSPS-RGLF  302
             FI  S YD Y IN +++ G    +   + +A   +   E R + L AL +  +P  +G+F
Sbjct  272   FIASSAYDKYQINSSIANGINTCIGYANCTAATNQTFLEFRSRFLNALPKPTNPKLKGVF  331

Query  301   VSNCFGHTQLIFYWNHPGF-EVNYRKDVEVVRDWYFDR  191
             + +   H+Q+ ++W+      +N     + + DW++DR
Sbjct  332   IDSFNHHSQVQYWWSPINITTINNLTISKALADWFYDR  369



>gb|AFK45147.1| unknown [Lotus japonicus]
Length=394

 Score =   260 bits (664),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 141/352 (40%), Positives = 202/352 (57%), Gaps = 17/352 (5%)
 Frame = -3

Query  1195  STILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLG  1016
             +T ++SAV+ GAVCLDGSPPAY F KG G G   WIV+  GG WC++++ C  R+ + LG
Sbjct  29    TTFVQSAVAKGAVCLDGSPPAYHFHKGFGAGINNWIVHFEGGAWCNNVTTCLARRDTRLG  88

Query  1015  SSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFR  836
             SS +        +F G        N +F NWN++ V YCDGSSFTGDVE V+P T LHFR
Sbjct  89    SSKKM---SQTLSFSGFFSNGQKFNPDFYNWNRIKVRYCDGSSFTGDVEAVDPKTNLHFR  145

Query  835   GRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGG  656
             G RIF AVVEDLL N GM++A +  L+G SAGGL  I+ CDRF +    +  VKCLS+ G
Sbjct  146   GGRIFVAVVEDLLAN-GMKNAQNAILSGCSAGGLTSILQCDRFRSLIPAAAKVKCLSDAG  204

Query  655   FFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLF  476
             +F++ K  + A  +E  +  +++ H S   LP  C    +   LC FPQ+VA  I+TP+ 
Sbjct  205   YFINLKDVSGAAHIEQLYSQVVETHGSAKNLPASCTSRLRPG-LCFFPQNVAGQIKTPIS  263

Query  475   IMVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALRETD-  323
              + + YDSY + + L+ G  +         +  K  S+ Q   ++  R + L A+   + 
Sbjct  264   FVNAAYDSYQVKNILAPGVADPHGTWRDCKLDIKKCSSNQLTVMQGFRTEFLKAISVVEN  323

Query  322   SPSRGLFVSNCFGHTQ--LIFYWNHPGFEVNYRKDV-EVVRDWYFDRINHVQ  176
             SPS+G+FV  C+ H Q  +   W      V     + + V DW+++R +  Q
Sbjct  324   SPSKGMFVDGCYSHCQTGMQETWMRSDSPVLANTTIAKAVGDWFYERRSFSQ  375



>ref|XP_010434425.1| PREDICTED: uncharacterized protein LOC104718381 isoform X2 [Camelina 
sativa]
Length=379

 Score =   259 bits (663),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 146/366 (40%), Positives = 208/366 (57%), Gaps = 25/366 (7%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T L+SAV+ GAVCLDGS PAY F KG G G   WIV++ GG WC+ ++ C  RK +  GS
Sbjct  27    TYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCIERKGTMKGS  86

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S    + +  F F GIL    + N +F NWN++ V YCDGSSFTG+V  VNP   L FRG
Sbjct  87    SK---FMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVAAVNPANKLFFRG  143

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R++ AVV+DL+  KGM++A +  L+G SAG LA I+HCD F      +  VKC+S+ G+
Sbjct  144   ARVWRAVVDDLMA-KGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTARVKCVSDAGY  202

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+H K  +    ++S +  ++ LH S   LP  C    +   LC FPQ+V   +RTPLF+
Sbjct  203   FIHGKDISGGSYIQSYYSKVVALHGSAKSLPISCTSKMK-PELCFFPQYVVPFMRTPLFV  261

Query  472   MVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRETDS-  320
             + + +DS+ I + L+    +  K         K  SA Q K ++  R QM+ AL    S 
Sbjct  262   INAAFDSWQIKNVLAPTAVDKSKEWKNCKLDLKKCSAAQLKTVQGFRDQMMRALSPVHST  321

Query  319   PSRGLFVSNCFGHTQ--LIFYWNH-PGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTLVK  149
             PSRGLF+ +C  H Q      W+   G +V   +  + V +W++ R +  Q++       
Sbjct  322   PSRGLFLDSCHAHCQGGSAASWSGVKGPQVANTRIAKAVGNWFYGR-SAFQKI-------  373

Query  148   DCPNNT  131
             DCP+ T
Sbjct  374   DCPSPT  379



>ref|XP_010439720.1| PREDICTED: uncharacterized protein LOC104723107 [Camelina sativa]
Length=391

 Score =   260 bits (664),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 147/366 (40%), Positives = 209/366 (57%), Gaps = 25/366 (7%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T L+SAV+ GAVCLDGS PAY F KG G G   WIV++ GG WC+ ++ C  RK +  GS
Sbjct  27    TYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCIERKGTMKGS  86

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S  ++ N   F F GIL    + N +F NWN++ V YCDGSSFTG+V  VNP   L FRG
Sbjct  87    S--KFMNKD-FGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVAAVNPANKLFFRG  143

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R++ AVV+DL+  KGM++A +  L+G SAG LA I+HCD F      +  VKC+S+ G+
Sbjct  144   ARVWRAVVDDLMA-KGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTARVKCVSDAGY  202

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+H K  +    ++S +  ++ LH S   LP  C    +   LC FPQ+V   +RTPLF+
Sbjct  203   FIHGKDISGGSYIQSYYSKVVALHGSAKSLPISCTSKMK-PELCFFPQYVVPSMRTPLFV  261

Query  472   MVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRETDS-  320
             + + +DS+ I + L+    +  K         K  SA Q K ++  R QM+ AL    S 
Sbjct  262   INAAFDSWQIKNVLAPTAVDKSKEWKNCKLDLKKCSAAQLKTVQGFRDQMMRALSPVHST  321

Query  319   PSRGLFVSNCFGHTQ--LIFYWNH-PGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTLVK  149
             PSRGLF+ +C  H Q      W+   G +V   +  + V +W++ R +  Q++       
Sbjct  322   PSRGLFLDSCHAHCQGGSAASWSGVKGPQVANTRISKAVGNWFYGR-SAFQKI-------  373

Query  148   DCPNNT  131
             DCP+ T
Sbjct  374   DCPSPT  379



>gb|KHN41756.1| Protein notum like [Glycine soja]
Length=449

 Score =   261 bits (668),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 141/346 (41%), Positives = 201/346 (58%), Gaps = 17/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             TI+++AV+ GAVCLDGSPPAY F KG G G   W+V   GG WC++++ C  RKT+ LGS
Sbjct  30    TIVQNAVAKGAVCLDGSPPAYHFDKGFGSGINNWLVAFEGGGWCNNVTTCLARKTNRLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +         F GIL+     N +F NWN++ V YCDGSSFTGDVE VNP T LHFRG
Sbjct  90    SKQMA---KQIAFSGILNNRAMFNPDFYNWNRIKVRYCDGSSFTGDVEAVNPVTKLHFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RIF+AV+EDLL  KGM++A +  ++G SAGGL  ++HCDRF         VKCLS+ G+
Sbjct  147   ARIFNAVMEDLLA-KGMKNARNAIISGCSAGGLTSVLHCDRFRALLPRGARVKCLSDAGY  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+++K     Q +E  F  ++  H S   LP+ C  +   A LC FPQ++   I TP+F 
Sbjct  206   FINAKDVLGEQHIEQYFSQVVVTHGSARSLPQSC-TSRLSAKLCFFPQYLVSRITTPIFF  264

Query  472   MVSTYDSYLINHTLSTGFYEAVKSKH--------ISATQYKALKELRLQMLVALRET-DS  320
             + + YDS+ I + L+ G  +     H         S  Q   ++  R + L A+    +S
Sbjct  265   VNAAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSPDQLDLMQGFRTEFLRAITVLGNS  324

Query  319   PSRGLFVSNCFGH--TQLIFYW-NHPGFEVNYRKDVEVVRDWYFDR  191
              S+G+F+ +C+ H  T++   W      E+      + V DW+++R
Sbjct  325   SSKGMFIDSCYAHCQTEMQETWLRSDSPELKKTTIAKAVADWFYER  370



>gb|KHG23649.1| Notum [Gossypium arboreum]
Length=381

 Score =   259 bits (663),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 146/344 (42%), Positives = 206/344 (60%), Gaps = 27/344 (8%)
 Frame = -3

Query  1156  CLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFN  977
             CLDG+PPAY + KG G G   W++ L GG WC+++S C  RK +HLGSS R         
Sbjct  29    CLDGTPPAYHWDKGYGTGINSWLIQLEGGGWCNNVSSCLVRKNTHLGSSKRMV---KQIP  85

Query  976   FKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLL  797
             F GIL+     N  F NWN++ V YCDGSSFTGDV  VNP   LHFRG R++ AV+EDLL
Sbjct  86    FSGILN-----NKHFYNWNRIKVRYCDGSSFTGDVAAVNPVANLHFRGARVWLAVMEDLL  140

Query  796   VNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQD  617
              +KGM++A +  L+G SAGGLA I+HCD F       T VKC+S+ G+F++++  +    
Sbjct  141   -SKGMRNAENAILSGCSAGGLASILHCDSFRALLPMGTKVKCISDAGYFINTRDVSGGHY  199

Query  616   LESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINH  437
             +++ F  ++  H S   L   C    +   LC FPQ++A+ IRTPLFI+ + YDS+ I +
Sbjct  200   IQTFFDQLVATHGSAKNLLPSCTSRMKPG-LCFFPQYIAQQIRTPLFIINAAYDSWQIRN  258

Query  436   TLSTGF------YEAVK--SKHISATQYKALKELRLQMLVA-LRETDSPSRGLFVSNCFG  284
              L+ G       +E+ K   K+   +Q K +++ RLQ LVA LR   S SRG+F+ +CF 
Sbjct  259   ILAPGIADPHGHWESCKLDIKNCLPSQIKVMQDFRLQFLVALLRLGKSASRGMFIDSCFA  318

Query  283   HTQ-----LIFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVE  167
             H Q     L F  + P   +N  K  + V DW++DR N  Q+++
Sbjct  319   HCQTEMQELWFMQDSP--LLNKTKIGKAVGDWFYDR-NPFQKID  359



>ref|XP_003628996.1| Carboxylic ester hydrolase [Medicago truncatula]
 gb|AET03472.1| pectinacetylesterase family protein [Medicago truncatula]
Length=406

 Score =   260 bits (665),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 147/348 (42%), Positives = 203/348 (58%), Gaps = 21/348 (6%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T LESAVS GAVCLDGSPPAY F +G  EG   WIV++ GG WC +++ C  R+ S LGS
Sbjct  30    TRLESAVSKGAVCLDGSPPAYHFDQGHDEGANNWIVHIEGGGWCHNVTYCLYRRDSRLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             SH     +    F G L  N   N +F NWN+V V YCDGSSFTGDVE V+PTT L++RG
Sbjct  90    SHEM---EEQTYFSGYLSDNQQYNPDFYNWNRVKVRYCDGSSFTGDVEEVDPTTKLYYRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RIF AV+E+LL  KGM  A +  L+G SAGGL  I+HCD F   F N T VKC+S+ G+
Sbjct  147   ARIFSAVMEELLA-KGMDHAENAILSGCSAGGLTTILHCDGFRALFPNETRVKCVSDAGY  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F++    +    +E  +  ++  H S   LP  C        LC FPQ++A  I+TP+FI
Sbjct  206   FVNVNDISGDHYIEDYYSQVVATHGSEKSLPSSCTSMLSPG-LCFFPQYMASSIQTPIFI  264

Query  472   MVSTYDSYLINHTLST------GFYEAVKS--KHISATQYKALKELRLQMLVALRE-TDS  320
             + + YDS+ I + L+       G + + K+   + S  Q   +++ R Q L AL   ++S
Sbjct  265   VNAAYDSWQIKNILAPGDADPDGQWRSCKTNLNNCSPEQLNIMQDYRTQFLEALSPISNS  324

Query  319   PSRGLFVSNCFGHTQ-----LIFYWNHPGFEVNYRKDVEVVRDWYFDR  191
             PS G+F+ +C+ H Q       F  + P   V  +   + V DW+++R
Sbjct  325   PSNGMFIDSCYVHCQTEPQETWFKSDSP--MVGNKTVAKAVGDWFYER  370



>ref|XP_009771151.1| PREDICTED: uncharacterized protein LOC104221730 [Nicotiana sylvestris]
Length=402

 Score =   260 bits (664),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 144/370 (39%), Positives = 207/370 (56%), Gaps = 39/370 (11%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T L+SAV+ GAVCLDGSPPAY F KG G G   W + L GG WC++ + C +R  + LGS
Sbjct  30    TYLQSAVAKGAVCLDGSPPAYHFDKGFGAGVNNWFIQLEGGAWCNNATTCLSRTKTRLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S          +F GIL      N +F NWN++ + YCDGSSFTGDVE V+P T +++RG
Sbjct  90    SKLMV---KTVSFSGILSNKAKFNPDFYNWNRIRIRYCDGSSFTGDVEAVDPRTKVYYRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RIF AV+ED L  KGM++A +  L G SAG LA I+HCDRF         VKCLS+ GF
Sbjct  147   ARIFSAVMEDFLA-KGMKNAQNAILAGCSAGSLAAILHCDRFKGLLPPGAKVKCLSDAGF  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+++K  + A  +E  +  +++ H S   LP+ C    +   LC FPQ+VA+ I+TPLF+
Sbjct  206   FINAKTISGASHIEQFYSDVVNTHGSAKNLPQSCTSRLKPG-LCFFPQNVAQQIKTPLFL  264

Query  472   MVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALRET-DS  320
             + + YDS+ I + L+ G  +         +     S+ Q + ++  R + L AL     S
Sbjct  265   VNAAYDSWQIKNILAPGVADPRGTWRNCKLDILKCSSAQLETMQGYRNEFLKALNGLGPS  324

Query  319   PSRGLFVSNCFGHTQLIFYWNHPGFEVNYRKD----------VEVVRDWYFDRINHVQEV  170
              +RG ++++C+ H Q        G +  + +D           + V DW++DR N  QE+
Sbjct  325   STRGYYINSCYAHCQT-------GTQETWLRDDSPRLASTTIAKAVGDWFYDR-NRFQEI  376

Query  169   EQSTLVKDCP  140
                    DCP
Sbjct  377   -------DCP  379



>ref|NP_001190770.1| pectinacetylesterase family protein [Arabidopsis thaliana]
 gb|AEE84178.1| pectinacetylesterase family protein [Arabidopsis thaliana]
Length=517

 Score =   263 bits (672),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 141/346 (41%), Positives = 199/346 (58%), Gaps = 17/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T L+SAV+ GAVCLDGS PAY F KG G G   WIV++ GG WC+ ++ C  RK +  GS
Sbjct  27    TYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCNERKGTMKGS  86

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S    + +  F F GIL    + N +F NWN++ V YCDGSSFTG+VE VNP   L FRG
Sbjct  87    SK---FMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVEAVNPANKLFFRG  143

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R++ AVV+DL+  KGM++A +  L+G SAG LA I+HCD F      + +VKC+S+ G+
Sbjct  144   ARVWRAVVDDLMA-KGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTASVKCVSDAGY  202

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+H K       ++S +  ++ LH S   LP  C    +   LC FPQ+V   +RTPLF+
Sbjct  203   FIHGKDITGGSYIQSYYSKVVALHGSAKSLPVSCTSKMK-PELCFFPQYVVPSMRTPLFV  261

Query  472   MVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRETDS-  320
             + + +DS+ I + L+    +  K         K  SA Q K ++  R QM+ AL    S 
Sbjct  262   INAAFDSWQIKNVLAPTAVDKGKEWKNCKLDLKKCSAAQLKTVQGFRDQMMRALSPVHST  321

Query  319   PSRGLFVSNCFGHTQ---LIFYWNHPGFEVNYRKDVEVVRDWYFDR  191
             PSRGLF+ +C  H Q      +    G +V   +  + V +W++ R
Sbjct  322   PSRGLFLDSCHAHCQGGSAASWSGDKGPQVANTRIAKAVGNWFYGR  367



>ref|XP_006283887.1| hypothetical protein CARUB_v10005004mg [Capsella rubella]
 gb|EOA16785.1| hypothetical protein CARUB_v10005004mg [Capsella rubella]
Length=391

 Score =   259 bits (662),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 146/366 (40%), Positives = 209/366 (57%), Gaps = 25/366 (7%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T L+SAV+ GAVCLDGS PAY F KG G G   WIV++ GG WC+ ++ C  RK +  GS
Sbjct  27    TYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCLARKNTMKGS  86

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S  ++ N   F F GIL    + N +F NWN++ V YCDGSSFTG+V  VNP+  L FRG
Sbjct  87    S--KFMNKD-FGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVAAVNPSNKLFFRG  143

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R++ AVV+DL+  KGM++A +  L+G SAG LA I+HCD F      +  VKC+S+ G+
Sbjct  144   ARVWRAVVDDLMA-KGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTARVKCVSDAGY  202

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+H K  +    ++S +  ++ LH S   LP  C    +   LC FPQ+V   +RTPLF+
Sbjct  203   FIHGKDISGGSYIQSYYSKVVALHGSAKSLPLSCTSKMK-PELCFFPQYVVPSMRTPLFV  261

Query  472   MVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRETDS-  320
             + + +DS+ I + L+    +  K         K  SA Q + ++  R QM+ AL    S 
Sbjct  262   INAAFDSWQIKNVLAPTAVDKSKEWKNCKLDLKKCSAAQLRTVQGFRDQMMRALSPVHST  321

Query  319   PSRGLFVSNCFGHTQ--LIFYWNH-PGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTLVK  149
             PSRGLF+ +C  H Q      W+   G +V   +    V +W++ R +  Q++       
Sbjct  322   PSRGLFLDSCHAHCQGGSAASWSGVKGPQVANTRIATAVGNWFYGR-SAFQKI-------  373

Query  148   DCPNNT  131
             DCP+ T
Sbjct  374   DCPSPT  379



>ref|XP_008667853.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF86109.1| unknown [Zea mays]
 gb|ACG43470.1| pectinacetylesterase precursor [Zea mays]
 tpg|DAA36174.1| TPA: pectinacetylesterase isoform 1 [Zea mays]
 tpg|DAA36175.1| TPA: pectinacetylesterase isoform 2 [Zea mays]
Length=397

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 148/361 (41%), Positives = 199/361 (55%), Gaps = 26/361 (7%)
 Frame = -3

Query  1186  LESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGSSH  1007
             L++AV+ GAVCLDGSPP Y F  G G G   W+V++ GG WC +  EC  RK +  GSS 
Sbjct  38    LKAAVAKGAVCLDGSPPVYHFSPGSGSGANNWVVHMEGGGWCRNPDECAVRKGNFRGSSK  97

Query  1006  RQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRR  827
                      +F GIL  N   N +F NWN+V + YCDGSSFTGDVE V+    L +RG R
Sbjct  98    FM----KPLSFSGILGGNQKSNPDFYNWNRVKIRYCDGSSFTGDVEAVDTAKDLRYRGFR  153

Query  826   IFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFL  647
             ++ AV++DLL  +GM  A +  L+G SAGGLA I+HCDRF + F   T VKC S+ G+F 
Sbjct  154   VWRAVIDDLLTVRGMSKAQNALLSGCSAGGLAAILHCDRFHDLFPAKTKVKCFSDAGYFF  213

Query  646   HSKHPAKAQDLESKFRGIIDLHNSTAVLPEPC-RKNHQLAYLCMFPQHVAKDIRTPLFIM  470
               K  +      S ++ +++LH S   LP  C  K  Q   LCMFPQ+V   +RTPLFI+
Sbjct  214   DGKDISGNFYARSIYKSVVNLHGSAKNLPASCTSKPKQSPELCMFPQYVVPTMRTPLFIL  273

Query  469   VSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRETDSPS  314
              + YDS+ + + L+    +  K+        K  SA+Q   L+  R   L AL +T   S
Sbjct  274   NAAYDSWQVKNVLAPSPADPKKTWAQCKLDIKSCSASQLTTLQNFRTDFLAALPKTQ--S  331

Query  313   RGLFVSNCFGHTQLIFY--WNHPGFE-VNYRKDVEVVRDWYFDRINHVQEVEQSTLVKDC  143
              G+F+ +C  H Q      W   G   VN  +  + V DWY+DR     EV +     DC
Sbjct  332   VGMFIDSCNAHCQSGSQDTWLADGSPTVNKTQIGKAVGDWYYDR-----EVPRQI---DC  383

Query  142   P  140
             P
Sbjct  384   P  384



>ref|XP_010434424.1| PREDICTED: uncharacterized protein LOC104718381 isoform X1 [Camelina 
sativa]
Length=391

 Score =   259 bits (662),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 147/366 (40%), Positives = 209/366 (57%), Gaps = 25/366 (7%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T L+SAV+ GAVCLDGS PAY F KG G G   WIV++ GG WC+ ++ C  RK +  GS
Sbjct  27    TYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCIERKGTMKGS  86

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S  ++ N   F F GIL    + N +F NWN++ V YCDGSSFTG+V  VNP   L FRG
Sbjct  87    S--KFMNKD-FGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVAAVNPANKLFFRG  143

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R++ AVV+DL+  KGM++A +  L+G SAG LA I+HCD F      +  VKC+S+ G+
Sbjct  144   ARVWRAVVDDLMA-KGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTARVKCVSDAGY  202

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+H K  +    ++S +  ++ LH S   LP  C    +   LC FPQ+V   +RTPLF+
Sbjct  203   FIHGKDISGGSYIQSYYSKVVALHGSAKSLPISCTSKMK-PELCFFPQYVVPFMRTPLFV  261

Query  472   MVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRETDS-  320
             + + +DS+ I + L+    +  K         K  SA Q K ++  R QM+ AL    S 
Sbjct  262   INAAFDSWQIKNVLAPTAVDKSKEWKNCKLDLKKCSAAQLKTVQGFRDQMMRALSPVHST  321

Query  319   PSRGLFVSNCFGHTQ--LIFYWNH-PGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTLVK  149
             PSRGLF+ +C  H Q      W+   G +V   +  + V +W++ R +  Q++       
Sbjct  322   PSRGLFLDSCHAHCQGGSAASWSGVKGPQVANTRIAKAVGNWFYGR-SAFQKI-------  373

Query  148   DCPNNT  131
             DCP+ T
Sbjct  374   DCPSPT  379



>ref|XP_009132784.1| PREDICTED: uncharacterized protein LOC103857370 [Brassica rapa]
Length=391

 Score =   259 bits (662),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 145/364 (40%), Positives = 207/364 (57%), Gaps = 25/364 (7%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T L+SAV+ GAVCLDGS PAY F KG G G   WIV++ GG WC+ ++ C  RK +  GS
Sbjct  27    TYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCIKRKGTMKGS  86

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S  ++ N   F F GIL      N +F NWN++ V YCDGSSFTG+VE VNP   L FRG
Sbjct  87    S--KFMNKD-FGFSGILGGKQNTNPDFYNWNRIKVRYCDGSSFTGNVEAVNPANKLFFRG  143

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R++ AV++DL+  KGM++A +  L+G SAG LA I+HCD F      +  VKC+S+ G+
Sbjct  144   ARVWRAVIDDLMA-KGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTARVKCVSDAGY  202

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+H K  +    ++S +  ++ LH S   LP  C    +   LC FPQ+V   +RTPLF+
Sbjct  203   FIHGKDISGGSYIQSYYSKVVALHGSAKSLPISCTSKMK-PELCFFPQYVVPSMRTPLFV  261

Query  472   MVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRETDS-  320
             + + +DS+ I + L+    +  K         K  SA Q + ++  R QM+ AL    S 
Sbjct  262   INAAFDSWQIKNVLAPTGVDKRKEWANCKLDLKKCSAAQLRTVQGFRDQMMRALSPIHST  321

Query  319   PSRGLFVSNCFGHTQ---LIFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTLVK  149
             PSRGLF+ +C  H Q      +    G +V   K  + V +W++ R +  Q++       
Sbjct  322   PSRGLFLDSCHAHCQGGSAASWSGAKGPQVANTKISKAVGNWFYGR-SAFQKI-------  373

Query  148   DCPN  137
             DCP+
Sbjct  374   DCPS  377



>ref|XP_003548585.1| PREDICTED: protein notum homolog [Glycine max]
Length=398

 Score =   259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 140/346 (40%), Positives = 202/346 (58%), Gaps = 18/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T+++++ + GAVCLDGSPPAY F KG G+G   WIV++ GG WC++++ C +RK + LGS
Sbjct  30    TLVKNSETKGAVCLDGSPPAYHFDKGFGKGINNWIVHIEGGGWCNNVTSCLDRKNTTLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S+      S  +F  IL      N +F NWN+V V YCDGSSFTGDVE V+PTT LHFRG
Sbjct  90    SNHM----SDISFYAILSNQQQFNPDFYNWNRVKVRYCDGSSFTGDVEEVDPTTNLHFRG  145

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RIF AV+E+LL  KGM++A +  L+G SAGGL  I+HCD F     +   VKC+ + G+
Sbjct  146   ARIFSAVMEELLA-KGMKNAKNAILSGCSAGGLTTILHCDSFKALLPSRANVKCVPDAGY  204

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F++ +  + A   +  +  ++ +H S   LP  C   H  A LC FPQ+VA  I TP+F+
Sbjct  205   FVNVEDISGAHSFQEFYSEVVSIHGSAKNLPTSCTSKHNPA-LCFFPQYVASHISTPIFV  263

Query  472   MVSTYDSYLINHTLSTGFYEAVKSKH--------ISATQYKALKELRLQMLVALRET-DS  320
             + S YD + I +       +   S H         S  Q   L+  + +   AL E  DS
Sbjct  264   VNSAYDWWQIGNIFVPSSADPSNSWHSCKLNLSNCSPDQLSKLQGFKSEFQRALSEVGDS  323

Query  319   PSRGLFVSNCFGH--TQLIFYWNHPGFEVNYRKDV-EVVRDWYFDR  191
             PS+G+F+ +C+ H  T+    W   G ++   K + + V DW++ R
Sbjct  324   PSKGMFIDSCYAHCQTETQETWFKSGSQLLANKTIAKAVGDWFYGR  369



>ref|XP_009398466.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009398467.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009398468.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009398469.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=395

 Score =   259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 147/363 (40%), Positives = 213/363 (59%), Gaps = 26/363 (7%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T +ESA+  GAVCLDGSPPAY    G G G   W+V+L GG WC++I+ C  RK + LGS
Sbjct  29    TYVESAIPKGAVCLDGSPPAYHLSPGFGSGVNNWLVHLEGGGWCNNITTCLARKNTRLGS  88

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +         F GIL    + N +F NWNKV V YCDGSSFTGDVE V+P T LH+RG
Sbjct  89    SGQM---AKQLAFSGILSNTQSFNPDFYNWNKVKVRYCDGSSFTGDVERVDPATNLHYRG  145

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R++ AV+E+LL  +GM  A +  L+G SAGGLA I+HCD F N    S  VKCLS+ G+
Sbjct  146   ARVWLAVMEELLA-RGMSKAENALLSGCSAGGLASILHCDSFRNLLPASAKVKCLSDAGY  204

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F++ K  + A+ +++ +  ++  H S   LP  C    +   +C FPQ++A++I +PLFI
Sbjct  205   FINVKDISGAEHIKAFYNDVVTTHGSAKNLPL-CTSMIEPG-MCFFPQYMAQEIESPLFI  262

Query  472   MVSTYDSYLINHTLSTGFYEAVKSKH--------ISATQYKALKELRLQMLVALRETDSP  317
             + + YDS+ I + L     +   S H         S+ Q + ++E RL+ L A+    +P
Sbjct  263   LNAAYDSWQIKNILVPTVADRHGSWHNCKLDIKLCSSAQLQIMQEFRLEFLNAVNGLGTP  322

Query  316   -SRGLFVSNCFGHTQ--LIFYWNHPGFEVNYRKDV-EVVRDWYFDRINHVQEVEQSTLVK  149
              SRGLF+++C+ H Q  +   W  P   +  +  + E V DW+++R +  Q++       
Sbjct  323   SSRGLFINSCYAHCQSEMQETWLLPNSPMLDKIPIAEAVGDWFYNR-SAFQKI-------  374

Query  148   DCP  140
             DCP
Sbjct  375   DCP  377



>emb|CDY67801.1| BnaAnng25210D, partial [Brassica napus]
Length=383

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 145/354 (41%), Positives = 209/354 (59%), Gaps = 27/354 (8%)
 Frame = -3

Query  1162  AVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSA  983
             AVCLDGSPPAY   +G G G   W++ L GG WC +++ C +R  + LGSS +   N   
Sbjct  24    AVCLDGSPPAYHIDRGSGTGINSWLIQLEGGGWCHNVTNCISRMHTKLGSSKKMVEN---  80

Query  982   FNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVED  803
               F  IL      N +F NWN+V V YCDGSSFTGDV+TVNP T LHFRG R++ AV+++
Sbjct  81    LAFSAILSNKEQRNPDFYNWNRVKVRYCDGSSFTGDVKTVNPATNLHFRGARVWLAVMQE  140

Query  802   LLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKA  623
             LL  KGM++A +  L+G SAGGLA ++HCD F       T VKCLS+ GFFL+++  + A
Sbjct  141   LLA-KGMRNAENAVLSGCSAGGLASLMHCDSFRALLPMGTNVKCLSDAGFFLNTRDVSGA  199

Query  622   QDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLI  443
             Q ++S F  ++ LH S   LP  C      A +C FPQ+VA+ IRTP+F++ + YDS+ I
Sbjct  200   QYIKSYFNDVVTLHGSAKNLPRSCTSRLTPA-MCFFPQYVARQIRTPVFVLNAAYDSWQI  258

Query  442   NHTLST------GFYEAVK--SKHISATQYKALKELRLQMLVA-LRETDSPSRGLFVSNC  290
              + L+       G +++ +   K+   +Q K +++ RL+ L A +    S SRG+F+ +C
Sbjct  259   KNILAPRAADPEGKWQSCQLDIKNCQRSQLKVMQDFRLEFLSAVIGLGRSASRGMFIDSC  318

Query  289   FGH----TQLIFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTLVKDCP  140
             + H    TQ  ++W      +N     + V DW +DR N  Q++       DCP
Sbjct  319   YTHCQTETQTSWFWQDSPI-LNRTTIAKAVGDWVYDR-NLFQKI-------DCP  363



>ref|XP_004150551.1| PREDICTED: protein notum homolog [Cucumis sativus]
Length=539

 Score =   263 bits (672),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 138/346 (40%), Positives = 206/346 (60%), Gaps = 17/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T ++ AV  GAVCLDGSPPAY F  G G G   W++ L GG WC++++ C  R+ + LGS
Sbjct  30    TYVQDAVIKGAVCLDGSPPAYHFSDGFGSGINNWLIQLEGGGWCNNVTTCLQRRDTRLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +     +   F GIL      N +F NWN++ V YCDGSSFTGDVE V+  T LHFRG
Sbjct  90    SKKMV---TQLAFSGILSNKPQFNPDFYNWNRIKVRYCDGSSFTGDVEAVDSATNLHFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R+F A++++LL  KGM++A +  L+G SAGGL+ I+HCD F +    +T VKCLS+ G+
Sbjct  147   ARVFRAIIDNLLA-KGMKNAKNAILSGCSAGGLSSILHCDNFKSLLPPTTKVKCLSDAGY  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+++K  + AQ +E  +  ++  H S   LP  C    +   +C FPQ+V + I+TP+F+
Sbjct  206   FINAKDVSGAQHIEGFYSDVVTTHGSAKNLPISCTSKMK-PEMCFFPQNVVQLIQTPIFL  264

Query  472   MVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALRETDSP  317
             + + YDS+ I + L+ G  +         +  K+ S  Q + +++ R+Q L AL    S 
Sbjct  265   VNAAYDSWQIKNILAPGVADPHGTWHECKLDIKNCSPIQLRTMQDFRVQFLSALNGVGSS  324

Query  316   -SRGLFVSNCFGH--TQLIFYWNHPGFEVNYRKDV-EVVRDWYFDR  191
              SRGLF+ +C+ H  T++   W      V  +  + + V DW+FDR
Sbjct  325   LSRGLFIDSCYAHCQTEMQETWLRTDSPVLSKTTIAKAVGDWFFDR  370



>ref|XP_010536220.1| PREDICTED: protein notum homolog isoform X1 [Tarenaya hassleriana]
Length=399

 Score =   259 bits (661),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 140/348 (40%), Positives = 209/348 (60%), Gaps = 21/348 (6%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T ++ AV+ GAVCLDGSPPAY   +G G G   W++ L GG WC++++ C  R  +HLGS
Sbjct  30    TYVQKAVAKGAVCLDGSPPAYHLDRGSGTGINNWLIQLEGGGWCNNVTNCVARMRTHLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +         F  IL      N +F NWN+V + YCDGSSFTGDV+TV+P T LHFRG
Sbjct  90    SKQMA---KQIAFSAILSNRRQYNPDFYNWNRVKIRYCDGSSFTGDVQTVDPDTNLHFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R++ AV+EDLL  KGM++A +  L+G SAGGLA ++HCD F       + VKC+S+ GF
Sbjct  147   GRVWLAVMEDLLA-KGMRNAENAVLSGCSAGGLASMLHCDSFRALLPMGSKVKCISDAGF  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F++++  + A+ +   F+ ++ LH S   LP  C      A LC FPQ+VA+ IRTPLF+
Sbjct  206   FVNTRDVSGAEYIREYFKDVVTLHGSAKNLPLSCTSRLNPA-LCFFPQYVAQHIRTPLFV  264

Query  472   MVSTYDSYLINHTLS------TGFYEAVK--SKHISATQYKALKELRLQMLVA-LRETDS  320
             + + YDS+ I + L+       G +++ +   K+    Q K +++ RL+ L A +    S
Sbjct  265   LNAAYDSWQIKNILAPRAADPNGKWQSCQLDIKNCQPNQLKVMQDFRLEFLSAVIGLGKS  324

Query  319   PSRGLFVSNCFGH----TQLIFYW-NHPGFEVNYRKDVEVVRDWYFDR  191
              SRG+F+ +C+ H    +Q  ++W + P   ++     + V DW +DR
Sbjct  325   SSRGMFIDSCYAHCQTESQTSWFWPDSP--RLDRVTIAKAVGDWVYDR  370



>ref|XP_009619780.1| PREDICTED: uncharacterized protein LOC104111729 [Nicotiana tomentosiformis]
Length=391

 Score =   258 bits (659),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 147/383 (38%), Positives = 217/383 (57%), Gaps = 18/383 (5%)
 Frame = -3

Query  1255  LLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLL  1076
             L +V +       +  F  N TI++ A + GAVCLDGSPPAY    G G G   WI+ L 
Sbjct  14    LAVVSITTTLGAGDDGFYVNITIVQKATAKGAVCLDGSPPAYHLHPGHGSGLCSWIIVLD  73

Query  1075  GGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCD  896
              G WCSSI +C +R  +  GSS  +Y +  AF F GIL     EN EF NWN+V V YCD
Sbjct  74    AGGWCSSIPDCLDRSANFSGSS--KYMDRWAF-FAGILSNISEENPEFYNWNRVRVKYCD  130

Query  895   GSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHC  716
             GSSFTGDVE V+P   L+FRG RIF A++ED L  KGMQ+A +  L+G SAGGLA I++C
Sbjct  131   GSSFTGDVEQVDPDNKLYFRGSRIFKAIMED-LSTKGMQNAENAILSGSSAGGLATILNC  189

Query  715   DRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQ  536
             D+  +   N   +KC+++ GFF++ +  +   D++  ++ ++ LH S   LP  C     
Sbjct  190   DKLKSLLPNVARLKCVADAGFFINGRTISGTLDIQEMYQRVVTLHGSAKNLPSACTSAMD  249

Query  535   LAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGF------YEAVKSK--HISATQ  380
              + LC FP++V   ++TPLFI+ S YDS+ IN+TL   +      +E  K +  + + +Q
Sbjct  250   PS-LCFFPENVVPYVQTPLFIINSAYDSWQINNTLVPKYLDPELVWEQCKKQISNCTFSQ  308

Query  379   YKALKELRLQMLVALRE-TDSPSRGLFVSNCFGHTQLI---FYWNHPGFEVNYRKDVEVV  212
                ++   ++ L A    T   +RG F+ +C  H  ++   F+++     + ++   E V
Sbjct  309   RLIIQAFGVEFLKAFEGLTPCFTRGYFIMSCHSHGAILSTNFWFSPTSPRLLHKTLAEAV  368

Query  211   RDWYFDRINHVQEVEQSTLVKDC  143
              DWYFDR    Q ++     +DC
Sbjct  369   GDWYFDRAGF-QRIDPYPCARDC  390



>ref|XP_010449359.1| PREDICTED: uncharacterized protein LOC104731629 [Camelina sativa]
Length=391

 Score =   258 bits (659),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 147/366 (40%), Positives = 209/366 (57%), Gaps = 25/366 (7%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T L+SAV+ GAVCLDGS PAY F KG G G   WIV++ GG WC+ ++ C  RK +  GS
Sbjct  27    TYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCIERKGTMKGS  86

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S  ++ N   F F GIL    + N +F NWN++ V YCDGSSFTG+V  VNP   L FRG
Sbjct  87    S--KFMNKD-FGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVAAVNPANKLFFRG  143

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R++ AVV+DL+  KGM++A +  L+G SAG LA I+HCD F      +  VKC+S+ G+
Sbjct  144   ARVWRAVVDDLMA-KGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTARVKCVSDAGY  202

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+H K  +    ++S +  ++ LH S   LP  C    +   LC FPQ+V   +RTPLF+
Sbjct  203   FIHGKDISGGSYIQSYYSKVVALHGSAKSLPISCTSKMK-PELCFFPQYVVPFMRTPLFV  261

Query  472   MVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRETDS-  320
             + + +DS+ I + L+    +  K         K  SA Q K ++  R QM+ AL    S 
Sbjct  262   INAAFDSWQIKNVLAPTAVDKRKEWKNCKLDLKKCSAAQLKTVQGFRDQMMRALSPVHST  321

Query  319   PSRGLFVSNCFGHTQ--LIFYWNH-PGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTLVK  149
             PSRGLF+ +C  H Q      W+   G +V   +  + V +W++ R +  Q++       
Sbjct  322   PSRGLFLDSCHAHCQGGSAASWSGVKGPQVANTRISKAVGNWFYGR-SAFQKI-------  373

Query  148   DCPNNT  131
             DCP+ T
Sbjct  374   DCPSPT  379



>emb|CDX78932.1| BnaA01g09990D [Brassica napus]
Length=391

 Score =   258 bits (658),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 144/364 (40%), Positives = 205/364 (56%), Gaps = 25/364 (7%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T L+SAV+ GAVCLDGS PAY F KG G G   WIV++ GG WC+ ++ C  RK +  GS
Sbjct  27    TYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCIKRKGTMKGS  86

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S    + +  F F GIL      N +F NWN++ V YCDGSSFTG+VE VNP   L FRG
Sbjct  87    SK---FMNKDFGFSGILGGKQNTNPDFYNWNRIKVRYCDGSSFTGNVEAVNPANKLFFRG  143

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R++ AV++DL+  KGM++A +  L+G SAG LA I+HCD F      +  VKC+S+ G+
Sbjct  144   ARVWRAVIDDLMA-KGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTARVKCVSDAGY  202

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+H K  +    ++S +  ++ LH S   LP  C    +   LC FPQ+V   +RTPLF+
Sbjct  203   FIHGKDISGGSYIQSYYSKVVALHGSAKSLPISCTSKMK-PELCFFPQYVVPSMRTPLFV  261

Query  472   MVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRETDS-  320
             + + +DS+ I + L     +  K         K  SA Q + ++  R QM+ AL    S 
Sbjct  262   INAAFDSWQIKNVLVPTGVDKRKEWANCKLDLKKCSAAQLRTVQGFRDQMMRALSPIHST  321

Query  319   PSRGLFVSNCFGHTQ---LIFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTLVK  149
             PSRGLF+ +C  H Q      +    G +V   K  + V +W++ R +  Q++       
Sbjct  322   PSRGLFLDSCHAHCQGGSAASWSGAKGPQVANTKISKAVGNWFYGR-SAFQKI-------  373

Query  148   DCPN  137
             DCP+
Sbjct  374   DCPS  377



>ref|XP_004300392.1| PREDICTED: protein notum homolog [Fragaria vesca subsp. vesca]
Length=394

 Score =   258 bits (659),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 139/346 (40%), Positives = 201/346 (58%), Gaps = 17/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T+++SAV+ GAVCLDGSPPAY F KG G G   W+V++ GG WC  +  C  R  +  GS
Sbjct  30    TLVQSAVAKGAVCLDGSPPAYHFDKGFGAGINNWLVHIEGGGWCKDVESCVERTKNFRGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S      +   +F G+L      N +F NWN++ V YCDGSSFTGDVE VNP T LHFRG
Sbjct  90    SKHM---EKTISFSGVLGKKETLNPDFYNWNRIKVRYCDGSSFTGDVEAVNPATNLHFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R+F AV++DLL  KGM +A +  L+G SAGGLA I+ CD F +     T VKCL++ G+
Sbjct  147   GRVFLAVIDDLLA-KGMMNAKNALLSGCSAGGLASILQCDNFRSLLPAGTNVKCLADAGY  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+++K  + +Q +E+ +  ++ LH S   LP  C        LC FPQ+V   +RTP+F+
Sbjct  206   FINAKSISGSQQIEAFYSQVVALHGSAKHLPASCTSRLNPG-LCFFPQNVVPTLRTPIFL  264

Query  472   MVSTYDSYLINHTLST------GFYEAVKS--KHISATQYKALKELRLQMLVALR-ETDS  320
             + + YDS+ I + L+       G +++ K   K+ S  Q + +++ R   L  L     S
Sbjct  265   VNAAYDSWQIKNILAPSAADPKGSWKSCKMGIKNCSPAQIQTMQDYRTTFLNVLNGGLTS  324

Query  319   PSRGLFVSNCFGHTQLIFY--WNHPGFEVNYRKDV-EVVRDWYFDR  191
             PS G F+ +C+ H Q+     W      V  +  + + V DWY++R
Sbjct  325   PSHGAFIDSCYAHCQIGTQETWLAADSPVVGKTTIAKAVGDWYYNR  370



>ref|XP_009108426.1| PREDICTED: protein notum homolog [Brassica rapa]
 emb|CDX76482.1| BnaA08g09180D [Brassica napus]
Length=391

 Score =   257 bits (657),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 143/364 (39%), Positives = 207/364 (57%), Gaps = 25/364 (7%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T L+SAV+ GAVCLDGS PAY F KG G G   WIV++ GG WC+ ++ C+ RK +  GS
Sbjct  27    TYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCSARKNTMKGS  86

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S  ++ N   F F GIL      N +F NWN++ V YCDGSSFTG+VE VNP   L FRG
Sbjct  87    S--KFMNKD-FGFSGILGGKQNTNPDFYNWNRIKVRYCDGSSFTGNVEAVNPANKLFFRG  143

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R++ AV++DL+  KGM++A +  L+G SAG LA I+HCD F      +  VKC+S+ G+
Sbjct  144   ARVWRAVIDDLMA-KGMKNAQNAILSGCSAGALAAILHCDTFRAILPPTARVKCVSDAGY  202

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+H    +    +++ +  ++ LH S   LP  C    +   LC FPQ+V   +RTPLF+
Sbjct  203   FIHGTDISGGSYIQTYYSKVVALHGSAKSLPVSCTSKMK-PELCFFPQNVVPSMRTPLFV  261

Query  472   MVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRETDS-  320
             + + +DS+ I + L+    +  K         K  +A Q K ++  R QM+ AL    S 
Sbjct  262   INAAFDSWQIKNVLAPTAVDKRKEWKNCKLDLKKCTAAQLKTVQGFRDQMMRALSPVHST  321

Query  319   PSRGLFVSNCFGHTQ---LIFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTLVK  149
             PSRGLF+ +C  H Q      +    G +V   K  + V +W++ R +  Q++       
Sbjct  322   PSRGLFLDSCHAHCQGGSAASWSGAKGPQVANSKISQAVGNWFYGR-SAFQKI-------  373

Query  148   DCPN  137
             DCP+
Sbjct  374   DCPS  377



>emb|CDY09287.1| BnaC03g63170D [Brassica napus]
Length=391

 Score =   257 bits (656),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 143/364 (39%), Positives = 207/364 (57%), Gaps = 25/364 (7%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T L+SAV+ GAVCLDGS PAY F KG G G   WIV++ GG WC+ ++ C+ RK +  GS
Sbjct  27    TYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCSARKNTMKGS  86

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S  ++ N   F F GIL      N +F NWN++ V YCDGSSFTG+VE VNP   L FRG
Sbjct  87    S--KFMNKD-FGFSGILGGKQNTNPDFYNWNRIKVRYCDGSSFTGNVEAVNPANKLFFRG  143

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R++ AV++DL+  KGM++A +  L+G SAG LA I+HCD F      +  VKC+S+ G+
Sbjct  144   ARVWRAVIDDLMA-KGMKNAQNAILSGCSAGALAAILHCDTFRAILPPTARVKCVSDAGY  202

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+H    +    +++ +  ++ LH S   LP  C    +   LC FPQ+V   +RTPLF+
Sbjct  203   FIHGTDISGGSYIQTYYSKVVALHGSAKSLPVSCTSKMK-PELCFFPQNVVPSMRTPLFV  261

Query  472   MVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRETDS-  320
             + + +DS+ I + L+    +  K         K  +A Q K ++  R QM+ AL    S 
Sbjct  262   INAAFDSWQIKNVLAPTAVDKRKEWKNCKHDLKKCTAAQLKTVQGFRDQMMRALSPVHST  321

Query  319   PSRGLFVSNCFGHTQ---LIFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTLVK  149
             PSRGLF+ +C  H Q      +    G +V   K  + V +W++ R +  Q++       
Sbjct  322   PSRGLFLDSCHAHCQGGSAASWSGAKGPQVANSKISQAVGNWFYGR-SAFQKI-------  373

Query  148   DCPN  137
             DCP+
Sbjct  374   DCPS  377



>ref|XP_006413981.1| hypothetical protein EUTSA_v10024796mg [Eutrema salsugineum]
 gb|ESQ55434.1| hypothetical protein EUTSA_v10024796mg [Eutrema salsugineum]
Length=564

 Score =   262 bits (669),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 142/347 (41%), Positives = 199/347 (57%), Gaps = 17/347 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T L+SAV+ GAVCLDGS PAY F KG G G   WIV++ GG WC+ ++ C  RK +  GS
Sbjct  27    TYLQSAVAKGAVCLDGSAPAYHFDKGFGSGINNWIVHMEGGGWCTDVASCIKRKGTMKGS  86

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S    + +  F F GIL      N +F NWN++ V YCDGSSFTG+VE VNP   L FRG
Sbjct  87    SK---FMNKDFGFSGILGGKQNTNPDFYNWNRIKVRYCDGSSFTGNVEAVNPANKLFFRG  143

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R++ AV++DL+  KGM++A +  L+G SAG LA I+HCD F      +  VKC+S+ G+
Sbjct  144   ARVWRAVIDDLMA-KGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTARVKCVSDAGY  202

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+H K  +    ++S +  ++ LH S   LP  C    +   LC FPQ+V   +RTPLF+
Sbjct  203   FIHGKDISGGSYIQSYYSKVVALHGSAKSLPLSCTSKMR-PELCFFPQYVVPFMRTPLFV  261

Query  472   MVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRETDS-  320
             + + +DS+ I + L+    +  K         K  SA Q K ++  R QM+ AL    S 
Sbjct  262   INAAFDSWQIKNVLAPTAVDKRKEWKTCKLDLKKCSAAQLKTVQGFRDQMMRALSPVHST  321

Query  319   PSRGLFVSNCFGHTQ---LIFYWNHPGFEVNYRKDVEVVRDWYFDRI  188
             PSRGLF+ +C  H Q      +    G +V   K  + V +W++ RI
Sbjct  322   PSRGLFLDSCHAHCQGGSAASWSGAKGPQVANTKIAKAVGNWFYGRI  368



>ref|XP_009771153.1| PREDICTED: uncharacterized protein LOC104221731 [Nicotiana sylvestris]
Length=532

 Score =   261 bits (667),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 146/353 (41%), Positives = 207/353 (59%), Gaps = 19/353 (5%)
 Frame = -3

Query  1198  NSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHL  1019
             N+TIL SA+  GAVCLDGSPPAYL  +G G G   W++++ GG WCS+ISEC  R  +  
Sbjct  177   NTTILHSAIEKGAVCLDGSPPAYLIDRGSGYGVNNWLIHIEGGGWCSTISECIKRTGTRY  236

Query  1018  GSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHF  839
             GSS      +  + F+GIL     EN +F NWN+V V YCDG+SFTGDVE V   TGLHF
Sbjct  237   GSSIHM---EDQYYFQGILSNKPNENPDFLNWNRVKVKYCDGASFTGDVEEV---TGLHF  290

Query  838   RGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNG  659
             RG R+F A++EDLL  KGM  A +  L+G SAGGL  I+HCD+F + F  +  VKC+S+ 
Sbjct  291   RGARVFLAIMEDLLY-KGMWKAENAILSGTSAGGLTAILHCDKFRSFFSTNARVKCISDA  349

Query  658   GFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPL  479
             GFF++ K       ++  +  ++ LH ST  LP  C  ++    LC FP++V + IRTPL
Sbjct  350   GFFVNIKTILGEPHIKQLYERVVTLHGSTKNLPRSCTSSYLDPSLCFFPEYVVQHIRTPL  409

Query  478   FIMVSTYDSYLINHTLSTGFYEAVKSKHI---SATQYKALKELRLQMLVA----LRETDS  320
             F++ S YDS+ IN++L          K I   S +Q + L++ R+  + A    +R T  
Sbjct  410   FVINSAYDSWQINNSLIPYNKWTYCKKDINVCSPSQIQTLQDFRVIFIRAVINGIRLTS-  468

Query  319   PSRGLFVSNCFGH--TQLIFYWNHPGFEVNYRKDV-EVVRDWYFDRINHVQEV  170
              + G F+++C  H   +   YW +P       K + + V +W+F      QE+
Sbjct  469   -ASGYFITSCHSHKGIETPSYWFYPNSPTLVNKAIAQAVGEWFFVESIRFQEI  520



>gb|ACG39759.1| carboxylic ester hydrolase [Zea mays]
Length=398

 Score =   257 bits (657),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 150/370 (41%), Positives = 205/370 (55%), Gaps = 29/370 (8%)
 Frame = -3

Query  1207  FTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKT  1028
             F  + T +ESAV+ GAVCLDGS PAY   +G G G + W+V+  GG WC++++ C  RK 
Sbjct  26    FLVDITYVESAVAKGAVCLDGSAPAYHLARGSGSGEKSWLVHFEGGGWCNNVTTCLQRKR  85

Query  1027  SHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTG  848
             + LGSS       +   F GIL     +N +F NWNKV V YCDGSSFTGDVE V+P T 
Sbjct  86    TRLGSSKEMA---TQIAFSGILSDTPDDNPDFYNWNKVKVRYCDGSSFTGDVEEVDPATK  142

Query  847   LHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCL  668
             LH+RG RI+ AV++DLL  KGM  A +  ++G SAGGL  I+HCDRF +    +  VKCL
Sbjct  143   LHYRGARIWQAVMDDLLA-KGMDKAENALISGCSAGGLTSILHCDRFHDLLPPAARVKCL  201

Query  667   SNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIR  488
             S+ GFF++ K  A    + + F  ++  H S   LP  C         C FPQ+  K I+
Sbjct  202   SDAGFFINEKDVAGVGYIAAFFNDVVTTHGSAKNLPPSCTSTLPPG-TCFFPQNEVKQIQ  260

Query  487   TPLFIMVSTYDSYLINHTLSTGFYEAVKSKH--------ISATQYKALKELRLQMLVALR  332
             TPLFI+ + YDS+ + + L  G  +     H         SA+Q + L+  R   L  + 
Sbjct  261   TPLFILNAAYDSWQVRNILVPGVADPHGKWHSCKHDIDQCSASQLRVLQGFRGDFLKEVA  320

Query  331   ET-DSPSRGLFVSNCFGHTQ-----LIFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEV  170
             E  +S SRGLF+++CF H Q     L F  + P   +        V DW+FDR +  Q++
Sbjct  321   ELGNSDSRGLFINSCFVHCQSEIQELWFSSDSP--VLGNTTVANAVGDWFFDR-SSFQKI  377

Query  169   EQSTLVKDCP  140
                    DCP
Sbjct  378   -------DCP  380



>ref|XP_009626489.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana tomentosiformis]
Length=386

 Score =   256 bits (655),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 151/379 (40%), Positives = 222/379 (59%), Gaps = 26/379 (7%)
 Frame = -3

Query  1285  MGTLLNTTFILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGE  1106
             MG+++   F+ L+ V      T       N+TILESAV+ GAVCLDGS PA+ F +G G 
Sbjct  1     MGSIIYAVFVSLLCV-----STTTQAQYVNTTILESAVAEGAVCLDGSAPAFNFYQGTGA  55

Query  1105  GRQRWIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCN  926
               +RW+++L GG WC + S C  R     GSS +      A+ F GIL  +   N +F +
Sbjct  56    RVRRWLLHLEGGGWCDTTSNCLTRAGQVYGSSKQI--PPQAY-FTGILSNDPELNPDFYD  112

Query  925   WNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGS  746
             WNKV + YCDG+S+TGDVE V+P+T LH+RG RIF A+V+ LL  KGM  A +  L+G S
Sbjct  113   WNKVKIRYCDGASYTGDVEEVDPSTNLHYRGARIFKAIVQHLLA-KGMYKAENAILSGTS  171

Query  745   AGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAV  566
             AGGLA I++CD+F N    S  V+C+S+ GFF++ +  +    ++  F  ++ LH S   
Sbjct  172   AGGLAAILNCDKFNNLLPLSVRVRCISDSGFFVNVETISGYPHIQELFYRVVKLHGSAKN  231

Query  565   LPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVK-----S  401
             LP+ C  ++  + LC FPQ+VA  ++TPLFI+ S YDS+ +N++    + + +       
Sbjct  232   LPQACAFDYDKS-LCFFPQYVAPYMQTPLFIINSAYDSWQVNYSFVPKYVDPLGVWNNCK  290

Query  400   KHIS---ATQYKALKELRLQMLVALRET-DSPSRGLFVSNCFGH--TQLIFYW---NHPG  248
              HIS    +Q + L + RL+ L AL+    S SRG F+ +C  H   +   YW   N P 
Sbjct  291   HHISQCTPSQLQILDDYRLKFLKALQGLGPSSSRGYFIISCHTHNIVERQSYWMYKNSP-  349

Query  247   FEVNYRKDVEVVRDWYFDR  191
               ++ +K  + V DWYF+R
Sbjct  350   -TLDNKKIAKAVGDWYFER  367



>dbj|BAK03817.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=416

 Score =   258 bits (658),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 147/348 (42%), Positives = 205/348 (59%), Gaps = 20/348 (6%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T+L SAV +GAVC+DG+PPA+    G GEG+ RWIV+L GG WC S+  C  RK S LGS
Sbjct  50    TLLTSAVGIGAVCMDGTPPAFHMDPGSGEGKNRWIVHLEGGSWCESLGSCLYRKASRLGS  109

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S     N     F GIL  + AEN +F +WN+V++ YCDG+SF G  E  +  TGL FRG
Sbjct  110   SDLM--NKELMYFGGILSSSPAENPDFFSWNRVMIRYCDGASFAG--EGYDAGTGLFFRG  165

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRN-STTVKCLSNGG  656
             +RI++AV++ LL + GM  A HV LTG SAG LAV++HCD+F   F    TTVKCL++ G
Sbjct  166   QRIWNAVMQHLL-SIGMSSADHVLLTGSSAGALAVVLHCDQFGAFFAGRDTTVKCLADAG  224

Query  655   FFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLF  476
             FFL + + A  + L S F G++  H     LP  C  +H  A  C FPQ++   I TP+F
Sbjct  225   FFLDAVNVAGGRTLRSYFGGVVATHGVAQNLPTSC-TDHLNATSCFFPQNIIGGIDTPIF  283

Query  475   IMVSTYDSYLINHTLS------TGFYEAVKSKHISAT--QYKALKELRLQMLVALRETDS  320
             ++ + YD++ I  +L+      +G + A KS  ++    Q   L+  R QM+V +    S
Sbjct  284   VLNAAYDTWQIRESLAPDGADPSGAWRACKSNRLACNELQMNILQAFRNQMVVTVLRVVS  343

Query  319   PSR--GLFVSNCF--GHTQLIFYWN-HPGFEVNYRKDVEVVRDWYFDR  191
              SR  G F+++CF  G T+    WN +    +  +   + V DWYF R
Sbjct  344   RSRSNGYFINSCFTHGQTENPATWNAYDSPAIQNKTIWKSVGDWYFGR  391



>gb|KHG09455.1| Protein notum [Gossypium arboreum]
Length=397

 Score =   257 bits (656),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 140/349 (40%), Positives = 200/349 (57%), Gaps = 21/349 (6%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T L+ AV+ GAVCLDGSPPAY F KG G G   WIV++ GG WC  +  C +RK + LGS
Sbjct  32    TYLQDAVAKGAVCLDGSPPAYHFDKGSGTGVDNWIVHMEGGGWCEDVPTCLSRKNTDLGS  91

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +       F F G+L      N +F NWN++ V YCDGSSFTGD   V+    L F+G
Sbjct  92    SKQMV---KQFGFSGLLSGQQKSNPDFYNWNRIKVRYCDGSSFTGD--AVDRANNLFFKG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
               I++ ++ DLL  KGM++A +  L+G SAGGLA I+HCDRF      ST VKC+S+ GF
Sbjct  147   NSIWEFIIADLLA-KGMRNAKNAILSGCSAGGLASILHCDRFRALLPASTKVKCISDAGF  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPC-RKNHQLAYLCMFPQHVAKDIRTPLF  476
             FLH++  +  + +E  +  +  LH S   LP  C  +      LC FPQ+V + ++TP+F
Sbjct  206   FLHAQDVSGGKHIEEFYGKVARLHGSVKNLPASCTSRMGARPELCFFPQYVVQTMQTPIF  265

Query  475   IMVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRET--  326
              + S YDS+ I + L+    +  K         K  + TQ K +++ R Q L AL     
Sbjct  266   FVNSAYDSWQIKNILAPSAADKSKEWKSCKLDLKKCTETQLKIIQDFRTQFLSALNRAGV  325

Query  325   -DSPSRGLFVSNCFGHTQL---IFYWNHPGFEVNYRKDVEVVRDWYFDR  191
              +SPS+G+F+ +C+ H Q+   I + +     V+  K  + V DWY++R
Sbjct  326   INSPSKGMFIDSCYAHCQVGKQIQWSSDSSPVVSNMKIAKAVGDWYYER  374



>ref|XP_008373439.1| PREDICTED: protein notum homolog isoform X2 [Malus domestica]
 ref|XP_008373440.1| PREDICTED: protein notum homolog isoform X2 [Malus domestica]
Length=438

 Score =   258 bits (659),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 145/346 (42%), Positives = 198/346 (57%), Gaps = 17/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T + SAV+ GAVCLDGSPPAY   KG G G   W+V++ GG WC++I+ C  RK + LGS
Sbjct  30    TYVHSAVAKGAVCLDGSPPAYHLDKGYGSGINNWLVHIEGGGWCNNITTCLVRKNNRLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +         F GIL+     N +F NWN+V V YCDG+SFTGDV  VN  TGL FRG
Sbjct  90    SKKML---KEIAFSGILNSRHIFNPDFYNWNRVKVRYCDGASFTGDVAAVNLATGLFFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RIF AV+E+LL  KGM  A +  L+G SAGGLA I+HCD F         VKC+S+ G+
Sbjct  147   ARIFRAVIEELLA-KGMGKAKNAILSGCSAGGLASILHCDNFHALLPVGAKVKCVSDAGY  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+++K  + A+ +E  F  ++  H S   LP  C        LC FPQ+ A  IRTP+F 
Sbjct  206   FINAKDVSGARHVEQFFSQVVATHGSAKNLPPSCTSKLSPG-LCFFPQYFASQIRTPMFY  264

Query  472   MVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALRE-TDS  320
             + + YDS+ I + L+ G  +         +   H   TQ K +++ R Q L A+   + S
Sbjct  265   VNAAYDSWQIKNILAPGVADPHGTWQNCKLDITHCKPTQLKTMQDFRAQFLSAIGGVSGS  324

Query  319   PSRGLFVSNCFGH--TQLIFYWNHPGFEV-NYRKDVEVVRDWYFDR  191
              S+G+F+ +C+ H  T+L   W  P   V N     + V DW++DR
Sbjct  325   RSKGMFIDSCYAHCQTELQETWLMPDSPVLNKTTIAKAVGDWFYDR  370



>ref|XP_009776987.1| PREDICTED: uncharacterized protein LOC104226656 isoform X1 [Nicotiana 
sylvestris]
Length=391

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 204/356 (57%), Gaps = 28/356 (8%)
 Frame = -3

Query  1195  STILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLG  1016
             +T LESA++ GAVCLDGS PA+ F  G G G   W++ L GG WC S S+C +R T+  G
Sbjct  26    TTFLESAIAKGAVCLDGSAPAFNFHPGTGSGVYNWLIQLQGGGWCDSASDCQDRATNGYG  85

Query  1015  SSHRQYWNDSAFN-FKGILDFNCAENS-----EFCNWNKVVVHYCDGSSFTGDVETVNPT  854
             +S     N S    F G+L  +   N      +F NWN++ V YCDGSS+TGD+E V+P 
Sbjct  86    TSK----NISKIGYFMGVLSNDSQLNPVNKYLDFYNWNRIKVRYCDGSSYTGDIEEVDPA  141

Query  853   TGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVK  674
             T LHFRG RIF A++++LL +KGM  A +  L+G SAGGL  I+HCD+F   F  +  VK
Sbjct  142   TNLHFRGARIFKAIMDELLYHKGMIYAENAILSGTSAGGLGAILHCDKFRLFFSLTARVK  201

Query  673   CLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKD  494
             C+S+ GFF+++K       ++  F+ ++ LH S   LP  C        LC FPQ+ A+ 
Sbjct  202   CISDAGFFINAKTITDEPHIKEYFKRVVALHGSAKNLPLSCTFLSLDPSLCFFPQYAAQH  261

Query  493   IRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKHI-----------SATQYKALKELRLQM  347
             I TPLFI+ S YDS+ IN++L     +    +H+           S +Q + L++ RL  
Sbjct  262   ICTPLFIINSAYDSWQINNSLVP---QEADPRHVWDFCKGNINNCSLSQIQTLQDFRLTF  318

Query  346   LVALRET-DSPSRGLFVSNCFGH--TQLIFYWNHPGFEVNYRKDV-EVVRDWYFDR  191
             L AL E   S SRG F+S+C  H   +   YW++        K + E V DW+FDR
Sbjct  319   LEALNELGPSTSRGYFISSCHSHKGIEAQAYWSYNNSPTLANKTIAEAVGDWFFDR  374



>ref|XP_003565180.2| PREDICTED: uncharacterized protein LOC100841115 isoform X1 [Brachypodium 
distachyon]
Length=527

 Score =   261 bits (666),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 144/356 (40%), Positives = 203/356 (57%), Gaps = 18/356 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T+L  A   GAVCLDG+PP Y   +G G G   W+V+L GG WCS++ +C+NR+ S LGS
Sbjct  129   TLLAGAREKGAVCLDGTPPGYHLIRGSGSGSNSWLVHLEGGGWCSTVKDCSNRRMSQLGS  188

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVE-TVNPTTGLHFR  836
             S+  +     F   GI   +  +N +F NWN+V V YCDG+SF+GD E      T LHF+
Sbjct  189   SN--FMKPLQFAGAGIFGSDQLQNPDFYNWNRVYVRYCDGASFSGDAEGQAQDGTTLHFK  246

Query  835   GRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGG  656
             G RI++AV+++L+  KG+ +AT V LTG SAGGLA I+HCD F+ RF +  +VKCL++ G
Sbjct  247   GLRIYEAVIDELM-GKGLANATQVLLTGCSAGGLATILHCDDFSARFPHEVSVKCLADAG  305

Query  655   FFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLF  476
             FFL  K  +  +   S + G++ L N   VLP+ C  N +    C FP  + K I TP+F
Sbjct  306   FFLDVKDISGQRSFWSVYNGVVHLQNVRKVLPKDCLANKEPTE-CFFPAELIKSIHTPIF  364

Query  475   IMVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRET--  326
             I+ S YDS+ I + L  G     KS         + ++TQ K L   R  M+  L+    
Sbjct  365   ILNSGYDSWQIQYVLVPGSSAPDKSWLSCRENLANCNSTQIKVLDGFRNTMVDDLKVVVE  424

Query  325   DSPSRGLFVSNCFGHTQLI--FYWNHP-GFEVNYRKDVEVVRDWYFDRINHVQEVE  167
             D    GLF+ +CF H Q +    WN P    +  +   E V DW+F R   V+E++
Sbjct  425   DKQDWGLFIDSCFTHCQTLSGTSWNSPVSTRLGNKSIAEAVGDWHFGRSKRVKEID  480



>ref|XP_009771487.1| PREDICTED: protein notum homolog [Nicotiana sylvestris]
Length=387

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 148/366 (40%), Positives = 212/366 (58%), Gaps = 22/366 (6%)
 Frame = -3

Query  1198  NSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHL  1019
             N TIL SA++ GAVCLDGSPPAY   +G G G + WI+ + GG WC SIS+C +R T+ L
Sbjct  28    NITILNSAIAQGAVCLDGSPPAYHLDRGYGSGLRSWIIVMDGGAWCQSISDCLSRSTTEL  87

Query  1018  GSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHF  839
             GSS +Q  N S   F GIL  N   N +F NWN+V V YCDGSSFTGD+E V+P   L F
Sbjct  88    GSS-KQMKNGS--RFAGILYNNPQNNPDFYNWNRVRVKYCDGSSFTGDIEQVDPDNKLFF  144

Query  838   RGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNG  659
             RG RIF A+++DL  +KGMQ+A +  L+G SAGGLA I++CD+F +   N   VKC+++ 
Sbjct  145   RGARIFKAIMKDLW-SKGMQNAENAILSGVSAGGLATILNCDKFKSLMPNDAKVKCVADA  203

Query  658   GFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPL  479
             GFF++ K  +   D++  ++ ++ LH S   LP  C    + + LC FPQ+V   + TPL
Sbjct  204   GFFINGKTISGTSDIQEMYQRVVTLHGSAKNLPPSCTYAMEPS-LCFFPQNVVPYVETPL  262

Query  478   FIMVSTYDSYLINHTLSTGFYEAVK-----SKHISATQYKALKELRLQM----LVALRET  326
             FIM S YD++ I + L   + +         K IS   +   + L +Q+     +   E 
Sbjct  263   FIMNSHYDTWQIENILVPKYLDPQHVWDNCKKQISNCTFS--QRLIIQVFGGEFLKAFEG  320

Query  325   DSPS--RGLFVSNCFGHTQLIF--YWNHPGFEVNYRKDV-EVVRDWYFDRINHVQEVEQS  161
              +PS   G F+++C  H  ++   +W  P       K + E V DW+F+R    Q ++  
Sbjct  321   LNPSFTSGYFITSCHSHGAIMSTNFWLSPTSPRLLHKTIGEAVADWFFERAG-FQYIDLF  379

Query  160   TLVKDC  143
                +DC
Sbjct  380   PCARDC  385



>gb|KHN41567.1| Protein notum like [Glycine soja]
Length=399

 Score =   257 bits (656),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 138/346 (40%), Positives = 201/346 (58%), Gaps = 17/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T +E+AV+ GAVCLDGSPPAY F KG G G   WIV+  GG WC++++ C +R+ + LGS
Sbjct  30    TFVENAVAKGAVCLDGSPPAYHFNKGSGAGINNWIVHFEGGGWCNNVTTCLSRRDTRLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +    D++ +F G    +   N +F +WN++ V YCDGSSFTGDVE V+P T LHFRG
Sbjct  90    SKKM---DTSLSFSGFFSNSKKFNPDFYDWNRIKVRYCDGSSFTGDVEAVDPKTNLHFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R+F  VVEDLL  KGM++A +  ++G SAGGLA I++CDRF +    +T VKCL++ GF
Sbjct  147   ARVFAVVVEDLLA-KGMKNAQNAIISGCSAGGLASILNCDRFKSLLPATTKVKCLADAGF  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F++ K  + AQ +E  +  ++  H S   LP  C    +   LC FPQ+V   I TP+F 
Sbjct  206   FINVKDVSGAQRIEEFYSQVVQTHGSAKNLPTSCTSRLRPG-LCFFPQNVVSQISTPIFF  264

Query  472   MVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALRET-DS  320
             + + YDS+ I + L+ G  +         +  K+ S  Q   ++  R   L A     + 
Sbjct  265   VNAAYDSWQIKNILAPGAADPHGQWRECKLDIKNCSPNQLSVMQGFRTDFLRAFSVVGNG  324

Query  319   PSRGLFVSNCFGHTQ--LIFYWNHPGFEVNYRKDV-EVVRDWYFDR  191
              S+G F+  C+ H Q  +   W      V  +  + + V DW++DR
Sbjct  325   ASKGHFIDGCYAHCQTGIQETWLRNDSPVVAKTSIAKAVGDWFYDR  370



>ref|XP_003613922.1| Notum-like protein [Medicago truncatula]
 gb|AES96880.1| pectinacetylesterase family protein [Medicago truncatula]
Length=394

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 140/343 (41%), Positives = 201/343 (59%), Gaps = 13/343 (4%)
 Frame = -3

Query  1195  STILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLG  1016
             +TI+++AV+ GAVCLDGSPPAY F KG G+G   W+V++ GG WC +++ C  R T+ LG
Sbjct  31    TTIVQNAVAKGAVCLDGSPPAYNFDKGYGKGSNSWLVHMEGGGWCHNVTNCLGRMTTRLG  90

Query  1015  SSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFR  836
             SS +    +    F GIL+     N +F NWN++ + YCDGSSFTGDVE V+P T LHFR
Sbjct  91    SSKQM---NKTLAFSGILNDKKQFNPDFYNWNRIKIRYCDGSSFTGDVEAVDPVTKLHFR  147

Query  835   GRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGG  656
             G RIF+AV+E+LL  KGM+ A +  L+G SAGGL  ++HCDRF       + VKC+S+ G
Sbjct  148   GARIFEAVMEELLA-KGMKKAQNAILSGCSAGGLTSLLHCDRFRALLPKGSNVKCISDAG  206

Query  655   FFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLF  476
             +F+++K  + A   E  F  I+ LH S   LP  C    +   LC FPQ+    I TP+F
Sbjct  207   YFINAKDISGAPHFEEYFNQIVTLHGSVKNLPGSCTSKLK-PELCFFPQNFVSQITTPIF  265

Query  475   IMVSTYDSYLINHTLSTGFYEAVKSK----HISATQYKALKELRLQMLVALRET-DSPSR  311
             ++ S  DSY I + L+    +    K      +  Q   ++  R + L AL    +S S 
Sbjct  266   VVNSPIDSYQIKNILAPDADDWKNCKLDITKCTPAQLNQVQGFRKEFLRALAPIGNSSSV  325

Query  310   GLFVSNCFGH--TQLIFYWNHPGFEVNYRKDV-EVVRDWYFDR  191
             G F+ +C+ H  T+L  +W   G  +     + + V DW++DR
Sbjct  326   GTFIDSCYLHCQTELQEFWLFNGSPLLANTTIAKSVADWFYDR  368



>ref|XP_003547731.1| PREDICTED: protein notum homolog isoform X1 [Glycine max]
 ref|XP_006599118.1| PREDICTED: protein notum homolog isoform X2 [Glycine max]
Length=398

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 140/346 (40%), Positives = 196/346 (57%), Gaps = 18/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T++E+A S GAVCLDGSPPAY F KG GEG   WIV++ GG WC+++  C  RK + LGS
Sbjct  30    TLVENAESKGAVCLDGSPPAYHFDKGFGEGIDNWIVHIEGGGWCNNVESCLERKNTRLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +         F  IL      N +F NWN+V V YCDGSSFTGDVE V+PTT LHFRG
Sbjct  90    SKQM----KDIYFSAILSNEQQFNPDFYNWNRVKVRYCDGSSFTGDVEEVDPTTNLHFRG  145

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RIF AV+E+LL  KGM++  +  L+G SAGGL  I+HCD F     +   VKC+ + G+
Sbjct  146   ARIFSAVMEELLA-KGMKNVKNAILSGCSAGGLTTILHCDSFKALLPSGANVKCVPDAGY  204

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F++ +  + A  ++  +  ++ +H S   LP  C      A LC FPQ+VA  I TP+F+
Sbjct  205   FVNVEDISGAHSIQEFYSEVVSIHGSAKNLPTSCTSKLNPA-LCFFPQYVASHISTPIFV  263

Query  472   MVSTYDSYLINHTLSTGFYEAVKSKH--------ISATQYKALKELRLQMLVALRET-DS  320
             + S YD + I +    G  +   S H         S  Q   ++  + +   AL E  DS
Sbjct  264   VNSAYDRWQIRNIFIPGSADPSNSWHSCKINISNCSTDQLSKIQGFKSEFERALSEVGDS  323

Query  319   PSRGLFVSNCFGH--TQLIFYW-NHPGFEVNYRKDVEVVRDWYFDR  191
             PS+G+F+ +C+ H  T+L   W      ++      + V DW++ R
Sbjct  324   PSKGMFIDSCYAHCQTELQETWLKSDSPQLANTTIAKAVGDWFYGR  369



>ref|XP_006599203.1| PREDICTED: uncharacterized protein LOC100781246 isoform X1 [Glycine 
max]
 ref|XP_006599204.1| PREDICTED: uncharacterized protein LOC100781246 isoform X2 [Glycine 
max]
 ref|XP_006599205.1| PREDICTED: uncharacterized protein LOC100781246 isoform X3 [Glycine 
max]
Length=399

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 138/346 (40%), Positives = 202/346 (58%), Gaps = 17/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T +E+AV+ GAVCLDGSPPAY F KG G G   WIV+  GG WC++++ C +R+ + LGS
Sbjct  30    TFVENAVAKGAVCLDGSPPAYHFHKGSGAGINNWIVHFEGGGWCNNVTTCLSRRDTRLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +    D++ +F G    +   N +F +WN++ V YCDGSSFTGDVE V+P T LHFRG
Sbjct  90    SKKM---DTSLSFSGFFSNSKKFNPDFYDWNRIKVRYCDGSSFTGDVEAVDPKTNLHFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R+F  VVEDLL  KGM++A +  ++G SAGGLA I++CDRF +    +T VKCL++ GF
Sbjct  147   ARVFAVVVEDLLA-KGMKNAQNAIISGCSAGGLASILNCDRFKSLLPATTKVKCLADAGF  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F++ K  + AQ +E  +  ++  H S   LP  C    +   LC FPQ+V   I TP+F 
Sbjct  206   FINVKDVSGAQRIEEFYSQVVQTHGSAKNLPTSCTSRLRPG-LCFFPQNVVSQISTPIFF  264

Query  472   MVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALRET-DS  320
             + + YDS+ I + L+ G  +         +  K+ S  Q   ++  R   L A     ++
Sbjct  265   VNAAYDSWQIKNILAPGAADPRGQWRECKLDIKNCSPNQLSVMQGFRTDFLRAFSVVGNA  324

Query  319   PSRGLFVSNCFGHTQ--LIFYWNHPGFEVNYRKDV-EVVRDWYFDR  191
              S+G F+  C+ H Q  +   W      V  +  + + V DW++DR
Sbjct  325   ASKGHFIDGCYAHCQTGIQETWLRNDSPVVAKTSIAKAVGDWFYDR  370



>ref|NP_001151183.1| LOC100284816 precursor [Zea mays]
 gb|ACG41900.1| carboxylic ester hydrolase [Zea mays]
Length=398

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 150/370 (41%), Positives = 204/370 (55%), Gaps = 29/370 (8%)
 Frame = -3

Query  1207  FTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKT  1028
             F  + T +ESAV+ GAVCLDGS PAY   +G G G   W+V+  GG WC++++ C  RK 
Sbjct  26    FLVDITYVESAVAKGAVCLDGSAPAYHLARGSGSGENSWLVHFEGGGWCNNVTTCLQRKR  85

Query  1027  SHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTG  848
             + LGSS       +   F GIL     +N +F NWNKV V YCDGSSFTGDVE V+P T 
Sbjct  86    TRLGSSKEMA---TQIAFSGILSDTPDDNPDFYNWNKVKVRYCDGSSFTGDVEEVDPATK  142

Query  847   LHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCL  668
             LH+RG RI+ AV++DLL  KGM  A +  ++G SAGGL  I+HCDRF +    +  VKCL
Sbjct  143   LHYRGARIWQAVMDDLLA-KGMDKAENALISGCSAGGLTSILHCDRFHDLLPPAARVKCL  201

Query  667   SNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIR  488
             S+ GFF++ K  A    + + F  ++  H S   LP  C         C FPQ+  K I+
Sbjct  202   SDAGFFINEKDVAGVGYIAAFFNDVVTTHGSAKNLPPSCTSTLPPG-TCFFPQNEVKQIQ  260

Query  487   TPLFIMVSTYDSYLINHTLSTGFYEAVKSKH--------ISATQYKALKELRLQMLVALR  332
             TPLFI+ + YDS+ + + L  G  +     H         SA+Q + L+  R   L  + 
Sbjct  261   TPLFILNAAYDSWQVRNILVPGVADPHGKWHSCKHDIDQCSASQLRVLQGFRGDFLKEVA  320

Query  331   ET-DSPSRGLFVSNCFGHTQ-----LIFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEV  170
             E  +S SRGLF+++CF H Q     L F  + P   +        V DW+FDR +  Q++
Sbjct  321   ELGNSDSRGLFINSCFVHCQSEIQELWFSSDSP--VLGNTTVANAVGDWFFDR-SSFQKI  377

Query  169   EQSTLVKDCP  140
                    DCP
Sbjct  378   -------DCP  380



>ref|XP_006363883.1| PREDICTED: uncharacterized protein LOC102589191 [Solanum tuberosum]
Length=476

 Score =   259 bits (661),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 146/351 (42%), Positives = 204/351 (58%), Gaps = 23/351 (7%)
 Frame = -3

Query  1198  NSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHL  1019
             N TILESA + GAVCLDGSPPAY   +G G G   WI+YL GG WC SI EC  R T++L
Sbjct  9     NITILESATAQGAVCLDGSPPAYHLHRGHGTGLDNWIIYLDGGGWCESIPECLYRTTTYL  68

Query  1018  GSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHF  839
             GS+ +      AF F GIL     +N EF NWN+V V YCDGSSFTGDVE V+P   L+F
Sbjct  69    GSTKKM--GQQAF-FSGILHNTSKQNPEFHNWNRVRVKYCDGSSFTGDVEQVHPENKLYF  125

Query  838   RGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNG  659
             RG RIF A++ED L +KGM++A +  L+G SAGGLA I++CD+F      +  VKC+++ 
Sbjct  126   RGARIFKAIMED-LSSKGMKNAENAILSGTSAGGLATILNCDKFKCLLPENARVKCVADA  184

Query  658   GFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPL  479
              FF++ K        +  ++ I++LH S   LP  C    + + LC FP++V   ++TPL
Sbjct  185   SFFINGKSIYGTSFTQEMYQNIVNLHESAKNLPPACTSAMEPS-LCFFPENVMPYVQTPL  243

Query  478   FIMVSTYDSYLINHTLSTGFYEAVKSKHISATQYKALKELRLQMLVALR----------E  329
             FI+ S YDS+ IN+TL   + +    +H      K++       L+ ++          E
Sbjct  244   FIINSIYDSWQINNTLVPPYLD---KQHAWKACIKSISSCTSSQLIIIQAFGVEFSKTFE  300

Query  328   TDSP--SRGLFVSNCFGH--TQLIFYWNHPGFEVNYRKDV-EVVRDWYFDR  191
                P  +RG F+++C+ H   +L  YW        + K + E V DWYF+R
Sbjct  301   GLPPCSTRGYFLTSCYSHGGIRLTPYWLKTSSLTLFNKTIAEAVADWYFER  351



>gb|EPS71696.1| hypothetical protein M569_03061, partial [Genlisea aurea]
Length=395

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 146/400 (37%), Positives = 223/400 (56%), Gaps = 27/400 (7%)
 Frame = -3

Query  1258  ILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYL  1079
             IL +V++    ++  S+     T ++ AV  GAVCLDGSPPAY    G G G   W+V++
Sbjct  1     ILFLVLITVSGKSEGSFVGI--TYVDGAVEKGAVCLDGSPPAYHLDLGSGAGANSWLVHV  58

Query  1078  LGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYC  899
              GG WC++++ C  R+ + LGSS R     +   F GI       N +F NWN+V V YC
Sbjct  59    EGGGWCNNVTTCLARRDTRLGSSRRMA---TQIAFSGIFSNRPQFNPDFYNWNRVKVRYC  115

Query  898   DGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIH  719
             DG+SFTGDVE V+P T L++RG R+  AV+EDLL  KGM++A +  L+G SAGGL  I+H
Sbjct  116   DGASFTGDVEAVDPATKLYYRGARVLGAVIEDLLA-KGMKNAENAVLSGCSAGGLTSILH  174

Query  718   CDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNH  539
             CD F       T VKC ++ GFF++++  + A  +   +  +   H S   LP+ C    
Sbjct  175   CDAFKALLPVGTRVKCFADAGFFINARDVSGAAHINDFYNDVATTHGSAKNLPQGCTSRL  234

Query  538   QLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKSKH--------ISAT  383
             +   LC FPQ+VA++IRTPLFI+ + YDS+ I + L+ G  +   + H         S +
Sbjct  235   KPG-LCFFPQNVAQEIRTPLFIVNAAYDSWQIKNILAPGVADPHGTWHDCKTDITKCSKS  293

Query  382   QYKALKELRLQMLVALRE------TDSP-SRGLFVSNCFGHTQLIF---YWNHPGFEVNY  233
             Q + +++ R Q L +L +      T +P S+G F+++C+ H Q      ++      +N 
Sbjct  294   QLQTMQDFRTQFLKSLNDGVGSSLTSTPSSKGYFINSCYAHCQTEMQETWFRSDSPLLND  353

Query  232   RKDVEVVRDWYFDRINHVQEVEQS-TLVKDCPNNTFIEEE  116
             +   E + DW+FDR N  Q ++ +    K C N  F  ++
Sbjct  354   KTIAEAIGDWFFDR-NSFQHIDCAYPCDKTCHNRIFDPKD  392



>ref|XP_007156330.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
 gb|ESW28324.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
Length=397

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 141/352 (40%), Positives = 199/352 (57%), Gaps = 29/352 (8%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T +E+AV+ GAVCLDGS PAY F KG G G   WIV+  GG WC++++ C +R+ + LGS
Sbjct  28    TFVENAVAKGAVCLDGSAPAYHFHKGSGAGINNWIVHFEGGGWCNNVTSCLSRRDTRLGS  87

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +    D+  +F G    +   N +F +WN++ V YCDGSSFTGDVE V+P T LHFRG
Sbjct  88    SKKM---DTQLSFSGFFSNSKKFNQDFYDWNRIKVRYCDGSSFTGDVEAVDPRTNLHFRG  144

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R+F AVVEDLL  KGM++A +  ++G SAGGLA I++CDRF      +T VKCL++ G+
Sbjct  145   ARVFAAVVEDLLA-KGMKNAQNAIISGCSAGGLAAILNCDRFKALLPRTTKVKCLADAGY  203

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F++ K  + AQ +E  +  ++  H S   LP  C    +   LC FPQ+V   I TP+F 
Sbjct  204   FINVKDVSGAQRIEEFYSQVVQTHGSAKNLPSSCTSRLKPG-LCFFPQNVVSQISTPIFF  262

Query  472   MVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALRET-DS  320
             + + YDS+ I + L+ G  +         +  K+ S  Q   ++  R   L A     +S
Sbjct  263   VNAAYDSWQIKNILAPGAADPHGQWRECKLDIKNCSPNQLSVMQVFRTDFLRAFGAVGNS  322

Query  319   PSRGLFVSNCFGHTQLIFYWNHPGFEVNYRKDVEV---------VRDWYFDR  191
             PS+G F+  C+ H Q          E   R D  V         V DW++DR
Sbjct  323   PSKGHFIDGCYAHCQTGTQ------ETWLRNDSPVLGNTTIARAVGDWFYDR  368



>gb|EMT30528.1| hypothetical protein F775_25893 [Aegilops tauschii]
Length=403

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 155/368 (42%), Positives = 210/368 (57%), Gaps = 29/368 (8%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T+L SAV++GAVC+DGSPPAY    G G G+ RWIV+L GG WC S+  C  RK S LGS
Sbjct  45    TVLTSAVAMGAVCMDGSPPAYHMDGGYGAGKNRWIVHLEGGSWCESVGSCLYRKVSRLGS  104

Query  1012  S---HRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLH  842
             S   +RQ +      F GIL  + AEN +F +WN+V++ YCDG+SF G  E  +  +GL 
Sbjct  105   SNLMNRQMY------FGGILSSSPAENPDFFSWNRVMIRYCDGASFAG--EGYDARSGLF  156

Query  841   FRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRN-STTVKCLS  665
             FRG+RI++AV++ LL + GM  A HV LTG SAG LAV++HCD+FA  F    TTVKCL+
Sbjct  157   FRGQRIWNAVIQHLL-SMGMSSADHVLLTGSSAGALAVVLHCDQFAGFFAGRGTTVKCLA  215

Query  664   NGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRT  485
             + GFFL + + A    L + F G++  H     LP  C  +H  A  C FPQ+V   I T
Sbjct  216   DAGFFLDAVNVAGWHTLRTYFGGVVATHGVAQNLPRSC-TSHLDATSCFFPQNVIGGINT  274

Query  484   PLFIMVSTYDSYLINHTLST------GFYEAVKSKHIS--ATQYKALKELRLQML-VALR  332
             P+F+  + YD++ I  +L+       G + A KS   +  A Q   L+  R QM+   L 
Sbjct  275   PIFLRNAAYDTWQIRESLAPDVADPGGAWRACKSSRFACNAFQMNILQAFRNQMVGTVLS  334

Query  331   ETDSPSRGLFVSNCFGHTQLIFY-WNHPGFEVNYRKDV-EVVRDWYFDRINHVQEVEQST  158
              + S S G F+++CF H Q  +  WN  G      K + + V DWYF R     EV    
Sbjct  335   VSRSRSNGFFINSCFTHGQSEYATWNAYGSPNLQNKAIWKSVGDWYFGR----AEVRAID  390

Query  157   LVKDCPNN  134
                 C N+
Sbjct  391   CAYPCDNS  398



>ref|XP_008797987.1| PREDICTED: protein notum homolog isoform X1 [Phoenix dactylifera]
Length=391

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 141/369 (38%), Positives = 207/369 (56%), Gaps = 30/369 (8%)
 Frame = -3

Query  1207  FTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKT  1028
             F    T++++AV+ GAVCLDGSPPAY F  G G G   W+V++ GG WCS++ EC  R  
Sbjct  27    FDVPLTLVQAAVAKGAVCLDGSPPAYHFAPGFGSGVNNWLVHMEGGGWCSNVEECKERTG  86

Query  1027  SHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTG  848
             +  GSS          +F GIL      N +F NWNKV + YCDGSSFTGD+E VNP T 
Sbjct  87    NFRGSSKYM----KQLSFSGILGNQQNLNPDFYNWNKVKIRYCDGSSFTGDIEAVNPATN  142

Query  847   LHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCL  668
             LHFRG R++ A++++LL  KGM  A +  L+G SAGGLA I+HCD F +       VKC 
Sbjct  143   LHFRGARVWRAIMDELLA-KGMNKAQNALLSGCSAGGLASILHCDSFHDLLPAGARVKCF  201

Query  667   SNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIR  488
             S+ G+F+ +K  +  + ++  +  ++  H S   LP  C      + LC FPQ+V +++R
Sbjct  202   SDAGYFIDAKDVSGKETIKDFYNQVVTTHGSAKNLPSSCTSRFPPS-LCFFPQYVVQNMR  260

Query  487   TPLFIMVSTYDSYLINHTLSTGFYEAVK--------SKHISATQYKALKELRLQMLVALR  332
             TPLFI+ + YD++ I +  +    +  K         K  S++Q +AL+  R + L AL 
Sbjct  261   TPLFILNAAYDAWQIKNIFAPSPSDPRKIWSECKLDIKKCSSSQLQALQGFRSEFLRAL-  319

Query  331   ETDSPSRGLFVSNCFGHTQ-----LIFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVE  167
               +SPS G+F+ +C+ H Q          N P   ++     + V DW++ R + VQ++ 
Sbjct  320   PRNSPSVGMFIDSCYSHCQSGAQETWLSSNSPA--IDRMSIAKAVGDWFYGR-SAVQKI-  375

Query  166   QSTLVKDCP  140
                   DCP
Sbjct  376   ------DCP  378



>ref|XP_010942974.1| PREDICTED: protein notum homolog [Elaeis guineensis]
Length=391

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 136/350 (39%), Positives = 197/350 (56%), Gaps = 18/350 (5%)
 Frame = -3

Query  1207  FTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKT  1028
             F    T+++SAV+ GAVCLDGSPPAY F  G G G   W+V++ GG WC ++ EC  R  
Sbjct  27    FDVPLTLVQSAVAKGAVCLDGSPPAYHFTPGFGSGVNNWLVHMEGGGWCRNVEECKERTK  86

Query  1027  SHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTG  848
             +  GSS          +F GIL      N +F NWNKV + YCDGSSFTGDVE V+P T 
Sbjct  87    NFRGSSKYM----KQLSFSGILGNKQKLNPDFYNWNKVKIRYCDGSSFTGDVEAVDPATN  142

Query  847   LHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCL  668
             LHFRG R++ A+++DLL  KGM  A +  L+G SAGGLA I+HCD F +       VKC 
Sbjct  143   LHFRGARVWRAIMDDLLA-KGMSKAQNALLSGCSAGGLASILHCDSFRDLLPAGARVKCF  201

Query  667   SNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIR  488
             S+ G+F+++K  +  + +   +  ++  H S   LP  C      + +C FPQ+V + +R
Sbjct  202   SDAGYFINAKDVSGKESIRDFYNQVVATHGSAKNLPSSCTSRFPPS-MCFFPQYVVQSMR  260

Query  487   TPLFIMVSTYDSYLINHTLSTGFYEAVK--------SKHISATQYKALKELRLQMLVALR  332
             TPLFI+ + YD++ I + L+    +  K         K  S++Q + ++  R + L AL 
Sbjct  261   TPLFILNAAYDAWQIKNILAPSPSDPRKFWGECKLDIKKCSSSQLQVMQGFRSEFLRAL-  319

Query  331   ETDSPSRGLFVSNCFGHTQ---LIFYWNHPGFEVNYRKDVEVVRDWYFDR  191
               +SPS G+F+ +C+ H Q      + +     +N     + V DWYF R
Sbjct  320   PANSPSIGMFIDSCYSHCQSGAQETWLSSDSPAINKMPIAKAVGDWYFGR  369



>ref|XP_006587657.1| PREDICTED: protein notum homolog isoform X3 [Glycine max]
 gb|KHN11801.1| Protein notum like [Glycine soja]
Length=400

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 138/346 (40%), Positives = 197/346 (57%), Gaps = 17/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             TI+++AV+ GAVCLDGSPPAY F +G G G   W+V   GG WC++++ C  RKT+ LGS
Sbjct  30    TIVQNAVAKGAVCLDGSPPAYHFDRGFGSGINNWLVAFEGGGWCNNVTTCLARKTNRLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +         F GIL+     N +F NWN++ V YCDGSSFTGDVE VNP T LHFRG
Sbjct  90    SKQMA---KLIAFSGILNNREMFNPDFYNWNRIKVRYCDGSSFTGDVEAVNPVTKLHFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RIF+AV+EDLL  KGM++A +  ++G SAGGL  ++HCDRF         VKCLS+ G+
Sbjct  147   GRIFNAVMEDLLA-KGMKNARNAIISGCSAGGLTSVLHCDRFRALLPRGARVKCLSDAGY  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F++ K     Q +E  F  ++  H S   LP+ C  +     LC FPQ++   I TP+F 
Sbjct  206   FINGKDVLGEQHIEQYFSQVVATHGSARNLPQSC-TSRLSPRLCFFPQYLVSRITTPIFF  264

Query  472   MVSTYDSYLINHTLSTGFYEAVKSKH--------ISATQYKALKELRLQMLVALRET-DS  320
             + + YDS+ I + L+ G  +     H         S  Q   ++  R + L A+    +S
Sbjct  265   VNAAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSPDQLDLMQGFRTEFLRAITVLGNS  324

Query  319   PSRGLFVSNCFGHTQLIF---YWNHPGFEVNYRKDVEVVRDWYFDR  191
              S+G+F+ +C+ H Q      +      E+      + V DW+++R
Sbjct  325   SSKGMFIDSCYAHCQTEMQETWLRSDSPELKKTTIAKAVADWFYER  370



>gb|KHN27509.1| Protein notum like [Glycine soja]
Length=398

 Score =   256 bits (654),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 140/346 (40%), Positives = 196/346 (57%), Gaps = 18/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T++E+A S GAVCLDGSPPAY F KG GEG   WIV++ GG WC+++  C  RK + LGS
Sbjct  30    TLVENAESKGAVCLDGSPPAYHFDKGFGEGIDNWIVHIEGGGWCNNVESCLERKNTRLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +         F  IL      N +F NWN+V V YCDGSSFTGDVE V+PTT LHFRG
Sbjct  90    SKQM----KDIYFSAILSNEQQFNPDFYNWNRVKVRYCDGSSFTGDVEEVDPTTNLHFRG  145

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RIF AV+E+LL  KGM++  +  L+G SAGGL  I+HCD F     +   VKC+ + G+
Sbjct  146   ARIFSAVMEELLA-KGMKNVKNAILSGCSAGGLTTILHCDSFKALLPSGANVKCVPDAGY  204

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F++ +  + A  ++  +  ++ +H S   LP  C      A LC FPQ+VA  I TP+F+
Sbjct  205   FVNVEDISGAHSIQEFYSEVVSIHGSAKNLPTSCTSKLNPA-LCFFPQYVASHISTPIFV  263

Query  472   MVSTYDSYLINHTLSTGFYEAVKSKH--------ISATQYKALKELRLQMLVALRET-DS  320
             + S YD + I +    G  +   S H         S  Q   ++  + +   AL E  DS
Sbjct  264   VNSAYDRWQIRNIFIPGSADPSNSWHSCKINISNCSTDQLSKIQGFKSEFERALSEVGDS  323

Query  319   PSRGLFVSNCFGH--TQLIFYW-NHPGFEVNYRKDVEVVRDWYFDR  191
             PS+G+F+ +C+ H  T+L   W      ++      + V DW++ R
Sbjct  324   PSKGVFIDSCYAHCQTELQETWLKSDSPQLANTTIAKAVGDWFYGR  369



>ref|XP_004244443.1| PREDICTED: uncharacterized protein LOC101251798 [Solanum lycopersicum]
Length=392

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 146/401 (36%), Positives = 214/401 (53%), Gaps = 46/401 (11%)
 Frame = -3

Query  1285  MGTLLNTTFILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGE  1106
             M  LL   F LLIV++ +      +Y       L+SAV+ GAVCLDGSPPAY F KG G 
Sbjct  6     MQLLLRAIFTLLIVLISEGHPVEITY-------LQSAVAKGAVCLDGSPPAYHFDKGFGA  58

Query  1105  GRQRWIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCN  926
             G   W + L GG WC++ + C  R  + LGSS          +F GIL      N +F N
Sbjct  59    GVNNWFIQLEGGAWCNNATTCLERTKTRLGSSKLMV---KTVSFSGILSNKAKFNPDFYN  115

Query  925   WNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGS  746
             WN++ + YCDGSSFTGDV   +P T + +RG RIF AV++D L  KGM++A +  L G S
Sbjct  116   WNRIRIRYCDGSSFTGDVAAADPRTKVFYRGARIFSAVMDDFLA-KGMKNAQNAILAGCS  174

Query  745   AGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAV  566
             AG LA I+HCDRF     +   VKCLS+ GFF++++  +    +E  +  +++ H S   
Sbjct  175   AGSLAAILHCDRFKGLLPSGAKVKCLSDAGFFINTQTISGTSHIEKFYSEVVNTHGSAKN  234

Query  565   LPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEA--------  410
             LP+ C    +   LC FPQ+VA+ I+TPLF++ + YDS+ I + L+ G  +         
Sbjct  235   LPQSCTSRLKPG-LCFFPQNVAQQIQTPLFLVNAAYDSWQIKNILAPGVADPHGTWRNCK  293

Query  409   VKSKHISATQYKALKELRLQMLVALRET-DSPSRGLFVSNCFGHTQLIFYWNHPGFEVNY  233
             +     S+ Q + ++  R + L AL     S +RG ++++C+ H Q        G +  +
Sbjct  294   LDILKCSSAQLQTMQAFRSEFLKALNSLGPSSTRGYYINSCYAHCQT-------GTQETW  346

Query  232   RKD----------VEVVRDWYFDRINHVQEVEQSTLVKDCP  140
              +D           + V DWY++R    QE+       DCP
Sbjct  347   LRDDSPVLSGTTIAKAVGDWYYER-KRFQEI-------DCP  379



>ref|XP_006359968.1| PREDICTED: protein notum homolog, partial [Solanum tuberosum]
Length=369

 Score =   254 bits (650),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 145/365 (40%), Positives = 208/365 (57%), Gaps = 25/365 (7%)
 Frame = -3

Query  1198  NSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHL  1019
             N TIL++AV+ GAVCLDGSPPAY   +G G G   W++ + GG WC ++++C  RK S  
Sbjct  10    NLTILQTAVAKGAVCLDGSPPAYHLDRGSGTGVNNWVISVEGGGWCQNVAQCLLRKNSKY  69

Query  1018  GSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHF  839
             GSS +    ++   F G+L      N EF NWN+V V YCDG SFTGDVE ++P TGLH+
Sbjct  70    GSSAKM---ENQVFFSGMLSNEQKFNPEFYNWNRVFVRYCDGGSFTGDVEAIDPGTGLHY  126

Query  838   RGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNG  659
             RG RIF A++E+LL  +GM  + +  L+G SAGGL  I+HCD F     +S  VKC S+ 
Sbjct  127   RGARIFKAIMEELLA-QGMNKSENAILSGCSAGGLTTILHCDNFRILLPSSVKVKCFSDA  185

Query  658   GFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPL  479
             G+F++ +  +    ++  F  ++ LH S   LP  C    + + LC FPQ+VA+ I+TPL
Sbjct  186   GYFVNIEDISGKLFIQQFFNDVVTLHGSVRNLPPSCTSKLKPS-LCFFPQNVAQQIQTPL  244

Query  478   FIMVSTYDSYLINHTL------STGFYEAVKS--KHISATQYKALKELRLQMLVALRET-  326
             FI+ S YDS+ + + L        G + +  +  K  +  Q K L+  RL  L AL    
Sbjct  245   FIINSAYDSWQVRNILVPRGTDPKGAWNSCGANIKTCTPDQLKVLQGFRLNFLKALEGLG  304

Query  325   DSPSRGLFVSNCFGH--TQLIFYWNHPGFEVNYRKDV-EVVRDWYFDRINHVQEVEQSTL  155
              S +RG ++++CF H  TQ    W  P     + K + E V DW  +R N  +++     
Sbjct  305   PSSTRGYYINSCFAHCQTQKQASWFGPNSPRLFNKTIAEAVGDWVLER-NQFRQI-----  358

Query  154   VKDCP  140
               DCP
Sbjct  359   --DCP  361



>tpg|DAA36176.1| TPA: pectinacetylesterase [Zea mays]
Length=519

 Score =   259 bits (662),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 148/361 (41%), Positives = 199/361 (55%), Gaps = 26/361 (7%)
 Frame = -3

Query  1186  LESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGSSH  1007
             L++AV+ GAVCLDGSPP Y F  G G G   W+V++ GG WC +  EC  RK +  GSS 
Sbjct  160   LKAAVAKGAVCLDGSPPVYHFSPGSGSGANNWVVHMEGGGWCRNPDECAVRKGNFRGSSK  219

Query  1006  RQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRR  827
                      +F GIL  N   N +F NWN+V + YCDGSSFTGDVE V+    L +RG R
Sbjct  220   FM----KPLSFSGILGGNQKSNPDFYNWNRVKIRYCDGSSFTGDVEAVDTAKDLRYRGFR  275

Query  826   IFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFL  647
             ++ AV++DLL  +GM  A +  L+G SAGGLA I+HCDRF + F   T VKC S+ G+F 
Sbjct  276   VWRAVIDDLLTVRGMSKAQNALLSGCSAGGLAAILHCDRFHDLFPAKTKVKCFSDAGYFF  335

Query  646   HSKHPAKAQDLESKFRGIIDLHNSTAVLPEPC-RKNHQLAYLCMFPQHVAKDIRTPLFIM  470
               K  +      S ++ +++LH S   LP  C  K  Q   LCMFPQ+V   +RTPLFI+
Sbjct  336   DGKDISGNFYARSIYKSVVNLHGSAKNLPASCTSKPKQSPELCMFPQYVVPTMRTPLFIL  395

Query  469   VSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRETDSPS  314
              + YDS+ + + L+    +  K+        K  SA+Q   L+  R   L AL +T   S
Sbjct  396   NAAYDSWQVKNVLAPSPADPKKTWAQCKLDIKSCSASQLTTLQNFRTDFLAALPKTQ--S  453

Query  313   RGLFVSNCFGHTQLIFY--WNHPGFE-VNYRKDVEVVRDWYFDRINHVQEVEQSTLVKDC  143
              G+F+ +C  H Q      W   G   VN  +  + V DWY+DR     EV +     DC
Sbjct  454   VGMFIDSCNAHCQSGSQDTWLADGSPTVNKTQIGKAVGDWYYDR-----EVPRQI---DC  505

Query  142   P  140
             P
Sbjct  506   P  506



>ref|XP_007156331.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
 gb|ESW28325.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
Length=417

 Score =   256 bits (654),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 141/352 (40%), Positives = 199/352 (57%), Gaps = 29/352 (8%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T +E+AV+ GAVCLDGS PAY F KG G G   WIV+  GG WC++++ C +R+ + LGS
Sbjct  48    TFVENAVAKGAVCLDGSAPAYHFHKGSGAGINNWIVHFEGGGWCNNVTSCLSRRDTRLGS  107

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +    D+  +F G    +   N +F +WN++ V YCDGSSFTGDVE V+P T LHFRG
Sbjct  108   SKKM---DTQLSFSGFFSNSKKFNQDFYDWNRIKVRYCDGSSFTGDVEAVDPRTNLHFRG  164

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R+F AVVEDLL  KGM++A +  ++G SAGGLA I++CDRF      +T VKCL++ G+
Sbjct  165   ARVFAAVVEDLLA-KGMKNAQNAIISGCSAGGLAAILNCDRFKALLPRTTKVKCLADAGY  223

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F++ K  + AQ +E  +  ++  H S   LP  C    +   LC FPQ+V   I TP+F 
Sbjct  224   FINVKDVSGAQRIEEFYSQVVQTHGSAKNLPSSCTSRLKPG-LCFFPQNVVSQISTPIFF  282

Query  472   MVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALRET-DS  320
             + + YDS+ I + L+ G  +         +  K+ S  Q   ++  R   L A     +S
Sbjct  283   VNAAYDSWQIKNILAPGAADPHGQWRECKLDIKNCSPNQLSVMQVFRTDFLRAFGAVGNS  342

Query  319   PSRGLFVSNCFGHTQLIFYWNHPGFEVNYRKDVEV---------VRDWYFDR  191
             PS+G F+  C+ H Q          E   R D  V         V DW++DR
Sbjct  343   PSKGHFIDGCYAHCQTGTQ------ETWLRNDSPVLGNTTIARAVGDWFYDR  388



>emb|CDY11398.1| BnaA09g39640D [Brassica napus]
Length=415

 Score =   256 bits (654),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 141/363 (39%), Positives = 209/363 (58%), Gaps = 26/363 (7%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T++  A S GAVCLDG+ P Y   +G G G   W+++L GG WC++ S C  RKT+  GS
Sbjct  54    TLIHGADSKGAVCLDGTLPGYHLDRGFGSGANSWLIHLEGGGWCNNRSSCVFRKTTRRGS  113

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S    + + A NF GIL     EN +F NWN++ + YCDG+SF+GD +     T   +RG
Sbjct  114   SK---FMEKALNFTGILSNTPQENPDFFNWNRIKLRYCDGASFSGDSQDEGSQT--FYRG  168

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
             +RI+ A +E+ + + GMQ A    L+G SAGGLA I+HCD F  R   ST VKCLS+ G 
Sbjct  169   KRIWQAAMEEFM-SVGMQKAEQALLSGCSAGGLASILHCDDFRERLPLSTKVKCLSDAGM  227

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             FL +   +    L + ++G++ + N    L   C  NH     C FPQ++  DI+TP+F+
Sbjct  228   FLDAVDVSGGHSLRNMYQGVVTVQNLQKDLSSAC-TNHLDPTSCFFPQNLVSDIKTPMFL  286

Query  472   MVSTYDSYLINHTLST------GFYEAVKS--KHISATQYKALKELRLQMLVALRE-TDS  320
             + S YDS+ + H+L+       G +E  KS     +++Q + L+E R QM++AL   + S
Sbjct  287   LNSAYDSWQVRHSLAPSPADPRGVWEHCKSDISRCNSSQLQFLQEFRKQMVLALNSFSAS  346

Query  319   PSRGLFVSNCFGHTQLIF---YWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTLVK  149
             P  GLF+++CF H Q      ++     ++N ++  E V DWYFDR N+V+ +       
Sbjct  347   PQNGLFINSCFTHCQSEIQDTWFTQDSPKLNGKRVAESVGDWYFDRTNNVKAI-------  399

Query  148   DCP  140
             DCP
Sbjct  400   DCP  402



>ref|XP_003547821.1| PREDICTED: protein notum homolog [Glycine max]
 gb|KHN26083.1| Protein notum like [Glycine soja]
Length=398

 Score =   256 bits (653),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 141/347 (41%), Positives = 196/347 (56%), Gaps = 22/347 (6%)
 Frame = -3

Query  1189  ILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGSS  1010
             ++E+A S GAVCLDGSPPAY F KG GEG   WIV++ GG WC++I  C +RK + LGSS
Sbjct  31    LVENAESKGAVCLDGSPPAYHFDKGFGEGINSWIVHIEGGGWCNNIESCLDRKDTRLGSS  90

Query  1009  HRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGR  830
              +         F GIL      N +F NWN+V V YCDGSSFTGDVE V+PTT LHFRG 
Sbjct  91    KQM----EDIYFSGILSNEQQFNPDFYNWNRVKVRYCDGSSFTGDVEEVDPTTNLHFRGA  146

Query  829   RIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFF  650
             RIF AV+E+LL  KG++ A +  L+G SAGGL  I+HCD F     +   VKC+ + G+F
Sbjct  147   RIFSAVIEELLA-KGLERAENAILSGCSAGGLTTILHCDSFKTFLPSRANVKCVPDAGYF  205

Query  649   LHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIM  470
             ++ +  + A  ++  +  ++  H S   LP  C        LC FPQ+VA  I TP+F++
Sbjct  206   VNVEDISGAHFIQQYYSEVVSTHGSAKNLPTSCTSKLS-PTLCFFPQYVASHISTPIFVV  264

Query  469   VSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALRET-DSP  317
              S YDS+ I +    G  +         V   + S  Q   L+  + +   AL E  DSP
Sbjct  265   NSAYDSWQIRYIFVPGSADPSDSWNSCKVNMSNCSPDQLSKLQGFKSEFERALSEVGDSP  324

Query  316   SRGLFVSNCFGHTQ-----LIFYWNHPGFEVNYRKDVEVVRDWYFDR  191
             S+G+F+ +C+ H Q       F  + P  ++      + V DW++ R
Sbjct  325   SKGMFIDSCYAHCQTEPQETWFKTDSP--KLANTTIAKAVADWFYGR  369



>ref|XP_008373438.1| PREDICTED: protein notum homolog isoform X1 [Malus domestica]
Length=466

 Score =   257 bits (657),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 145/346 (42%), Positives = 198/346 (57%), Gaps = 17/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T + SAV+ GAVCLDGSPPAY   KG G G   W+V++ GG WC++I+ C  RK + LGS
Sbjct  58    TYVHSAVAKGAVCLDGSPPAYHLDKGYGSGINNWLVHIEGGGWCNNITTCLVRKNNRLGS  117

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +         F GIL+     N +F NWN+V V YCDG+SFTGDV  VN  TGL FRG
Sbjct  118   SKKML---KEIAFSGILNSRHIFNPDFYNWNRVKVRYCDGASFTGDVAAVNLATGLFFRG  174

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RIF AV+E+LL  KGM  A +  L+G SAGGLA I+HCD F         VKC+S+ G+
Sbjct  175   ARIFRAVIEELLA-KGMGKAKNAILSGCSAGGLASILHCDNFHALLPVGAKVKCVSDAGY  233

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+++K  + A+ +E  F  ++  H S   LP  C        LC FPQ+ A  IRTP+F 
Sbjct  234   FINAKDVSGARHVEQFFSQVVATHGSAKNLPPSCTSKLSPG-LCFFPQYFASQIRTPMFY  292

Query  472   MVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALRE-TDS  320
             + + YDS+ I + L+ G  +         +   H   TQ K +++ R Q L A+   + S
Sbjct  293   VNAAYDSWQIKNILAPGVADPHGTWQNCKLDITHCKPTQLKTMQDFRAQFLSAIGGVSGS  352

Query  319   PSRGLFVSNCFGH--TQLIFYWNHPGFEV-NYRKDVEVVRDWYFDR  191
              S+G+F+ +C+ H  T+L   W  P   V N     + V DW++DR
Sbjct  353   RSKGMFIDSCYAHCQTELQETWLMPDSPVLNKTTIAKAVGDWFYDR  398



>ref|NP_974575.2| putative pectinacetylesterase [Arabidopsis thaliana]
 gb|AEE84179.1| putative pectinacetylesterase [Arabidopsis thaliana]
Length=365

 Score =   254 bits (649),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 139/337 (41%), Positives = 200/337 (59%), Gaps = 19/337 (6%)
 Frame = -3

Query  1162  AVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSA  983
             AVCLDGSPPAY   +G G G   W++ L GG WC++++ C +R  + LGSS +   N   
Sbjct  6     AVCLDGSPPAYHLDRGSGTGINSWLIQLEGGGWCNNVTNCVSRMHTRLGSSKKMVEN---  62

Query  982   FNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVED  803
               F  IL      N +F NWN+V V YCDG+SFTGDVE VNP T LHFRG R++ AV+++
Sbjct  63    LAFSAILSNKKQYNPDFYNWNRVKVRYCDGASFTGDVEAVNPATNLHFRGARVWLAVMQE  122

Query  802   LLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKA  623
             LL  KGM +A +  L+G SAGGLA ++HCD F       T VKCLS+ GFFL+++  +  
Sbjct  123   LLA-KGMINAENAVLSGCSAGGLASLMHCDSFRALLPMGTKVKCLSDAGFFLNTRDVSGV  181

Query  622   QDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLI  443
             Q +++ F  ++ LH S   LP  C      A +C FPQ+VA+ IRTPLFI+ + YDS+ I
Sbjct  182   QYIKTYFEDVVTLHGSAKNLPRSCTSRLTPA-MCFFPQYVARQIRTPLFILNAAYDSWQI  240

Query  442   NHTLST------GFYEAVK--SKHISATQYKALKELRLQMLVA-LRETDSPSRGLFVSNC  290
              + L+       G +++ +   K+   +Q K +++ RL+ L A +    S SRG+F+ +C
Sbjct  241   KNILAPRAADPYGKWQSCQLDIKNCHPSQIKVMQDFRLEFLSAVIGLGRSSSRGMFIDSC  300

Query  289   FGH----TQLIFYWNHPGFEVNYRKDVEVVRDWYFDR  191
             + H    TQ  ++W      +N     + V DW +DR
Sbjct  301   YTHCQTETQTSWFWQDSPI-LNRTTIAKAVGDWVYDR  336



>gb|KHN27511.1| Protein notum like [Glycine soja]
Length=398

 Score =   255 bits (652),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 139/346 (40%), Positives = 201/346 (58%), Gaps = 18/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T+++++ + GAVCLDGSPPAY F KG G+G   WIV++ GG WC++++ C +RK + LGS
Sbjct  30    TLVKNSETKGAVCLDGSPPAYHFDKGFGKGINNWIVHIEGGGWCNNVTSCLDRKNTTLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S+      S  +F  IL      N +F NWN+V V YCDGSSFTGDVE V+PTT LHFRG
Sbjct  90    SNHM----SDISFYAILSNQQQFNPDFYNWNRVKVRYCDGSSFTGDVEEVDPTTNLHFRG  145

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RIF AV+E+LL  KGM++A +  L+G SAGGL  I+HCD F     +   VKC+ + G+
Sbjct  146   ARIFSAVMEELLA-KGMKNAKNAILSGCSAGGLTTILHCDSFKALLPSRANVKCVPDAGY  204

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F++ +  + A   +  +  ++ +H S   LP  C      A LC FPQ+VA  I TP+F+
Sbjct  205   FVNVEDISGAHSFQEFYSEVVSIHGSAKNLPTSCTSKLNPA-LCFFPQYVASHISTPIFV  263

Query  472   MVSTYDSYLINHTLSTGFYEAVKSKH--------ISATQYKALKELRLQMLVALRET-DS  320
             + S YD + I +       +   S H         S  Q   L+  + +   AL E  DS
Sbjct  264   VNSAYDWWQIGNIFVPSSADPSNSWHSCKLNLSNCSPDQLSKLQGFKSEFQRALSEVGDS  323

Query  319   PSRGLFVSNCFGH--TQLIFYWNHPGFEVNYRKDV-EVVRDWYFDR  191
             PS+G+F+ +C+ H  T+    W   G ++   K + + V DW++ R
Sbjct  324   PSKGMFIDSCYAHCQTETQETWFKSGSQLLANKTIAKAVGDWFYGR  369



>ref|XP_006587656.1| PREDICTED: protein notum homolog isoform X2 [Glycine max]
Length=450

 Score =   257 bits (656),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 139/346 (40%), Positives = 199/346 (58%), Gaps = 17/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             TI+++AV+ GAVCLDGSPPAY F +G G G   W+V   GG WC++++ C  RKT+ LGS
Sbjct  30    TIVQNAVAKGAVCLDGSPPAYHFDRGFGSGINNWLVAFEGGGWCNNVTTCLARKTNRLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +         F GIL+     N +F NWN++ V YCDGSSFTGDVE VNP T LHFRG
Sbjct  90    SKQMA---KLIAFSGILNNREMFNPDFYNWNRIKVRYCDGSSFTGDVEAVNPVTKLHFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RIF+AV+EDLL  KGM++A +  ++G SAGGL  ++HCDRF         VKCLS+ G+
Sbjct  147   GRIFNAVMEDLLA-KGMKNARNAIISGCSAGGLTSVLHCDRFRALLPRGARVKCLSDAGY  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F++ K     Q +E  F  ++  H S   LP+ C  +     LC FPQ++   I TP+F 
Sbjct  206   FINGKDVLGEQHIEQYFSQVVATHGSARNLPQSC-TSRLSPRLCFFPQYLVSRITTPIFF  264

Query  472   MVSTYDSYLINHTLSTGFYEAVKSKH--------ISATQYKALKELRLQMLVALRET-DS  320
             + + YDS+ I + L+ G  +     H         S  Q   ++  R + L A+    +S
Sbjct  265   VNAAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSPDQLDLMQGFRTEFLRAITVLGNS  324

Query  319   PSRGLFVSNCFGH--TQLIFYW-NHPGFEVNYRKDVEVVRDWYFDR  191
              S+G+F+ +C+ H  T++   W      E+      + V DW+++R
Sbjct  325   SSKGMFIDSCYAHCQTEMQETWLRSDSPELKKTTIAKAVADWFYER  370



>ref|XP_009116880.1| PREDICTED: protein notum homolog [Brassica rapa]
Length=415

 Score =   255 bits (652),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 140/363 (39%), Positives = 209/363 (58%), Gaps = 26/363 (7%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T++  A S GAVCLDG+ P Y   +G G G   W+++L GG WC++ S C  RKT+  GS
Sbjct  54    TLIHGADSKGAVCLDGTLPGYHLDRGFGSGANSWLIHLEGGGWCNNQSSCVFRKTTRRGS  113

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S    + + A NF GIL     EN +F  WN++ + YCDG+SF+GD +     T   +RG
Sbjct  114   SK---FMEKALNFTGILSNTPQENPDFFKWNRIKLRYCDGASFSGDSQDEGSQT--FYRG  168

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
             +RI+ A +E+ + + GMQ A    L+G SAGGLA I+HCD F  R   ST VKCLS+ G 
Sbjct  169   KRIWQAAMEEFM-SVGMQKAEQALLSGCSAGGLASILHCDDFRERLPLSTKVKCLSDAGM  227

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             FL +   +  + L + ++G++ + N    L   C  NH     C FPQ++  DI+TP+F+
Sbjct  228   FLDAVDVSGGRSLRNMYQGVVTVQNLQKDLSSAC-TNHLDPTSCFFPQNLVSDIKTPMFL  286

Query  472   MVSTYDSYLINHTLST------GFYEAVKS--KHISATQYKALKELRLQMLVALRE-TDS  320
             + S YDS+ + H+L+       G +E  KS     +++Q + L+E R QM++AL   + S
Sbjct  287   LNSAYDSWQVRHSLAPSPADPRGVWEHCKSDISRCNSSQLQFLQEFRKQMVLALNSFSAS  346

Query  319   PSRGLFVSNCFGHTQLIF---YWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTLVK  149
             P  GLF+++CF H Q      ++     ++N ++  E V DWYFDR N+V+ +       
Sbjct  347   PQNGLFINSCFTHCQSEIQDTWFTQDSPKLNGKRVAESVGDWYFDRTNNVKAI-------  399

Query  148   DCP  140
             DCP
Sbjct  400   DCP  402



>ref|XP_004509558.1| PREDICTED: protein notum homolog [Cicer arietinum]
Length=397

 Score =   254 bits (650),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 146/346 (42%), Positives = 203/346 (59%), Gaps = 17/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T LE+AVS GAVCLDGSPP + F +G G+G   WIV++ GG WC ++ +C  RK S LGS
Sbjct  28    TRLENAVSKGAVCLDGSPPTFHFDEGHGDGVNNWIVHIEGGGWCHNVQDCLGRKNSRLGS  87

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S   +  + ++ F G L  N   N +F NWN+V V YCDGSSFTGDVE V+PTT LHFRG
Sbjct  88    S--DHMKEKSY-FSGYLSNNQQFNPDFYNWNRVKVRYCDGSSFTGDVEEVDPTTKLHFRG  144

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RIF AV+E+LL  +GM  A +  L+G SAGGL  I+HCD F     N   VKC+S+ G+
Sbjct  145   ARIFSAVMEELLA-RGMVHAKNAILSGCSAGGLTSILHCDGFKALLPNGARVKCVSDAGY  203

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F++ K  +  Q +E  FR +++ H S   LP  C        LC FPQ++A  I+TP+FI
Sbjct  204   FVNVKDISGEQFIEEYFRQVVETHGSAKNLPTSCTSTLSPG-LCFFPQYMASGIKTPIFI  262

Query  472   MVSTYDSYLINHTLSTGF------YEAVKSKHI--SATQYKALKELRLQMLVALRET-DS  320
             + + YDS+ I + L+ G       + + K+  I  S  Q   +++ R Q L AL    +S
Sbjct  263   VNAAYDSWQIKNILAPGAADPNGQWRSCKTNLINCSPKQLNIMQDYRSQFLKALSVVGNS  322

Query  319   PSRGLFVSNCFGH--TQLIFYWNHPGFEVNYRKDVE-VVRDWYFDR  191
              S G+F+ +C+ H  T+    W          K +   V DW+++R
Sbjct  323   SSNGMFIDSCYIHCQTEPQETWLQSDSPTVANKTIAGAVADWFYER  368



>ref|XP_003580427.1| PREDICTED: uncharacterized protein LOC100827238 isoform X2 [Brachypodium 
distachyon]
Length=391

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 142/361 (39%), Positives = 200/361 (55%), Gaps = 26/361 (7%)
 Frame = -3

Query  1186  LESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGSSH  1007
             L+SAV+ GAVCLDGSPP Y F  G G G   W+V++ GG WC +  EC+ RK +  GSS 
Sbjct  32    LKSAVAKGAVCLDGSPPVYHFSPGSGSGANNWVVHMEGGGWCKTSEECSIRKGNFRGSSK  91

Query  1006  RQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRR  827
                      +F GIL  +   N +F NWN+V V YCDGSSFTGDVE V  +T LH+RG R
Sbjct  92    YM----KPLSFSGILGGSDKFNPDFYNWNRVKVRYCDGSSFTGDVEAVETSTNLHYRGNR  147

Query  826   IFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFL  647
             ++ A+++DLL ++GM  A +  L+G SAGGLA I+HCDRF++    S  VKC S+ G+F 
Sbjct  148   VWQAIIQDLL-DRGMSKAQNALLSGCSAGGLAAILHCDRFSDLLPASAKVKCFSDAGYFF  206

Query  646   HSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMV  467
                       +   ++ I++LH S   LP  C        LC FPQ+V   +RTPLFI+ 
Sbjct  207   DGTDITGNNYVRKSYKDIVNLHGSAKSLPSSCTSKRS-PELCFFPQYVIPTLRTPLFILN  265

Query  466   STYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRET-DSPS  314
             + YD++ I + L+    +  K+        K  S++Q   L+  R   L AL +   SPS
Sbjct  266   AAYDTWQIRNILAPNAADPKKTWAKCKLDIKSCSSSQLVTLQNFRKDFLAALPQPGQSPS  325

Query  313   RGLFVSNCFGHTQ--LIFYWNHPGF-EVNYRKDVEVVRDWYFDRINHVQEVEQSTLVKDC  143
              G+F+ +CF H Q      W   G   +   +  + V DW+++R  HV +      + DC
Sbjct  326   LGIFIDSCFAHCQSGAQDTWIGEGSPSIQKMRIGKAVGDWFYNR--HVSQ------LIDC  377

Query  142   P  140
             P
Sbjct  378   P  378



>ref|XP_009603747.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana tomentosiformis]
Length=392

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 156/389 (40%), Positives = 215/389 (55%), Gaps = 25/389 (6%)
 Frame = -3

Query  1285  MGTLLNTTFILLIVVLHQQP---QTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKG  1115
             M  +++   IL+  VL        T       N T LE+A+S GAVCLDGS PA+ F  G
Sbjct  1     MEKVMDCNSILMAAVLFSLLCLWTTTEGDLIVNITYLETAISKGAVCLDGSAPAFHFDPG  60

Query  1114  IGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSE  935
              G G   W+++L GG WC +IS C  R  + L S + Q    +   F G+L  +   N +
Sbjct  61    TGSGIYSWLIHLQGGGWCETISNCQYRALTDLSSKNMQ----NISYFTGVLSSDPQLNPD  116

Query  934   FCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLT  755
             F NWN+V V YCDGSS+TGD+E V+P T LHFRG RIF+A++E  L  +GM  A +  L+
Sbjct  117   FYNWNRVKVKYCDGSSYTGDIEEVDPDTNLHFRGARIFEAIMEYFL-GQGMIYAQNAILS  175

Query  754   GGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNS  575
             G SAGGL  IIHCD+F      +  VKC+S+ GFF+  +  +    +E  ++ ++ LH S
Sbjct  176   GTSAGGLGAIIHCDKFRLFLPLTARVKCISDAGFFVDLETISGEPLIEEMYKRVVALHGS  235

Query  574   TAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKS--  401
                LP  C        LC FPQ+VA+ I TPLFI+ S YDS+ IN++L     +      
Sbjct  236   AKNLPLSCTALSSDPNLCFFPQYVARHICTPLFIVNSAYDSWQINNSLVPRVADPDDEWT  295

Query  400   ---KHI---SATQYKALKELRLQMLVALRET-DSPSRGLFVSNCFGH--TQLIFYW---N  257
                K I   S +Q + L++ RL  L AL E   S SRG F+S+C  H   ++  YW   N
Sbjct  296   YCKKDINVCSPSQIQTLQDFRLTFLEALNELGPSTSRGYFISSCHSHHGIEIQNYWSSKN  355

Query  256   HPGFEVNYRKDVEVVRDWYFDRINHVQEV  170
              P   ++ +   E V DW+FDR +  QEV
Sbjct  356   SP--TLDNKTIAEAVGDWFFDR-SGFQEV  381



>ref|XP_010240371.1| PREDICTED: uncharacterized protein LOC100827238 isoform X1 [Brachypodium 
distachyon]
Length=404

 Score =   254 bits (650),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 142/361 (39%), Positives = 202/361 (56%), Gaps = 26/361 (7%)
 Frame = -3

Query  1186  LESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGSSH  1007
             L+SAV+ GAVCLDGSPP Y F  G G G   W+V++ GG WC +  EC+ RK +  GSS 
Sbjct  45    LKSAVAKGAVCLDGSPPVYHFSPGSGSGANNWVVHMEGGGWCKTSEECSIRKGNFRGSSK  104

Query  1006  RQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRR  827
                      +F GIL  +   N +F NWN+V V YCDGSSFTGDVE V  +T LH+RG R
Sbjct  105   YM----KPLSFSGILGGSDKFNPDFYNWNRVKVRYCDGSSFTGDVEAVETSTNLHYRGNR  160

Query  826   IFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFL  647
             ++ A+++DLL ++GM  A +  L+G SAGGLA I+HCDRF++    S  VKC S+ G+F 
Sbjct  161   VWQAIIQDLL-DRGMSKAQNALLSGCSAGGLAAILHCDRFSDLLPASAKVKCFSDAGYFF  219

Query  646   HSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMV  467
                       +   ++ I++LH S   LP  C  + +   LC FPQ+V   +RTPLFI+ 
Sbjct  220   DGTDITGNNYVRKSYKDIVNLHGSAKSLPSSC-TSKRSPELCFFPQYVIPTLRTPLFILN  278

Query  466   STYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRET-DSPS  314
             + YD++ I + L+    +  K+        K  S++Q   L+  R   L AL +   SPS
Sbjct  279   AAYDTWQIRNILAPNAADPKKTWAKCKLDIKSCSSSQLVTLQNFRKDFLAALPQPGQSPS  338

Query  313   RGLFVSNCFGHTQ--LIFYWNHPGF-EVNYRKDVEVVRDWYFDRINHVQEVEQSTLVKDC  143
              G+F+ +CF H Q      W   G   +   +  + V DW+++R  HV +      + DC
Sbjct  339   LGIFIDSCFAHCQSGAQDTWIGEGSPSIQKMRIGKAVGDWFYNR--HVSQ------LIDC  390

Query  142   P  140
             P
Sbjct  391   P  391



>ref|XP_002454426.1| hypothetical protein SORBIDRAFT_04g030720 [Sorghum bicolor]
 gb|EES07402.1| hypothetical protein SORBIDRAFT_04g030720 [Sorghum bicolor]
Length=398

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 150/365 (41%), Positives = 202/365 (55%), Gaps = 29/365 (8%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T +ESAV+ GAVCLDGS PAY   +G G G   W+V+  GG WC++++ C  RK + LGS
Sbjct  31    TYVESAVAKGAVCLDGSAPAYHLARGSGSGENSWLVHFEGGGWCNNVTTCLQRKRTRLGS  90

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S       +   F GIL      N +F NWNKV V YCDGSSFTGDVE V+PTT LHFRG
Sbjct  91    SKEMA---TQIAFSGILSDTPDGNPDFYNWNKVKVRYCDGSSFTGDVEEVDPTTKLHFRG  147

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RI+ AV+EDLL  KGM  A +  ++G SAGGL  I+HCDRF +    +  VKCLS+ GF
Sbjct  148   ARIWQAVMEDLLA-KGMDKAENALISGCSAGGLTSILHCDRFHDLLPLAARVKCLSDAGF  206

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F++ K  A    + + F  ++  H S   LP  C        +C FP++  K I TPLFI
Sbjct  207   FINEKDVAGVGYIAAFFNDVVTTHGSANNLPPSCTSMLPPG-MCFFPKNEVKQIHTPLFI  265

Query  472   MVSTYDSYLINHTLSTGFYEAVKSKH--------ISATQYKALKELRLQMLVALRE-TDS  320
             + + YDS+ + + L  G  +     H         SA+Q + L+  R   L  + E  +S
Sbjct  266   LNAAYDSWQVRNILVPGVADPHGKWHSCKHDIGQCSASQLRVLQGFRGDFLKEVSEQANS  325

Query  319   PSRGLFVSNCFGHTQ-----LIFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTL  155
              SRGLF+++CF H Q     L F  + P  ++        V DW+F R +  Q++     
Sbjct  326   DSRGLFINSCFVHCQSESQELWFSSDSP--KLGNTTIANAVGDWFFGR-SSFQKI-----  377

Query  154   VKDCP  140
               DCP
Sbjct  378   --DCP  380



>gb|ABK24994.1| unknown [Picea sitchensis]
Length=399

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 142/373 (38%), Positives = 211/373 (57%), Gaps = 27/373 (7%)
 Frame = -3

Query  1222  TANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISEC  1043
             +AN+ F  + T++E AV+ GAVCLDGSPP Y   +G G G   W+V+  GG WC++++ C
Sbjct  25    SANA-FLVDLTLVEDAVAKGAVCLDGSPPGYHLSRGFGSGVNNWLVHFEGGSWCNNVTTC  83

Query  1042  TNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETV  863
             + R  + LGSS          +F G+L  N A N +F NWN++ V YCDG+SFTGDVE V
Sbjct  84    SARTKTRLGSSKYMI---KQVDFSGLLGNNKARNPDFYNWNRIKVRYCDGASFTGDVEAV  140

Query  862   NPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNST  683
             NP   L+FRG+R+F AV+ DL+  KGM +A    ++G SAGGL  I+HCD F      +T
Sbjct  141   NPVDKLYFRGQRVFKAVIGDLMA-KGMINAQQAVISGCSAGGLTSILHCDNFRALMPKTT  199

Query  682   TVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHV  503
              VKCL++ GFF+  K  + A  + S F  +  L  S   LP  C    +L   C FPQ++
Sbjct  200   KVKCLADAGFFIDVKDVSGAYHIRSFFNEVATLQQSVKNLPLAC--TEKLGTQCFFPQYL  257

Query  502   AKDIRTPLFIMVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQM  347
                I+TPLF++ + YDS+ I + ++ G  +         +  K  S  Q + ++  RL+M
Sbjct  258   LPYIQTPLFLLNAGYDSWQIKNIVAPGVADPHGLWHNCKLDIKKCSPNQLETMQGFRLEM  317

Query  346   LVALRE-TDSPSRGLFVSNCFGHTQLIF---YWNHPGFEVNYRKDVEVVRDWYFDRINHV  179
             L AL+   +S S G+F+++C+ H Q      +  +   ++N     E V++WYF      
Sbjct  318   LNALKIFQNSASGGMFINSCYAHCQSEMQETWLANDSPKLNGLSIAEAVQNWYFG-----  372

Query  178   QEVEQSTLVKDCP  140
             Q + + T   DCP
Sbjct  373   QGIVKET---DCP  382



>gb|EMT14315.1| hypothetical protein F775_08483 [Aegilops tauschii]
Length=400

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 153/378 (40%), Positives = 210/378 (56%), Gaps = 27/378 (7%)
 Frame = -3

Query  1276  LLNTTFILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQ  1097
             L  + F   + VL      A+ YF  + T +ESAV+ GAVCLDGSPPAY   +G G G  
Sbjct  9     LWCSAFACALAVLE-----ADGYFV-DITYVESAVAKGAVCLDGSPPAYHLARGSGSGAS  62

Query  1096  RWIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENS-EFCNWN  920
              W+V+  GG WC++++ C  R  + LGSS           F GIL      N  +F NWN
Sbjct  63    SWLVHFEGGGWCNNVTTCLQRSHTRLGSSKEMA---KQVAFSGILSNAPEYNPVDFYNWN  119

Query  919   KVVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAG  740
             KV V YCDGSSFTG+ E V+P T LH+RG R++ AV+EDLL  KGM  A +  ++G SAG
Sbjct  120   KVRVRYCDGSSFTGNKEEVDPRTNLHYRGARVWQAVMEDLLA-KGMNKAENALISGCSAG  178

Query  739   GLAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLP  560
             GL  I+HCDRF      +  VKCLS+ GFF++ K  A      + F  ++  H S   LP
Sbjct  179   GLTSILHCDRFHRLLPAAANVKCLSDAGFFINVKDIAGVNHAAAFFSDVVKTHGSVKNLP  238

Query  559   EPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTG----FYEAVKS--K  398
               C  +   A +C+FPQ+  K I+TPLFI+ + YDS+ + + L  G     + + K   K
Sbjct  239   SLC-TSKLPAGMCLFPQNEVKQIQTPLFILNAAYDSWQVRNILVPGGSDPRWRSCKHDIK  297

Query  397   HISATQYKALKE-----LRLQMLVALR-ETDSPSRGLFVSNCFGHTQ--LIFYWNHPGFE  242
               SA Q K L++      R   L A+  + DSP+RGLF+++CF H Q  +   W  PG  
Sbjct  298   QCSAKQLKILQDGADAGFRDHFLEAIEAQGDSPTRGLFINSCFAHCQSEIQEIWFAPGSP  357

Query  241   V-NYRKDVEVVRDWYFDR  191
             V   ++    V DW++ R
Sbjct  358   VLGDKRIASAVGDWFYGR  375



>gb|ABK24433.1| unknown [Picea sitchensis]
Length=399

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 142/373 (38%), Positives = 211/373 (57%), Gaps = 27/373 (7%)
 Frame = -3

Query  1222  TANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISEC  1043
             +AN+ F  + T++E AV+ GAVCLDGSPP Y   +G G G   W+V+  GG WC++++ C
Sbjct  25    SANA-FLVDLTLVEDAVAKGAVCLDGSPPGYHLSRGFGSGVNNWLVHFEGGSWCNNVTTC  83

Query  1042  TNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETV  863
             + R  + LGSS          +F G+L  N A N +F NWN++ V YCDG+SFTGDVE V
Sbjct  84    SARTKTRLGSSKYMI---KQVDFSGLLGNNKARNPDFYNWNRIKVRYCDGASFTGDVEAV  140

Query  862   NPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNST  683
             NP   L+FRG+R+F AV+ DL+  KGM +A    ++G SAGGL  I+HCD F      +T
Sbjct  141   NPVDKLYFRGQRVFKAVIGDLMA-KGMINAQQAVISGCSAGGLTSILHCDNFRALMPKTT  199

Query  682   TVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHV  503
              VKCL++ GFF+  K  + A  + S F  +  L  S   LP  C    +L   C FPQ++
Sbjct  200   KVKCLADAGFFIDVKDVSGAYHIRSFFNEVATLQQSVKNLPLAC--TEKLGTQCFFPQYL  257

Query  502   AKDIRTPLFIMVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQM  347
                I+TPLF++ + YDS+ I + ++ G  +         +  K  S  Q + ++  RL+M
Sbjct  258   LPYIQTPLFLLNAGYDSWQIKNIVAPGVADPHGLWHNCKLDIKKCSPNQLETMQGFRLEM  317

Query  346   LVALRE-TDSPSRGLFVSNCFGHTQLIF---YWNHPGFEVNYRKDVEVVRDWYFDRINHV  179
             L AL+   +S S G+F+++C+ H Q      +  +   ++N     E V++WYF      
Sbjct  318   LNALKIFQNSASGGMFINSCYAHCQSEMQETWLANDSPKLNGLSIAEAVQNWYFG-----  372

Query  178   QEVEQSTLVKDCP  140
             Q + + T   DCP
Sbjct  373   QGIVKET---DCP  382



>gb|EYU29130.1| hypothetical protein MIMGU_mgv1a007782mg [Erythranthe guttata]
Length=395

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 140/369 (38%), Positives = 213/369 (58%), Gaps = 19/369 (5%)
 Frame = -3

Query  1258  ILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYL  1079
             I+L++ +        S+F  + T +ESAV+ GAVCLDGS PAY F KG G G   W+V++
Sbjct  4     IILLIYMVIIVGRGESFFV-DITYVESAVAKGAVCLDGSAPAYHFDKGSGAGINNWLVHI  62

Query  1078  LGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYC  899
              GG WC++ + C  R+   LGSS +         F GI       N +F NWN++ V YC
Sbjct  63    EGGGWCNNATTCLARRNGRLGSSKQMA---KQIAFSGIFSNKPQFNPDFYNWNRLKVRYC  119

Query  898   DGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIH  719
             DG+SFTGDVE V+P T L++RG R+F AV+EDLL  KGM++A +  L+G SAGGL  I++
Sbjct  120   DGASFTGDVEAVDPATKLYYRGARVFVAVIEDLLA-KGMKNAENAILSGCSAGGLTSILN  178

Query  718   CDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNH  539
             CDRF +    ST VKC ++ GFF+++K  + AQ +E  +  ++  H S   L + C    
Sbjct  179   CDRFKSLLPISTNVKCFADAGFFINAKDVSGAQHIEQFYNDVVTTHGSAKHLAQSCTSKM  238

Query  538   QLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEA--------VKSKHISAT  383
             + + LC FP+++ + I+TP+F++ + YDS+ I + L+ G  +            K  S T
Sbjct  239   KPS-LCFFPENMVQAIQTPIFVVNAAYDSWQIKNILAPGVADPHGLWHNCKTDIKKCSTT  297

Query  382   QYKALKELRLQMLVALRE-TDSPSRGLFVSNCFGH----TQLIFYWNHPGFEVNYRKDVE  218
             Q + ++E RL+ L AL     + S+G F+++C+ H    TQ  +  N      N     +
Sbjct  298   QLQTMQEYRLEFLKALSGLMSAKSKGYFINSCYAHCQTETQETWSTNISPMLNNKVTIAK  357

Query  217   VVRDWYFDR  191
              V DW+++R
Sbjct  358   AVGDWFYER  366



>ref|XP_009794297.1| PREDICTED: protein notum homolog [Nicotiana sylvestris]
Length=402

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 149/373 (40%), Positives = 207/373 (55%), Gaps = 29/373 (8%)
 Frame = -3

Query  1216  NSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTN  1037
             N     N T L S V+  AVCLDGSPPAY   KG G G   W++ + GG WC++++ C +
Sbjct  22    NEGLFVNITYLLSGVAKEAVCLDGSPPAYHHDKGFGTGVNSWLIQMEGGGWCNNVTTCLS  81

Query  1036  RKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNP  857
             RK + LGSS +         F GIL      N +F NWN+V V YCDGSSFTGDV+ VNP
Sbjct  82    RKNTRLGSSKQMV---KQLAFSGILSNKPQFNPDFYNWNRVKVRYCDGSSFTGDVQAVNP  138

Query  856   TTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTV  677
              T LHFRG R+F AV+EDLL  KGM++A +  L+G SAGGL  I+HCD F         V
Sbjct  139   ITNLHFRGARVFLAVMEDLLA-KGMKNAENAILSGCSAGGLTSILHCDSFKALLPMGAKV  197

Query  676   KCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAK  497
             KC S+ G+F++ K  + A  +E  F  ++ LH S   LP  C    +   LC FPQ+VA+
Sbjct  198   KCFSDAGYFINVKDISGAPHIEEFFGDVVRLHGSAKNLPPSCTSRLK-PNLCFFPQNVAQ  256

Query  496   DIRTPLFIMVSTYDSYLINHTLST------GFYEAVKSK--HISATQYKALKELRLQMLV  341
              +RTPLF++ + YDS+ I + L+       G +   K      S+ Q + ++  RL  L 
Sbjct  257   HVRTPLFLVNAAYDSWQIKNILAPSVADPRGVWRNCKLDILRCSSRQLQTMQGFRLGFLR  316

Query  340   ALRET-DSPSRGLFVSNCFGHTQ-----LIFYWNHPGFEVNYRKDVEVVRDWYFDRINHV  179
             AL     S SRG F+++C+ H Q       F  + P  ++  +   + + DW+FD+ N  
Sbjct  317   ALYALGPSSSRGYFINSCYAHCQTEVQETWFRADSP--KLANKTIAKALGDWFFDK-NPF  373

Query  178   QEVEQSTLVKDCP  140
             Q++       DCP
Sbjct  374   QKI-------DCP  379



>ref|XP_006361581.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=387

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 149/401 (37%), Positives = 213/401 (53%), Gaps = 46/401 (11%)
 Frame = -3

Query  1285  MGTLLNTTFILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGE  1106
             M   L   F LLIV + +           + T L+SAV+ GAVCLDGSPPAY F KG G 
Sbjct  6     MQLWLRAIFTLLIVFITEG-------HPVDITYLQSAVAKGAVCLDGSPPAYHFDKGFGA  58

Query  1105  GRQRWIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCN  926
             G   W++ L GG WC++ + C  R  + LGSS          +F GIL      N +F N
Sbjct  59    GVNNWLIQLEGGAWCNNATTCLARTKTRLGSSKLML---KTVSFSGILSNKAEFNPDFYN  115

Query  925   WNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGS  746
             WN++ + YCDGSSFTGDV   +P T + +RG RIF AV+ED L  KGM++A +  L G S
Sbjct  116   WNRIRIKYCDGSSFTGDVAAADPKTKVFYRGARIFSAVMEDFLA-KGMKNAQNAILAGCS  174

Query  745   AGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAV  566
             AG LA I+HCDRF         VKCLS+ GFF++++  +    +E  +  +++ H S   
Sbjct  175   AGSLAAILHCDRFKGLLPPGAKVKCLSDAGFFINTQTISGTSHIEQFYSEVVNTHGSVKN  234

Query  565   LPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLST------GFYEAVK  404
             LP+ C    +   LC FPQ+VA+ I+TPLF++ + YDS+ I H L+       G +   K
Sbjct  235   LPQSCTSRLKPG-LCFFPQNVAQHIQTPLFLVNAAYDSWQIKHILAPEVADPHGTWRNCK  293

Query  403   SK--HISATQYKALKELRLQMLVALRET-DSPSRGLFVSNCFGHTQLIFYWNHPGFEVNY  233
                 + S+TQ + ++  R + L AL     S +RG ++++C+ H Q        G +  +
Sbjct  294   LDILNCSSTQLQTMQAFRSEFLKALNSLGPSSTRGYYINSCYAHCQT-------GTQETW  346

Query  232   RKD----------VEVVRDWYFDRINHVQEVEQSTLVKDCP  140
               D           + V DWY++R    QE+       DCP
Sbjct  347   LMDDSLVLSGTTIAKAVGDWYYER-KRFQEI-------DCP  379



>ref|XP_004512351.1| PREDICTED: protein notum homolog isoform X3 [Cicer arietinum]
Length=448

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 141/354 (40%), Positives = 200/354 (56%), Gaps = 33/354 (9%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             + + +AV  GAVCLDGSPPAY F KG G G   W+V   GG WC++I+ C  RK + LGS
Sbjct  32    SYVHNAVIKGAVCLDGSPPAYHFDKGFGTGINSWLVQFEGGGWCNNITTCLGRKMNRLGS  91

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +         F GIL+     N +F NWN++ V YCDGSSFTGDVE VNP T LHFRG
Sbjct  92    SKQMA---KQIAFSGILNNRRLFNPDFYNWNRIKVRYCDGSSFTGDVEIVNPVTKLHFRG  148

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R+F+AV+E+LL  KGM++A +  ++G SAGGL  I+HCDRF         VKCLS+ G+
Sbjct  149   ARVFNAVMEELLA-KGMKNAKNAIISGCSAGGLTSILHCDRFRALLPQGAKVKCLSDAGY  207

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPC--RKNHQLAYLCMFPQHVAKDIRTPL  479
             F++++  +  Q +E  F  ++  H S   LP  C  R N +   LC FPQ+V   I TP+
Sbjct  208   FINARDVSGTQHIEQFFSQVVTTHGSANNLPRSCTSRLNPK---LCFFPQYVVSQITTPI  264

Query  478   FIMVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALRET-  326
             F + + YDS+ I + L+ G  +         +   + S+ Q   ++  R + L AL    
Sbjct  265   FFVNAAYDSWQIKNILAPGVADPHGHWHSCKMDINNCSSNQLDLMQGFRTEFLRALTVLG  324

Query  325   DSPSRGLFVSNCFGHTQLIFYWNHPGFEVNYRKD---------VEVVRDWYFDR  191
             +SPS+G+F+ +C+ H Q          E  +R D          + V DW+++R
Sbjct  325   NSPSKGMFIDSCYAHCQTEMQ------ETWFRSDSPLLAKTTIAKAVADWFYER  372



>gb|EYU37453.1| hypothetical protein MIMGU_mgv1a007583mg [Erythranthe guttata]
Length=403

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 144/384 (38%), Positives = 216/384 (56%), Gaps = 24/384 (6%)
 Frame = -3

Query  1285  MGTLLNTT-------FILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYL  1127
             MG  + TT        ++ ++ L        +    N T+L +AV  GAVCLDGSP  Y 
Sbjct  1     MGIYIPTTMADHWLKLLICVIALSSTKVNVRASEMVNITLLSNAVEKGAVCLDGSPAGYH  60

Query  1126  FGKGIGEGRQRWIVYLLGGEWCSSISECTNR-KTSHLGSSHRQYWNDSAFNFKGILDFNC  950
             + KG G+G   W++YL GG WC     C +R K S + SS +   N +  NF  IL  N 
Sbjct  61    YAKGYGDGANSWMIYLPGGGWCGRKQSCIDRVKYSPMLSSTK---NITQENFGAILSPNK  117

Query  949   AENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDAT  770
               N +F NWN+V + YCDGSSF GDV+ V+P T LH RG RIF +V+++LL +KG++DA 
Sbjct  118   TSNPDFYNWNRVFIRYCDGSSFMGDVKKVDPETNLHKRGSRIFTSVIDELL-SKGLKDAK  176

Query  769   HVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGII  590
             +V LTG SAGGLA I++CDRF     N+  VKC+S+ GFF+H+K+   A   E  F  ++
Sbjct  177   NVMLTGNSAGGLATILNCDRFRALVPNANMVKCVSDSGFFIHAKNLPNAAGRERTFSRVV  236

Query  589   DLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTL------S  428
               H  +  LP+ C    +   LC FP+++   I+TPLF++ S +D + I   L      +
Sbjct  237   HFHGISKFLPKSCTSRMKPG-LCFFPENLVAHIKTPLFLLNSDFDKFQIQVNLKPHPVDN  295

Query  427   TGFYEAVKS-KHISATQYKALKELRLQMLVALRET-DSPSRGLFVSNCFGHT--QLIFYW  260
              G+    ++    +  Q + +K+ R   L  L+   ++PSRGLF+++C+ H    L+  +
Sbjct  296   PGWVNCTRNITTCTPPQLQIIKDFRNTFLETLKGVGNNPSRGLFINSCYIHDFLYLMGRY  355

Query  259   NHPGFEVNYRKDV-EVVRDWYFDR  191
             N P     + K + + + DWYF+R
Sbjct  356   NSPDSPKLHNKTIAQAIGDWYFNR  379



>ref|XP_006363510.1| PREDICTED: uncharacterized protein LOC102583822 [Solanum tuberosum]
Length=398

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 137/372 (37%), Positives = 209/372 (56%), Gaps = 13/372 (3%)
 Frame = -3

Query  1288  KMGTLLNTTFILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIG  1109
             ++  LL     ++ +      Q  N Y + N TI+ SAVS GAVCLDGSPPAY F  G G
Sbjct  9     QLVVLLVCCLTIITIKCANATQNPNKY-SVNPTIVHSAVSKGAVCLDGSPPAYYFEPGFG  67

Query  1108  EGRQRWIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFC  929
             +G + WIV+L GG WC +++ C +R T+  GSS +     +  +F+GI   N ++N +F 
Sbjct  68    DGAENWIVHLSGGAWCMNVTNCQDRATTSNGSSKKM----AQLDFQGIHSKNESQNPDFY  123

Query  928   NWNKVVVHYCDGSSFTGDVETVNPTT----GLHFRGRRIFDAVVEDLLVNKGMQDATHVF  761
             NWNKV+V YCDG SF GD E ++PT      L FRG++IF AV+E++L  KG+++A +  
Sbjct  124   NWNKVLVAYCDGGSFIGDSEYIDPTNNSTKNLQFRGQKIFYAVLEEVL-EKGLKNAKNAI  182

Query  760   LTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLH  581
             L G SAGG   I++CD F +     + VKCL + G+F+H K+P   +    +F G+  L 
Sbjct  183   LAGSSAGGYPAILYCDYFRDSLPIKSRVKCLVDSGYFVHFKNPVLERFWSWRFGGVAALQ  242

Query  580   NSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKS  401
              +   LP+ C    + A LC++ +++ +  +TP F+ +S +D+    +TL    Y  +  
Sbjct  243   GAAKTLPKSCTSKMK-AELCLYAENIQEYTKTPFFLYMSAFDNIETQYTLGDEKYTTIDE  301

Query  400   KHISATQYKALKELRLQMLVALRETDSPS-RGLFVSNCFGHTQLIFYWN-HPGFEVNYRK  227
                SA    +L+E+R   L A+ + + P  RG+F+     HT L+  W+     E+N   
Sbjct  302   GKGSACLNASLREMRSDFLNAIPKGNDPKHRGVFIDAMHHHTSLMGRWSFEVALEINNVL  361

Query  226   DVEVVRDWYFDR  191
                   DWYFDR
Sbjct  362   APIAFADWYFDR  373



>ref|XP_011082153.1| PREDICTED: protein notum homolog [Sesamum indicum]
Length=395

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 144/370 (39%), Positives = 207/370 (56%), Gaps = 25/370 (7%)
 Frame = -3

Query  1198  NSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTS--  1025
             N T L++AVS GAVCLDGSP  Y + KG G G   W+VYL GG WC S  +C  R  +  
Sbjct  36    NVTFLDNAVSTGAVCLDGSPAGYHYEKGYGTGADNWLVYLPGGAWCGSKGDCLARTKTIG  95

Query  1024  HLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGL  845
                 +    W      F GIL  +   N +  NW++  + YCDG+SF  DVE V+P T L
Sbjct  96    GTTVNVTTTW------FGGILSADSLVNPDLYNWHRTFIRYCDGASFMADVEAVDPETNL  149

Query  844   HFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLS  665
             H RG RIF AVV D+L+ KGM++A ++ L G SAGGLA I++CDRF     N++ VKCLS
Sbjct  150   HLRGARIFRAVV-DVLLAKGMKNAKNIILAGNSAGGLATILNCDRFRALVPNASRVKCLS  208

Query  664   NGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRT  485
             + GFF+ +++    +  E  F  ++  H+ T  LP+ C      + LCMFP+++  D++T
Sbjct  209   DSGFFIRAQNLPGVEKREKGFADVVAFHDITKFLPKSCTSRMDPS-LCMFPEYLVGDVQT  267

Query  484   PLFIMVSTYDSYLINHTLST------GFYEAVKSKHI-SATQYKALKELRLQMLVALRE-  329
             PLF++ S +D Y I + L        G+ E   +  + +  Q   +KE R   L  L+  
Sbjct  268   PLFLLHSAFDQYQIQYNLKPYPAIEQGWKECTSNTRLCTPAQIDFMKEFRTTFLQTLKAI  327

Query  328   TDSPSRGLFVSNCFGHTQLI--FYWNHPGFEVNYRKDVE-VVRDWYFDRINHVQEVEQST  158
              D PSRG+F+++C+ H  L     WN+ G      K +E V+ DWYF+R +  + ++  T
Sbjct  328   PDCPSRGMFINSCYIHDFLFSRARWNYQGPPSLGNKIIERVIGDWYFERCS-AKAIDAET  386

Query  157   LVKDCPNNTF  128
                D P N F
Sbjct  387   ---DHPLNCF  393



>gb|EYU29131.1| hypothetical protein MIMGU_mgv1a007782mg [Erythranthe guttata]
Length=394

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 139/368 (38%), Positives = 216/368 (59%), Gaps = 18/368 (5%)
 Frame = -3

Query  1258  ILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYL  1079
             I+L++ +        S+F  + T +ESAV+ GAVCLDGS PAY F KG G G   W+V++
Sbjct  4     IILLIYMVIIVGRGESFFV-DITYVESAVAKGAVCLDGSAPAYHFDKGSGAGINNWLVHI  62

Query  1078  LGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYC  899
              GG WC++ + C  R+   LGSS +         F GI       N +F NWN++ V YC
Sbjct  63    EGGGWCNNATTCLARRNGRLGSSKQMA---KQIAFSGIFSNKPQFNPDFYNWNRLKVRYC  119

Query  898   DGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIH  719
             DG+SFTGDVE V+P T L++RG R+F AV+EDLL  KGM++A +  L+G SAGGL  I++
Sbjct  120   DGASFTGDVEAVDPATKLYYRGARVFVAVIEDLLA-KGMKNAENAILSGCSAGGLTSILN  178

Query  718   CDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNH  539
             CDRF +    ST VKC ++ GFF+++K  + AQ +E  +  ++  H S   L + C    
Sbjct  179   CDRFKSLLPISTNVKCFADAGFFINAKDVSGAQHIEQFYNDVVTTHGSAKHLAQSCTSKM  238

Query  538   QLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEA--------VKSKHISAT  383
             + + LC FP+++ + I+TP+F++ + YDS+ I + L+ G  +            K  S T
Sbjct  239   KPS-LCFFPENMVQAIQTPIFVVNAAYDSWQIKNILAPGVADPHGLWHNCKTDIKKCSTT  297

Query  382   QYKALKELRLQMLVALRE-TDSPSRGLFVSNCFGH--TQLIFYWN-HPGFEVNYRKDVEV  215
             Q + ++E RL+ L AL     + S+G F+++C+ H  T+    W+ +    +N +   + 
Sbjct  298   QLQTMQEYRLEFLKALSGLMSAKSKGYFINSCYAHCQTETQETWSTNISPMLNNKTIAKA  357

Query  214   VRDWYFDR  191
             V DW+++R
Sbjct  358   VGDWFYER  365



>ref|XP_009794027.1| PREDICTED: uncharacterized protein LOC104240572 [Nicotiana sylvestris]
Length=394

 Score =   253 bits (646),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 146/361 (40%), Positives = 205/361 (57%), Gaps = 24/361 (7%)
 Frame = -3

Query  1222  TANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISEC  1043
             T  +    N+T LES+++ GAVCLDGS PA+ F  G G G   W++ L GG WC S S+C
Sbjct  24    TTEANLIVNTTFLESSIAKGAVCLDGSAPAFNFHPGTGSGVYSWLIQLQGGGWCDSASDC  83

Query  1042  TNRKTSHLGSSHRQYWNDSAFN-FKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVET  866
              +R T   G+S     N S  + F G+L  +   N +F +WN+V + YCDGSS+TGD+E 
Sbjct  84    QDRATKEYGTSK----NISKISYFMGVLSNDSELNPDFYDWNRVKIRYCDGSSYTGDIEE  139

Query  865   VNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNS  686
             V+P T LHFRG RIF A++E+LL +KGM  A +  L+G SAGGL  I+HCD+F   F  +
Sbjct  140   VDPATNLHFRGARIFKAIMEELLYHKGMIYAENAILSGTSAGGLGAILHCDKFRLFFSLT  199

Query  685   TTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQH  506
               VKC+S+ GFF+++K       ++  F+ ++ LH S   LP  C        +C FPQ+
Sbjct  200   ARVKCISDAGFFINAKTITGEPHIKEYFKRVVTLHGSAKNLPLSCTFLSLDPSVCFFPQY  259

Query  505   VAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKS-KHI-----------SATQYKALKE  362
              A+ I TPLFI+ S YDS+ IN+ L     E V   +H+           S +Q + L+E
Sbjct  260   AAQHICTPLFIINSAYDSWQINNILVP---EGVADPQHVWDTCKKDINKCSPSQIQTLQE  316

Query  361   LRLQMLVALRET-DSPSRGLFVSNCFGH--TQLIFYW-NHPGFEVNYRKDVEVVRDWYFD  194
              R   L AL E   S SRG F+S+C  H   ++  YW N+    +  +   E V DW+  
Sbjct  317   FRSTFLEALNELGPSISRGYFISSCHFHHGIEIQSYWSNNNSPTIANKTIAEAVGDWFVG  376

Query  193   R  191
             R
Sbjct  377   R  377



>ref|XP_004953590.1| PREDICTED: protein notum homolog isoform X1 [Setaria italica]
Length=401

 Score =   253 bits (646),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 147/348 (42%), Positives = 194/348 (56%), Gaps = 21/348 (6%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T +ESAV+ GAVCLDGS PAY   +G G G   W+V+  GG WCS+++ C  RK + LGS
Sbjct  34    TYVESAVAKGAVCLDGSAPAYHLARGSGSGVNSWLVHFEGGGWCSNVTTCLQRKRTRLGS  93

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S       +   F GIL      N +F NWNKV V YCDGSSFTGDVE V+PTT LH+RG
Sbjct  94    SKEMA---TQIAFSGILSDTPDYNPDFYNWNKVKVRYCDGSSFTGDVEEVDPTTKLHYRG  150

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RI+ AV+EDLL  KGM  A +  ++G SAGGL  I+HCDRF +       VKCLS+ GF
Sbjct  151   ARIWQAVMEDLLA-KGMDKAENALISGCSAGGLTSILHCDRFHDLLPLGARVKCLSDAGF  209

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F++ K  A    + + F  ++  H S   LP  C        +C FP +  K I+TPLFI
Sbjct  210   FINEKDVAGVGYIAAFFNDVVTTHGSAKNLPSSCTSILPPG-VCFFPSNEVKQIQTPLFI  268

Query  472   MVSTYDSYLINHTLSTGFYEAVKSKH--------ISATQYKALKELRLQMLVALRET-DS  320
             + + YD + + + L  G  +   + H         SA Q + L+  R   L A+ E  +S
Sbjct  269   LNAAYDYWQVRNILVPGVADRRGTWHSCKHDIDQCSAAQLRVLQGFRDDFLKAVAEQGNS  328

Query  319   PSRGLFVSNCFGHTQ-----LIFYWNHPGFEVNYRKDVEVVRDWYFDR  191
              SRGLF+++CF H Q     L F  + P   +        V DW+FDR
Sbjct  329   TSRGLFINSCFVHCQSEIQELWFSSDSP--MLGNTTIAAAVGDWFFDR  374



>ref|XP_010325632.1| PREDICTED: protein notum homolog isoform X1 [Solanum lycopersicum]
Length=402

 Score =   253 bits (646),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 148/372 (40%), Positives = 204/372 (55%), Gaps = 37/372 (10%)
 Frame = -3

Query  1201  TNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSH  1022
              N T + S V+ GAVCLDGSPPAY   KG G G   W++ + GG WC++++ C +RK + 
Sbjct  27    VNITYVLSGVAKGAVCLDGSPPAYHHDKGFGTGVNSWLIQMEGGGWCNNVTTCLSRKNTR  86

Query  1021  LGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLH  842
             LGSS +   N     F GIL      N +F NWN+V V YCDGSSFTGDV+ VNP T LH
Sbjct  87    LGSSKQMVEN---LAFSGILSNKPQFNPDFYNWNRVKVGYCDGSSFTGDVQEVNPITKLH  143

Query  841   FRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSN  662
             FRG R+F AV+E+LL  KGM++A +  L+G SAGGL  I+HCD F         VKC S+
Sbjct  144   FRGARVFLAVMEELLA-KGMKNAENAILSGCSAGGLTSILHCDSFKALLPMGAKVKCFSD  202

Query  661   GGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTP  482
              G+F+  K  + A  +E  FR ++ LH S   LP  C    +   LC FPQ+VA+ +RTP
Sbjct  203   AGYFIDVKDISGAPHIEEYFRDVVSLHGSAKNLPPVCTSRLK-PDLCFFPQNVAQHVRTP  261

Query  481   LFIMVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALRET  326
             LF++ + YDS+ I + L+    +         +     S+ Q + +   RL  L AL   
Sbjct  262   LFLVNAAYDSWQIKNILAPDVADPYGVWLNCKLDILKCSSRQLQIMHGYRLLFLRALNAL  321

Query  325   -DSPSRGLFVSNCFGHTQLIFYWNHPGFEVNYRKD---------VEVVRDWYFDRINHVQ  176
               S SRG F+++C+ H Q          E  YR D          + + DW++D+ N  Q
Sbjct  322   GPSSSRGYFINSCYAHCQTEVQ------ETWYRADSPKLANKTIAKALGDWFYDK-NPFQ  374

Query  175   EVEQSTLVKDCP  140
             ++       DCP
Sbjct  375   KI-------DCP  379



>emb|CDM87215.1| unnamed protein product [Triticum aestivum]
Length=425

 Score =   254 bits (648),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 146/362 (40%), Positives = 203/362 (56%), Gaps = 23/362 (6%)
 Frame = -3

Query  1204  TTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTS  1025
             T   T+L  A   GA+CLDG+PP Y   +G G+G  RW+++L GG WCS+  +C+NR+  
Sbjct  56    TVPLTLLAGAQEKGALCLDGTPPGYHLQRGSGDGSNRWLIHLEGGGWCSTTKDCSNRRMY  115

Query  1024  HLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVE-TVNPTTG  848
              LGSS+  +     F   GIL  +  +N +F NWNKV V YCDG+SF+GD E      + 
Sbjct  116   GLGSSN--FMKPMRFAGAGILGSDQLQNPDFYNWNKVFVRYCDGASFSGDAEGRAQDGST  173

Query  847   LHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCL  668
             LHFRG RI+ AV+++L+  KG+ +AT   LTG SAGGLA I+HCD F+ RF    +VKCL
Sbjct  174   LHFRGLRIYQAVIDELM-EKGLANATQALLTGCSAGGLATILHCDDFSARFSRDVSVKCL  232

Query  667   SNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIR  488
             ++ GFFL     +  +   S + G++ L N   VLP+ C  N +    C FP  + K IR
Sbjct  233   ADAGFFLDVMDISGKRSFWSVYDGVVHLQNVREVLPKDCLANKEPTE-CFFPAELIKSIR  291

Query  487   TPLFIMVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALR  332
             TP+FI+ S YDS+ I + L        KS        ++ ++TQ K L   R  ML AL 
Sbjct  292   TPMFILNSAYDSWQIRNVLVPVSSAPDKSWSSCKDNIRNCNSTQIKVLDGFRNAMLGALN  351

Query  331   ET-DSPSRGLFVSNCFGHTQLIF--YWNHPGFEVNYRKD----VEVVRDWYFDRINHVQE  173
                D    GLFV +CF H Q ++   WN    E++ R       E   DWY  R + V+E
Sbjct  352   VVEDKEDWGLFVDSCFTHCQSLYGISWNS---EISPRLGNKTIAEAAGDWYHGRSHGVKE  408

Query  172   VE  167
             ++
Sbjct  409   ID  410



>ref|XP_010942975.1| PREDICTED: protein notum homolog isoform X1 [Elaeis guineensis]
 ref|XP_010942976.1| PREDICTED: protein notum homolog isoform X1 [Elaeis guineensis]
Length=397

 Score =   253 bits (646),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 147/371 (40%), Positives = 205/371 (55%), Gaps = 23/371 (6%)
 Frame = -3

Query  1264  TFILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIV  1085
               I L++ L      A  YF  + T +ESA++ GAVCLDGSPPAY    G G G   W+V
Sbjct  12    ALICLLIFLK-----AEGYFV-DITYVESALAKGAVCLDGSPPAYHLSPGFGSGVNNWLV  65

Query  1084  YLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVH  905
             ++ GG WC++++ C  RK S LGSS           F GIL+     N +F NWNKV V 
Sbjct  66    HIEGGGWCNNVTTCLARKNSRLGSSRHMA---KQIAFSGILNNRQTFNPDFYNWNKVKVR  122

Query  904   YCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVI  725
             YCDGSSFTGDVE VNP T LH+RG R++ AV+EDLL  KGM  A +  L+G SAGGL  I
Sbjct  123   YCDGSSFTGDVERVNPATNLHYRGARVWLAVMEDLLA-KGMSKAKNALLSGCSAGGLTSI  181

Query  724   IHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRK  545
             +HCD F       T  KCLS+ G+F+  K    A+ +++ F  ++  H S   LP  C  
Sbjct  182   LHCDNFRAILPLGTRAKCLSDAGYFIDMKDVTGAEHIKAFFNDVVTTHGSAQNLPSSC-T  240

Query  544   NHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGF--------YEAVKSKHIS  389
             +     +C FPQ++ + I TPLFI+ + YDS+ I + L  G         Y  +  +  S
Sbjct  241   SRLTPSMCFFPQNMVQQIHTPLFILNAAYDSWQIRNILVPGVADPHGTWHYCKLDIQQCS  300

Query  388   ATQYKALKELRLQMLVALRE-TDSPSRGLFVSNCFGHTQ--LIFYWNHPGFEVNYRKDV-  221
             + Q + ++  R + L AL     S S G+F+++C+ H Q  +   W      V  +  + 
Sbjct  301   SPQLQIMQGFRTEFLNALAGFGRSSSTGMFINSCYAHCQSEMQETWLSSDSPVLEKMPIA  360

Query  220   EVVRDWYFDRI  188
             + V DW++DRI
Sbjct  361   KAVGDWFYDRI  371



>tpg|DAA36173.1| TPA: hypothetical protein ZEAMMB73_990456 [Zea mays]
Length=370

 Score =   252 bits (643),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 133/313 (42%), Positives = 180/313 (58%), Gaps = 15/313 (5%)
 Frame = -3

Query  1186  LESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGSSH  1007
             L++AV+ GAVCLDGSPP Y F  G G G   W+V++ GG WC +  EC  RK +  GSS 
Sbjct  38    LKAAVAKGAVCLDGSPPVYHFSPGSGSGANNWVVHMEGGGWCRNPDECAVRKGNFRGSSK  97

Query  1006  RQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRR  827
                      +F GIL  N   N +F NWN+V + YCDGSSFTGDVE V+    L +RG R
Sbjct  98    FM----KPLSFSGILGGNQKSNPDFYNWNRVKIRYCDGSSFTGDVEAVDTAKDLRYRGFR  153

Query  826   IFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFL  647
             ++ AV++DLL  +GM  A +  L+G SAGGLA I+HCDRF + F   T VKC S+ G+F 
Sbjct  154   VWRAVIDDLLTVRGMSKAQNALLSGCSAGGLAAILHCDRFHDLFPAKTKVKCFSDAGYFF  213

Query  646   HSKHPAKAQDLESKFRGIIDLHNSTAVLPEPC-RKNHQLAYLCMFPQHVAKDIRTPLFIM  470
               K  +      S ++ +++LH S   LP  C  K  Q   LCMFPQ+V   +RTPLFI+
Sbjct  214   DGKDISGNFYARSIYKSVVNLHGSAKNLPASCTSKPKQSPELCMFPQYVVPTMRTPLFIL  273

Query  469   VSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRETDSPS  314
              + YDS+ + + L+    +  K+        K  SA+Q   L+  R   L AL +T   S
Sbjct  274   NAAYDSWQVKNVLAPSPADPKKTWAQCKLDIKSCSASQLTTLQNFRTDFLAALPKTQ--S  331

Query  313   RGLFVSNCFGHTQ  275
              G+F+ +C  H Q
Sbjct  332   VGMFIDSCNAHCQ  344



>ref|XP_002447050.1| hypothetical protein SORBIDRAFT_06g027560 [Sorghum bicolor]
 gb|EES11378.1| hypothetical protein SORBIDRAFT_06g027560 [Sorghum bicolor]
Length=390

 Score =   252 bits (644),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 145/361 (40%), Positives = 196/361 (54%), Gaps = 31/361 (9%)
 Frame = -3

Query  1189  ILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGSS  1010
              L++AV+ GAVCLDGSPP Y F  G G G   W+    GG WC +  EC  RK +  GSS
Sbjct  37    FLKAAVAKGAVCLDGSPPVYHFSPGSGSGADNWV----GGGWCRNPDECAVRKGNFRGSS  92

Query  1009  HRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGR  830
                       +F GIL  +   N +F NWN++ V YCDGSSFTGDVE V+    LH+RG 
Sbjct  93    KFM----RPLSFSGILGGSQKSNPDFYNWNRIKVRYCDGSSFTGDVEAVDTAKNLHYRGF  148

Query  829   RIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFF  650
             R++ A+++DLL  +GM  A +  L+G SAGGLA I+HCDRF + F  +T VKC S+ G+F
Sbjct  149   RVWRAIMDDLLTVRGMNKAKYALLSGCSAGGLAAILHCDRFRDLFPATTKVKCFSDAGYF  208

Query  649   LHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIM  470
                K  +      S ++ +++LH S   LP  C        LCMFPQ+V   +RTPLFI+
Sbjct  209   FDGKDISGNYYARSIYKNVVNLHGSAKNLPASCTSKQ--PELCMFPQYVVPTMRTPLFIL  266

Query  469   VSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALRETDSPS  314
              + YDS+ + + L+    +  K+        K  S +Q   L+  R   L AL +T  PS
Sbjct  267   NAAYDSWQVKNVLAPSPADPKKTWAQCKLDIKSCSPSQLTTLQNFRTDFLAALPKT--PS  324

Query  313   RGLFVSNCFGHTQLIFY--WNHPGFE-VNYRKDVEVVRDWYFDRINHVQEVEQSTLVKDC  143
              G+F+ +C  H Q      W   G   VN  +  + V DWYFDR     EV +     DC
Sbjct  325   VGMFIDSCNAHCQSGSQDTWLADGSPTVNKTQIGKAVGDWYFDR-----EVSRQI---DC  376

Query  142   P  140
             P
Sbjct  377   P  377



>ref|XP_003565721.1| PREDICTED: protein notum homolog [Brachypodium distachyon]
 ref|XP_010230843.1| PREDICTED: protein notum homolog [Brachypodium distachyon]
Length=411

 Score =   253 bits (645),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 147/364 (40%), Positives = 207/364 (57%), Gaps = 28/364 (8%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             TIL SAV  GAVCLDGSPPAY   +G G GR  WIV L GG WC S+  C  RK  +LGS
Sbjct  52    TILTSAVEKGAVCLDGSPPAYHLDRGSGSGRNSWIVNLEGGGWCDSVLSCGWRKGGYLGS  111

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S      D    F GI+  +  +N +F NWN+V+V YCDG SF G  E ++  TG+ FRG
Sbjct  112   SLHM---DKPMFFGGIMSASAVDNPDFYNWNRVMVRYCDGGSFAG--EGLDRATGVCFRG  166

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRN-STTVKCLSNGG  656
             +RI+DA V  LL + GM  A    LTG SAGGLA ++HCD+F+  F   +TTVKCL++ G
Sbjct  167   QRIWDAAVRHLL-SIGMASADRALLTGCSAGGLAAMLHCDQFSAFFAGKNTTVKCLADAG  225

Query  655   FFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLF  476
              FL +   +  + L S F+G++  H     LP  C   H  A  C FPQ++  +I+TP+F
Sbjct  226   LFLDAVDVSGGRSLRSYFQGVVATHGVAQNLPSSC-TGHLDATSCFFPQNIIGNIKTPIF  284

Query  475   IMVSTYDSYLINHTLS------TGFYEAVKSKHISA--TQYKALKELRLQMLVALRE-TD  323
             ++ + YD++ +  +L+       G + A K    +   +Q   L+  R QM+  +++ + 
Sbjct  285   LLNAAYDTWQLRESLAPNGADHNGAWRACKLNRTACNESQLTFLRSFRDQMVATVKDFSG  344

Query  322   SPSRGLFVSNCF--GHTQLIFYWNHPGFEVNYRKDV-EVVRDWYFDRINHVQEVEQSTLV  152
             S S GLF+++CF  G +++   WN PG      K + + V DWYF R   V+ +      
Sbjct  345   SRSNGLFINSCFIHGQSEMWATWNAPGSPAIGNKGIGKSVGDWYFGRA-QVKAI------  397

Query  151   KDCP  140
              DCP
Sbjct  398   -DCP  400



>ref|XP_008808370.1| PREDICTED: uncharacterized protein LOC103720446 isoform X3 [Phoenix 
dactylifera]
Length=401

 Score =   252 bits (644),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 146/388 (38%), Positives = 211/388 (54%), Gaps = 34/388 (9%)
 Frame = -3

Query  1261  FILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVY  1082
             FILL +++  + +     F    T+++SAV+ GAVCLDGSPPAY F  G G G   W+V+
Sbjct  16    FILLELLISMKVEG----FDVPLTLVQSAVAKGAVCLDGSPPAYHFAPGFGSGVNNWLVH  71

Query  1081  LLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHY  902
             + GG WC ++ EC  R  +  GSS          +F GIL      N +F NWNKV + Y
Sbjct  72    MEGGGWCRNVEECKERTKNFRGSSKYM----KQLSFSGILGKKQNLNPDFYNWNKVKIRY  127

Query  901   CDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVII  722
             CDGSSFTGD+E VNP T LHFRG R++ A+++DLL  K M  A +  L+G SAGGLA I+
Sbjct  128   CDGSSFTGDIEAVNPATNLHFRGARVWRAIIDDLLA-KRMNKAQNALLSGCSAGGLASIL  186

Query  721   HCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKN  542
             HCD F +       VKC S+ G+F++ K  +  + ++  +  +   H S   LP  C   
Sbjct  187   HCDSFRDLVPAGARVKCFSDAGYFINGKDVSGKESIKDFYNQVATTHGSAKNLPSSCTSR  246

Query  541   HQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKS--------KHISA  386
                + +C FPQ+V + +RTPLFI+ + YD++ I + L+    +  K         K  S+
Sbjct  247   FPPS-MCFFPQYVVQSMRTPLFILNAAYDAWQIKNILAPSPSDPRKVWGECKLDIKKCSS  305

Query  385   TQYKALKELRLQMLVALRE-TDSPSRGLFVSNCFGHTQ--LIFYW---NHPGFEVNYRKD  224
              Q + ++  R Q L AL     S S G+F+++C+ H Q  +   W   N P  E      
Sbjct  306   NQLQVMQGFRTQFLNALAGFGSSSSTGMFINSCYAHCQSEMQETWLSSNSPVLE--KIPI  363

Query  223   VEVVRDWYFDRINHVQEVEQSTLVKDCP  140
              + V DW++DRI   Q++       DCP
Sbjct  364   AKAVGDWFYDRI-AFQKI-------DCP  383



>ref|XP_010235852.1| PREDICTED: protein notum homolog isoform X2 [Brachypodium distachyon]
Length=353

 Score =   251 bits (640),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 145/350 (41%), Positives = 191/350 (55%), Gaps = 23/350 (7%)
 Frame = -3

Query  1159  VCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAF  980
             +CLDGS PAY   +G G G   W+V+  GG WCS+++ C  RK + LGSS          
Sbjct  1     MCLDGSAPAYHLARGFGSGVDSWLVHFEGGGWCSNVTTCLERKNTRLGSSKEMA---KQV  57

Query  979   NFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDL  800
              F GIL      N +F NWNKV V YCDGSSFTGD E V+PTT LH+RG R++ AV+EDL
Sbjct  58    AFSGILSNTPDHNPDFYNWNKVRVRYCDGSSFTGDKEEVDPTTKLHYRGARVWQAVMEDL  117

Query  799   LVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQ  620
             L  KGM  A +  ++G SAGGL  ++HCDRF +R      VKCLS+ GFF+  K  A  +
Sbjct  118   LA-KGMDRAENALISGCSAGGLTSVLHCDRFRDRMPVEANVKCLSDAGFFIDVKDIAGEK  176

Query  619   DLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLIN  440
                  F  ++  H S   LP  C        +C+FPQ+  K I+TPLFI+ + YDS+ + 
Sbjct  177   HAADFFNDVVTTHGSAKNLPSSCTSKLPPG-MCLFPQNEVKQIQTPLFILNAAYDSWQVR  235

Query  439   HTLSTGFYEA--VKSKH----ISATQYKALKELRLQMLVALRET-DSPSRGLFVSNCFGH  281
             + L  G  +      KH     S  Q K L+  R   L AL E   S SRGLF+++CF H
Sbjct  236   NILVPGGSDPHWRSCKHDINQCSEKQLKTLQGFRDDFLKALEEQGSSSSRGLFINSCFAH  295

Query  280   TQ--LIFYWNHPGFEV-NYRKDVEVVRDWYFDRINHVQEVEQSTLVKDCP  140
              Q  +   W  P   V   +K    + DW++DR +  QE+       DCP
Sbjct  296   CQSEIQEIWFAPDSPVLGNKKIANAIGDWFYDR-SPFQEI-------DCP  337



>ref|XP_004512349.1| PREDICTED: protein notum homolog isoform X1 [Cicer arietinum]
 ref|XP_004512350.1| PREDICTED: protein notum homolog isoform X2 [Cicer arietinum]
Length=487

 Score =   255 bits (651),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 141/354 (40%), Positives = 200/354 (56%), Gaps = 33/354 (9%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             + + +AV  GAVCLDGSPPAY F KG G G   W+V   GG WC++I+ C  RK + LGS
Sbjct  71    SYVHNAVIKGAVCLDGSPPAYHFDKGFGTGINSWLVQFEGGGWCNNITTCLGRKMNRLGS  130

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +         F GIL+     N +F NWN++ V YCDGSSFTGDVE VNP T LHFRG
Sbjct  131   SKQM---AKQIAFSGILNNRRLFNPDFYNWNRIKVRYCDGSSFTGDVEIVNPVTKLHFRG  187

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R+F+AV+E+LL  KGM++A +  ++G SAGGL  I+HCDRF         VKCLS+ G+
Sbjct  188   ARVFNAVMEELLA-KGMKNAKNAIISGCSAGGLTSILHCDRFRALLPQGAKVKCLSDAGY  246

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPC--RKNHQLAYLCMFPQHVAKDIRTPL  479
             F++++  +  Q +E  F  ++  H S   LP  C  R N +   LC FPQ+V   I TP+
Sbjct  247   FINARDVSGTQHIEQFFSQVVTTHGSANNLPRSCTSRLNPK---LCFFPQYVVSQITTPI  303

Query  478   FIMVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALRET-  326
             F + + YDS+ I + L+ G  +         +   + S+ Q   ++  R + L AL    
Sbjct  304   FFVNAAYDSWQIKNILAPGVADPHGHWHSCKMDINNCSSNQLDLMQGFRTEFLRALTVLG  363

Query  325   DSPSRGLFVSNCFGHTQLIFYWNHPGFEVNYRKD---------VEVVRDWYFDR  191
             +SPS+G+F+ +C+ H Q          E  +R D          + V DW+++R
Sbjct  364   NSPSKGMFIDSCYAHCQTEMQ------ETWFRSDSPLLAKTTIAKAVADWFYER  411



>ref|XP_004246219.1| PREDICTED: protein notum homolog [Solanum lycopersicum]
Length=390

 Score =   252 bits (643),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 143/370 (39%), Positives = 209/370 (56%), Gaps = 18/370 (5%)
 Frame = -3

Query  1216  NSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTN  1037
             + +   N TIL+SA + GAVCLDGSPPAY   +G G G + WI+YL GG WC SI +C +
Sbjct  25    DDFLYVNITILQSATAQGAVCLDGSPPAYHLHRGYGTGFRSWIIYLEGGSWCESIPDCLD  84

Query  1036  RKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNP  857
             R T+ LGSS+    +D    F G+L     +N +F NWN+V V YCDGSSFT DVE V+P
Sbjct  85    RSTTSLGSSNHMKQHDF---FAGVLHNTSKQNPDFHNWNRVKVKYCDGSSFTSDVEQVHP  141

Query  856   TTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTV  677
                L+FRG RIF A++EDL  +KG++ A +  LTG SAGGLA I++CD+F      S  V
Sbjct  142   ENKLYFRGARIFKAIMEDLW-SKGIKSAENAILTGTSAGGLATILNCDKFKYLLPESAKV  200

Query  676   KCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAK  497
             KC+++  FF++S        ++  ++ I++LH  T  LP  C    + + LC+F Q+V  
Sbjct  201   KCVADAAFFINSNTIYGTSYIQEMYQKIVNLHGLTKNLPSACTSVMEPS-LCLFSQNVIP  259

Query  496   DIRTPLFIMVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLV  341
              I+TPLFI+ S YDS+ IN+ L   + +   +           ++ Q   ++   ++ L 
Sbjct  260   YIQTPLFIINSIYDSWQINNILVPLYLDPQHAWANCINNISRCTSNQRIIIQAFGVKFLK  319

Query  340   ALRETDS-PSRGLFVSNCFGHTQLIF--YWNHPGFEVNYRKDV-EVVRDWYFDRINHVQE  173
                +  S  +RG F+++C+ H  + F  YW          K + E V DWYF+R    Q 
Sbjct  320   TFNKLPSCCTRGYFLTSCYSHGDMRFPTYWFSATSPRLLNKTIAEAVADWYFERAG-FQY  378

Query  172   VEQSTLVKDC  143
              +     +DC
Sbjct  379   KDPYPCARDC  388



>ref|XP_009407790.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=431

 Score =   253 bits (646),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 145/394 (37%), Positives = 210/394 (53%), Gaps = 28/394 (7%)
 Frame = -3

Query  1288  KMGTLLNTTFILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIG  1109
             K GT +     LL ++   Q +  N       T+L+ AV+ GAVCLDGS PAY    G G
Sbjct  38    KSGTWVCPLICLLYLLAFLQVEGDN----VPMTVLKGAVAEGAVCLDGSAPAYNLAPGSG  93

Query  1108  EGRQRWIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFC  929
              G   W+V++ GG WCS++ EC  RK +  GSS          +F G+L      N +F 
Sbjct  94    SGANNWLVFVEGGGWCSTVEECLARKNTFRGSSDHM----PPQSFSGMLGGVQQSNPDFY  149

Query  928   NWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGG  749
             NWN+V + YCDG+SFTGD+E V+P TGLHFRG R++ A+++DLL  KGM  A    L G 
Sbjct  150   NWNRVKIRYCDGASFTGDIEKVDPATGLHFRGARVWRAIMKDLLA-KGMNKAQKALLGGC  208

Query  748   SAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTA  569
             SAGGL  I+HCD F +    + TVKC S+ G+F+ +K  + A  ++S +  ++ LH S  
Sbjct  209   SAGGLTTILHCDNFRSLLPATATVKCFSDAGYFIDAKDISGADAIQSFYGDVVKLHGSAN  268

Query  568   VLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKS----  401
              LP  C  +   A  C FPQ+V   ++TPLFI+ + YD + I+H L     +   +    
Sbjct  269   NLPSSC-TSRLPANKCFFPQNVVATLKTPLFILNAAYDQWQIDHILVPSSADPKNTWGDC  327

Query  400   ----KHISATQYKALKELRLQMLVALRETDSPSRGLFVSNCFGHT---QLIFYWNHPGFE  242
                 K  S+ Q + L+  R   L AL    S S GLF+ +C  H        +++    +
Sbjct  328   KLDIKKCSSDQLQKLQGFRTTFLNALPGAGSSSTGLFILSCHTHCLSGDADIWYSDDSPK  387

Query  241   VNYRKDVEVVRDWYFDRINHVQEVEQSTLVKDCP  140
             ++     + V DWYF R + V+++       DCP
Sbjct  388   IDNTPIGKAVGDWYFGRSSAVRKI-------DCP  414



>ref|XP_010111521.1| hypothetical protein L484_021346 [Morus notabilis]
 gb|EXC31044.1| hypothetical protein L484_021346 [Morus notabilis]
Length=386

 Score =   252 bits (643),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 138/355 (39%), Positives = 205/355 (58%), Gaps = 29/355 (8%)
 Frame = -3

Query  1162  AVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSA  983
             + CLDGSPPAY F  G G G   W+V + GG WC++++ C  RK + LGSS         
Sbjct  28    SFCLDGSPPAYHFSHGFGSGVNNWLVQIEGGGWCNNVTTCLARKNTRLGSSKAMV---KE  84

Query  982   FNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVED  803
              +F GIL      N +F +WN++ V YCDGSSFTGDVE VNP T LHFRG R+F A++ED
Sbjct  85    LSFSGILSNKQKFNPDFYDWNRIKVRYCDGSSFTGDVEAVNPATNLHFRGARVFLAIIED  144

Query  802   LLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFLHSKHPAKA  623
             L   KGM++A +  L+G SAGGLA I+HCD+F +   ++T VKCLS+ G+F+++   + A
Sbjct  145   LQA-KGMKNAQNAILSGCSAGGLASILHCDKFKSLMPSTTKVKCLSDAGYFINTNDVSGA  203

Query  622   QDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLI  443
             + +E+ +  ++  H S   LP  C        LC FPQ+V   I+TP+F + + YDS+ I
Sbjct  204   KHIETFYTEVVATHGSAKNLPSSCTSRLSPG-LCFFPQYVVSQIQTPIFFVNAAYDSWQI  262

Query  442   NHTLSTGFYEAVKSKH--------ISATQYKALKELRLQMLVALRET-DSPSRGLFVSNC  290
              + L+ G  +   + H         S+ Q K +++ RL+ L A+    +S S+GLF+ +C
Sbjct  263   KNILAPGVADPHGTWHYCKLDITKCSSIQLKTMQDFRLEFLKAISVVGNSLSKGLFIDSC  322

Query  289   FGH--TQLIFYW---NHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTLVKDCP  140
             + H  T++   W   N P   +      + V DW++DR +  Q++       DCP
Sbjct  323   YAHCQTEMQETWLRANSP--RLGATTIAKAVGDWFYDR-SAFQKI-------DCP  367



>ref|XP_007158098.1| hypothetical protein PHAVU_002G123900g [Phaseolus vulgaris]
 gb|ESW30092.1| hypothetical protein PHAVU_002G123900g [Phaseolus vulgaris]
Length=400

 Score =   252 bits (644),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 134/346 (39%), Positives = 196/346 (57%), Gaps = 17/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T L++AV+ GAVCLDGSPP Y F +G G G   W+V   GG WC++++ C +RKT+HLGS
Sbjct  30    TYLQNAVAKGAVCLDGSPPGYHFDRGSGTGINNWLVAFEGGGWCNNVTTCLSRKTNHLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +         F GI+      N +F NWN++ V YCDGSSFTGDVE VNP T LHFRG
Sbjct  90    SKQM---AKQIAFSGIMSNRPMFNPDFYNWNRIKVRYCDGSSFTGDVEAVNPVTKLHFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RIF AV+EDLL  KGM++A +  ++G SAGGL  ++HCDRF         VKC+S+ G+
Sbjct  147   ARIFAAVMEDLLA-KGMKNARNAIISGCSAGGLTAVLHCDRFKALLPREARVKCVSDAGY  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F++++    A  ++  F  ++  H S   LP+ C  +     LC FPQ++   I TP+F 
Sbjct  206   FINARDVTGAYHIQQYFSQVVATHGSARNLPQSC-TSRLTPKLCFFPQYLVSHITTPIFF  264

Query  472   MVSTYDSYLINHTLSTGFYEAVKSKH--------ISATQYKALKELRLQMLVALRETDSP  317
             + + YDS+ I + L+ G  +     H         S  Q   ++  R + L AL    + 
Sbjct  265   VNAAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSPDQLDLMQGFRTEFLRALTVLGNS  324

Query  316   S-RGLFVSNCFGHTQLIF---YWNHPGFEVNYRKDVEVVRDWYFDR  191
             S +G+F+ +C+ H Q      +  +   E+      + V DW+++R
Sbjct  325   SYKGMFIDSCYAHCQTEMQETWLRNDSPELEKTTIAKAVADWFYER  370



>gb|ADE77373.1| unknown [Picea sitchensis]
Length=411

 Score =   252 bits (644),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 150/386 (39%), Positives = 207/386 (54%), Gaps = 35/386 (9%)
 Frame = -3

Query  1222  TANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISEC  1043
             + N+    N T+L +AV  GAVCLDGSPPAY   +G G G  RW+V++ GG WC  +  C
Sbjct  40    STNAMLLVNITVLNNAVFKGAVCLDGSPPAYHLHRGFGSGANRWLVHMEGGGWCYDMLSC  99

Query  1042  TNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETV  863
             + R  S LGSS   Y  D+   F GIL    ++N +F +WN+V+V YCDGSSFTGDVE V
Sbjct  100   SGRAASPLGSS--LYMGDT-IAFTGILSDVRSQNPDFYSWNRVMVRYCDGSSFTGDVEEV  156

Query  862   NPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNST  683
             +P T +HFRG+RI+ AV+EDLL  KGM  A    LTG SAGG+   IHCDRF +    S 
Sbjct  157   DPITKVHFRGQRIWQAVMEDLLA-KGMYKARQALLTGCSAGGVTTFIHCDRFNDLLPGSA  215

Query  682   TVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHV  503
              VKC+ + GFF+ S   +           ++ LH S+  LP  C      + LC FPQ++
Sbjct  216   KVKCMPDAGFFIDSNDISGGNQQRFLVDQMVTLHGSSKHLPVACTSEMIPSSLCFFPQYL  275

Query  502   AKDIRTPLFIMVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQM  347
              + IRTPL ++ S YD   I   L     +         +     +  Q + ++E    M
Sbjct  276   LQWIRTPLLVVNSAYDPLQIRFILVPAAADPNNYWRNCKMNITRCAPWQLRVMEEFTDYM  335

Query  346   LVALRE-TDSPSRGLFVSNCFGHTQ--LIFYWNHPGFEVNYRKDV-EVVRDWYFDRINHV  179
             + AL   ++S + GLF+++C+ H Q  +   W+ P     Y K + E   DWYF R    
Sbjct  336   ISALTPVSNSRTGGLFINSCYAHCQTNVQALWHSPSSPRLYSKTIAEAAGDWYFGR----  391

Query  178   QEVEQSTLVK--DCP-------NNTF  128
                   ++VK  DCP       NN+F
Sbjct  392   ------SVVKYIDCPYPCDSTCNNSF  411



>ref|XP_008347803.1| PREDICTED: uncharacterized protein LOC103410929 [Malus domestica]
Length=401

 Score =   252 bits (643),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 134/346 (39%), Positives = 204/346 (59%), Gaps = 17/346 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T++E+AV+ GAVCLDGS  AY F KG G G   W+V++ GG WC+++ +C +RK+++ GS
Sbjct  33    TLVENAVAKGAVCLDGSAXAYHFDKGFGAGINNWLVHVEGGGWCNTVEDCLDRKSNYRGS  92

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +    +   +F G+L      N +F NWN++ V YCDGSSFTGDVE V+P T LHFRG
Sbjct  93    STKM---EKTMSFSGVLGNKPKTNPDFYNWNRIKVRYCDGSSFTGDVEAVDPATNLHFRG  149

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R+F A+++ LL  KGM++A +  L+G SAGGL  I+HCD F +     T VKCL++ G+
Sbjct  150   ARVFRAIIDXLLA-KGMKNAQNALLSGCSAGGLTSILHCDNFRSLLPVGTKVKCLADAGY  208

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F+++K  + ++ ++  +  ++ LH S   LP  C        LC FPQ+V     TP+F+
Sbjct  209   FINAKSLSGSZHIQGFYSEVVALHGSAKNLPASCTSRMSPG-LCFFPQNVVPQTXTPIFL  267

Query  472   MVSTYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVAL-RETDS  320
             + + YDS+ I + L+ G  +         +  K+ S +Q + L+E RLQ L  +   + S
Sbjct  268   VNAAYDSWQIKNILAPGVADPKGAWKKCKLNIKNCSPSQLQTLQEYRLQFLKTIAXSSTS  327

Query  319   PSRGLFVSNCFGHTQLIFY--WNHPGFEVNYRKDV-EVVRDWYFDR  191
              S G F+ +CF H Q+     W      +  +  +   V DWY+DR
Sbjct  328   SSHGAFIDSCFAHCQIGTQETWLAADSPMLSKTTIANAVGDWYYDR  373



>gb|EMS59699.1| hypothetical protein TRIUR3_12152 [Triticum urartu]
Length=386

 Score =   251 bits (642),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 151/386 (39%), Positives = 215/386 (56%), Gaps = 33/386 (9%)
 Frame = -3

Query  1255  LLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLL  1076
             ++++VL   P           T++ SAV  GAVC+DG+PPAY    G G G++ WIV L 
Sbjct  9     IVVLVLAAAPGVP----AVPITLITSAVDKGAVCMDGTPPAYHMDPGSGAGKKSWIVNLE  64

Query  1075  GGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCD  896
             GG WC +++ C  RK S LGSS+     +    F+GIL  N AEN +F +WN+V+V YCD
Sbjct  65    GGGWCENVTACMYRKGSRLGSSNLM---ERQLEFRGILSSNPAENPDFYSWNRVMVRYCD  121

Query  895   GSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHC  716
             G+SF G  E  +  + ++FRG+RIFDAV++ LL + GM  A  V L GGSAGGL+ I+HC
Sbjct  122   GASFAG--EGYDAGSRVYFRGQRIFDAVIQHLL-SIGMSSADQVLLAGGSAGGLSAILHC  178

Query  715   DRFANRFRN-STTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNH  539
             D+F   F   STTVKCL++ G FL +   A    L S F G++  H     LP  C    
Sbjct  179   DQFGAFFAGRSTTVKCLADAGLFLDAVDVAGGHTLRSYFGGVVATHGVAQTLPRSCTGRL  238

Query  538   QLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLST------GFYEAVKSKHIS--AT  383
               A  C FPQ++   I+TP  ++ + YD++ I+ +L+       G + A KS  ++  A+
Sbjct  239   D-ATSCFFPQNIIGSIKTPTSLLNAAYDTWQIHESLAPDVADHGGAWRACKSSRLACNAS  297

Query  382   QYKALKELRLQMLVALRETDSPSR--GLFVSNCFGHTQ--LIFYWNHPGFEVNYRKDV-E  218
             Q K L+  R QM+  ++   S S+  G F+++CF H Q  +   WN  G    + K + +
Sbjct  298   QMKVLQAFREQMVGIVQGAFSRSKGNGFFINSCFTHGQSKVPATWNANGSPTIHNKSIAK  357

Query  217   VVRDWYFDRINHVQEVEQSTLVKDCP  140
              V DWYF R     EV       DCP
Sbjct  358   SVSDWYFGR----AEVR----AIDCP  375



>ref|XP_009413211.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=397

 Score =   251 bits (642),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 133/351 (38%), Positives = 201/351 (57%), Gaps = 18/351 (5%)
 Frame = -3

Query  1207  FTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKT  1028
             F    T+LE AV  GAVCLDGSPPAY F  G G G   W+V++ GG WC+++ +C  R+ 
Sbjct  31    FDVPMTLLEGAVDEGAVCLDGSPPAYHFSPGFGSGMNNWLVHMEGGGWCTNVQDCLARRD  90

Query  1027  SHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTG  848
             +  GSS          +F GIL  +   N +F NWNKV + YCDGSSFTGDV+ V+P T 
Sbjct  91    TFRGSSKYM----KPLSFSGILGNSQNSNPDFYNWNKVKIRYCDGSSFTGDVDEVDPATK  146

Query  847   LHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCL  668
             L+FRG +I+ AV+E+LL  KGM  A +  L+G SAGGLA I+HCD+F +      TVKCL
Sbjct  147   LYFRGAKIWLAVIEELLA-KGMNKAENALLSGCSAGGLASILHCDKFGDLLPAGATVKCL  205

Query  667   SNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIR  488
             S+ G+F+++K     + +++ +  ++  H S   LP  C  +     +C FPQ+V   +R
Sbjct  206   SDAGYFINAKDITGTESIKAYYSEVVSTHGSAKNLPSSC-TSRMTPSMCFFPQYVVPQMR  264

Query  487   TPLFIMVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALR  332
             T LFI+ + YD++ I + L+    +  K+        K  S+ Q + ++  R + L AL 
Sbjct  265   TSLFILNAAYDAWQIKNILAPSAADPHKTWNDCKLDIKQCSSDQLQIMQGFRSEFLNALA  324

Query  331   ET-DSPSRGLFVSNCFGHTQLIFYWNHPGFEVNYRKDVEV---VRDWYFDR  191
                +S +RG+F+++C+ H Q          +     ++ +   V DW++DR
Sbjct  325   ALGNSSARGMFINSCYAHCQSGSQDTWLAADSPALDNIPIGKAVGDWFYDR  375



>ref|XP_006587655.1| PREDICTED: protein notum homolog isoform X1 [Glycine max]
Length=453

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 140/349 (40%), Positives = 200/349 (57%), Gaps = 20/349 (6%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             TI+++AV+ GAVCLDGSPPAY F +G G G   W+V   GG WC++++ C  RKT+ LGS
Sbjct  30    TIVQNAVAKGAVCLDGSPPAYHFDRGFGSGINNWLVAFEGGGWCNNVTTCLARKTNRLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +         F GIL+     N +F NWN++ V YCDGSSFTGDVE VNP T LHFRG
Sbjct  90    SKQMA---KLIAFSGILNNREMFNPDFYNWNRIKVRYCDGSSFTGDVEAVNPVTKLHFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHV---FLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSN  662
              RIF+AV+EDLL  KGM++A +V    ++G SAGGL  ++HCDRF         VKCLS+
Sbjct  147   GRIFNAVMEDLLA-KGMKNARNVREAIISGCSAGGLTSVLHCDRFRALLPRGARVKCLSD  205

Query  661   GGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTP  482
              G+F++ K     Q +E  F  ++  H S   LP+ C  +     LC FPQ++   I TP
Sbjct  206   AGYFINGKDVLGEQHIEQYFSQVVATHGSARNLPQSC-TSRLSPRLCFFPQYLVSRITTP  264

Query  481   LFIMVSTYDSYLINHTLSTGFYEAVKSKH--------ISATQYKALKELRLQMLVALRET  326
             +F + + YDS+ I + L+ G  +     H         S  Q   ++  R + L A+   
Sbjct  265   IFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSPDQLDLMQGFRTEFLRAITVL  324

Query  325   -DSPSRGLFVSNCFGH--TQLIFYW-NHPGFEVNYRKDVEVVRDWYFDR  191
              +S S+G+F+ +C+ H  T++   W      E+      + V DW+++R
Sbjct  325   GNSSSKGMFIDSCYAHCQTEMQETWLRSDSPELKKTTIAKAVADWFYER  373



>gb|EMT00867.1| hypothetical protein F775_21765 [Aegilops tauschii]
Length=528

 Score =   254 bits (650),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 153/398 (38%), Positives = 221/398 (56%), Gaps = 33/398 (8%)
 Frame = -3

Query  1291  KKMGTLLNTTFILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGI  1112
             +K+G        L+++VL   P    S      T++ SAV  GAVC+DG+PPAY    G 
Sbjct  139   EKIGMAKLWALSLVVLVLAAAP----SVPAVPITLITSAVDKGAVCMDGTPPAYHMDPGS  194

Query  1111  GEGRQRWIVYLLGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEF  932
             G G++ WIV L GG WC S++ C  RK S LGSS+     +    F+GIL    AEN +F
Sbjct  195   GAGKKSWIVNLEGGGWCESVTACMYRKGSRLGSSNLM---ERQLEFRGILSSTPAENPDF  251

Query  931   CNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTG  752
              +WN+V++ YCDG+SF G  E  +  + ++FRG+RIF+A ++ LL + GM  A  V L G
Sbjct  252   YSWNRVMIRYCDGASFAG--EGYDAGSRVYFRGQRIFNAAIQHLL-SIGMSSADQVLLAG  308

Query  751   GSAGGLAVIIHCDRFANRFRN-STTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNS  575
             GSAGGL+ I+HCD+F   F   STTVKCL++ G FL +   A    L S F G++  H  
Sbjct  309   GSAGGLSAILHCDQFGAFFAGRSTTVKCLADAGLFLDAVDVAGGHTLRSYFGGVVATHRV  368

Query  574   TAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLST------GFYE  413
                LP  C   H  A  C FPQ++   I+TP+F++ + YD++ I+ +L+       G + 
Sbjct  369   AQTLPRSC-TGHLDATSCFFPQNIIGSIKTPIFLLNAAYDTWQIHESLAPDVADHGGAWR  427

Query  412   AVKSKHIS--ATQYKALKELRLQMLVALRETDSPSR--GLFVSNCFGHTQ--LIFYWNHP  251
             A KS  ++  A+Q K L+  R QM+  +    S S+  G F+++CF H Q  +   WN  
Sbjct  428   ACKSNRLACNASQMKVLQAFREQMVGIVEGAFSRSKGNGFFINSCFTHGQSKVPATWNAN  487

Query  250   GFEVNYRKDV-EVVRDWYFDRINHVQEVEQSTLVKDCP  140
             G    + K + + V DWYF R   V+ +       DCP
Sbjct  488   GSPTIHNKSIAKSVSDWYFGRA-EVRAI-------DCP  517



>gb|KDP28067.1| hypothetical protein JCGZ_19475 [Jatropha curcas]
Length=394

 Score =   251 bits (640),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 133/346 (38%), Positives = 199/346 (58%), Gaps = 18/346 (5%)
 Frame = -3

Query  1189  ILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGSS  1010
             ++E+A + GAVCLDGS PAY F KG G G   WIV++ GG WC  I  C  R+ ++ GSS
Sbjct  31    LIENAKAKGAVCLDGSAPAYHFQKGEGTGINNWIVHMEGGGWCDDIESCLARRNTYKGSS  90

Query  1009  HRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGR  830
              +    +    F GIL      N +F NWN++ + YCDGSSFTGDVE V+P T L+FRG 
Sbjct  91    SKM---NKTMGFSGILGSKQVSNPDFYNWNRIKIRYCDGSSFTGDVEEVDPKTNLYFRGE  147

Query  829   RIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFF  650
             R++ AV+++LL  KGM +A +  L+G SAGGLA I+HCD+F +    + TVKC+S+ G+F
Sbjct  148   RVWQAVIDELLA-KGMNNAQNAILSGCSAGGLAAILHCDKFKSFLPATATVKCVSDAGYF  206

Query  649   LHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIM  470
             +H K  A   ++E+ F  I+  H S   LP  C    +   LC FP++VA+ ++TPLF++
Sbjct  207   IHGKDIAGGYEIENFFGRIVTTHGSAKNLPASCTSKMK-PELCFFPENVAQTMQTPLFVI  265

Query  469   VSTYDSYLINHTLST------GFYEAVKSK--HISATQYKALKELRLQMLVALR--ETDS  320
              S YD + + + L+       G +++ K         Q + +++ R Q + AL     + 
Sbjct  266   NSAYDFWQLKNVLAPSAADRKGTFKSCKLDLTKCKPAQLETVQDFRTQFINALNIGLGNK  325

Query  319   PSRGLFVSNCFGHTQL---IFYWNHPGFEVNYRKDVEVVRDWYFDR  191
                G F+ +C+ H Q    + +       +N  +  + V DWYFDR
Sbjct  326   TVNGYFIDSCYAHCQTGSPLVWLAEKSPVLNDTRIAKAVGDWYFDR  371



>ref|XP_009616254.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=404

 Score =   251 bits (641),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 147/366 (40%), Positives = 205/366 (56%), Gaps = 25/366 (7%)
 Frame = -3

Query  1201  TNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSH  1022
              N T L S ++ GAVCLDGS PAY   KG G G   W++ + GG WC++++ C +RK + 
Sbjct  29    VNITYLLSGMAKGAVCLDGSSPAYHHDKGFGTGVNSWLIQMEGGGWCNNVTTCLSRKNTR  88

Query  1021  LGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLH  842
             LGSS +         F GIL      N +F NWN+V V YCDGSSFTGDV+ VNP T LH
Sbjct  89    LGSSKQMV---KQLAFSGILSNKPQFNPDFYNWNRVKVRYCDGSSFTGDVQAVNPITNLH  145

Query  841   FRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSN  662
             FRG R+F AV+EDLL  KGM++A +  L+G SAGGL  I+HCD F         VKC S+
Sbjct  146   FRGARVFLAVMEDLLA-KGMKNAENAILSGCSAGGLTSILHCDSFKALLPMGAKVKCFSD  204

Query  661   GGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTP  482
              G+F++ K  + A  +E  F  ++ LH S   LP  C    +   LC FPQ+VA+ +RTP
Sbjct  205   AGYFINVKDISGAPHIEEFFGDVVRLHGSAKNLPPSCTSRLK-PNLCFFPQNVAQHVRTP  263

Query  481   LFIMVSTYDSYLINHTLST------GFYEAVKSK--HISATQYKALKELRLQMLVALRET  326
             LF++ + YDS+ I + L+       G +   K      S+ Q + ++  RL  L AL   
Sbjct  264   LFLVNAAYDSWQIKNILAPSVADPRGVWRNCKLDILRCSSRQLQTMQGFRLGFLRALITL  323

Query  325   -DSPSRGLFVSNCFGH--TQLIFYWNHPGFEVNYRKDVEV-VRDWYFDRINHVQEVEQST  158
               S SRG F+++C+ H  T++   W          K + + + DW+FD+ N  Q++    
Sbjct  324   GPSSSRGYFINSCYAHCQTEVQETWFRADSPKLANKTIAIALGDWFFDK-NSFQKI----  378

Query  157   LVKDCP  140
                DCP
Sbjct  379   ---DCP  381



>ref|XP_010266381.1| PREDICTED: uncharacterized protein LOC104603915 isoform X2 [Nelumbo 
nucifera]
Length=399

 Score =   251 bits (640),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 139/368 (38%), Positives = 212/368 (58%), Gaps = 18/368 (5%)
 Frame = -3

Query  1258  ILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYL  1079
             +L +++       AN +F    T +E++++ GAVCLDGSPPAY   KG G G   W+V+L
Sbjct  9     LLYLLICTLITMKANGFFV-GITYVENSIAKGAVCLDGSPPAYHMDKGFGSGINNWLVHL  67

Query  1078  LGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYC  899
              GG WCS+++ C   K +  GSS +         F GIL      N +F NWNK+ V YC
Sbjct  68    EGGGWCSNVTICLAHKDTRHGSSKKMA---KQIAFSGILSNKENFNPDFYNWNKIKVRYC  124

Query  898   DGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIH  719
             DGSSFTGDVE ++P   L+ RG R++ AV+EDLL  KGM++A +  L+G S+GGLA I+H
Sbjct  125   DGSSFTGDVEAIDPANNLYLRGERVWQAVMEDLL-EKGMKNAKYALLSGCSSGGLAAILH  183

Query  718   CDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNH  539
             CDRF         VKCLS+ G+F+++K  +    +++ +  ++  H S   LP  C    
Sbjct  184   CDRFRELLPVDAKVKCLSDAGYFINAKDVSGKDHIQAIYNDVVTTHQSAKNLPVSCTSRT  243

Query  538   QLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGF--------YEAVKSKHISAT  383
             + + LC FPQ+V +D+ T LFI+ + YDS+ I +TL+ G         Y  +  K+ S++
Sbjct  244   EPS-LCFFPQNVVQDMYTQLFILNAAYDSWQIKNTLAPGVADPHGHWHYCKLDIKNCSSS  302

Query  382   QYKALKELRLQMLVALRETDSPS-RGLFVSNCFGHTQ--LIFYWNHPGFEVNYRKDV-EV  215
             Q + ++  R + L ++ E  S S +G+F+++C+ H Q  +   W      V  +  + + 
Sbjct  303   QLQTMQGFRSEFLNSVGELMSSSMKGMFINSCYAHCQSEVQETWLRADSPVLDKTPIAKA  362

Query  214   VRDWYFDR  191
             V DWY DR
Sbjct  363   VGDWYNDR  370



>ref|XP_006291204.1| hypothetical protein CARUB_v10017332mg [Capsella rubella]
 gb|EOA24102.1| hypothetical protein CARUB_v10017332mg [Capsella rubella]
Length=418

 Score =   251 bits (642),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 141/384 (37%), Positives = 216/384 (56%), Gaps = 30/384 (8%)
 Frame = -3

Query  1249  IVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGG  1070
             ++ L +    A+S      T+++ A S GAVCLDG+ P Y   +G G G   W++ L GG
Sbjct  38    VISLMENKLMASSVPMVPLTLIQGADSKGAVCLDGTLPGYHLDRGFGSGANSWLIQLEGG  97

Query  1069  EWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGS  890
              WC++   C  RKTS  GSS+   + + A  F GIL     EN +F NWN++ + YCDG+
Sbjct  98    GWCNNHRSCVYRKTSRRGSSN---FMEKALAFTGILSNKPEENPDFFNWNRIKLRYCDGA  154

Query  889   SFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDR  710
             SF+GD +  +  + L +RG+RI+   +++ L + GMQ A    L+G SAGGLA I+HCD 
Sbjct  155   SFSGDSQ--DEGSQLFYRGQRIWQVAMQEFL-SLGMQQANQALLSGCSAGGLASILHCDE  211

Query  709   FANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLA  530
             F     NST VKCLS+ G FL +   +    L + F+G++ + N    L   C  NH   
Sbjct  212   FRELLPNSTKVKCLSDAGMFLDAVDVSGGHSLRNMFQGVVTVQNLQKDLSSTC-TNHLDP  270

Query  529   YLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLST------GFYEAVKSKHI--SATQYK  374
               C FPQ++  DI+TP+F++ + YDS+ I  +L+       G ++A KS H+  +++Q +
Sbjct  271   TSCFFPQNLVSDIKTPMFLLNTAYDSWQIQESLAPPTADPGGIWKACKSDHLHCNSSQIQ  330

Query  373   ALKELRLQMLVALRE-TDSPSRGLFVSNCFGHTQ-----LIFYWNHPGFEVNYRKDVEVV  212
               +E R QM++A+   + S   GLF+++CF H Q       F  + P  ++N ++  E V
Sbjct  331   FFQEFRTQMVLAVNSFSASEQNGLFINSCFAHCQSERQDTWFAQDSP--QLNGKRVAESV  388

Query  211   RDWYFDRINHVQEVEQSTLVKDCP  140
              DWYFDR  +V+ +       DCP
Sbjct  389   GDWYFDRTTNVKAI-------DCP  405



>ref|XP_007156332.1| hypothetical protein PHAVU_003G277600g [Phaseolus vulgaris]
 gb|ESW28326.1| hypothetical protein PHAVU_003G277600g [Phaseolus vulgaris]
Length=399

 Score =   251 bits (640),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 133/315 (42%), Positives = 185/315 (59%), Gaps = 14/315 (4%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T++E+A+S GAVCLDGSPPAY F KG GEG   WIV++ GG WC    +C  RK + LGS
Sbjct  30    TLVENALSKGAVCLDGSPPAYHFDKGDGEGINNWIVHMEGGGWCKDADDCLGRKDTRLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +Q   D    F GIL      N +F NW++V + YCDGSSFTGDVE V+PT  L+FRG
Sbjct  90    S-KQMVED--LYFSGILSNEREYNPDFYNWDRVKIRYCDGSSFTGDVEEVDPTNNLYFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              RIF AV+EDLL  KGM+ A +  L+G SAGGL  I+HCD F     +  TVKC+ + G+
Sbjct  147   ARIFSAVMEDLLA-KGMEKAENAILSGCSAGGLTTILHCDNFKALLPSKATVKCVPDAGY  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F++ +  + A+ +E  +  ++  H S   LP  C      + LC FPQ+VA  I TP+FI
Sbjct  206   FINVEDISGARFIEDYYSKVVSTHGSAKNLPTSCTSKLS-SGLCFFPQYVASHISTPIFI  264

Query  472   MVSTYDSYLINHTLSTGFYEAVKSKHISATQYKALKELRLQMLVALRET---------DS  320
             + S YDS+ I + L+ G  +   + H            +L ++   ++          DS
Sbjct  265   VNSAYDSWQIRNILAPGAADPSDNWHSCKLDLAKCSPDQLSIVQGFKKEFEKAVSVVGDS  324

Query  319   PSRGLFVSNCFGHTQ  275
              S G+F+++C+ H Q
Sbjct  325   SSNGMFINSCYDHCQ  339



>gb|EMS61917.1| hypothetical protein TRIUR3_01659 [Triticum urartu]
Length=425

 Score =   251 bits (642),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 144/362 (40%), Positives = 203/362 (56%), Gaps = 23/362 (6%)
 Frame = -3

Query  1204  TTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTS  1025
             T   T+L  A   GAVCLDG+PP Y   +G G+G  RW+++L GG WCS+I +C+NR+  
Sbjct  56    TVPLTLLAGAQEKGAVCLDGTPPGYHLQRGSGDGSNRWLIHLEGGGWCSTIKDCSNRRMY  115

Query  1024  HLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVE-TVNPTTG  848
              LGSS+  +     F   GIL  +  +N +F NWNKV V YCDG+SF+GD E      + 
Sbjct  116   ALGSSN--FMKPMRFAGAGILGSDQLQNPDFYNWNKVFVRYCDGASFSGDAEGRAQDGST  173

Query  847   LHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCL  668
             LHFRG RI+ AV+++L+  KG+ +AT   LTG SAGGLA I+HCD F+ RF  + +VKCL
Sbjct  174   LHFRGLRIYQAVIDELM-EKGLANATQALLTGCSAGGLATILHCDDFSARFSLNVSVKCL  232

Query  667   SNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIR  488
             ++ GFFL  K  +  +   S + G++ L N   VLP+ C  N +    C FP  + K IR
Sbjct  233   ADAGFFLDVKDISGKRSFWSVYDGVVHLQNVREVLPKDCLTNKEPTE-CFFPAELIKSIR  291

Query  487   TPLFIMVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALR  332
             TP+FI+ S YDS+ I + L        K         ++ ++TQ K L   R  M+ A +
Sbjct  292   TPMFILNSAYDSWQIRNVLVPVSSAPDKPWSSCKDNIRNCNSTQIKVLDGFRNTMVGAFK  351

Query  331   ETD-SPSRGLFVSNCFGHTQLIF--YWNHPGFEVNYR----KDVEVVRDWYFDRINHVQE  173
               +     GLFV +CF H Q ++   WN    E++ R       E   DWY  R    +E
Sbjct  352   VVEYKEDWGLFVDSCFTHCQSLYGISWNS---EISPRLGNKSIAEAAGDWYHGRSQGEKE  408

Query  172   VE  167
             ++
Sbjct  409   ID  410



>ref|XP_010266380.1| PREDICTED: uncharacterized protein LOC104603915 isoform X1 [Nelumbo 
nucifera]
Length=412

 Score =   251 bits (640),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 139/368 (38%), Positives = 212/368 (58%), Gaps = 18/368 (5%)
 Frame = -3

Query  1258  ILLIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYL  1079
             +L +++       AN +F    T +E++++ GAVCLDGSPPAY   KG G G   W+V+L
Sbjct  22    LLYLLICTLITMKANGFFV-GITYVENSIAKGAVCLDGSPPAYHMDKGFGSGINNWLVHL  80

Query  1078  LGGEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYC  899
              GG WCS+++ C   K +  GSS +         F GIL      N +F NWNK+ V YC
Sbjct  81    EGGGWCSNVTICLAHKDTRHGSSKKMA---KQIAFSGILSNKENFNPDFYNWNKIKVRYC  137

Query  898   DGSSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIH  719
             DGSSFTGDVE ++P   L+ RG R++ AV+EDLL  KGM++A +  L+G S+GGLA I+H
Sbjct  138   DGSSFTGDVEAIDPANNLYLRGERVWQAVMEDLL-EKGMKNAKYALLSGCSSGGLAAILH  196

Query  718   CDRFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNH  539
             CDRF         VKCLS+ G+F+++K  +    +++ +  ++  H S   LP  C    
Sbjct  197   CDRFRELLPVDAKVKCLSDAGYFINAKDVSGKDHIQAIYNDVVTTHQSAKNLPVSCTSRT  256

Query  538   QLAYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGF--------YEAVKSKHISAT  383
             + + LC FPQ+V +D+ T LFI+ + YDS+ I +TL+ G         Y  +  K+ S++
Sbjct  257   EPS-LCFFPQNVVQDMYTQLFILNAAYDSWQIKNTLAPGVADPHGHWHYCKLDIKNCSSS  315

Query  382   QYKALKELRLQMLVALRETDSPS-RGLFVSNCFGHTQ--LIFYWNHPGFEVNYRKDV-EV  215
             Q + ++  R + L ++ E  S S +G+F+++C+ H Q  +   W      V  +  + + 
Sbjct  316   QLQTMQGFRSEFLNSVGELMSSSMKGMFINSCYAHCQSEVQETWLRADSPVLDKTPIAKA  375

Query  214   VRDWYFDR  191
             V DWY DR
Sbjct  376   VGDWYNDR  383



>dbj|BAJ89162.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=424

 Score =   251 bits (641),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 143/362 (40%), Positives = 203/362 (56%), Gaps = 23/362 (6%)
 Frame = -3

Query  1204  TTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTS  1025
             T   T+L  A   GAVCLDG+PP Y   +G G+G  RW+++L GG WCS++ +C+NR+  
Sbjct  55    TVPLTLLAGAQEKGAVCLDGTPPGYHLQRGSGDGSNRWLIHLEGGGWCSTVKDCSNRRMY  114

Query  1024  HLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVE-TVNPTTG  848
              LGSS+  +     F   GIL  +  +N +F NWNKV V YCDG+SF+GD E      + 
Sbjct  115   ALGSSN--FMKPMRFAGAGILGSDQLQNPDFYNWNKVFVRYCDGASFSGDAEGRAQDGSI  172

Query  847   LHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCL  668
             L+FRG RI+ AV+++L+  KG+ +AT   LTG SAGGLA I+HCD F+ RF    +VKCL
Sbjct  173   LYFRGLRIYQAVLDELM-EKGLANATQALLTGCSAGGLATILHCDDFSARFSRDVSVKCL  231

Query  667   SNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIR  488
             ++ GFFL  K  +  +   S + G++ L N   VLP+ C  N +    C FP  + K  R
Sbjct  232   ADAGFFLDVKDISGKRSFWSVYDGVVHLQNVREVLPKDCLANKEPTE-CFFPAELIKSTR  290

Query  487   TPLFIMVSTYDSYLINHTLSTGFYEAVKS--------KHISATQYKALKELRLQMLVALR  332
             TP+FI+ S YDS+ + + L        KS        ++ ++TQ K L   R  M+ AL 
Sbjct  291   TPMFILNSAYDSWQVRNVLVPVSSAPDKSWSSCKDNIRNCNSTQIKVLNGFRNTMVGALN  350

Query  331   ET-DSPSRGLFVSNCFGHTQLIF--YWNHPGFEVNYRKD----VEVVRDWYFDRINHVQE  173
                D    GLF+ +CF H Q ++   WN    E++ R       E   DWY  R   V+E
Sbjct  351   VVEDKEDWGLFIDSCFTHCQSLYGISWNS---EISPRLGNKTIAEAAGDWYHGRSRRVKE  407

Query  172   VE  167
             ++
Sbjct  408   ID  409



>gb|AFK37852.1| unknown [Lotus japonicus]
Length=399

 Score =   250 bits (639),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 136/344 (40%), Positives = 201/344 (58%), Gaps = 17/344 (5%)
 Frame = -3

Query  1186  LESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGSSH  1007
             LE AVS GAVCLDG+PPAY F +G GEG   WIV+L GG WC+++++C  RK +  GSS 
Sbjct  32    LEKAVSKGAVCLDGTPPAYHFDEGSGEGVNNWIVFLEGGGWCNNVTDCLLRKDTRRGSSD  91

Query  1006  RQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRGRR  827
             +    +  F F G L  N   N +F NWN+++V YCDG+SFTGDVE V+P T LHFRG R
Sbjct  92    QM--TEPRF-FNGFLSENQKFNPDFYNWNRILVRYCDGASFTGDVEEVDPATNLHFRGAR  148

Query  826   IFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGFFL  647
             +F AV+E+LL  KGMQ+A +  L+G SAGGLA I+ CD F +       VKC+ + G+F+
Sbjct  149   VFVAVIEELLA-KGMQNAENAILSGCSAGGLATILQCDHFKSLLPAEAKVKCVPDAGYFI  207

Query  646   HSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFIMV  467
             + K  +  Q +E  +  ++  H S   LP  C        LC FPQ+VA +I TP+F + 
Sbjct  208   NVKDTSGTQYIEEYYNEVVATHGSAKNLPPSCTSRRSPG-LCFFPQYVASEISTPIFYVN  266

Query  466   STYDSYLINHTLSTGFYEA--------VKSKHISATQYKALKELRLQMLVALRETD-SPS  314
             + YD++ I++  + G  +         +   + S  Q  A++  R + + AL  T+ S S
Sbjct  267   AAYDTWQIHNIFARGSADPHGIWHNCKLDINNCSPDQLTAIQGFRTEFIKALSVTENSRS  326

Query  313   RGLFVSNCFGHTQLIF---YWNHPGFEVNYRKDVEVVRDWYFDR  191
              G+F+ +C+ H Q      + +    ++   K  + V DW+++R
Sbjct  327   EGMFIDSCYVHCQTETQESWLSSDSPQLANTKLGKAVGDWFYER  370



>emb|CAD41867.2| OSJNBa0041A02.14 [Oryza sativa Japonica Group]
 emb|CAH67867.1| B0403H10-OSIGBa0105A11.19 [Oryza sativa Indica Group]
Length=396

 Score =   250 bits (638),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 144/384 (38%), Positives = 208/384 (54%), Gaps = 27/384 (7%)
 Frame = -3

Query  1252  LIVVLHQQPQTANSYFTTNSTILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLG  1073
             +++VL     ++      +   L+SAVS GAVCLDGSPP Y F  G G G   W+V++ G
Sbjct  14    MVLVLGLVVASSAKAGDVDMVFLKSAVSTGAVCLDGSPPVYHFSPGSGSGANNWLVHMEG  73

Query  1072  GEWCSSISECTNRKTSHLGSSHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDG  893
             G WC +  EC+ R+ +  GSS          +F GI+  N   N +F NWN++ V YCDG
Sbjct  74    GGWCRNAQECSVRQGNFRGSSKFMR----PLSFSGIIGGNQRNNPDFYNWNRIKVRYCDG  129

Query  892   SSFTGDVETVNPTTGLHFRGRRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCD  713
             SSFTGDVETV  +T LHFRG R+++A++EDLL  KGM  A +  L+G SAGGLA I+HCD
Sbjct  130   SSFTGDVETVETSTNLHFRGARVWNAIIEDLLA-KGMSKAQNALLSGCSAGGLAAILHCD  188

Query  712   RFANRFRNSTTVKCLSNGGFFLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQL  533
             +F +    +  VKC S+ GFF+  K       + + ++ +++LH S   LP  C      
Sbjct  189   QFRDLLPATANVKCFSDAGFFVDGKDITGNDFVRTFYKDVVNLHGSAKNLPSSCTSKMS-  247

Query  532   AYLCMFPQHVAKDIRTPLFIMVSTYDSYLINHTLSTGFYEAVKS--------KHISATQY  377
               LC FPQ+V   +RTPLFI+ + YD++ I + L+    +  K+           S++Q 
Sbjct  248   PDLCFFPQNVVPTLRTPLFILNAAYDAWQIKNVLAPSAADKKKTWAKCKLDITACSSSQL  307

Query  376   KALKELRLQMLVAL-RETDSPSR-GLFVSNCFGHTQLIFY--WNHPGFEVNYRKDV-EVV  212
               L+  R   L AL +   SP+   +F+ +C+ H Q      W   G  V  +  + + V
Sbjct  308   TTLQNFRTDFLAALPKPEQSPANLSIFIDSCYAHCQSGSQDTWLAQGSPVVEKTQIGKAV  367

Query  211   RDWYFDRINHVQEVEQSTLVKDCP  140
              DW+ DR     EV +     DCP
Sbjct  368   GDWFHDR-----EVSRRI---DCP  383



>ref|XP_008378614.1| PREDICTED: uncharacterized protein LOC103441693 [Malus domestica]
 ref|XP_008347801.1| PREDICTED: uncharacterized protein LOC103410927 [Malus domestica]
Length=393

 Score =   250 bits (638),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 134/345 (39%), Positives = 200/345 (58%), Gaps = 17/345 (5%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T++E+AV+ GAVCLDGS PAY F KG G G   W+VY  GG WC++++ C +R    LGS
Sbjct  30    TLVENAVAKGAVCLDGSAPAYHFDKGFGAGINNWLVYFEGGGWCNTVATCLDRSNYSLGS  89

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S +    +    F G+L      N +F NWN++ V YCDGSSFTGDVE V+P T LHFRG
Sbjct  90    STKM---EKTMLFSGVLSNKQKTNPDFYNWNRIKVRYCDGSSFTGDVEAVDPATNLHFRG  146

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
              R+F A+++DLL  KGM++A    L+G SAGGLA I+HCD F +       VKC+ + G+
Sbjct  147   ARVFRAIMDDLLA-KGMKNAQSALLSGCSAGGLASILHCDNFRSLLPVDAKVKCVPDAGY  205

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             F++++  + +  +++ +  ++ LH S   LP  C        LC FPQ+V    RTP+F 
Sbjct  206   FINARTVSGSPYIQAFYSEVVALHGSAKNLPASCTSRMSPG-LCFFPQNVVPLTRTPIFF  264

Query  472   MVSTYDSYLINHTLST------GFYEAVK--SKHISATQYKALKELRLQMLVALR-ETDS  320
             + + YD + I + L+       G ++  K   K+ S +Q + ++E RLQ L  +   ++S
Sbjct  265   VNAAYDWWQIQNILAPDVADPEGAWKKCKLNIKNCSPSQLQTMQEFRLQFLKTITGASNS  324

Query  319   PSRGLFVSNCFGHTQLIFY--WNHPGFEVNYRKDV-EVVRDWYFD  194
              S G F+ +C+ H Q+     W      +  +  + E V DWY+D
Sbjct  325   SSHGWFIHSCYAHCQIEMQETWLAADSPMLCKTTIAEAVGDWYYD  369



>emb|CDX76613.1| BnaC08g31990D [Brassica napus]
Length=415

 Score =   250 bits (639),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 139/365 (38%), Positives = 210/365 (58%), Gaps = 30/365 (8%)
 Frame = -3

Query  1192  TILESAVSVGAVCLDGSPPAYLFGKGIGEGRQRWIVYLLGGEWCSSISECTNRKTSHLGS  1013
             T++  A S GAVCLDG+ P Y   +G G     W+++L GG WC++ S C  RKT+  GS
Sbjct  54    TLIHGADSKGAVCLDGTLPGYHLDRGFGSSANSWLIHLEGGGWCNNRSSCVFRKTTRRGS  113

Query  1012  SHRQYWNDSAFNFKGILDFNCAENSEFCNWNKVVVHYCDGSSFTGDVETVNPTTGLHFRG  833
             S    + + A NF GIL     EN +F NWN++ + YCDG+SF+GD +  +  + + +RG
Sbjct  114   SK---FMEKALNFTGILSNKPQENPDFFNWNRIKLRYCDGASFSGDSQ--DEDSQIFYRG  168

Query  832   RRIFDAVVEDLLVNKGMQDATHVFLTGGSAGGLAVIIHCDRFANRFRNSTTVKCLSNGGF  653
             +RI+ A +E+ + + GMQ A    L+G SAGGLA I+HCD F  R   ST VKCLS+ G 
Sbjct  169   KRIWQAAMEEFM-SLGMQKAEQALLSGCSAGGLASILHCDDFRERLPLSTKVKCLSDAGM  227

Query  652   FLHSKHPAKAQDLESKFRGIIDLHNSTAVLPEPCRKNHQLAYLCMFPQHVAKDIRTPLFI  473
             FL +   +    L + F+G++ + N    L   C  NH     C FPQ++  DI+TP+F+
Sbjct  228   FLDAVDVSGGHSLRNMFQGVVTVQNLQKDLSSAC-TNHLDPTSCFFPQNLVSDIKTPMFL  286

Query  472   MVSTYDSYLINHTLST------GFYEAVKS--KHISATQYKALKELRLQMLVALRE-TDS  320
             + + YDS  +  +L+       G ++  KS     +++Q + L+E R QM++AL   + S
Sbjct  287   LNAAYDSRQVRQSLAPSPADPRGVWKHCKSDISRCNSSQLQFLQEFRKQMVLALNSFSAS  346

Query  319   PSRGLFVSNCFGHTQ-----LIFYWNHPGFEVNYRKDVEVVRDWYFDRINHVQEVEQSTL  155
             P  GLF+++CF H Q       F  + P  ++N ++  E V DWYFDR N+V+++     
Sbjct  347   PQNGLFINSCFTHCQSEIQDTWFVQDSP--KLNGKRVAESVGDWYFDRANNVKDI-----  399

Query  154   VKDCP  140
               DCP
Sbjct  400   --DCP  402



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3893783391680