BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13000_g1_i1 len=1689 path=[1:0-585 587:586-1688]

Length=1689
                                                                      Score     E

emb|CDP08509.1|  unnamed protein product                                619   0.0      
ref|XP_011088290.1|  PREDICTED: serine carboxypeptidase II-3-like       613   0.0      
ref|XP_011088747.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    603   0.0      
ref|XP_002281988.1|  PREDICTED: serine carboxypeptidase II-3-like       602   0.0      Vitis vinifera
ref|XP_011088748.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    600   0.0      
emb|CBI32446.3|  unnamed protein product                                597   0.0      
emb|CAN63486.1|  hypothetical protein VITISV_017087                     592   0.0      Vitis vinifera
emb|CDP19962.1|  unnamed protein product                                590   0.0      
ref|XP_011088288.1|  PREDICTED: serine carboxypeptidase II-3-like       580   0.0      
gb|EYU42662.1|  hypothetical protein MIMGU_mgv1a022120mg                579   0.0      
gb|EYU37705.1|  hypothetical protein MIMGU_mgv1a005479mg                577   0.0      
ref|XP_007017345.1|  Serine carboxypeptidase 40, putative               543   0.0      
ref|XP_006346531.1|  PREDICTED: serine carboxypeptidase II-3-like       535   0.0      
ref|XP_009801012.1|  PREDICTED: serine carboxypeptidase II-3-like       536   0.0      
ref|XP_006473888.1|  PREDICTED: serine carboxypeptidase-like 40-like    535   0.0      
ref|XP_009619884.1|  PREDICTED: serine carboxypeptidase 24-like         535   0.0      
emb|CDP08504.1|  unnamed protein product                                536   0.0      
ref|XP_004230806.1|  PREDICTED: serine carboxypeptidase II-3-like       533   0.0      
ref|XP_006423055.1|  hypothetical protein CICLE_v10028330mg             530   1e-180   
ref|XP_006346530.1|  PREDICTED: serine carboxypeptidase II-3-like       530   2e-180   
gb|KDO49122.1|  hypothetical protein CISIN_1g044068mg                   527   2e-179   
ref|XP_006346529.1|  PREDICTED: serine carboxypeptidase II-3-like       526   3e-179   
ref|XP_009794620.1|  PREDICTED: putative serine carboxypeptidase-...    528   3e-179   
ref|XP_010315498.1|  PREDICTED: serine carboxypeptidase II-3-like       527   4e-179   
ref|XP_010315499.1|  PREDICTED: serine carboxypeptidase II-3-like       525   5e-178   
ref|XP_010315500.1|  PREDICTED: serine carboxypeptidase II-3-like       523   1e-177   
ref|XP_010916829.1|  PREDICTED: serine carboxypeptidase II-3-like       511   2e-173   
gb|KDP38391.1|  hypothetical protein JCGZ_04316                         509   3e-172   
ref|XP_006346528.1|  PREDICTED: serine carboxypeptidase II-3-like       504   1e-169   
ref|XP_007224802.1|  hypothetical protein PRUPE_ppa023729mg             501   5e-169   
ref|XP_010664592.1|  PREDICTED: serine carboxypeptidase-like 40         498   6e-168   
ref|XP_009370169.1|  PREDICTED: serine carboxypeptidase II-3-like...    497   3e-167   
gb|KDO66312.1|  hypothetical protein CISIN_1g039871mg                   495   2e-166   
ref|XP_006470494.1|  PREDICTED: serine carboxypeptidase-like 40-like    495   2e-166   
ref|XP_009777076.1|  PREDICTED: putative serine carboxypeptidase-...    494   3e-166   
ref|XP_006354958.1|  PREDICTED: serine carboxypeptidase-like 40-like    493   1e-165   
ref|XP_010041326.1|  PREDICTED: serine carboxypeptidase II-3-like       492   2e-165   
gb|KCW66184.1|  hypothetical protein EUGRSUZ_F00022                     491   2e-165   
ref|XP_002282331.1|  PREDICTED: serine carboxypeptidase II-3-like       490   1e-164   Vitis vinifera
ref|XP_008220190.1|  PREDICTED: serine carboxypeptidase II-3-like       487   1e-163   
ref|XP_008813040.1|  PREDICTED: serine carboxypeptidase II-3-like       486   2e-163   
ref|XP_009607740.1|  PREDICTED: serine carboxypeptidase-like 40         484   4e-163   
ref|XP_004238587.1|  PREDICTED: putative serine carboxypeptidase-...    486   5e-163   
ref|XP_004292826.1|  PREDICTED: serine carboxypeptidase II-3-like       485   9e-163   
ref|XP_010098713.1|  Serine carboxypeptidase II-3                       481   3e-161   
ref|XP_008809533.1|  PREDICTED: putative serine carboxypeptidase-...    490   3e-161   
ref|XP_008813035.1|  PREDICTED: putative serine carboxypeptidase-...    478   4e-160   
ref|XP_004306277.1|  PREDICTED: serine carboxypeptidase II-3-like       478   5e-160   
ref|XP_009400122.1|  PREDICTED: serine carboxypeptidase II-3-like       476   4e-159   
emb|CBI19568.3|  unnamed protein product                                489   1e-157   
ref|XP_006473369.1|  PREDICTED: serine carboxypeptidase II-3-like       471   2e-157   
ref|XP_010932885.1|  PREDICTED: serine carboxypeptidase-like 40 i...    468   7e-157   
gb|KHN46300.1|  Serine carboxypeptidase II-3                            467   2e-156   
ref|XP_003544446.1|  PREDICTED: serine carboxypeptidase II-3-like...    469   2e-156   
ref|XP_010932884.1|  PREDICTED: putative serine carboxypeptidase-...    468   2e-156   
ref|XP_004502015.1|  PREDICTED: serine carboxypeptidase-like 40-like    468   5e-156   
gb|KHN12757.1|  Serine carboxypeptidase II-3                            466   5e-156   
ref|XP_006853073.1|  hypothetical protein AMTR_s00038p00085900          468   7e-156   
ref|XP_006434836.1|  hypothetical protein CICLE_v10000968mg             467   8e-156   
ref|XP_004292825.1|  PREDICTED: serine carboxypeptidase II-3-like       467   9e-156   
gb|AAT78819.1|  putative serine carboxypeptidase                        466   2e-155   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003592240.1|  Serine carboxypeptidase-like protein               466   2e-155   
ref|XP_011090479.1|  PREDICTED: serine carboxypeptidase II-3-like       466   3e-155   
ref|XP_006480243.1|  PREDICTED: serine carboxypeptidase II-3-like       465   5e-155   
ref|XP_006650145.1|  PREDICTED: serine carboxypeptidase II-3-like       465   7e-155   
ref|XP_006830191.1|  hypothetical protein AMTR_s00173p00045470          465   7e-155   
gb|KDO47634.1|  hypothetical protein CISIN_1g011108mg                   464   1e-154   
ref|XP_003601337.1|  Serine carboxypeptidase-like protein               464   2e-154   
ref|XP_007015556.1|  Serine carboxypeptidase II-3, expressed, put...    464   2e-154   
ref|XP_004984185.1|  PREDICTED: serine carboxypeptidase II-3-like...    462   7e-154   
ref|NP_001242872.1|  uncharacterized protein LOC100820473 precursor     462   1e-153   
ref|XP_006446687.1|  hypothetical protein CICLE_v10015024mg             461   1e-153   
emb|CDP01380.1|  unnamed protein product                                461   2e-153   
ref|XP_007160822.1|  hypothetical protein PHAVU_001G019500g             461   2e-153   
ref|XP_006470157.1|  PREDICTED: serine carboxypeptidase II-3-like...    461   3e-153   
ref|XP_006470156.1|  PREDICTED: serine carboxypeptidase II-3-like...    461   3e-153   
ref|XP_006438918.1|  hypothetical protein CICLE_v10031327mg             461   3e-153   
ref|XP_010685501.1|  PREDICTED: serine carboxypeptidase II-3-like       461   3e-153   
ref|XP_006482952.1|  PREDICTED: serine carboxypeptidase-like 40-like    461   3e-153   
gb|AES71588.2|  serine carboxypeptidase-like protein                    459   1e-152   
ref|XP_007146042.1|  hypothetical protein PHAVU_006G007800g             459   1e-152   
ref|NP_001148004.1|  serine carboxypeptidase precursor                  459   2e-152   Zea mays [maize]
gb|EEE59169.1|  hypothetical protein OsJ_11092                          458   3e-152   Oryza sativa Japonica Group [Japonica rice]
gb|EEC75382.1|  hypothetical protein OsI_11848                          457   6e-152   Oryza sativa Indica Group [Indian rice]
ref|XP_006593897.1|  PREDICTED: serine carboxypeptidase II-3-like       457   1e-151   
ref|XP_006578498.1|  PREDICTED: serine carboxypeptidase II-3-like       459   1e-151   
ref|XP_007017341.1|  Serine carboxypeptidase II-3 chain B isoform 1     456   2e-151   
gb|ABF96315.1|  Serine carboxypeptidase II-3 precursor, putative,...    456   2e-151   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003592242.1|  Serine carboxypeptidase-like protein               456   3e-151   
ref|XP_006595959.1|  PREDICTED: serine carboxypeptidase II-3-like...    456   5e-151   
ref|XP_003557804.1|  PREDICTED: serine carboxypeptidase 24-like         455   5e-151   
ref|XP_010279511.1|  PREDICTED: serine carboxypeptidase-like 40 i...    455   6e-151   
ref|XP_010279510.1|  PREDICTED: serine carboxypeptidase-like 40         455   6e-151   
gb|KHN05141.1|  Serine carboxypeptidase II-3                            453   4e-150   
ref|XP_007223971.1|  hypothetical protein PRUPE_ppa014620mg             455   4e-150   
ref|XP_003592237.1|  Serine carboxypeptidase II-3                       452   5e-150   
ref|XP_010279514.1|  PREDICTED: serine carboxypeptidase-like 40         452   8e-150   
ref|XP_007052442.1|  Serine carboxypeptidase-like 40                    453   2e-149   
gb|EYU35986.1|  hypothetical protein MIMGU_mgv1a026061mg                451   2e-149   
gb|AES59494.2|  serine carboxypeptidase-like protein                    451   2e-149   
ref|XP_003592239.1|  Serine carboxypeptidase-like protein               451   3e-149   
gb|AAQ63884.1|  putative serine carboxypeptidase                        451   3e-149   Medicago truncatula
ref|XP_003542323.2|  PREDICTED: serine carboxypeptidase-like 40-l...    450   4e-149   
ref|XP_006595329.1|  PREDICTED: serine carboxypeptidase II-3-like       450   5e-149   
ref|XP_004292824.1|  PREDICTED: serine carboxypeptidase II-3-like       450   5e-149   
ref|XP_003592238.1|  Serine carboxypeptidase II-3                       450   6e-149   
ref|XP_011008273.1|  PREDICTED: serine carboxypeptidase-like 40         450   7e-149   
ref|XP_002517751.1|  serine carboxypeptidase, putative                  450   8e-149   Ricinus communis
ref|XP_010067798.1|  PREDICTED: serine carboxypeptidase-like 40         449   2e-148   
ref|XP_009354385.1|  PREDICTED: serine carboxypeptidase-like 40         449   2e-148   
gb|KEH40059.1|  serine carboxypeptidase-like protein                    449   2e-148   
ref|XP_002314061.1|  hypothetical protein POPTR_0009s06080g             449   2e-148   Populus trichocarpa [western balsam poplar]
ref|XP_011091773.1|  PREDICTED: serine carboxypeptidase-like 40         448   3e-148   
ref|XP_004984183.1|  PREDICTED: serine carboxypeptidase II-3-like...    449   5e-148   
ref|XP_011025504.1|  PREDICTED: serine carboxypeptidase-like 40 i...    447   5e-148   
emb|CDP08507.1|  unnamed protein product                                441   9e-148   
gb|AES71590.2|  serine carboxypeptidase-like protein                    446   2e-147   
ref|XP_010938742.1|  PREDICTED: serine carboxypeptidase II-3-like       445   4e-147   
gb|KHN35601.1|  Serine carboxypeptidase II-3                            445   4e-147   
ref|XP_003589243.1|  Serine carboxypeptidase II-3                       444   7e-147   
ref|XP_010103278.1|  Serine carboxypeptidase-like 40                    445   7e-147   
ref|XP_004303115.1|  PREDICTED: serine carboxypeptidase-like 40-like    444   9e-147   
gb|KDP43605.1|  hypothetical protein JCGZ_16892                         444   1e-146   
gb|KHG12237.1|  Serine carboxypeptidase-like 40                         444   1e-146   
ref|XP_010938507.1|  PREDICTED: serine carboxypeptidase II-3-like...    443   2e-146   
ref|XP_008363303.1|  PREDICTED: serine carboxypeptidase-like 40         443   2e-146   
ref|XP_008393840.1|  PREDICTED: serine carboxypeptidase II-3-like       442   3e-146   
ref|XP_003599510.1|  Serine carboxypeptidase-like protein               442   4e-146   
gb|KHN30516.1|  Serine carboxypeptidase-like 40                         442   6e-146   
ref|XP_010068957.1|  PREDICTED: serine carboxypeptidase-like 40         445   7e-146   
ref|XP_009367487.1|  PREDICTED: serine carboxypeptidase II-3-like       442   8e-146   
ref|XP_009370170.1|  PREDICTED: serine carboxypeptidase II-3-like...    441   1e-145   
gb|KHG19786.1|  Serine carboxypeptidase-like 40                         441   1e-145   
ref|XP_002298413.2|  putative serine carboxypeptidase family protein    441   1e-145   Populus trichocarpa [western balsam poplar]
emb|CDP16362.1|  unnamed protein product                                441   2e-145   
ref|XP_008800209.1|  PREDICTED: serine carboxypeptidase II-3-like       441   2e-145   
ref|XP_003592243.1|  Serine carboxypeptidase II-3                       440   5e-145   
gb|EMT20722.1|  Serine carboxypeptidase II-3                            440   7e-145   
ref|XP_009399958.1|  PREDICTED: serine carboxypeptidase II-3-like       439   7e-145   
ref|XP_007219043.1|  hypothetical protein PRUPE_ppa004618mg             439   8e-145   
emb|CDP16361.1|  unnamed protein product                                438   2e-144   
ref|XP_010067792.1|  PREDICTED: serine carboxypeptidase-like 40         438   2e-144   
ref|XP_002517750.1|  serine carboxypeptidase, putative                  437   6e-144   Ricinus communis
ref|XP_009391583.1|  PREDICTED: serine carboxypeptidase II-3            437   7e-144   
gb|EMT05424.1|  Serine carboxypeptidase II-3                            437   9e-144   
ref|XP_008783277.1|  PREDICTED: serine carboxypeptidase II-3-like       437   9e-144   
emb|CDP16360.1|  unnamed protein product                                436   2e-143   
ref|XP_009368057.1|  PREDICTED: serine carboxypeptidase-like 40         436   2e-143   
emb|CDP16351.1|  unnamed protein product                                435   3e-143   
ref|NP_001060508.1|  Os07g0656900                                       433   3e-143   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008802653.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    435   3e-143   
ref|XP_003557803.1|  PREDICTED: serine carboxypeptidase-like 27         435   3e-143   
ref|XP_010067796.1|  PREDICTED: serine carboxypeptidase-like 40 i...    435   4e-143   
ref|XP_007224867.1|  hypothetical protein PRUPE_ppa022742mg             434   4e-143   
ref|XP_009392029.1|  PREDICTED: putative serine carboxypeptidase-...    436   4e-143   
ref|XP_002272961.1|  PREDICTED: serine carboxypeptidase-like 40 i...    435   5e-143   Vitis vinifera
dbj|BAC16131.1|  putative serine carboxypeptidase II-3 precursor        436   5e-143   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK01526.1|  predicted protein                                      435   6e-143   
ref|NP_001050257.1|  Os03g0386800                                       433   6e-143   Oryza sativa Japonica Group [Japonica rice]
gb|AAT78817.1|  putative serine carboxypeptidase                        434   8e-143   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009592799.1|  PREDICTED: serine carboxypeptidase-like 40         438   1e-142   
gb|AES59495.2|  serine carboxypeptidase-like protein                    434   1e-142   
ref|XP_008783276.1|  PREDICTED: serine carboxypeptidase II-3-like       433   1e-142   
dbj|BAJ94105.1|  predicted protein                                      434   2e-142   
ref|XP_011025637.1|  PREDICTED: serine carboxypeptidase-like 40         432   8e-142   
emb|CDP18508.1|  unnamed protein product                                429   1e-141   
ref|XP_008658699.1|  PREDICTED: lysosomal protective protein isof...    431   2e-141   
ref|XP_008231545.1|  PREDICTED: serine carboxypeptidase-like 40         431   2e-141   
emb|CDP16358.1|  unnamed protein product                                430   3e-141   
emb|CDP16356.1|  unnamed protein product                                430   3e-141   
ref|XP_002271490.3|  PREDICTED: serine carboxypeptidase-like 40 i...    430   3e-141   Vitis vinifera
ref|XP_008231546.1|  PREDICTED: serine carboxypeptidase-like 40         429   5e-141   
sp|P52711.1|CBP23_HORVU  RecName: Full=Serine carboxypeptidase II...    430   6e-141   Hordeum vulgare [barley]
ref|XP_008220189.1|  PREDICTED: serine carboxypeptidase II-3-like       429   7e-141   
ref|XP_004984181.1|  PREDICTED: serine carboxypeptidase-like 26-l...    429   7e-141   
ref|XP_004499088.1|  PREDICTED: serine carboxypeptidase II-3-like...    429   8e-141   
ref|XP_004514571.1|  PREDICTED: serine carboxypeptidase-like 40-like    429   8e-141   
ref|XP_004984182.1|  PREDICTED: serine carboxypeptidase-like 26-l...    429   1e-140   
ref|XP_009777002.1|  PREDICTED: serine carboxypeptidase-like 40         428   1e-140   
ref|XP_004231125.1|  PREDICTED: serine carboxypeptidase-like 40 i...    428   2e-140   
gb|KHG24370.1|  Serine carboxypeptidase II-3                            427   2e-140   
ref|XP_003559864.1|  PREDICTED: serine carboxypeptidase II-3-like       428   3e-140   
ref|XP_002314060.2|  hypothetical protein POPTR_0009s06090g             427   4e-140   Populus trichocarpa [western balsam poplar]
ref|XP_002463311.1|  hypothetical protein SORBIDRAFT_02g041610          427   7e-140   Sorghum bicolor [broomcorn]
ref|XP_010261659.1|  PREDICTED: serine carboxypeptidase-like 40         426   9e-140   
emb|CAC19488.1|  putative serine carboxypeptidase                       426   9e-140   Pisum sativum [garden pea]
gb|AES71591.2|  serine carboxypeptidase-like protein                    426   1e-139   
emb|CDP01379.1|  unnamed protein product                                425   2e-139   
ref|NP_001151412.1|  lysosomal protective protein precursor             425   2e-139   Zea mays [maize]
ref|XP_002467770.1|  hypothetical protein SORBIDRAFT_01g033770          425   3e-139   Sorghum bicolor [broomcorn]
emb|CDP16350.1|  unnamed protein product                                425   3e-139   
ref|XP_006345489.1|  PREDICTED: serine carboxypeptidase-like 40-like    424   4e-139   
ref|XP_010659210.1|  PREDICTED: serine carboxypeptidase-like 40 i...    425   4e-139   
ref|XP_006658912.1|  PREDICTED: serine carboxypeptidase II-3-like       423   6e-139   
ref|XP_010067794.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    422   6e-139   
ref|XP_009792171.1|  PREDICTED: serine carboxypeptidase-like 40         424   7e-139   
ref|XP_010324807.1|  PREDICTED: serine carboxypeptidase-like 40 i...    424   8e-139   
ref|XP_010279512.1|  PREDICTED: serine carboxypeptidase-like 40 i...    423   1e-138   
ref|XP_010932886.1|  PREDICTED: serine carboxypeptidase-like 40 i...    420   1e-138   
ref|XP_004135951.1|  PREDICTED: serine carboxypeptidase-like 40-like    424   1e-138   
ref|XP_009601275.1|  PREDICTED: serine carboxypeptidase-like 40         423   1e-138   
ref|NP_191906.1|  serine carboxypeptidase-like 40                       423   2e-138   Arabidopsis thaliana [mouse-ear cress]
gb|EEC75383.1|  hypothetical protein OsI_11849                          420   2e-138   Oryza sativa Indica Group [Indian rice]
gb|EEE59170.1|  hypothetical protein OsJ_11093                          420   3e-138   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008461353.1|  PREDICTED: serine carboxypeptidase-like 40         423   3e-138   
ref|XP_006345490.1|  PREDICTED: serine carboxypeptidase-like 40-like    422   3e-138   
gb|KHN11708.1|  Serine carboxypeptidase-like 40                         422   5e-138   
ref|XP_004499087.1|  PREDICTED: serine carboxypeptidase II-3-like...    422   6e-138   
ref|XP_003534383.1|  PREDICTED: serine carboxypeptidase-like 40-l...    421   7e-138   
ref|XP_006345491.1|  PREDICTED: serine carboxypeptidase-like 40-like    421   2e-137   
ref|XP_004229672.1|  PREDICTED: serine carboxypeptidase-like 40         420   2e-137   
ref|XP_003539875.1|  PREDICTED: serine carboxypeptidase-like 40-like    419   9e-137   
gb|KHN32398.1|  Serine carboxypeptidase-like 40                         418   1e-136   
ref|XP_010694765.1|  PREDICTED: serine carboxypeptidase-like 40         419   2e-136   
ref|XP_007204505.1|  hypothetical protein PRUPE_ppa019210mg             416   2e-136   
ref|XP_003589244.1|  Serine carboxypeptidase II-3                       418   2e-136   
ref|XP_002876724.1|  hypothetical protein ARALYDRAFT_486857             418   2e-136   
gb|KCW66001.1|  hypothetical protein EUGRSUZ_G03291                     416   2e-136   
ref|XP_006345492.1|  PREDICTED: serine carboxypeptidase-like 40-like    422   3e-136   
ref|XP_007015558.1|  Serine carboxypeptidase-like 40, putative is...    415   3e-136   
emb|CBI28593.3|  unnamed protein product                                432   3e-136   
gb|ACN29008.1|  unknown                                                 418   4e-136   Zea mays [maize]
ref|XP_007015557.1|  Serine carboxypeptidase-like 40, putative is...    415   4e-136   
ref|NP_001132061.1|  uncharacterized protein LOC100193473               414   5e-136   Zea mays [maize]
ref|XP_002273192.3|  PREDICTED: serine carboxypeptidase-like 40         416   7e-136   Vitis vinifera
ref|NP_001147904.1|  serine carboxypeptidase 1 precursor                417   8e-136   Zea mays [maize]
ref|XP_004499086.1|  PREDICTED: serine carboxypeptidase II-3-like...    417   8e-136   
gb|KEH17668.1|  serine carboxypeptidase-like protein                    416   9e-136   
ref|XP_004231124.2|  PREDICTED: serine carboxypeptidase-like 40         417   1e-135   
gb|KFK35499.1|  hypothetical protein AALP_AA5G292700                    416   1e-135   
emb|CBI28591.3|  unnamed protein product                                416   2e-135   
ref|XP_010920885.1|  PREDICTED: serine carboxypeptidase-like 27         416   2e-135   
gb|KHG25905.1|  Serine carboxypeptidase-like 27                         414   2e-135   
ref|XP_004288721.1|  PREDICTED: serine carboxypeptidase 24-like         413   3e-135   
ref|XP_008337089.1|  PREDICTED: serine carboxypeptidase II-3-like       410   3e-135   
gb|ABR16997.1|  unknown                                                 416   3e-135   Picea sitchensis
ref|XP_003552566.1|  PREDICTED: serine carboxypeptidase-like 25-l...    413   5e-135   
ref|XP_006292523.1|  hypothetical protein CARUB_v10018754mg             412   6e-135   
ref|XP_010906017.1|  PREDICTED: serine carboxypeptidase II-3-like       413   9e-135   
ref|XP_010067795.1|  PREDICTED: serine carboxypeptidase-like 40         413   1e-134   
ref|XP_011008261.1|  PREDICTED: serine carboxypeptidase-like 40         413   1e-134   
ref|XP_002529402.1|  serine carboxypeptidase, putative                  412   1e-134   Ricinus communis
ref|XP_006402270.1|  hypothetical protein EUTSA_v10005912mg             413   2e-134   
ref|XP_008243007.1|  PREDICTED: serine carboxypeptidase 24              411   2e-134   
gb|KHN41581.1|  Serine carboxypeptidase-like 25                         410   3e-134   
gb|KHN13554.1|  Serine carboxypeptidase-like 25                         410   4e-134   
ref|XP_010512774.1|  PREDICTED: serine carboxypeptidase-like 40 i...    412   6e-134   
ref|XP_004229673.1|  PREDICTED: serine carboxypeptidase-like 40         411   7e-134   
ref|XP_006345395.1|  PREDICTED: serine carboxypeptidase-like 40-like    411   9e-134   
gb|EEC69980.1|  hypothetical protein OsI_00486                          410   1e-133   Oryza sativa Indica Group [Indian rice]
ref|NP_001042076.1|  Os01g0158200                                       409   1e-133   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010545119.1|  PREDICTED: serine carboxypeptidase-like 40         410   1e-133   
gb|KEH21654.1|  serine carboxypeptidase-like protein                    409   2e-133   
ref|XP_011025505.1|  PREDICTED: serine carboxypeptidase-like 40 i...    408   2e-133   
ref|XP_004499085.1|  PREDICTED: serine carboxypeptidase II-3-like...    411   2e-133   
ref|XP_010265559.1|  PREDICTED: serine carboxypeptidase 24-like i...    408   3e-133   
ref|XP_010068958.1|  PREDICTED: serine carboxypeptidase-like 40         409   3e-133   
gb|KCW66005.1|  hypothetical protein EUGRSUZ_G03296                     408   4e-133   
ref|XP_010468839.1|  PREDICTED: serine carboxypeptidase-like 40         409   6e-133   
ref|XP_009592794.1|  PREDICTED: serine carboxypeptidase-like 40         409   7e-133   
ref|XP_004142401.1|  PREDICTED: serine carboxypeptidase-like 27-like    407   7e-133   
dbj|BAB08188.1|  unnamed protein product                                408   8e-133   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003530438.1|  PREDICTED: serine carboxypeptidase-like 25-l...    407   9e-133   
ref|XP_010068962.1|  PREDICTED: serine carboxypeptidase-like 40         408   9e-133   
ref|XP_010068956.1|  PREDICTED: serine carboxypeptidase-like 40         408   1e-132   
gb|ACN26414.1|  unknown                                                 409   1e-132   Zea mays [maize]
ref|XP_007131400.1|  hypothetical protein PHAVU_011G010600g             408   1e-132   
ref|NP_001147829.1|  LOC100281439 precursor                             409   1e-132   Zea mays [maize]
ref|XP_010047069.1|  PREDICTED: serine carboxypeptidase 24-like         406   2e-132   
gb|KHG08205.1|  Serine carboxypeptidase-like 27                         406   2e-132   
ref|XP_009358427.1|  PREDICTED: serine carboxypeptidase 24              407   2e-132   
ref|XP_008394313.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    407   2e-132   
ref|XP_006453596.1|  hypothetical protein CICLE_v10008182mg             406   2e-132   
ref|XP_010413138.1|  PREDICTED: serine carboxypeptidase-like 40         408   3e-132   
ref|XP_002312024.1|  serine carboxypeptidase S10 family protein         405   4e-132   Populus trichocarpa [western balsam poplar]
gb|KHG16869.1|  Serine carboxypeptidase-like 25                         406   4e-132   
ref|XP_010067819.1|  PREDICTED: serine carboxypeptidase-like 40         406   5e-132   
ref|XP_006297594.1|  hypothetical protein CARUB_v10013616mg             405   5e-132   
ref|XP_010264739.1|  PREDICTED: serine carboxypeptidase-like 27         405   5e-132   
ref|XP_011031767.1|  PREDICTED: serine carboxypeptidase-like 27         405   6e-132   
ref|XP_006474013.1|  PREDICTED: serine carboxypeptidase 24-like         405   1e-131   
tpg|DAA41639.1|  TPA: serine carboxypeptidase 1                         408   1e-131   
ref|XP_008446902.1|  PREDICTED: serine carboxypeptidase-like 27         404   1e-131   
gb|KCW66006.1|  hypothetical protein EUGRSUZ_G03299                     407   1e-131   
ref|XP_007139483.1|  hypothetical protein PHAVU_008G033300g             404   1e-131   
dbj|BAD33942.1|  putative serine carboxypeptidase precursor             405   2e-131   
gb|EEE67734.1|  hypothetical protein OsJ_25423                          405   2e-131   
ref|XP_009414289.1|  PREDICTED: serine carboxypeptidase-like 27         404   2e-131   
ref|XP_006408447.1|  hypothetical protein EUTSA_v10020652mg             404   3e-131   
ref|XP_006850617.1|  hypothetical protein AMTR_s00034p00161680          403   3e-131   
gb|ABR16596.1|  unknown                                                 405   4e-131   
ref|XP_011040963.1|  PREDICTED: serine carboxypeptidase-like 27         403   4e-131   
ref|XP_011076996.1|  PREDICTED: serine carboxypeptidase-like 27         402   5e-131   
ref|XP_010485446.1|  PREDICTED: serine carboxypeptidase-like 25         403   5e-131   
ref|XP_010463602.1|  PREDICTED: serine carboxypeptidase-like 25         403   6e-131   
ref|XP_008789080.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    402   7e-131   
ref|XP_010937832.1|  PREDICTED: serine carboxypeptidase-like 27         402   8e-131   
ref|XP_007032748.1|  Serine carboxypeptidase-like 25 isoform 1          404   8e-131   
gb|EMS68142.1|  Serine carboxypeptidase-like 40                         406   9e-131   
gb|KDP25725.1|  hypothetical protein JCGZ_23946                         402   1e-130   
ref|XP_007216267.1|  hypothetical protein PRUPE_ppa017321mg             402   1e-130   
ref|XP_002315292.2|  serine carboxypeptidase S10 family protein         401   1e-130   
ref|XP_010253608.1|  PREDICTED: serine carboxypeptidase-like 27         401   1e-130   
gb|AAM65698.1|  putative serine carboxypeptidase II                     401   2e-130   
ref|XP_008233341.1|  PREDICTED: serine carboxypeptidase-like 27         401   2e-130   
gb|KCW66002.1|  hypothetical protein EUGRSUZ_G03292                     400   2e-130   
ref|NP_186860.1|  serine carboxypeptidase-like 25                       401   2e-130   
dbj|BAO04184.1|  hypothetical protein                                   400   3e-130   
ref|XP_007032749.1|  Serine carboxypeptidase-like 25 isoform 2          401   3e-130   
ref|XP_010258045.1|  PREDICTED: serine carboxypeptidase-like 25         401   3e-130   
ref|XP_003591950.1|  Serine carboxypeptidase-like protein               400   3e-130   
emb|CBI32445.3|  unnamed protein product                                399   3e-130   
emb|CDY43258.1|  BnaC05g48510D                                          401   3e-130   
emb|CDY39224.1|  BnaA03g50360D                                          400   3e-130   
ref|XP_006661322.1|  PREDICTED: serine carboxypeptidase II-3-like       401   3e-130   
ref|XP_002462503.1|  hypothetical protein SORBIDRAFT_02g026870          402   4e-130   
ref|XP_011033395.1|  PREDICTED: serine carboxypeptidase 24-like         400   5e-130   
ref|XP_010548637.1|  PREDICTED: serine carboxypeptidase 24              400   5e-130   
ref|XP_009137947.1|  PREDICTED: serine carboxypeptidase 24              400   5e-130   
ref|XP_004489523.1|  PREDICTED: serine carboxypeptidase-like 25-like    400   6e-130   
ref|XP_003548016.1|  PREDICTED: serine carboxypeptidase-like 27-like    400   8e-130   
gb|ACG38162.1|  serine carboxypeptidase K10B2.2 precursor               399   9e-130   
ref|XP_008654560.1|  PREDICTED: uncharacterized protein LOC100273...    399   9e-130   
emb|CBI21207.3|  unnamed protein product                                400   9e-130   
ref|XP_004146676.1|  PREDICTED: serine carboxypeptidase 24-like         400   9e-130   
ref|XP_002280058.1|  PREDICTED: serine carboxypeptidase-like 25         400   1e-129   
ref|XP_002285022.1|  PREDICTED: putative serine carboxypeptidase-...    400   1e-129   
ref|XP_004161865.1|  PREDICTED: serine carboxypeptidase 24-like         400   1e-129   
ref|XP_009631140.1|  PREDICTED: serine carboxypeptidase 24-like         399   1e-129   
gb|AAO72592.1|  serine carboxypepsidase                                 399   1e-129   
ref|XP_002960751.1|  serine carboxypeptidase-like enzyme                399   1e-129   
ref|XP_008443849.1|  PREDICTED: serine carboxypeptidase 24-like i...    399   1e-129   
ref|XP_008460255.1|  PREDICTED: serine carboxypeptidase-like 25 i...    399   1e-129   
ref|XP_010445019.1|  PREDICTED: serine carboxypeptidase-like 25         399   1e-129   
ref|XP_009792407.1|  PREDICTED: serine carboxypeptidase 24-like         399   2e-129   
gb|ACF79757.1|  unknown                                                 399   2e-129   
ref|XP_003549539.1|  PREDICTED: serine carboxypeptidase 24-like         399   2e-129   
ref|XP_010551814.1|  PREDICTED: serine carboxypeptidase-like 25 i...    399   2e-129   
ref|XP_002308408.1|  BRI1 SUPPRESSOR 1 family protein                   399   2e-129   
gb|AFK37459.1|  unknown                                                 399   2e-129   
gb|EMT31261.1|  Serine carboxypeptidase II-3                            399   3e-129   
gb|KFK29637.1|  hypothetical protein AALP_AA7G159500                    398   3e-129   
ref|XP_006350225.1|  PREDICTED: serine carboxypeptidase-like 27-like    398   3e-129   
gb|KDO48447.1|  hypothetical protein CISIN_1g012819mg                   397   4e-129   
ref|XP_003591949.1|  Serine carboxypeptidase-like protein               398   4e-129   
ref|XP_010089631.1|  Serine carboxypeptidase-like 25                    398   4e-129   
ref|XP_002983919.1|  serine carboxypeptidase-like enzyme                397   4e-129   
ref|XP_003519151.1|  PREDICTED: serine carboxypeptidase 24-like i...    398   4e-129   
ref|XP_010551812.1|  PREDICTED: serine carboxypeptidase-like 25 i...    398   4e-129   
ref|XP_009420309.1|  PREDICTED: serine carboxypeptidase 24-like         398   4e-129   
ref|XP_006343642.1|  PREDICTED: serine carboxypeptidase 24-like         398   5e-129   
emb|CDO99730.1|  unnamed protein product                                397   5e-129   
ref|XP_002884303.1|  hypothetical protein ARALYDRAFT_477440             398   5e-129   
ref|XP_006589433.1|  PREDICTED: serine carboxypeptidase-like 27-like    397   6e-129   
ref|XP_010908844.1|  PREDICTED: serine carboxypeptidase-like 27         397   6e-129   
ref|XP_003556225.1|  PREDICTED: serine carboxypeptidase-like 27-l...    397   8e-129   
ref|XP_008443851.1|  PREDICTED: serine carboxypeptidase 24-like i...    397   9e-129   
ref|XP_009365880.1|  PREDICTED: serine carboxypeptidase-like 25         397   9e-129   
ref|XP_008443850.1|  PREDICTED: serine carboxypeptidase 24-like i...    397   1e-128   
ref|XP_003576614.1|  PREDICTED: serine carboxypeptidase II-3-like       397   1e-128   
gb|AFK43035.1|  unknown                                                 396   1e-128   
ref|XP_007011905.1|  Alpha/beta-Hydrolases superfamily protein          396   2e-128   
dbj|BAK02399.1|  predicted protein                                      396   2e-128   
ref|XP_011009401.1|  PREDICTED: serine carboxypeptidase-like 25 i...    396   2e-128   
ref|XP_011018040.1|  PREDICTED: serine carboxypeptidase 24-like i...    396   2e-128   
ref|XP_010669644.1|  PREDICTED: serine carboxypeptidase-like 27         395   2e-128   
emb|CDP10248.1|  unnamed protein product                                395   3e-128   
gb|KHN42831.1|  Serine carboxypeptidase 24                              395   3e-128   
ref|XP_002274723.1|  PREDICTED: serine carboxypeptidase-like 27         395   3e-128   
ref|XP_002275684.1|  PREDICTED: serine carboxypeptidase 24 isofor...    395   4e-128   
ref|XP_010273635.1|  PREDICTED: serine carboxypeptidase 24-like         395   4e-128   
ref|XP_010549997.1|  PREDICTED: serine carboxypeptidase-like 25         395   4e-128   
ref|XP_011098746.1|  PREDICTED: serine carboxypeptidase-like 25         395   4e-128   
gb|KCW65386.1|  hypothetical protein EUGRSUZ_G02816                     395   4e-128   
ref|XP_010032541.1|  PREDICTED: serine carboxypeptidase-like 25         397   4e-128   
ref|XP_002457307.1|  hypothetical protein SORBIDRAFT_03g005360          395   4e-128   
ref|XP_009386999.1|  PREDICTED: serine carboxypeptidase-like 27         395   4e-128   
ref|XP_004959513.1|  PREDICTED: serine carboxypeptidase-like 40-like    396   5e-128   
tpg|DAA61817.1|  TPA: hypothetical protein ZEAMMB73_814931              397   5e-128   
ref|XP_009147382.1|  PREDICTED: serine carboxypeptidase-like 25         395   6e-128   
ref|XP_003576701.1|  PREDICTED: putative serine carboxypeptidase-...    396   6e-128   
ref|XP_010260044.1|  PREDICTED: serine carboxypeptidase-like 25 i...    395   6e-128   
ref|XP_010239387.1|  PREDICTED: putative serine carboxypeptidase-...    396   6e-128   
ref|XP_009104963.1|  PREDICTED: serine carboxypeptidase-like 40         396   7e-128   
emb|CAN74854.1|  hypothetical protein VITISV_028701                     394   7e-128   
ref|XP_004236634.1|  PREDICTED: serine carboxypeptidase-like 27         394   7e-128   
ref|XP_004304228.1|  PREDICTED: serine carboxypeptidase-like 25-like    395   8e-128   
ref|XP_008652807.1|  PREDICTED: serine carboxypeptidase-like 26         396   9e-128   
ref|XP_009794618.1|  PREDICTED: serine carboxypeptidase-like 26         395   9e-128   
sp|O82229.2|SCP23_ARATH  RecName: Full=Putative serine carboxypep...    394   1e-127   
ref|XP_008357779.1|  PREDICTED: serine carboxypeptidase-like 25 i...    395   1e-127   
gb|KHG14577.1|  Serine carboxypeptidase 24 -like protein                394   1e-127   
ref|XP_009590317.1|  PREDICTED: serine carboxypeptidase-like 26         395   1e-127   
ref|XP_004496292.1|  PREDICTED: serine carboxypeptidase-like 27-l...    394   1e-127   
gb|KHN17121.1|  Serine carboxypeptidase-like 27                         394   1e-127   
gb|KHN13367.1|  Serine carboxypeptidase-like 27                         395   2e-127   
ref|XP_004137284.1|  PREDICTED: serine carboxypeptidase-like 25-like    394   2e-127   
ref|XP_009410194.1|  PREDICTED: serine carboxypeptidase II-2-like       394   2e-127   
ref|XP_009141519.1|  PREDICTED: serine carboxypeptidase-like 26         393   2e-127   
ref|XP_010067290.1|  PREDICTED: serine carboxypeptidase-like 27         395   2e-127   
ref|XP_002306020.2|  serine carboxypeptidase S10 family protein         393   3e-127   
ref|XP_010432963.1|  PREDICTED: serine carboxypeptidase 24 isofor...    393   4e-127   
ref|XP_009802382.1|  PREDICTED: serine carboxypeptidase-like 27         392   4e-127   
ref|XP_009378094.1|  PREDICTED: serine carboxypeptidase-like 27         392   5e-127   
ref|XP_010447693.1|  PREDICTED: serine carboxypeptidase 24-like         392   5e-127   
ref|XP_003566409.1|  PREDICTED: serine carboxypeptidase II-1            392   5e-127   
ref|XP_006436271.1|  hypothetical protein CICLE_v10031497mg             392   6e-127   
ref|XP_009596929.1|  PREDICTED: serine carboxypeptidase-like 25         392   7e-127   
gb|AAK44013.1|AF370198_1  putative serine carboxypeptidase II           392   7e-127   
ref|XP_006285794.1|  hypothetical protein CARUB_v10007268mg             392   7e-127   
ref|XP_011079399.1|  PREDICTED: serine carboxypeptidase 24              392   7e-127   
gb|KDP43593.1|  hypothetical protein JCGZ_16880                         388   7e-127   
gb|AAC63669.1|  putative serine carboxypeptidase II                     390   8e-127   
gb|KDP31724.1|  hypothetical protein JCGZ_14937                         390   9e-127   
ref|XP_006338367.1|  PREDICTED: serine carboxypeptidase-like 25-like    392   9e-127   
ref|XP_006412682.1|  hypothetical protein EUTSA_v10025119mg             392   9e-127   
emb|CDY40438.1|  BnaA04g20790D                                          391   1e-126   
ref|XP_002869369.1|  hypothetical protein ARALYDRAFT_491690             392   1e-126   
gb|EPS67928.1|  hypothetical protein M569_06845                         391   1e-126   
ref|NP_194790.1|  serine carboxypeptidase 24                            391   2e-126   
ref|XP_006474032.1|  PREDICTED: serine carboxypeptidase-like 29-like    391   2e-126   
ref|XP_009592854.1|  PREDICTED: serine carboxypeptidase-like 27         390   2e-126   
ref|XP_009333715.1|  PREDICTED: serine carboxypeptidase-like 27         390   2e-126   
emb|CDM82076.1|  unnamed protein product                                392   2e-126   
ref|XP_004959517.1|  PREDICTED: serine carboxypeptidase II-3-like       392   2e-126   
ref|XP_011000079.1|  PREDICTED: serine carboxypeptidase-like 25         391   2e-126   
emb|CDP02317.1|  unnamed protein product                                391   3e-126   
ref|XP_002324116.2|  serine carboxypeptidase S10 family protein         391   3e-126   
ref|XP_009410600.1|  PREDICTED: serine carboxypeptidase-like 27 i...    390   3e-126   
gb|KDP38717.1|  hypothetical protein JCGZ_04070                         391   3e-126   
ref|XP_004307399.1|  PREDICTED: serine carboxypeptidase-like 27-like    390   3e-126   
ref|XP_009410601.1|  PREDICTED: serine carboxypeptidase-like 27 i...    390   3e-126   
ref|XP_002457308.1|  hypothetical protein SORBIDRAFT_03g005370          390   4e-126   
emb|CDM82001.1|  unnamed protein product                                390   4e-126   
gb|KDO84298.1|  hypothetical protein CISIN_1g0114692mg                  386   4e-126   
gb|KDO84299.1|  hypothetical protein CISIN_1g0114692mg                  386   4e-126   
gb|KDP27243.1|  hypothetical protein JCGZ_19942                         390   4e-126   
ref|XP_004968264.1|  PREDICTED: serine carboxypeptidase-like 27-like    390   4e-126   
ref|XP_002528403.1|  serine carboxypeptidase, putative                  390   5e-126   
emb|CDY32091.1|  BnaC04g44750D                                          389   6e-126   
ref|XP_008805039.1|  PREDICTED: serine carboxypeptidase-like 27         390   6e-126   
ref|XP_008381976.1|  PREDICTED: serine carboxypeptidase-like 27         389   6e-126   
ref|XP_010547376.1|  PREDICTED: serine carboxypeptidase-like 27         389   6e-126   
ref|XP_004242603.2|  PREDICTED: serine carboxypeptidase 24 isofor...    390   6e-126   
ref|XP_004232164.1|  PREDICTED: serine carboxypeptidase-like 25         389   8e-126   
ref|XP_007143689.1|  hypothetical protein PHAVU_007G093300g             389   9e-126   
ref|XP_008652806.1|  PREDICTED: serine carboxypeptidase II-3-like       390   1e-125   
gb|KDO84297.1|  hypothetical protein CISIN_1g0114692mg                  386   1e-125   
gb|KDO83297.1|  hypothetical protein CISIN_1g015244mg                   387   1e-125   
ref|XP_007009787.1|  Serine carboxypeptidase-like 27 isoform 1          392   1e-125   
gb|KHG11306.1|  Serine carboxypeptidase-like 29                         390   1e-125   
ref|XP_006845380.1|  hypothetical protein AMTR_s00019p00043630          389   1e-125   
ref|XP_006453577.1|  hypothetical protein CICLE_v10008112mg             389   1e-125   
ref|XP_009771074.1|  PREDICTED: serine carboxypeptidase-like 25         389   1e-125   
ref|XP_011083949.1|  PREDICTED: serine carboxypeptidase 24-like i...    388   2e-125   
gb|KFK37671.1|  hypothetical protein AALP_AA3G013500                    389   2e-125   
ref|XP_010108549.1|  Serine carboxypeptidase 24                         389   2e-125   
ref|XP_008368824.1|  PREDICTED: serine carboxypeptidase-like 27         388   2e-125   
ref|NP_001150676.1|  serine carboxypeptidase K10B2.2 precursor          389   3e-125   
ref|XP_008670270.1|  PREDICTED: serine carboxypeptidase II-3-like       386   3e-125   
gb|ACA61621.1|  hypothetical protein AP7_B10.1                          387   4e-125   
ref|XP_002881414.1|  hypothetical protein ARALYDRAFT_482550             387   4e-125   
ref|XP_004307401.1|  PREDICTED: serine carboxypeptidase-like 27-like    387   5e-125   
emb|CDP08505.1|  unnamed protein product                                386   7e-125   
ref|XP_002324616.2|  hypothetical protein POPTR_0018s11210g             387   8e-125   
tpg|DAA53384.1|  TPA: serine carboxypeptidase K10B2.2                   387   9e-125   
ref|XP_010273729.1|  PREDICTED: serine carboxypeptidase II-2            387   1e-124   
ref|XP_008243035.1|  PREDICTED: serine carboxypeptidase II-2            387   1e-124   
ref|XP_009399563.1|  PREDICTED: serine carboxypeptidase 24-like         386   1e-124   
gb|EMT04246.1|  Serine carboxypeptidase-like 40                         384   2e-124   
gb|EYU44197.1|  hypothetical protein MIMGU_mgv1a005600mg                386   2e-124   
ref|XP_008670269.1|  PREDICTED: serine carboxypeptidase-like 28         387   2e-124   
gb|KFK32686.1|  hypothetical protein AALP_AA6G275800                    386   2e-124   
ref|XP_009117259.1|  PREDICTED: serine carboxypeptidase-like 22         385   2e-124   
ref|XP_010429355.1|  PREDICTED: putative serine carboxypeptidase-...    385   3e-124   
ref|XP_008357780.1|  PREDICTED: serine carboxypeptidase-like 25 i...    385   3e-124   
ref|XP_010906016.1|  PREDICTED: serine carboxypeptidase II-3-like       386   3e-124   
ref|XP_010460785.1|  PREDICTED: serine carboxypeptidase-like 27         385   4e-124   
ref|NP_179979.4|  serine carboxypeptidase-like 23                       384   4e-124   
ref|XP_002312023.1|  hypothetical protein POPTR_0008s04130g             385   4e-124   
gb|AES62200.2|  serine carboxypeptidase-like protein                    386   4e-124   
emb|CDO99728.1|  unnamed protein product                                385   5e-124   
gb|EYU34325.1|  hypothetical protein MIMGU_mgv1a005646mg                385   6e-124   
dbj|BAD33945.1|  putative serine carboxypeptidase precursor             386   6e-124   
gb|KFK38250.1|  hypothetical protein AALP_AA3G088900                    384   7e-124   
ref|XP_010464446.1|  PREDICTED: serine carboxypeptidase-like 27         384   8e-124   
ref|XP_010279513.1|  PREDICTED: serine carboxypeptidase-like 40 i...    380   8e-124   
ref|XP_010486379.1|  PREDICTED: serine carboxypeptidase-like 27         383   2e-123   
ref|XP_003559652.1|  PREDICTED: serine carboxypeptidase 2-like          384   2e-123   
ref|XP_002462502.1|  hypothetical protein SORBIDRAFT_02g026860          385   2e-123   
ref|XP_006410747.1|  hypothetical protein EUTSA_v10016650mg             382   2e-123   
gb|EMT04608.1|  Serine carboxypeptidase-like protein 40                 384   2e-123   
ref|XP_006407773.1|  hypothetical protein EUTSA_v10020705mg             382   3e-123   
ref|XP_010905043.1|  PREDICTED: serine carboxypeptidase II-2            383   3e-123   
ref|XP_004287151.1|  PREDICTED: serine carboxypeptidase-like 29-l...    383   3e-123   
ref|XP_006431295.1|  hypothetical protein CICLE_v10011605mg             384   3e-123   
ref|XP_009789305.1|  PREDICTED: serine carboxypeptidase II-2            383   3e-123   
ref|XP_009147009.1|  PREDICTED: serine carboxypeptidase-like 27 i...    382   3e-123   
ref|XP_009358402.1|  PREDICTED: serine carboxypeptidase II-2            383   4e-123   
ref|NP_181121.1|  serine carboxypeptidase-like 26                       382   4e-123   



>emb|CDP08509.1| unnamed protein product [Coffea canephora]
Length=484

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/474 (68%), Positives = 376/474 (79%), Gaps = 9/474 (2%)
 Frame = +2

Query  77    ECYSIGGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALP  256
             +C++  G+K DPL   LK ++  +++ N  T  +   +   VY+G Q+GLK+AD+I+ LP
Sbjct  20    QCFA--GKKHDPLLKHLKARRSSKRSVNYVTEEL-GNEYSPVYVGPQEGLKEADRITTLP  76

Query  257   GQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLnggpgcssfgnggMME  436
             GQP  V F Q+SGYVTVDP+AGRALFYYFAES+  S KPLVLWLNGGPGCSS G G M E
Sbjct  77    GQPNAVNFDQYSGYVTVDPKAGRALFYYFAESQNSSAKPLVLWLNGGPGCSSIGAGAMTE  136

Query  437   NGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVTGDKKTAADNYIF  616
              GPFRVN D  TLWLN YAWN VANV+FLESPAGVGFSYSN SSDY+TGD KTAAD+Y F
Sbjct  137   LGPFRVNKDGSTLWLNPYAWNTVANVLFLESPAGVGFSYSNTSSDYITGDTKTAADSYTF  196

Query  617   LLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYID  796
             L+NWLERFPEYKTRD  ITGESYAGHYVPQLAQLIL NNKITNQT+INLKGIAIGN Y+D
Sbjct  197   LVNWLERFPEYKTRDFLITGESYAGHYVPQLAQLILHNNKITNQTVINLKGIAIGNPYVD  256

Query  797   EETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYN  976
              ETQ SGTYD+YWTHALISDE H+GI +NCNFSS  + SD C T+ D AD ++GNI  YN
Sbjct  257   IETQGSGTYDYYWTHALISDEIHQGIFSNCNFSSENT-SDACQTYEDQADSAIGNIDDYN  315

Query  977   IYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCS  1156
             IYAP C      SSS+   +   FDPCS  Y+Y YLNTP+VQK+LHAN T IPGPWDSC+
Sbjct  316   IYAPLC-----SSSSNTPTTISEFDPCSDHYVYTYLNTPQVQKSLHANTTVIPGPWDSCN  370

Query  1157  QDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWY  1336
               +++NW+D PDTVLPTIKEL  SGISVW+YSGD D   +VTTT YA+NKL  SVK PWY
Sbjct  371   DYIHLNWDDEPDTVLPTIKELTESGISVWIYSGDTDSVCSVTTTKYALNKLGLSVKNPWY  430

Query  1337  PWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
              WY++GEVGGY V YE+L+FVT+RGAGHFVPSYQP RALT FS+F+ GKLPP +
Sbjct  431   AWYTQGEVGGYAVEYENLTFVTVRGAGHFVPSYQPSRALTLFSSFLAGKLPPSN  484



>ref|XP_011088290.1| PREDICTED: serine carboxypeptidase II-3-like [Sesamum indicum]
Length=481

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/471 (69%), Positives = 375/471 (80%), Gaps = 11/471 (2%)
 Frame = +2

Query  77    ECYSIGGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALP  256
             ECY  GGR +DPL  ++K +K +   N+    +++  +   VYI  QDGLK+AD+I  LP
Sbjct  18    ECY--GGRGYDPLSRVIKKRKSRTSANHHTEDVLT--EYSPVYIAPQDGLKEADRILMLP  73

Query  257   GQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLnggpgcssfgnggMME  436
             GQP  V F Q+SGYVTVDP AGRALFYY  E+E  S KPLVLWLNGGPGCSS G G M E
Sbjct  74    GQPT-VNFTQYSGYVTVDPTAGRALFYYLTEAEDSSSKPLVLWLNGGPGCSSIGAGAMTE  132

Query  437   NGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVTGDKKTAADNYIF  616
              GPFRVN D+KTLW NKYAWNNVAN+IFLESPAGVGFSYSNR+SDYVTGDK+TAAD+Y F
Sbjct  133   LGPFRVNPDAKTLWYNKYAWNNVANIIFLESPAGVGFSYSNRTSDYVTGDKQTAADSYTF  192

Query  617   LLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYID  796
             L+NWLERFPEYKTRD FITGESYAGHYVPQLA LIL+NNKITNQT+INLKGIAIGNAYID
Sbjct  193   LVNWLERFPEYKTRDFFITGESYAGHYVPQLADLILQNNKITNQTVINLKGIAIGNAYID  252

Query  797   EETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYN  976
                + +GTYD +WT ALISDETH+GI  NCNFSS A+ S  C+ + D A    GNI+ Y+
Sbjct  253   YTDRWAGTYDHFWTSALISDETHQGITENCNFSSDATVSGICNEYQDRAYNEAGNIFIYD  312

Query  977   IYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCS  1156
             IYAP C       SS+   S   +DPCS DY+  YLNTPEVQKALHANVTG+PGPW+ C+
Sbjct  313   IYAPLC------GSSATSPSISSYDPCSDDYVLAYLNTPEVQKALHANVTGLPGPWEDCN  366

Query  1157  QDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWY  1336
              ++N +W+D PDTVLP IK LM SGISVW+YSGD DG + VTTT Y++ KL   VKTPWY
Sbjct  367   YEINGDWQDQPDTVLPVIKRLMASGISVWIYSGDTDGIIPVTTTRYSMPKLGAPVKTPWY  426

Query  1337  PWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLP  1489
             PWYS+GEVGGYVV Y++++FVTIRGAGHFVPSYQPERALTFFS+F+EGKLP
Sbjct  427   PWYSQGEVGGYVVEYQNVTFVTIRGAGHFVPSYQPERALTFFSSFLEGKLP  477



>ref|XP_011088747.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase 24-like 
[Sesamum indicum]
Length=502

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/486 (66%), Positives = 375/486 (77%), Gaps = 19/486 (4%)
 Frame = +2

Query  77    ECYSIGGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALP  256
             +CY  GG++ DPL  L+K Q  KR +++  T   SA+    VYI  QDGLK+ADKI+ LP
Sbjct  19    QCY--GGKQRDPLGELIKVQMTKR-SSSFHTEDASAE-YSPVYIAPQDGLKEADKITVLP  74

Query  257   GQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLnggpgcssfgnggMME  436
             GQP+ V F+QFSGYVTVDP AGRALFY+  ESE P +KPLVLWLNGGPGCSS G+G M E
Sbjct  75    GQPQ-VSFSQFSGYVTVDPNAGRALFYWLTESEDPLNKPLVLWLNGGPGCSSIGSGAMTE  133

Query  437   NGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVTGDKKTAADNYIF  616
              GPFRVN D KTLW NK AWN  AN++FLESPAGVGFSYSN +SD  TGD KTAAD+Y F
Sbjct  134   LGPFRVNPDGKTLWHNKNAWNTAANILFLESPAGVGFSYSNTTSDNGTGDNKTAADSYTF  193

Query  617   LLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYID  796
             L+NWLERFPEYKTRD +ITGESYAGHYVPQLAQLIL+NNKITNQTIINLKGIAIGNAY+D
Sbjct  194   LINWLERFPEYKTRDFYITGESYAGHYVPQLAQLILKNNKITNQTIINLKGIAIGNAYVD  253

Query  797   EETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYN  976
              E + SG YD++WTHAL+SDE H  I+ NCNFSS AS ++TC   +  AD   G ++ Y+
Sbjct  254   YEDEMSGMYDYFWTHALMSDEHHDAILKNCNFSSTASVTETCRETMVKADADRGRVFFYD  313

Query  977   IYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDS--  1150
             IYAP C S S   S         +DPCS +Y++ YLNTPEVQKALHANVTGIPGPWD+  
Sbjct  314   IYAPLCGSNSTAPSVKFSMKLSSYDPCSDNYVFTYLNTPEVQKALHANVTGIPGPWDTLX  373

Query  1151  ------------CSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTY  1294
                         CS  +++ W DMPDTVLP IKELM SGISVW+YSGD DG+V VTTT Y
Sbjct  374   STTLKNSCTPSQCSDIISLFWHDMPDTVLPVIKELMASGISVWIYSGDTDGRVPVTTTRY  433

Query  1295  AINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFV  1474
             +++KL T VKTPWYPWY +GEVGGY V Y++++FVTIRGAGHFVPSYQPERAL FF +F+
Sbjct  434   SMSKLGTPVKTPWYPWYYEGEVGGYAVEYQNVTFVTIRGAGHFVPSYQPERALAFFMSFL  493

Query  1475  EGKLPP  1492
             EGKLPP
Sbjct  494   EGKLPP  499



>ref|XP_002281988.1| PREDICTED: serine carboxypeptidase II-3-like [Vitis vinifera]
Length=488

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/472 (67%), Positives = 372/472 (79%), Gaps = 9/472 (2%)
 Frame = +2

Query  77    ECYSIGGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALP  256
             +C+  GG ++D L  L++ Q+ KRQ+       MS +    VY+G+QDGLKD D+I ALP
Sbjct  20    QCH--GGSRYDLLGKLMQAQRSKRQSEGHSIESMSTE-YSPVYMGSQDGLKDGDRIQALP  76

Query  257   GQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLnggpgcssfgnggMME  436
             GQP G+   Q+SGYVTVDPQAGRALFYYF ES+  S KPLVLWLNGGPGCSS G+G MME
Sbjct  77    GQPNGLNLDQYSGYVTVDPQAGRALFYYFVESQNSSSKPLVLWLNGGPGCSSLGSGAMME  136

Query  437   NGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYI  613
              GPFRVN D  TL  N+YAW+NVAN++FLESPAGVGFSYSN +SDY  +GDK+TA DNY 
Sbjct  137   LGPFRVNGDGNTLSYNEYAWSNVANILFLESPAGVGFSYSNTTSDYDKSGDKQTAEDNYT  196

Query  614   FLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYI  793
             FLLNWLERFPEYKTRD FITGESYAGHYVPQL+Q IL+NNKITNQT+INLKGIAIGNA+I
Sbjct  197   FLLNWLERFPEYKTRDFFITGESYAGHYVPQLSQKILQNNKITNQTVINLKGIAIGNAWI  256

Query  794   DEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSY  973
             D ET   G YDF+WTH+LISDE + GI  NCNFSS  + SD C+ ++D AD ++G IY Y
Sbjct  257   DYETGLKGMYDFFWTHSLISDEINEGINLNCNFSSETTISDVCEQYLDAADAAVGYIYIY  316

Query  974   NIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSC  1153
             +IYAP CSS S  +          FDPCS DYI  YLN PEVQK++HANVT IPGPW+SC
Sbjct  317   DIYAPLCSSSSNSTRPISV-----FDPCSEDYIQTYLNIPEVQKSMHANVTNIPGPWESC  371

Query  1154  SQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPW  1333
             +  +   W+DMP TVLP I+ELM SGISVW+YSGD DG+V  T+T Y+IN L TSVKTPW
Sbjct  372   NDAIFYGWKDMPLTVLPVIEELMVSGISVWIYSGDTDGRVPTTSTRYSINNLGTSVKTPW  431

Query  1334  YPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLP  1489
             YPWY++GEVGGY VGY++LSFVTIRGAGHFVPSYQP RAL FFS+F+ GKLP
Sbjct  432   YPWYTQGEVGGYAVGYKNLSFVTIRGAGHFVPSYQPTRALAFFSSFLAGKLP  483



>ref|XP_011088748.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase II-3-like 
[Sesamum indicum]
Length=468

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/476 (66%), Positives = 376/476 (79%), Gaps = 19/476 (4%)
 Frame = +2

Query  77    ECYSIGGRKFDPLESLLKTQKQKR----QNNNAQTIIMSAQDLGSVYIGAQDGLKDADKI  244
             +CY  GG++ DPL  L+K Q+ K     +  +A T      +   VYI  QDGLK+AD+I
Sbjct  5     QCY--GGKRRDPLGELIKVQRTKTSASFRTQDAST------EYSPVYIAPQDGLKEADEI  56

Query  245   SALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLnggpgcssfgng  424
             + LPGQP+ V F+Q+SGYVTVDP AGRALFY+F   +   +KPLVLWLNGGPGCSS G+G
Sbjct  57    TDLPGQPQ-VSFSQYSGYVTVDPVAGRALFYWFTXCDDSPNKPLVLWLNGGPGCSSIGSG  115

Query  425   gMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVTGDKKTAAD  604
              M E GPFRVN D KTLW NK  WN VAN++FLESPAGVGFSYSN SSDYVTGD +TAAD
Sbjct  116   AMTELGPFRVNPDGKTLWYNKNGWNTVANILFLESPAGVGFSYSNTSSDYVTGDTRTAAD  175

Query  605   NYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGN  784
             +Y FLLNWLERFPEYKTRD +ITGESYAGHYVPQLAQLIL+NNKITNQT+INLKGIAIGN
Sbjct  176   SYTFLLNWLERFPEYKTRDFYITGESYAGHYVPQLAQLILKNNKITNQTVINLKGIAIGN  235

Query  785   AYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNI  964
             AYID E + SG YD++WTHAL+SDE H  I+ NCNFSS AS S+ C   +DDAD   G++
Sbjct  236   AYIDYEDEMSGMYDYFWTHALMSDEHHDAILNNCNFSSMASVSEKCQETMDDADADRGSV  295

Query  965   YSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPW  1144
             + Y+IYAP C       ++S   S   FDPCS +Y++ YLNTPEVQKALHANVTGIPGPW
Sbjct  296   FFYDIYAPLC------GTNSTAPSLSSFDPCSDNYVFDYLNTPEVQKALHANVTGIPGPW  349

Query  1145  DSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVK  1324
             D+C+  +   W++ P+TVLP IK+LM SGISVW+YSGD DG+V VTT+ Y+++KL T VK
Sbjct  350   DTCNDFIFFEWDEAPETVLPVIKDLMASGISVWIYSGDTDGRVPVTTSRYSMSKLGTPVK  409

Query  1325  TPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
             TPWYPWY +GEVGGY V Y++++FVTIRGAGHFVPSYQPERALTFFS+F+EGKLPP
Sbjct  410   TPWYPWYYQGEVGGYAVEYQNVTFVTIRGAGHFVPSYQPERALTFFSSFLEGKLPP  465



>emb|CBI32446.3| unnamed protein product [Vitis vinifera]
Length=477

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/464 (68%), Positives = 367/464 (79%), Gaps = 7/464 (2%)
 Frame = +2

Query  101   KFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQPEGVKF  280
             ++D L  L++ Q+ KRQ+       MS +    VY+G+QDGLKD D+I ALPGQP G+  
Sbjct  15    RYDLLGKLMQAQRSKRQSEGHSIESMSTE-YSPVYMGSQDGLKDGDRIQALPGQPNGLNL  73

Query  281   AQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLnggpgcssfgnggMMENGPFRVNS  460
              Q+SGYVTVDPQAGRALFYYF ES+  S KPLVLWLNGGPGCSS G+G MME GPFRVN 
Sbjct  74    DQYSGYVTVDPQAGRALFYYFVESQNSSSKPLVLWLNGGPGCSSLGSGAMMELGPFRVNG  133

Query  461   DSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFLLNWLER  637
             D  TL  N+YAW+NVAN++FLESPAGVGFSYSN +SDY  +GDK+TA DNY FLLNWLER
Sbjct  134   DGNTLSYNEYAWSNVANILFLESPAGVGFSYSNTTSDYDKSGDKQTAEDNYTFLLNWLER  193

Query  638   FPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDSG  817
             FPEYKTRD FITGESYAGHYVPQL+Q IL+NNKITNQT+INLKGIAIGNA+ID ET   G
Sbjct  194   FPEYKTRDFFITGESYAGHYVPQLSQKILQNNKITNQTVINLKGIAIGNAWIDYETGLKG  253

Query  818   TYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFCs  997
              YDF+WTH+LISDE + GI  NCNFSS  + SD C+ ++D AD ++G IY Y+IYAP CS
Sbjct  254   MYDFFWTHSLISDEINEGINLNCNFSSETTISDVCEQYLDAADAAVGYIYIYDIYAPLCS  313

Query  998   sgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNW  1177
             S S  +          FDPCS DYI  YLN PEVQK++HANVT IPGPW+SC+  +   W
Sbjct  314   SSSNSTRPISV-----FDPCSEDYIQTYLNIPEVQKSMHANVTNIPGPWESCNDAIFYGW  368

Query  1178  EDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKge  1357
             +DMP TVLP I+ELM SGISVW+YSGD DG+V  T+T Y+IN L TSVKTPWYPWY++GE
Sbjct  369   KDMPLTVLPVIEELMVSGISVWIYSGDTDGRVPTTSTRYSINNLGTSVKTPWYPWYTQGE  428

Query  1358  vggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLP  1489
             VGGY VGY++LSFVTIRGAGHFVPSYQP RAL FFS+F+ GKLP
Sbjct  429   VGGYAVGYKNLSFVTIRGAGHFVPSYQPTRALAFFSSFLAGKLP  472



>emb|CAN63486.1| hypothetical protein VITISV_017087 [Vitis vinifera]
Length=488

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/472 (68%), Positives = 374/472 (79%), Gaps = 9/472 (2%)
 Frame = +2

Query  77    ECYSIGGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALP  256
             +C+  GG ++D L  L++ Q+ KRQ+       MS +    VY+G+QDGLKD D+I ALP
Sbjct  20    QCH--GGSRYDLLGKLMQAQRSKRQSEGHSVESMSTE-YSPVYMGSQDGLKDGDRIQALP  76

Query  257   GQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLnggpgcssfgnggMME  436
             GQP G+   Q+SGYVTVDPQAGRALFYYF ES+  S KPLVLWLNGGPGCSS G+G MME
Sbjct  77    GQPNGLNLDQYSGYVTVDPQAGRALFYYFVESQNSSSKPLVLWLNGGPGCSSLGSGAMME  136

Query  437   NGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYI  613
              GPFRVNSD  TL  N+YAW+NVAN++FLESPAGVGFSYSN +SDY  +GDK+TA DNY 
Sbjct  137   LGPFRVNSDGNTLSYNEYAWSNVANILFLESPAGVGFSYSNTTSDYDKSGDKQTAEDNYT  196

Query  614   FLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYI  793
             FLLNWLERFPEYKTRD FITGESYAGHYVPQL+Q IL+NNKITNQT+INLKGIAIGNA+I
Sbjct  197   FLLNWLERFPEYKTRDFFITGESYAGHYVPQLSQKILQNNKITNQTLINLKGIAIGNAWI  256

Query  794   DEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSY  973
             D ET   G YDF+WTH+LISDE + GI  NCNFSS  + SD C+ ++DDAD ++G IY Y
Sbjct  257   DYETGLKGMYDFFWTHSLISDEINEGINLNCNFSSETTISDACEQYLDDADAAIGYIYIY  316

Query  974   NIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSC  1153
             +IYAP C      SSS+       FDPCS DYI  YLN PEVQK++HANVT IPGPW+SC
Sbjct  317   DIYAPLC-----SSSSNSTRPISVFDPCSEDYIQTYLNIPEVQKSMHANVTNIPGPWESC  371

Query  1154  SQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPW  1333
             +  +   W+DMP TVLP I+ELM SGISVW+YSGD DG+V  T+T Y+IN L TSVKTPW
Sbjct  372   NDAIFYGWKDMPLTVLPVIEELMVSGISVWIYSGDTDGRVPTTSTRYSINNLGTSVKTPW  431

Query  1334  YPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLP  1489
             YPWY++GEVGGY VGY++LSFVTIRGAGHFVPSYQP RAL FFS+F+ GKLP
Sbjct  432   YPWYTQGEVGGYAVGYKNLSFVTIRGAGHFVPSYQPARALAFFSSFLAGKLP  483



>emb|CDP19962.1| unnamed protein product [Coffea canephora]
Length=678

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/475 (65%), Positives = 360/475 (76%), Gaps = 10/475 (2%)
 Frame = +2

Query  77    ECYSIGGR-KFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISAL  253
             +CY   G   +DPL    K    ++  N+    + S  +   VYIG QDGLK ADKI+AL
Sbjct  211   QCYGEHGYYGYDPLAKFFKAPSLRKSVNHVNKELDS--EYSPVYIGPQDGLKAADKITAL  268

Query  254   PGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLnggpgcssfgnggMM  433
             PG+P+GV F Q+SGYVTVDP+AGRALFYYFAES+ PS KPLVLWLNGGPGCSS G G M 
Sbjct  269   PGEPKGVNFDQYSGYVTVDPKAGRALFYYFAESQNPSTKPLVLWLNGGPGCSSLGAGAMN  328

Query  434   ENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVTGDKKTAADNYI  613
             E GPFRV    K LW N YAWNNVAN+IFLESPAGVGFSYSN SSDY+TGD K+AAD Y 
Sbjct  329   ELGPFRVTKGGKMLWKNPYAWNNVANIIFLESPAGVGFSYSNTSSDYITGDTKSAADAYT  388

Query  614   FLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYI  793
             FL+NWLERFPEYKTRD  +TGESYAGHYVPQLAQLIL NNKITN T INLKG+AIGN Y 
Sbjct  389   FLVNWLERFPEYKTRDFLMTGESYAGHYVPQLAQLILHNNKITNHTAINLKGVAIGNGYY  448

Query  794   DEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSY  973
             D E Q +G+YD+YWTHALISDE H GI++NCNFSSA  P++ C  +   A+ ++GNI + 
Sbjct  449   DIEAQANGSYDYYWTHALISDEIHHGIVSNCNFSSADPPTEACQAYQSQANSALGNIDND  508

Query  974   NIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSC  1153
             NIYAP C       SS+       +DPCS +Y Y YLNTP VQK+LHAN TGIPGPW++C
Sbjct  509   NIYAPLC-------SSNTPPWINAYDPCSFNYSYTYLNTPAVQKSLHANTTGIPGPWETC  561

Query  1154  SQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPW  1333
             +  +  NW+D PDTVLP IKEL  SGISVWLYSGD D   +VTTT YA+NKL  SVKTPW
Sbjct  562   NGYIGSNWDDEPDTVLPLIKELTSSGISVWLYSGDTDSVCSVTTTRYALNKLGLSVKTPW  621

Query  1334  YPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
             Y WY++ EVGGY V YE+L+FVT+RGAGH VPSYQP RALT F++F++ KLPP +
Sbjct  622   YAWYTQDEVGGYAVEYENLTFVTVRGAGHLVPSYQPARALTLFASFLDRKLPPSN  676


 Score = 81.3 bits (199),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 55/94 (59%), Gaps = 13/94 (14%)
 Frame = +2

Query  1250  SGDIDGKVAVTTTTYAINKLNTSVKTPWYPW------------YSKgevggyvvgyeD-L  1390
             SGD D  V+ TTT Y +NKL  SVKTPWY +            YS     G      D L
Sbjct  91    SGDTDIVVSATTTRYVLNKLGLSVKTPWYAYISYISFLVERILYSMLVQVGGYAVEYDNL  150

Query  1391  SFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
             +FVT+RGAGHFVPS Q  RAL  FS+F++G LPP
Sbjct  151   TFVTVRGAGHFVPSRQHARALCLFSSFLDGNLPP  184


 Score = 59.7 bits (143),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 50/84 (60%), Gaps = 7/84 (8%)
 Frame = +2

Query  683  YAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDET  862
            YAGHY+PQL+QLIL N KITNQT+INLKGIA+  ++    +       F ++ A++  ++
Sbjct  30   YAGHYMPQLSQLILDNKKITNQTVINLKGIAMQKSFHAHTS-------FCYSTAVVYRKS  82

Query  863  HRGIIANCNFSSAASPSDTCDTFV  934
                I NC+  +    S T   +V
Sbjct  83   TNWNILNCSGDTDIVVSATTTRYV  106



>ref|XP_011088288.1| PREDICTED: serine carboxypeptidase II-3-like [Sesamum indicum]
Length=483

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/473 (64%), Positives = 370/473 (78%), Gaps = 10/473 (2%)
 Frame = +2

Query  77    ECYSIGGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALP  256
             + Y  GG  F+PL  L++ +  +R  N+  T   ++ +   VY+  Q+GLK+ DKIS LP
Sbjct  19    QGYYHGGSGFEPLRKLIRARLSRRSVNSV-TDEGASTEHSPVYLAPQEGLKEVDKISTLP  77

Query  257   GQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLnggpgcssfgnggMME  436
             GQP  V F Q++GYVTVDP AGRALFYYF ESE+ S +PLVLWLNGGPGCSS   G MME
Sbjct  78    GQPS-VNFDQYAGYVTVDPAAGRALFYYFTESESSSTRPLVLWLNGGPGCSSLAGGAMME  136

Query  437   NGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVTGDKKTAADNYIF  616
              GPFRVN D KTLW N+YAWNN+ANV+FLESPAGVGFSYSN S +Y  GDK+TAAD+Y F
Sbjct  137   LGPFRVNPDGKTLWHNEYAWNNLANVLFLESPAGVGFSYSNTSVEY--GDKQTAADSYTF  194

Query  617   LLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYID  796
             LLNW ERFPEYKTRD +I GESYAGHYVPQLA  IL+NNKITN T+INLKGIAIGNA ID
Sbjct  195   LLNWFERFPEYKTRDFYIAGESYAGHYVPQLASFILKNNKITNHTVINLKGIAIGNAEID  254

Query  797   EETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYN  976
              E + SG YD+YWTHALISDE H+ I++NCNFSS+AS S  C++ +D AD ++G +Y Y+
Sbjct  255   FEDELSGMYDYYWTHALISDEHHKAILSNCNFSSSASVSAVCNSVLDQADAALGTVYYYD  314

Query  977   IYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCS  1156
             IYAP C++ S     S       FDPCSS+Y++ YLN P+VQKALHANVTGI GPWD+C+
Sbjct  315   IYAPLCNASSNSPLVSG------FDPCSSNYVFTYLNRPDVQKALHANVTGITGPWDACN  368

Query  1157  QDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWY  1336
               V +NW D PDT+LPTIKELM  GI VW+YSGD D +V VT+T Y++ KL T VKTPW+
Sbjct  369   NTVFLNWNDRPDTILPTIKELMAGGIRVWIYSGDTDKRVPVTSTRYSLEKLGTPVKTPWF  428

Query  1337  PWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPK  1495
             PWY++GEVGGY V Y++++FV+IRGAGHFVPSYQP+RAL  FS+F++GKLPP+
Sbjct  429   PWYNQGEVGGYAVEYQNVTFVSIRGAGHFVPSYQPQRALVVFSSFLDGKLPPR  481



>gb|EYU42662.1| hypothetical protein MIMGU_mgv1a022120mg [Erythranthe guttata]
Length=489

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/477 (65%), Positives = 364/477 (76%), Gaps = 11/477 (2%)
 Frame = +2

Query  77    ECYSIGGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALP  256
             +CY  GGR FDPL   ++ Q+ K   NN    +   +   ++Y+  Q+G K+ D+I +LP
Sbjct  22    QCY--GGRGFDPLGEFVEVQRAKTSLNNLDENLSIKRS--TIYVENQEGYKEVDRILSLP  77

Query  257   GQPEGVKFAQFSGYVTVDPQAGRALFYYFAESE-TPSDKPLVLWLnggpgcssfgnggMM  433
             GQPE V F Q+SGYVTVD  AGRALFYYFAESE + S KPLVLWLNGGPGCSS G G M 
Sbjct  78    GQPE-VSFDQYSGYVTVDASAGRALFYYFAESENSSSTKPLVLWLNGGPGCSSLGAGAMT  136

Query  434   ENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVTGDKKTAADNYI  613
             E GPFRVN D KTLW NK +WN +ANVIFLESPAGVGFSYSN SSDY+TGD+KTAAD Y 
Sbjct  137   ELGPFRVNPDGKTLWHNKNSWNILANVIFLESPAGVGFSYSNTSSDYITGDRKTAADAYT  196

Query  614   FLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYI  793
             FL+NWL+RFP+YK RD +I GESYAGHYVPQLA LIL+NN+I N+T+INLKGIAIGNAYI
Sbjct  197   FLVNWLKRFPDYKHRDFYIAGESYAGHYVPQLADLILKNNEIANKTVINLKGIAIGNAYI  256

Query  794   DEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSY  973
             D E Q+ G YD+YWTHALISDE H+G+I NCNFSS    ++ C  F   A  + GN++ Y
Sbjct  257   DIEDQNKGVYDYYWTHALISDEIHKGLIENCNFSSGGPQTELCRGFRKQAREAKGNVFDY  316

Query  974   NIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSC  1153
             +IYAP C      ++SS   S  GFDPCS  Y Y YLNT EVQ+ALHANV GIP PWD C
Sbjct  317   DIYAPLC-----STTSSNTPSISGFDPCSGYYAYAYLNTREVQEALHANVAGIPKPWDEC  371

Query  1154  SQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPW  1333
             S  V  NW+D P TVLPTIK LM SGI VW+YSGD D  V VTTT Y++ KL  +VKTPW
Sbjct  372   SDYVGNNWQDSPLTVLPTIKRLMASGIRVWIYSGDTDSVVPVTTTRYSMPKLGAAVKTPW  431

Query  1334  YPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKSAE  1504
             YPWY++GEVGGY V Y++++FVTIRGAGHFVPSYQP+RALTFFS+F+EGKLPP + +
Sbjct  432   YPWYNQGEVGGYAVEYQNITFVTIRGAGHFVPSYQPQRALTFFSSFLEGKLPPTNTK  488



>gb|EYU37705.1| hypothetical protein MIMGU_mgv1a005479mg [Erythranthe guttata]
Length=482

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/474 (66%), Positives = 369/474 (78%), Gaps = 15/474 (3%)
 Frame = +2

Query  77    ECYSIGGRKFDPLESLLKTQKQKRQN--NNAQTIIMSAQDLGSVYIGAQDGLKDADKISA  250
             +CY  GGRK+DPL  L+K ++ KR +  N       S+ +   VY+  Q GLK+ DKI +
Sbjct  19    QCY--GGRKYDPLRELIKARRAKRSSSVNYVSEDATSSAEYSPVYVQNQYGLKEVDKILS  76

Query  251   LPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLnggpgcssfgnggM  430
             LPGQP+ V F+Q+SGYVTVDP AGRALFYYF ESE  S KPLVLWLNGGPGCSS G G M
Sbjct  77    LPGQPQ-VNFSQYSGYVTVDPIAGRALFYYFTESEDSSTKPLVLWLNGGPGCSSLGAGAM  135

Query  431   MENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVTGDKKTAADNY  610
              E GPFRVN D KTLWLNK AWNN ANV+FLESPAGVGFSYSNRSSDY+TGDK+TAAD Y
Sbjct  136   TELGPFRVNPDGKTLWLNKNAWNNEANVVFLESPAGVGFSYSNRSSDYITGDKQTAADAY  195

Query  611   IFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAY  790
              F++NWLERFPEYKTRD +ITGESYAGHYVPQLA LIL+NNKITNQT+INLKGIAIGNA 
Sbjct  196   TFVVNWLERFPEYKTRDFYITGESYAGHYVPQLADLILKNNKITNQTVINLKGIAIGNAL  255

Query  791   IDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYS  970
             I++E   +G YD+ WTHALISDETH GI+ NCNFSS    S+ CD +  +AD ++ +IY 
Sbjct  256   INDEDWWNGQYDYLWTHALISDETHNGIVKNCNFSS-PDISEACDNYAGEADDAVEDIYF  314

Query  971   YNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDS  1150
             Y+IYAP C      SSSS   S   FDPCS DY Y YLNTPEVQKALHA+V G    W+S
Sbjct  315   YDIYAPLC------SSSSNAPSISTFDPCSGDYAYTYLNTPEVQKALHAHVNGT---WES  365

Query  1151  CSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTP  1330
             C+ +V+ NW+D   T+LPTI+ELM SGI VW+YSGD D  V VTTT+Y++ K+   + TP
Sbjct  366   CNFEVHANWQDWQTTLLPTIEELMASGIRVWIYSGDTDRAVPVTTTSYSLTKIGAPITTP  425

Query  1331  WYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
             WYPWYS+GEVGGY VGY++L+FVT+RG+GHFVPSYQPERAL  F++F+ GKLPP
Sbjct  426   WYPWYSQGEVGGYAVGYQNLTFVTVRGSGHFVPSYQPERALVLFTSFLAGKLPP  479



>ref|XP_007017345.1| Serine carboxypeptidase 40, putative [Theobroma cacao]
 gb|EOY14570.1| Serine carboxypeptidase 40, putative [Theobroma cacao]
Length=569

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/501 (60%), Positives = 364/501 (73%), Gaps = 28/501 (6%)
 Frame = +2

Query  77    ECYSIGGRKFDPLESLLKTQKQKRQNNNAQ-----TIIMSAQDLGSVYIGAQDGLKDADK  241
             +CY  GGR F+P++ L +   ++  ++ ++     ++   A     VYIG Q GL++ DK
Sbjct  20    QCY--GGRDFNPIKLLRQELSEQMSSDVSKWPTYFSLETDAGQFSPVYIGPQGGLREVDK  77

Query  242   ISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfg  418
             I +LPGQP  V F Q+SGYVTVDP+AGRALFYYF ES    S KPLVLWLNGGPGCSS G
Sbjct  78    IGSLPGQPGEVDFDQYSGYVTVDPEAGRALFYYFVESPHHSSTKPLVLWLNGGPGCSSIG  137

Query  419   nggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKT  595
             NG MME GPFRV  D K+L  N+YAWN  AN+IFLESPAGVGFSYSNR+SDY  +GDK+T
Sbjct  138   NGAMMELGPFRVKKDGKSLRRNRYAWNKDANIIFLESPAGVGFSYSNRTSDYKSSGDKRT  197

Query  596   AADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIA  775
             A D+Y FL+NW ERFPEYKTR+ FITGESYAGHYVPQLA  IL+NNK TNQTIINLKGIA
Sbjct  198   AQDSYTFLVNWRERFPEYKTREFFITGESYAGHYVPQLAHTILQNNKYTNQTIINLKGIA  257

Query  776   IGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSM  955
             IGNAYID ET   G  DFYWTHAL+SDE + G+ +NC++S+    S  C  FVD A+ + 
Sbjct  258   IGNAYIDFETTMKGAVDFYWTHALMSDEIYNGLASNCDYSTLNLSSKECLGFVDKANDAA  317

Query  956   GNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIP  1135
             GNIY+Y+IYA  C + S  S+S        FDPCS +Y++ YLN PEVQ+ALHANVT +P
Sbjct  318   GNIYTYDIYASLC-NSSSSSNSKFTSQVSAFDPCSENYVHSYLNNPEVQRALHANVTALP  376

Query  1136  GPWDSCSQ------------------DVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDI  1261
               W+SC                    +VN +W+D P TVLP IKELM SGI VW+YSGD 
Sbjct  377   YLWESCRHGPISLSLFPSWGICVVIGEVNRHWKDKPLTVLPIIKELMESGIRVWIYSGDT  436

Query  1262  DGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQP  1441
             DG + VT + YAINKL T +KT WYPWY++GEVGGY VGY++L+FVT+RGAGHFVPSYQP
Sbjct  437   DGALPVTCSRYAINKLGTPIKTAWYPWYTQGEVGGYAVGYQNLTFVTVRGAGHFVPSYQP  496

Query  1442  ERALTFFSAFVEGKLPPKSAE  1504
              RAL  FS+F++GKLPP + +
Sbjct  497   ARALVLFSSFLDGKLPPSTRK  517



>ref|XP_006346531.1| PREDICTED: serine carboxypeptidase II-3-like [Solanum tuberosum]
Length=464

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/467 (63%), Positives = 348/467 (75%), Gaps = 9/467 (2%)
 Frame = +2

Query  98    RKFDPLESLLKTQKQKRQNNNAQTI-IMSAQDLGSVYIGAQDGLKDADKISALPGQPEGV  274
             R+ D L   LK ++ K +N  +Q + +   Q   S +I  Q G K+ DKI ALPGQP G+
Sbjct  2     REVDVLREFLKARRTKTKNVISQGLAVAEKQRSVSEFIVPQVGSKENDKILALPGQPSGI  61

Query  275   KFAQFSGYVTVDPQAGRALFYYFAESET-PSDKPLVLWLnggpgcssfgnggMMENGPFR  451
              FAQ+SGYVTV+  AGRALFYY AES   PS KPLVLWLNGGPGCSSFGNGGM+E GPFR
Sbjct  62    NFAQYSGYVTVNADAGRALFYYLAESSNDPSTKPLVLWLNGGPGCSSFGNGGMVELGPFR  121

Query  452   VNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVTGDKKTAADNYIFLLNWL  631
             VN D KTLWLN++AWNNVANV+FLESPAGVGFSYSN SSDY TGD+KT  D++ FL+NW+
Sbjct  122   VNKDGKTLWLNQFAWNNVANVLFLESPAGVGFSYSNTSSDYTTGDEKTRRDSFTFLVNWM  181

Query  632   ERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQD  811
             ERFPEYK RD +I GESYAGHYVPQLAQLIL + K     +INL+GIA GNA +D+ET +
Sbjct  182   ERFPEYKNRDFYIVGESYAGHYVPQLAQLILSHKKTEPNLVINLQGIAAGNALLDDETWN  241

Query  812   SGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPF  991
             SG+YDFYWTHALISDE H GI+ NCNFS+  S S+ CD +  +AD    NIY+YN Y+  
Sbjct  242   SGSYDFYWTHALISDEVHEGIVKNCNFSTETSTSEACDEYTSEADSCQANIYNYNTYSQL  301

Query  992   CssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNV  1171
             C      SS+       GFDPCS DY+  YLNT EVQKAL  NV  IP  W+SCS  ++ 
Sbjct  302   C-----NSSAYTSLPIDGFDPCSPDYVDNYLNTAEVQKAL--NVRDIPHSWESCSGYIHG  354

Query  1172  NWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSK  1351
              W+D PDTVLP  KELM SGI VW+YSGDID  + VTT+ Y I+K+ T VKT WYPW+ +
Sbjct  355   LWQDSPDTVLPIYKELMQSGIRVWIYSGDIDHILPVTTSRYGIDKIKTPVKTAWYPWFFQ  414

Query  1352  gevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
             GEVGGY V Y++L+FVT+RGAGHFVPSYQP RALT FS+F+ G LPP
Sbjct  415   GEVGGYAVEYQNLTFVTVRGAGHFVPSYQPGRALTMFSSFINGTLPP  461



>ref|XP_009801012.1| PREDICTED: serine carboxypeptidase II-3-like [Nicotiana sylvestris]
Length=489

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/463 (63%), Positives = 346/463 (75%), Gaps = 9/463 (2%)
 Frame = +2

Query  107   DPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQPEGVKFAQ  286
             D L   LK ++   + N             S +I  Q G K+ DKISALPGQP GV F Q
Sbjct  27    DNLRQFLKARRATTRINRGIAAAEKQIRSASKFIVPQVGSKENDKISALPGQPSGVNFDQ  86

Query  287   FSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMENGPFRVNSD  463
             +SGYVTVD  AGRALFY+F ES + PS +PLVLWLNGGPGCSSFGNGGM E GPFRVN D
Sbjct  87    YSGYVTVDANAGRALFYHFTESTQDPSTRPLVLWLNGGPGCSSFGNGGMTELGPFRVNKD  146

Query  464   SKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVTGDKKTAADNYIFLLNWLERFP  643
              KTLWLN +AWNNVANV+FLESPAGVGFSYSN SSDYVTGD+KT  D++ FL+NW+ERFP
Sbjct  147   GKTLWLNPFAWNNVANVLFLESPAGVGFSYSNTSSDYVTGDEKTKQDSFTFLINWMERFP  206

Query  644   EYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDSGTY  823
             EYK RD +I GESYAGHYVPQLAQLIL + K     +INL+GIA GNA +D+E  +SG+Y
Sbjct  207   EYKRRDFYIIGESYAGHYVPQLAQLILSHKKSEPNLVINLQGIATGNALLDDEAMNSGSY  266

Query  824   DFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFCssg  1003
             DFYWTHALISDE H GI++NCNF SA   ++ CD + D AD S GNIY+YNIY+  C   
Sbjct  267   DFYWTHALISDEVHEGIVSNCNF-SAEFTTEACDEYTDQADSSQGNIYTYNIYSQLC---  322

Query  1004  sglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWED  1183
                SS+       GFDPCS+DY+  YLNT EVQKAL  NV  IP  W SC+ +++ +W+D
Sbjct  323   --NSSAYFSLPESGFDPCSADYVDNYLNTVEVQKAL--NVRDIPQSWGSCNDEIHGSWQD  378

Query  1184  MPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevg  1363
              PDTVLP  +ELM SGI VW+YSGD+D  ++VTTT YAINK+ T VKT WYPW+ +GEVG
Sbjct  379   SPDTVLPIFQELMQSGIRVWIYSGDVDHILSVTTTRYAINKIKTPVKTAWYPWFFQGEVG  438

Query  1364  gyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
             GY V Y++L+FVT+RGAGHFVPSYQP RALT FS+F+ G LPP
Sbjct  439   GYAVEYQNLTFVTVRGAGHFVPSYQPGRALTMFSSFINGTLPP  481



>ref|XP_006473888.1| PREDICTED: serine carboxypeptidase-like 40-like [Citrus sinensis]
Length=490

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/478 (62%), Positives = 352/478 (74%), Gaps = 15/478 (3%)
 Frame = +2

Query  77    ECYSIGGRKFDPLESLLKTQKQKRQNNNAQTI----IMSAQDLGSVYIGAQDGLKDADKI  244
             +CY  G    +PL+  +K +  K ++N A T     I +     ++    QDGLKD DKI
Sbjct  20    QCY--GWIDMNPLK-FIKEELSKERDNYALTSYSSDIYAVAGHSALLNSPQDGLKDKDKI  76

Query  245   SALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgn  421
              +LPGQP GV F Q+SGYV VD Q GR+LFYYF ES +  S KPLVLWLNGGPGCSSFG 
Sbjct  77    ESLPGQPLGVNFDQYSGYVNVDSQDGRSLFYYFVESPQNSSSKPLVLWLNGGPGCSSFGA  136

Query  422   ggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTA  598
             G MME GPFRVN D KTL+ N+YAWN  AN+IFLESPAGVGFSYSN +SDY V GD +TA
Sbjct  137   GAMMELGPFRVNKDGKTLYQNEYAWNKDANIIFLESPAGVGFSYSNITSDYKVNGDIRTA  196

Query  599   ADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAI  778
              D+Y FL+NWLERFPEYKTRD FI GESYAGHY+PQLAQ IL NN+  NQTIINL+GIA+
Sbjct  197   RDSYTFLVNWLERFPEYKTRDFFIAGESYAGHYIPQLAQAILYNNQHDNQTIINLRGIAM  256

Query  779   GNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMG  958
             GNA ID ET   GT DFYWTHAL+ DE + G+ ++CNF+S  S  + C  F+D  D + G
Sbjct  257   GNALIDLETMMKGTVDFYWTHALMPDEIYYGVTSSCNFASLNSSDEVCLEFIDQGDAAAG  316

Query  959   NIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPG  1138
             NIYSY+IYAP C+S S  ++ S       FDPCS +YI  YLN P VQ+ALHANVTG+P 
Sbjct  317   NIYSYDIYAPLCNSSSKFNTVST------FDPCSENYIETYLNIPRVQEALHANVTGLPY  370

Query  1139  PWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTS  1318
             P  SCS ++N NW+D P TVLP I+ELM  GI +W+YSGD DG + VT T YA+ KL T 
Sbjct  371   PLQSCSGEINRNWKDKPQTVLPIIQELMAEGIRIWVYSGDTDGALPVTCTRYAVKKLGTP  430

Query  1319  VKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
             V+T WYPWY++GEVGGY VGY++L+FVT+RGAGHFVPSYQP RAL  FS+F+ G LPP
Sbjct  431   VRTAWYPWYTQGEVGGYAVGYQNLTFVTVRGAGHFVPSYQPARALVLFSSFINGTLPP  488



>ref|XP_009619884.1| PREDICTED: serine carboxypeptidase 24-like [Nicotiana tomentosiformis]
Length=508

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/463 (63%), Positives = 345/463 (75%), Gaps = 9/463 (2%)
 Frame = +2

Query  107   DPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQPEGVKFAQ  286
             D L   LK ++     N+        +   S +   Q G K+ DKI ALPGQP GV F Q
Sbjct  46    DVLRQFLKARRATTSINHGNAAAEKQRRSSSKFRVPQVGSKENDKILALPGQPSGVNFDQ  105

Query  287   FSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMENGPFRVNSD  463
             +SGYVTVD  AGRALFY+F ES + PS +PLVLWLNGGPGCSSFGNGGM E GPFRVN D
Sbjct  106   YSGYVTVDANAGRALFYHFTESTQDPSSRPLVLWLNGGPGCSSFGNGGMTELGPFRVNKD  165

Query  464   SKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVTGDKKTAADNYIFLLNWLERFP  643
              KTLWLN +AWNNVANV+FLESPAGVGFSYSN SSDYVTGD+KT  D++ FL+NW+ERFP
Sbjct  166   GKTLWLNPFAWNNVANVLFLESPAGVGFSYSNTSSDYVTGDEKTRQDSFTFLINWMERFP  225

Query  644   EYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDSGTY  823
             E+K RD +I GESYAGHYVPQLAQLIL + K     +INL+GIA GNA+ID+ET  SG+Y
Sbjct  226   EFKHRDFYIIGESYAGHYVPQLAQLILSHKKSEPNLVINLQGIATGNAFIDDETMSSGSY  285

Query  824   DFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFCssg  1003
             DFYWTHALISDE H GI++NCNF SA   +  CD + D AD S GNIY+YNIY+  C   
Sbjct  286   DFYWTHALISDEIHEGIVSNCNF-SAEFTTQACDEYTDQADSSQGNIYTYNIYSQLC---  341

Query  1004  sglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWED  1183
                SS+       GFDPCS+DY+  YLNT EVQKAL  NV  IP  W SC+  ++ +W+D
Sbjct  342   --NSSAYFSLPISGFDPCSADYVDNYLNTVEVQKAL--NVRDIPQSWGSCNDYIHGSWQD  397

Query  1184  MPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevg  1363
              PDTVLP  +ELM SGI VW+YSGD+D  V+VTT+ YAINK+ T VKTPWYPW+ +GEVG
Sbjct  398   SPDTVLPIFQELMQSGIRVWIYSGDVDHIVSVTTSRYAINKIKTPVKTPWYPWFFQGEVG  457

Query  1364  gyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
             GY V Y++L+FVT+RGAGHFVPSYQP RALT FS+F+ G LPP
Sbjct  458   GYAVEYQNLTFVTVRGAGHFVPSYQPGRALTMFSSFINGTLPP  500



>emb|CDP08504.1| unnamed protein product [Coffea canephora]
Length=569

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/449 (62%), Positives = 328/449 (73%), Gaps = 11/449 (2%)
 Frame = +2

Query  95    GRKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQPEGV  274
             G   DPL + LK +  KR  N+    +    +   VYIG Q+GLK+ADKI+ LPG+P GV
Sbjct  26    GHGNDPLVNFLKARSLKRSVNHVNEEL--GNEYSPVYIGPQEGLKEADKITTLPGEPNGV  83

Query  275   KFAQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLnggpgcssfgnggMMENGPFRV  454
              F Q+SGYVTVDP+AGRALFYYFAES+  S KPLVLWLNGGPGCSS G G M E GPFRV
Sbjct  84    NFDQYSGYVTVDPKAGRALFYYFAESQNSSTKPLVLWLNGGPGCSSLGAGAMTELGPFRV  143

Query  455   NSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVTGDKKTAADNYIFLLNWLE  634
             +   KTLW N YAWNNVANV+FLESPAGVGFSYSN SSDY+TGD KTAAD+Y FL+NWLE
Sbjct  144   SKGGKTLWKNPYAWNNVANVLFLESPAGVGFSYSNTSSDYITGDTKTAADSYTFLVNWLE  203

Query  635   RFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDS  814
             RFPEYKTRD  ITGESYAGHYVPQLAQLIL  NKITNQT+INLKG+AIGN Y D E Q+S
Sbjct  204   RFPEYKTRDFLITGESYAGHYVPQLAQLILHINKITNQTVINLKGVAIGNGYYDIEAQNS  263

Query  815   GTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFC  994
             G+YD+YWTHALISDE H GI++NCNFSSA  P++ C  +   A+ ++GNI   NIYAP C
Sbjct  264   GSYDYYWTHALISDEIHHGIVSNCNFSSAYPPTEACQAYQSQANSAIGNIDYDNIYAPLC  323

Query  995   ssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVN  1174
                    SS+       +DPCS +Y Y YLNTP +QK+LHAN +GIPGPW++C+  +  +
Sbjct  324   -------SSNTPPWINEYDPCSFNYAYTYLNTPAMQKSLHANTSGIPGPWETCNGYIGSH  376

Query  1175  WEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKg  1354
             W+D PDTVLP IKEL  SGISVWLYSGD D   +VTTT Y +NKL  SVKTPWY WY++ 
Sbjct  377   WDDEPDTVLPVIKELTSSGISVWLYSGDTDSVCSVTTTRYGLNKLGLSVKTPWYAWYTQ-  435

Query  1355  evggyvvgyeDLSFVTIRGAGHFVPSYQP  1441
                   +  + L       AGH+VP   P
Sbjct  436   -GEIPRIQNQGLLDTGESYAGHYVPQLSP  463


 Score = 80.9 bits (198),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 48/71 (68%), Gaps = 5/71 (7%)
 Frame = +2

Query  1097  VQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVA  1276
             VQK+LHAN TGIP PW++C     V     PD VLP IK+L  SGI VW+Y GD D  V+
Sbjct  484   VQKSLHANTTGIPRPWEAC-----VYILAFPDIVLPVIKQLTTSGIRVWIYGGDTDIVVS  538

Query  1277  VTTTTYAINKL  1309
             VTTT Y +NKL
Sbjct  539   VTTTRYVLNKL  549


 Score = 67.0 bits (162),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  635  RFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAI  778
              P  + + L  TGESYAGHYVPQL+  IL NNKITN+T+INLKGIA+
Sbjct  437  EIPRIQNQGLLDTGESYAGHYVPQLSPPILYNNKITNRTVINLKGIAV  484



>ref|XP_004230806.1| PREDICTED: serine carboxypeptidase II-3-like [Solanum lycopersicum]
Length=487

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/496 (60%), Positives = 352/496 (71%), Gaps = 15/496 (3%)
 Frame = +2

Query  8     RATMKGGCMFIllaavvhllvfaECYSIGGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQ  187
             R  MK   +  L   +  L     CY+    + D L   LKT++ K    N        Q
Sbjct  3     RKKMKANSVLTLSLILCCLSAQQYCYA---GEADVLREFLKTRRAKTTIINHGLAASEKQ  59

Query  188   DLGSVYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESE-TPS  364
                S  I  Q G K+ DKISALP QP  V+F Q++GYVTVD  AGRALFYY AES   PS
Sbjct  60    RSVSELIVPQAGSKENDKISALPEQPSAVRFNQYAGYVTVDANAGRALFYYLAESSGDPS  119

Query  365   DKPLVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVG  544
              KPLVLWLNGGPGCSS G G M+E GPFRVN+D KTLWLN++AWNNVAN++FLESPAGVG
Sbjct  120   TKPLVLWLNGGPGCSSLGAGAMIELGPFRVNNDGKTLWLNQFAWNNVANILFLESPAGVG  179

Query  545   FSYSNRSSDYVTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLIL  724
             FSYSN SSDY TGD+KT  D++ FLLNW+ERFPEYK RD +I GESYAGHYVPQLAQLIL
Sbjct  180   FSYSNTSSDYTTGDEKTRKDSFTFLLNWMERFPEYKHRDFYIVGESYAGHYVPQLAQLIL  239

Query  725   RNNKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAA  904
              + K     +INL+GIA GNA +D+ET   G+YDFYWTHALISDE H GI+ NCNFS+  
Sbjct  240   SHRKTEPNLVINLQGIATGNALLDDETMRRGSYDFYWTHALISDEVHDGIVKNCNFSTET  299

Query  905   SPSDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYL  1084
             + S+ CD ++  A  S+GNIY Y+IYAP C      +S++      GFDPCS +Y+  YL
Sbjct  300   T-SEACDKYIKQAGSSLGNIYGYDIYAPLC------NSNATSLPVCGFDPCSDNYVNSYL  352

Query  1085  NTPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDID  1264
             N+ EVQKAL  NV GIP  W +CS D  + W+D P TVLP  + LM SGI VW+YSGD D
Sbjct  353   NSAEVQKAL--NVRGIPYSWAACSTD--LIWQDWPPTVLPIFQGLMKSGIRVWIYSGDTD  408

Query  1265  GKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPE  1444
               +AVTTT YAINK+ T+VKTPWYPWY +GEVGG+ V YE+L+FVT+RGAGHFVPSYQP 
Sbjct  409   SVLAVTTTRYAINKIKTAVKTPWYPWYFQGEVGGHAVEYENLTFVTVRGAGHFVPSYQPG  468

Query  1445  RALTFFSAFVEGKLPP  1492
             RALT FS+F+ G LPP
Sbjct  469   RALTMFSSFINGTLPP  484



>ref|XP_006423055.1| hypothetical protein CICLE_v10028330mg [Citrus clementina]
 gb|ESR36295.1| hypothetical protein CICLE_v10028330mg [Citrus clementina]
Length=481

 Score =   530 bits (1366),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 292/467 (63%), Positives = 354/467 (76%), Gaps = 13/467 (3%)
 Frame = +2

Query  101   KFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQPEGVKF  280
             ++D L   +K Q++ R  + +     + ++  +VYIG Q+GLK+ADKI  LPGQP GV+ 
Sbjct  25    EYDLLGKFIKAQQEGRYVDYSGAPKEAGEE-STVYIGPQEGLKEADKIEKLPGQPYGVEI  83

Query  281   AQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLnggpgcssfgnggMMENGPFRVNS  460
              Q+SGYVTVDP+AGRALFYYF ES+  S KPLVLWLNGGPGCSSFG G MME GPFRVNS
Sbjct  84    DQYSGYVTVDPKAGRALFYYFVESQNSSTKPLVLWLNGGPGCSSFGFGAMMELGPFRVNS  143

Query  461   DSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYV-TGDKKTAADNYIFLLNWLER  637
             D K+L  N+YAWNNVAN++FLESPAGVGFSYSN SSDYV  GD++TAAD+Y FLLNW ER
Sbjct  144   DGKSLSHNEYAWNNVANMLFLESPAGVGFSYSNTSSDYVMNGDERTAADSYTFLLNWFER  203

Query  638   FPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDSG  817
             FPEYK+R+ F+ GESYAGHY+PQLA  IL+ NK  NQT INLKG+A+GNA+ID ET + G
Sbjct  204   FPEYKSREFFLAGESYAGHYIPQLALKILQFNK--NQTFINLKGLAMGNAWIDTETGNKG  261

Query  818   TYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFCs  997
              +DFYWTHALISDE   GI +NCNF+     S  C +++  A +SMGNI   +IYAP CS
Sbjct  262   MFDFYWTHALISDEVIHGINSNCNFTKF---SKACASYLIKAYQSMGNINILDIYAPLCS  318

Query  998   sgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNW  1177
                  SS         FDPCS  Y++ YLN+P+VQK+LHANVTGI GPW  CS  V  +W
Sbjct  319   PSFSTSSVLP------FDPCSEIYVHSYLNSPQVQKSLHANVTGIRGPWQDCSDTVLRHW  372

Query  1178  EDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKge  1357
             +D P TVLP+I+ELM SGISV++YSGD DG V   +  Y+INKL   VKT WYPWY +GE
Sbjct  373   KDSPLTVLPSIQELMTSGISVYIYSGDTDGMVPTISIRYSINKLGAKVKTAWYPWYIQGE  432

Query  1358  vggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
             VGGYVVGY++L+FVTIRGAGH VPS QP RAL FFS+F++GKLPP +
Sbjct  433   VGGYVVGYQNLTFVTIRGAGHMVPSSQPARALAFFSSFLDGKLPPAA  479



>ref|XP_006346530.1| PREDICTED: serine carboxypeptidase II-3-like [Solanum tuberosum]
Length=486

 Score =   530 bits (1366),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 293/474 (62%), Positives = 348/474 (73%), Gaps = 12/474 (3%)
 Frame = +2

Query  77    ECYSIGGRKFDPLESLLKTQKQKRQNNNAQTI-IMSAQDLGSVYIGAQDGLKDADKISAL  253
             +CY+    + D L   LK ++ K ++  +Q + +   Q   S ++  Q G K  DKISAL
Sbjct  20    QCYA---GEADVLREFLKARRTKTRDVVSQGLAVAEKQKSVSKFLVPQVGSKKNDKISAL  76

Query  254   PGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESET-PSDKPLVLWLnggpgcssfgnggM  430
             PGQP+G+ FAQ+SGYVTVD  AGRALFYY AES   PS KPL+LWLNGGPGCSSFGNGGM
Sbjct  77    PGQPKGINFAQYSGYVTVDANAGRALFYYLAESPNDPSTKPLLLWLNGGPGCSSFGNGGM  136

Query  431   MENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVTGDKKTAADNY  610
             +E GPFRVN D KTLWLN +AWN VANV+FLESPAGVGFSYSN SSDY TGD+KT  D++
Sbjct  137   VELGPFRVNEDGKTLWLNPFAWNKVANVLFLESPAGVGFSYSNTSSDYTTGDEKTRQDSF  196

Query  611   IFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAY  790
              FL+NW+ERFPEYK RD +I GESYAGHYVPQLAQLIL + K     +INL+GIA GNA 
Sbjct  197   TFLVNWMERFPEYKHRDFYIVGESYAGHYVPQLAQLILSHKKTKPNLVINLQGIATGNAL  256

Query  791   IDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYS  970
             +D+ET +SG+YDFYWTHALISDE H GI+ NCNFS+  S S+ CD +  +AD    NIYS
Sbjct  257   LDDETWNSGSYDFYWTHALISDEVHEGIVKNCNFSTETSTSEACDKYTSEADSCQANIYS  316

Query  971   YNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDS  1150
             YN Y+  C      SS+       GFDPCS +Y+  YLNT EVQKAL  NV  IP  W S
Sbjct  317   YNTYSQLC-----NSSAYTSLPIDGFDPCSDNYVDNYLNTIEVQKAL--NVRDIPHSWGS  369

Query  1151  CSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTP  1330
             CS D+   W+D PDTVLP  +ELM SGI VW+YSGDID  ++VTT+ Y INK+ T VKT 
Sbjct  370   CSNDIGGYWQDSPDTVLPIFQELMQSGIRVWIYSGDIDHILSVTTSRYDINKIKTPVKTA  429

Query  1331  WYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
             WYPW   GEVGGY V Y++L+FVT+RGAGHFVPSYQP RALT FS+F+ G LPP
Sbjct  430   WYPWSFHGEVGGYAVEYQNLTFVTVRGAGHFVPSYQPGRALTMFSSFINGTLPP  483



>gb|KDO49122.1| hypothetical protein CISIN_1g044068mg [Citrus sinensis]
Length=481

 Score =   527 bits (1358),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 292/467 (63%), Positives = 354/467 (76%), Gaps = 13/467 (3%)
 Frame = +2

Query  101   KFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQPEGVKF  280
             ++D L   +K Q++ R  + +     + ++L +VYIG Q+GLK+ADKI  LPGQP GV+ 
Sbjct  25    EYDLLGKFIKAQQEGRYVDYSGAPKEAGEEL-TVYIGPQEGLKEADKIEKLPGQPYGVEI  83

Query  281   AQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLnggpgcssfgnggMMENGPFRVNS  460
              Q+SGYVTVDP+AGRALFYYF ES+  S KPLVLWLNGGPGCSSFG G MME GPFRVNS
Sbjct  84    DQYSGYVTVDPKAGRALFYYFVESQNSSTKPLVLWLNGGPGCSSFGFGAMMELGPFRVNS  143

Query  461   DSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYV-TGDKKTAADNYIFLLNWLER  637
             D K+L  N+YAWNNVAN++FLESPAGVGFSYSN SSDYV  GD++TAAD+Y FLLNW ER
Sbjct  144   DGKSLSHNEYAWNNVANMLFLESPAGVGFSYSNTSSDYVMNGDERTAADSYTFLLNWFER  203

Query  638   FPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDSG  817
             FPEYK+R  F+ GESYAGHY+PQ+A  IL+ NK  NQT INLKG+A+G+A+ID ET + G
Sbjct  204   FPEYKSRAFFLAGESYAGHYIPQVALTILQFNK--NQTFINLKGLAMGDAWIDTETGNKG  261

Query  818   TYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFCs  997
              +DFYWTHALISDE   GI +NCNF+     S  C +++  A  SMGNI   +IYAP CS
Sbjct  262   MFDFYWTHALISDEVIHGINSNCNFTKF---SKACASYLIKAYESMGNINILDIYAPLCS  318

Query  998   sgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNW  1177
             S    SS         FDPCS  Y++ YLN+P+VQK+LHANVTGI GPW  CS  V  +W
Sbjct  319   SSFSTSSVLP------FDPCSEIYVHSYLNSPQVQKSLHANVTGIRGPWQDCSDTVLRHW  372

Query  1178  EDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKge  1357
             +D P TVLP+I+ELM SGISV++YSGD DG V   +T Y+INKL   VKT WYPWY +GE
Sbjct  373   KDSPLTVLPSIQELMTSGISVYIYSGDTDGMVPTISTRYSINKLEAKVKTAWYPWYIQGE  432

Query  1358  vggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
             VGGYVVGY++L+FV IRGAGH VPS QP RAL FFS+F++GKLPP +
Sbjct  433   VGGYVVGYQNLTFVAIRGAGHMVPSSQPARALAFFSSFLDGKLPPAA  479



>ref|XP_006346529.1| PREDICTED: serine carboxypeptidase II-3-like [Solanum tuberosum]
Length=463

 Score =   526 bits (1355),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 285/466 (61%), Positives = 344/466 (74%), Gaps = 12/466 (3%)
 Frame = +2

Query  101   KFDPLESLLKTQKQKRQNNNAQTI-IMSAQDLGSVYIGAQDGLKDADKISALPGQPEGVK  277
             + D L   LK ++ K  N     + +   Q   S +   Q G K+ DKISALPGQP G+ 
Sbjct  5     EVDVLREFLKARRVKTTNVIRHGVAVAEKQKSVSEFKVPQVGSKENDKISALPGQPSGIN  64

Query  278   FAQFSGYVTVDPQAGRALFYYFAESET-PSDKPLVLWLnggpgcssfgnggMMENGPFRV  454
             FAQ+SGYVTV+   GRALFYY AES   P+ KPLVLWLNGGPGCSSFGNGGM+E GPFRV
Sbjct  65    FAQYSGYVTVNADNGRALFYYLAESSADPTTKPLVLWLNGGPGCSSFGNGGMVELGPFRV  124

Query  455   NSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVTGDKKTAADNYIFLLNWLE  634
             N D KTLWLN++AWNNVAN++FLESPAGVGFSYSN SSDY +GD+KT  D++ FL+NW+E
Sbjct  125   NKDGKTLWLNQFAWNNVANILFLESPAGVGFSYSNTSSDYTSGDEKTRRDSFTFLVNWME  184

Query  635   RFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDS  814
             RFPEYK RD +I GESYAGHYVPQLAQLIL + K     +INL+GIA GNA +D+ET +S
Sbjct  185   RFPEYKNRDFYIVGESYAGHYVPQLAQLILSHKKSEPNLVINLQGIATGNALLDDETSNS  244

Query  815   GTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFC  994
             G+YDFYW+HALISDE H GI+ NCNFS+  + S+ CD +  +AD    NIYSYN Y+  C
Sbjct  245   GSYDFYWSHALISDEVHEGIVKNCNFSTETTTSEACDEYTSEADSCQANIYSYNTYSQLC  304

Query  995   ssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVN  1174
                   SS+       GFDPCS+DY++ YLNT EVQKAL  NV  IP  W+SCS    ++
Sbjct  305   -----YSSAYTSLPIDGFDPCSADYVFNYLNTAEVQKAL--NVRDIPQSWESCS---GIS  354

Query  1175  WEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKg  1354
             WED P TVLP  +ELM SGI VW+YSGDID  + VTT+ Y INK+ T +KT WYPW+ +G
Sbjct  355   WEDSPHTVLPIFQELMQSGIRVWIYSGDIDHILPVTTSRYGINKIKTPIKTAWYPWFFQG  414

Query  1355  evggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
             EVGGY V Y++L+FVT+RGAGHFVPSYQP RALT FS+F+ G LPP
Sbjct  415   EVGGYAVEYQNLTFVTVRGAGHFVPSYQPGRALTMFSSFINGTLPP  460



>ref|XP_009794620.1| PREDICTED: putative serine carboxypeptidase-like 23 [Nicotiana 
sylvestris]
Length=512

 Score =   528 bits (1359),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 284/467 (61%), Positives = 344/467 (74%), Gaps = 11/467 (2%)
 Frame = +2

Query  107   DPLESLLKTQKQKRQNNNAQTIIMSA---QDLGSVYIGAQDGLKDADKISALPGQPEGVK  277
             D L   LK ++    +    T  ++A   Q   S ++  Q G K+ DKISALPGQP GV 
Sbjct  51    DVLSKFLKARRANHLHTTRITNSLAADEKQRSVSGFLVPQVGSKEEDKISALPGQPSGVN  110

Query  278   FAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMENGPFRV  454
             F Q+SGYVTVD  AGRALFYYF ES + PS KPLVLWLNGGPGCSS G G MME GPFRV
Sbjct  111   FDQYSGYVTVDADAGRALFYYFTESTQDPSTKPLVLWLNGGPGCSSLGAGAMMELGPFRV  170

Query  455   NSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVTGDKKTAADNYIFLLNWLE  634
             N D KTLWLN +AWNNVAN++FLESPAGVGFSYSN SSDY+TGD+KT  D++ FL+NW+E
Sbjct  171   NKDGKTLWLNPFAWNNVANILFLESPAGVGFSYSNTSSDYITGDEKTRQDSFTFLVNWME  230

Query  635   RFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDS  814
             RFPEYK RD +ITGESYAGHYVPQLAQL+L + K     +INL+G+A GN  ID+ET  S
Sbjct  231   RFPEYKHRDFYITGESYAGHYVPQLAQLVLSHMKTEPNLVINLQGVATGNGVIDDETATS  290

Query  815   GTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFC  994
             G+YDFYWTHALISDE H GI++NCNFS+  S ++ C+ +   AD S GNIY+YNIY+  C
Sbjct  291   GSYDFYWTHALISDEIHEGIVSNCNFSAETSTTEACNKYTGQADSSQGNIYTYNIYSQLC  350

Query  995   ssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVN  1174
                   SS+       GFDPCS+DY+  YLNT  VQKAL  NV  IP  WDSC+  +  +
Sbjct  351   -----NSSAYFSLPIDGFDPCSADYVDNYLNTVGVQKAL--NVKDIPHSWDSCNGYIQGS  403

Query  1175  WEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKg  1354
             W+D P T+LP  +ELM +GI V +YSGD+D  + VTT+ YAI+K+ T VKTPWYPW+ +G
Sbjct  404   WQDSPHTMLPIFQELMQNGIRVLIYSGDVDHILPVTTSRYAIDKIKTPVKTPWYPWFFQG  463

Query  1355  evggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPK  1495
             EVGGY V Y++L+FVT+RGAGHFVPSYQP RALT FS+F+ G LPP 
Sbjct  464   EVGGYAVEYQNLTFVTVRGAGHFVPSYQPGRALTMFSSFINGTLPPH  510



>ref|XP_010315498.1| PREDICTED: serine carboxypeptidase II-3-like [Solanum lycopersicum]
Length=506

 Score =   527 bits (1358),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 290/491 (59%), Positives = 355/491 (72%), Gaps = 24/491 (5%)
 Frame = +2

Query  77    ECYSIGGRKFDPLESLLKTQKQKRQNNNAQTI-IMSAQDLGSVYIGAQDGLKDADKISAL  253
             +CY+    + D L   LK ++ K  N  +Q + +   Q   S +I  Q G K+ DKISAL
Sbjct  20    QCYA---GEVDVLREFLKARRTKTTNVISQGVAVAEKQRSVSEFIVPQVGSKENDKISAL  76

Query  254   PGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESET-PSDKPLVLWLnggpgcssfgnggM  430
             PGQP G+ FAQ+SGYVTV+  +GRALFYY AES   P+ KPLVLWLNGGPGCSSFGNGGM
Sbjct  77    PGQPSGINFAQYSGYVTVNADSGRALFYYLAESSNDPATKPLVLWLNGGPGCSSFGNGGM  136

Query  431   MENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVTGDKKTAADNY  610
             +E GPFRVN D KTLWLN++AWNNVANV+FLESPAGVGFSYSN SSDY +GD+KT  D++
Sbjct  137   VELGPFRVNKDGKTLWLNQFAWNNVANVLFLESPAGVGFSYSNTSSDYTSGDEKTKRDSF  196

Query  611   IFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAY  790
              FL+NW+ERFPEYK RD +I GESYAGHYVPQLAQLIL + K     +INL+GIA GNA 
Sbjct  197   TFLVNWMERFPEYKNRDFYIVGESYAGHYVPQLAQLILSHKKSEPNLVINLQGIATGNAL  256

Query  791   IDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYS  970
             +D+ET +SG+YDFYW+HALISDE H GII NCNFS+  + S+ CD F  +AD    N+Y 
Sbjct  257   LDDETSNSGSYDFYWSHALISDEVHEGIIKNCNFSTETTISEACDEFTSEADSCQANLYD  316

Query  971   YNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDS  1150
             YN Y+  C + S  +S  V     GFDPCS+DY++ YLNT EVQKAL  NV  IP  W+S
Sbjct  317   YNTYSQLC-NSSAYTSLPVSSQIDGFDPCSADYVFNYLNTAEVQKAL--NVRDIPQSWES  373

Query  1151  C----------------SQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVT  1282
             C                +    ++WED P TVLP  +ELM SGI VW+YSGDID  + VT
Sbjct  374   CRLIPLAINLITFLNILNLSSGISWEDSPHTVLPIFQELMQSGIRVWIYSGDIDHILPVT  433

Query  1283  TTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFF  1462
             T+ YAI+K+ T +KT WYPW+ +GEVGGY V Y++L+FVT+RGAGHFVPSYQP RALT F
Sbjct  434   TSRYAIDKIKTPIKTAWYPWFFQGEVGGYAVEYQNLTFVTVRGAGHFVPSYQPGRALTMF  493

Query  1463  SAFVEGKLPPK  1495
             S+F+ G LPP+
Sbjct  494   SSFINGTLPPR  504



>ref|XP_010315499.1| PREDICTED: serine carboxypeptidase II-3-like [Solanum lycopersicum]
Length=505

 Score =   525 bits (1351),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 293/490 (60%), Positives = 352/490 (72%), Gaps = 25/490 (5%)
 Frame = +2

Query  77    ECYSIGGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLG-SVYIGAQDGLKDADKISAL  253
             +CY+    + D L   LK ++ K +N  +Q + ++ + +  S +I  Q G K  DKISAL
Sbjct  20    QCYA---GEADVLREFLKARRTKTRNVMSQGLAVADKQISVSKFIVPQVGSKKNDKISAL  76

Query  254   PGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESET-PSDKPLVLWLnggpgcssfgnggM  430
             PGQP+G+ FAQ+SGYVTVD  AGRALFYYFAES   PS KPLVLWLNGGPGCSSFGNGGM
Sbjct  77    PGQPKGINFAQYSGYVTVDANAGRALFYYFAESSNDPSTKPLVLWLNGGPGCSSFGNGGM  136

Query  431   MENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVTGDKKTAADNY  610
              E GPFRVN D KTLWLN +AWN VANV+FLESPAGVGFSYSN SSDY TGD+KT  D++
Sbjct  137   AELGPFRVNEDGKTLWLNPFAWNKVANVLFLESPAGVGFSYSNTSSDYTTGDEKTRQDSF  196

Query  611   IFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAY  790
              FL+NW+ERF EYK R  +I GESYAGHYVPQLAQLIL   K  +  +INL+GIA GNA 
Sbjct  197   TFLVNWMERFSEYKNRYFYIIGESYAGHYVPQLAQLILSQKKTKHNLVINLQGIATGNAL  256

Query  791   IDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYS  970
             +D+ET +SG+YDFYWTHALISDE H GI+ NCNFS+  S S+ CD +  +AD   GNIYS
Sbjct  257   LDDETWNSGSYDFYWTHALISDEVHDGIVKNCNFSTETSTSEACDKYTSEADSCQGNIYS  316

Query  971   YNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDS  1150
             YN Y+  C   S   +S    S  GFDPCS+DY+  YLNT EVQKAL   V  IP  W+S
Sbjct  317   YNTYSQLC--NSSSYTSLPVSSIDGFDPCSADYVENYLNTAEVQKAL--KVRDIPHSWES  372

Query  1151  ----------------CSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVT  1282
                             CS D+   W+D P+TVLP  +ELM SGI VW+YSGD+D  ++VT
Sbjct  373   CRYFPINLITCFNPHLCSDDIGGYWQDSPNTVLPIFQELMQSGIRVWIYSGDVDHILSVT  432

Query  1283  TTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFF  1462
             T+ YAINK+ T +KT WYPW+  GEVGGY V Y++L+FVT+RGAGH VPSYQP RALT F
Sbjct  433   TSRYAINKIKTPIKTAWYPWFFNGEVGGYAVEYQNLTFVTVRGAGHLVPSYQPGRALTMF  492

Query  1463  SAFVEGKLPP  1492
             S+F+ G LPP
Sbjct  493   SSFINGTLPP  502



>ref|XP_010315500.1| PREDICTED: serine carboxypeptidase II-3-like [Solanum lycopersicum]
Length=479

 Score =   523 bits (1346),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 290/473 (61%), Positives = 349/473 (74%), Gaps = 19/473 (4%)
 Frame = +2

Query  77    ECYSIGGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALP  256
             +CY+    + D +   LK ++ K    +  + + +A+   +V++ +Q G K+ DKISALP
Sbjct  22    KCYA---GETDVVREFLKARRVK-STPSINSGLAAAEKRRAVFV-SQVGSKEDDKISALP  76

Query  257   GQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMM  433
             GQP GV F Q+SGYVTVD  +GRALFYYF ES + PS KPLVLWLNGGPGCSSFG G MM
Sbjct  77    GQPSGVSFDQYSGYVTVDADSGRALFYYFTESTQDPSTKPLVLWLNGGPGCSSFGAGAMM  136

Query  434   ENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVTGDKKTAADNYI  613
             E GPFRVN D KTLWLN +AWNNVAN++FLESPAGVGFSYSN SSDY TGD+KT  D++ 
Sbjct  137   ELGPFRVNKDGKTLWLNPFAWNNVANILFLESPAGVGFSYSNTSSDYTTGDEKTRQDSFT  196

Query  614   FLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYI  793
             FL+NW+ERFPEYK RD +ITGESYAGHYVPQLAQLIL   K     +INL+G+A GN  I
Sbjct  197   FLINWMERFPEYKHRDFYITGESYAGHYVPQLAQLILSYKKTEPNLVINLQGLATGNGII  256

Query  794   DEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSY  973
             D+ET +SGTYDFYWTHALISDE H GI+ NCNF SA + S+ C+ ++  AD   GNIY+Y
Sbjct  257   DDETMNSGTYDFYWTHALISDEVHDGIVLNCNF-SAETTSEACNEYIKQADSCQGNIYAY  315

Query  974   NIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSC  1153
             N Y+  C      SS+       GFDPCS+DY+  YLNT EVQKAL  NV   P  WDSC
Sbjct  316   NTYSQLC-----NSSAYTSLPIHGFDPCSADYVENYLNTAEVQKAL--NVKDAPYSWDSC  368

Query  1154  SQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPW  1333
                +     D P +VLP  +ELM SGI VW+YSGDID  ++VTT+TYAINK+ T VKTPW
Sbjct  369   KLII-----DSPHSVLPVFQELMQSGIRVWIYSGDIDHMLSVTTSTYAINKIKTPVKTPW  423

Query  1334  YPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
             YPW+ +GEVGGY V YE+L+FVT+RGAGHFVPSYQP RALT FS+F+ G LPP
Sbjct  424   YPWFFQGEVGGYAVEYENLTFVTVRGAGHFVPSYQPGRALTMFSSFINGTLPP  476



>ref|XP_010916829.1| PREDICTED: serine carboxypeptidase II-3-like [Elaeis guineensis]
Length=459

 Score =   511 bits (1316),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 281/463 (61%), Positives = 342/463 (74%), Gaps = 12/463 (3%)
 Frame = +2

Query  113   LESLLKTQKQKRQ-NNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQPEGVKFAQF  289
             L  L+K+Q+     ++  QT   S +    VY+G Q+G  +ADKI  LPGQPEGV F Q+
Sbjct  4     LRELMKSQRSSSTLHHGLQTHPASKKTYSPVYVGPQNGQMEADKIDELPGQPEGVNFDQY  63

Query  290   SGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMENGPFRVNSDS  466
             +GYVTVDP+AGRALFYYF ES + PS KPLVLWLNGGPGCSS G G M+E GPF VNSD 
Sbjct  64    AGYVTVDPEAGRALFYYFVESPQDPSTKPLVLWLNGGPGCSSLGAGAMVELGPFGVNSDG  123

Query  467   KTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFLLNWLERFP  643
             +TL+ N +AWN VANVIFLESPAGVGFSYSN ++DY ++GDK+TA D+Y FL+NWLERFP
Sbjct  124   RTLYANIHAWNIVANVIFLESPAGVGFSYSNTTTDYELSGDKRTAEDSYTFLVNWLERFP  183

Query  644   EYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDSGTY  823
             +YKTRD ++TGESYAGHY+P+LA LIL NNKI N+T INLKG+AIGNAYID++T    TY
Sbjct  184   QYKTRDFYMTGESYAGHYIPELASLILANNKIMNRTAINLKGVAIGNAYIDDDTNTRATY  243

Query  824   DFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFCssg  1003
             D+YWTHALISDE ++ I + C F S  S +  C + +  AD  +GNI  Y+IYAP C   
Sbjct  244   DYYWTHALISDEAYKEIRSKCTF-SGQSYTPGCVSALTAADAEVGNIDYYDIYAPLC---  299

Query  1004  sglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWED  1183
                 S +   +    DPC+  Y + YLN PEVQKALHANVTG+  PW  C      NW D
Sbjct  300   -KDPSKTTHLTKLEVDPCAGSYTWSYLNLPEVQKALHANVTGLWYPWSRCRG----NWTD  354

Query  1184  MPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevg  1363
              PDT+LPTIKEL+ SGISVWLYSGD D  V VT+T Y+I+ L   +++ W PWY  GEVG
Sbjct  355   APDTLLPTIKELISSGISVWLYSGDQDSVVPVTSTRYSIDMLGLGIESSWRPWYIDGEVG  414

Query  1364  gyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
             GYVVGY+ L+F T+RGAGH VPSYQPER+LT  S+F+EGKLPP
Sbjct  415   GYVVGYKGLTFATVRGAGHMVPSYQPERSLTMISSFLEGKLPP  457



>gb|KDP38391.1| hypothetical protein JCGZ_04316 [Jatropha curcas]
Length=488

 Score =   509 bits (1311),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 277/437 (63%), Positives = 329/437 (75%), Gaps = 10/437 (2%)
 Frame = +2

Query  197   SVYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESE-TPSDKP  373
             SVY+G QDGL  ADKI +LPGQP+GV F Q++GYVTVDP+ GRALFYYF ES    S KP
Sbjct  57    SVYVGRQDGLMKADKIGSLPGQPQGVDFDQYAGYVTVDPENGRALFYYFVESPYNSSTKP  116

Query  374   LVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSY  553
             LVLWLNGGPGCSSFG G M E GPFRVNSD KTL+ NKYAWNNVANVIFLESPAGVGFSY
Sbjct  117   LVLWLNGGPGCSSFGYGAMEELGPFRVNSDGKTLYRNKYAWNNVANVIFLESPAGVGFSY  176

Query  554   SNRSSDYVTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNN  733
             SN SSDY+TGDKKTA D+Y FL+NWLER+P+YKTRD +ITGESYAGHY PQLA  IL NN
Sbjct  177   SNTSSDYITGDKKTAEDSYTFLVNWLERYPQYKTRDFYITGESYAGHYAPQLAYTILSNN  236

Query  734   KITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPS  913
               +N T INLKGIAIGNA+ID+ T   GTYD+YWTHAL SDETH GI   C+F +  + S
Sbjct  237   NNSNHTKINLKGIAIGNAWIDQNTGLKGTYDYYWTHALNSDETHAGITKYCDFVT-GNFS  295

Query  914   DTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTP  1093
             + C  + D  DR +G I +YNIYAP C       +S    S + FDPCSS+Y++ YLN  
Sbjct  296   NICYQYQDLGDREIGVIDNYNIYAPLC--DQSKLNSVSTASVKDFDPCSSNYVHSYLNLT  353

Query  1094  EVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKV  1273
             EVQK LHA     P  WDSCS  V +++ D+P TVLPT+K+L+ SGI +W+YSGD D  V
Sbjct  354   EVQKVLHAK----PTEWDSCS--VVLDYTDIPPTVLPTVKQLIASGIRIWIYSGDTDSVV  407

Query  1274  AVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERAL  1453
             +VT++ YAIN     + T W PWY+  EVGGY+  YE ++ +T+RGAGH VPSYQPERAL
Sbjct  408   SVTSSRYAINNFKLPIHTAWRPWYTSSEVGGYLEEYEGITLITVRGAGHTVPSYQPERAL  467

Query  1454  TFFSAFVEGKLPPKSAE  1504
             T  S+F++GKLP K+ E
Sbjct  468   TMISSFLQGKLPHKTIE  484



>ref|XP_006346528.1| PREDICTED: serine carboxypeptidase II-3-like [Solanum tuberosum]
Length=527

 Score =   504 bits (1297),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 287/498 (58%), Positives = 349/498 (70%), Gaps = 16/498 (3%)
 Frame = +2

Query  8     RATMKGGCMFIllaavvhllvfaECYSIGGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQ  187
             R  M+   +  L   +  L     CY+    + D L   LK +  K  +    ++  S +
Sbjct  41    RKKMRANSVLTLSLILCCLSAQQYCYA---GEADVLREFLKNRWAKTTSIINHSLPASEK  97

Query  188   DLG-SVYIGAQDGLKDADKISALPGQPE-GVKFAQFSGYVTVDPQAGRALFYYFAESE-T  358
                 S  I  Q+G K+ DKISALP QP   V+F Q++GYVTVD  AGRALFYY AES   
Sbjct  98    QRSVSELIVPQEGSKENDKISALPEQPSSAVRFNQYAGYVTVDANAGRALFYYLAESSGD  157

Query  359   PSDKPLVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAG  538
             PS KPLVLWLNGGPGCSS G G M E GPFRVN+D KTLWLN++AWNNVAN++FLESPAG
Sbjct  158   PSTKPLVLWLNGGPGCSSLGAGAMDELGPFRVNNDGKTLWLNQFAWNNVANILFLESPAG  217

Query  539   VGFSYSNRSSDYVTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQL  718
             VGFSYSN S+DY+TGD+KT  D++ FLLNW+ERFPEYK RD +I GESYAGHYVPQLAQL
Sbjct  218   VGFSYSNTSADYITGDEKTRQDSFTFLLNWMERFPEYKHRDFYIVGESYAGHYVPQLAQL  277

Query  719   ILRNNKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSS  898
             IL + K     +INL+GIA GNA +D ET  SG+YDFYWTHALISDE H GI+ NCNF S
Sbjct  278   ILSHRKTEPNLVINLQGIATGNALLDFETMQSGSYDFYWTHALISDEVHDGIVLNCNF-S  336

Query  899   AASPSDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYV  1078
             A + S+ C+ ++  AD S+GNIY+Y+IYAP C       +++      GFDPCS +Y+  
Sbjct  337   AETTSEACNEYIKQADSSLGNIYAYDIYAPLC-----DPNANTSLPVCGFDPCSDNYVNS  391

Query  1079  YLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGD  1258
             YLN+ EVQKAL  NV  IP  W  C+   +++W+D P TVL   +ELM SGI VW+YSGD
Sbjct  392   YLNSAEVQKAL--NVRRIPYSWAPCAS--HLHWKDSPYTVLLVFQELMQSGIRVWIYSGD  447

Query  1259  IDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQ  1438
              D  + VTTT Y INK+   VKTPWY WY +GEVGGY V YE+L+FVT+RGAGHFVPSYQ
Sbjct  448   TDSVLPVTTTRYDINKIKIPVKTPWYSWYFQGEVGGYAVEYENLTFVTVRGAGHFVPSYQ  507

Query  1439  PERALTFFSAFVEGKLPP  1492
             P RALT FS+F+ G LPP
Sbjct  508   PGRALTMFSSFINGTLPP  525



>ref|XP_007224802.1| hypothetical protein PRUPE_ppa023729mg, partial [Prunus persica]
 gb|EMJ26001.1| hypothetical protein PRUPE_ppa023729mg, partial [Prunus persica]
Length=485

 Score =   501 bits (1290),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 285/476 (60%), Positives = 345/476 (72%), Gaps = 13/476 (3%)
 Frame = +2

Query  86    SIGGRKFDPLESLLKTQKQKR--QNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPG  259
             S    + + L  LL+++K        + +++  +   + ++Y+G  DGLK+ADKI ALPG
Sbjct  18    SCNANQIENLNKLLRSRKSANPPHPKSWESLDFADGQVSALYVGTHDGLKEADKIGALPG  77

Query  260   QPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMME  436
             QP+GV F Q+ GYVTVDPQAGRALFYYF ES +  S KPLVLWLNGGPGCSSFG G M E
Sbjct  78    QPQGVDFDQYGGYVTVDPQAGRALFYYFVESPQNSSTKPLVLWLNGGPGCSSFGYGAMEE  137

Query  437   NGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYV-TGDKKTAADNYI  613
              GPFRVNSD KTL+ N+YAWN+VANV+FLESPAGVGFSYSN +SDY   GDK+TA D+Y 
Sbjct  138   LGPFRVNSDRKTLFQNEYAWNHVANVLFLESPAGVGFSYSNTTSDYENVGDKRTAQDSYK  197

Query  614   FLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQT-IINLKGIAIGNAY  790
             FL+NWLERFP+YKTRD FITGESYAGHYVPQLA  IL++NK TNQT IINLKGIAIGNA+
Sbjct  198   FLINWLERFPQYKTRDFFITGESYAGHYVPQLASTILQHNKATNQTNIINLKGIAIGNAW  257

Query  791   IDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYS  970
             ID+ T   G YD+ W+HAL SDET+ GI   C+F+S  S S +CD + + A    GN+  
Sbjct  258   IDDSTGQLGIYDYLWSHALNSDETNAGIHKYCDFASDNS-SSSCDKYQNQAGDEAGNVDI  316

Query  971   YNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDS  1150
             YNIYAP C      S SS  GS  GFDPCS  Y+  YLN  EVQ ALH      P  W +
Sbjct  317   YNIYAPLCKISQAKSPSSSTGSVNGFDPCSDYYVDTYLNLVEVQAALHVK----PTNWSA  372

Query  1151  CSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTP  1330
             C     V W D P T+LPTIK+L+ SGIS+W+YSGD DG+V  T++ YA++ L   ++T 
Sbjct  373   CG---GVGWTDSPTTMLPTIKQLIASGISLWIYSGDNDGRVPFTSSRYALSTLKLPLQTT  429

Query  1331  WYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
             W PWYS  EVGGYV GY+ L+F TIRGAGH VPSYQP+RALTF S+F++GKLPP S
Sbjct  430   WRPWYSNTEVGGYVAGYKGLTFATIRGAGHMVPSYQPQRALTFISSFLQGKLPPTS  485



>ref|XP_010664592.1| PREDICTED: serine carboxypeptidase-like 40 [Vitis vinifera]
Length=485

 Score =   498 bits (1282),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 277/467 (59%), Positives = 345/467 (74%), Gaps = 10/467 (2%)
 Frame = +2

Query  92    GGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQPEG  271
             GGR F+P+  L++    K + ++  T   ++  L +      DGLK++ KI +LPGQP G
Sbjct  23    GGRGFNPIGKLIREGLSKGRLSDEWT--WTSFPLNTTSKFPLDGLKESHKIESLPGQPNG  80

Query  272   VKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMENGPF  448
             V F QFSGYVTVD  AGRALFYYF ES +  + KPLVLWLNGGPGCSSFG G MME GPF
Sbjct  81    VDFDQFSGYVTVDSLAGRALFYYFVESPQNSTTKPLVLWLNGGPGCSSFGIGAMMELGPF  140

Query  449   RVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFLLN  625
             RVN D +TL+LNK+AWN  AN+IFLESPAGVGFSYS+ +SDY  +GD +TA+D+YIFLL+
Sbjct  141   RVNKDGETLYLNKHAWNKEANIIFLESPAGVGFSYSDTASDYNSSGDYRTASDSYIFLLS  200

Query  626   WLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEET  805
             WLE FPEYKTRD FI GE YAGHYVPQLAQ IL  N I +  IINL+GIA+GN Y+D ET
Sbjct  201   WLEIFPEYKTRDFFIAGEGYAGHYVPQLAQTILLFNSIPDLPIINLRGIAMGNPYVDRET  260

Query  806   QDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYA  985
                G  D+YW+HALISDE +  +I NCN SS  S S+ C  ++  AD +MGNI  Y+IYA
Sbjct  261   AFKGIVDYYWSHALISDEIYMELILNCNVSSEESASEECIAWLLQADNAMGNINVYDIYA  320

Query  986   PFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDV  1165
             P C+S +  +S S       FDPCS +YI+ YLN P+VQ+ALHANVTG+P PW+ CS ++
Sbjct  321   PLCNSSADSNSISA------FDPCSGNYIHAYLNIPQVQEALHANVTGLPCPWEFCSVNI  374

Query  1166  NVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWY  1345
                W+D P T+LP+I+ELM SGI VW+YSGD DG V VT++ Y I KL T V+TPW+PWY
Sbjct  375   FGMWKDSPATMLPSIQELMSSGIQVWIYSGDTDGVVPVTSSRYFIKKLGTLVRTPWHPWY  434

Query  1346  SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKL  1486
             + GEVGGY V Y++L+FVT+RG+GHFVPSYQP R+L  F +F+ G L
Sbjct  435   THGEVGGYAVEYQNLTFVTVRGSGHFVPSYQPARSLQLFCSFLNGTL  481



>ref|XP_009370169.1| PREDICTED: serine carboxypeptidase II-3-like isoform X1 [Pyrus 
x bretschneideri]
Length=505

 Score =   497 bits (1280),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 274/435 (63%), Positives = 327/435 (75%), Gaps = 11/435 (3%)
 Frame = +2

Query  200   VYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPL  376
             VY+G QDGLK+ADKI +LPGQP+GV F Q++GYVTVD +AGRALFYYF ES +  S KPL
Sbjct  80    VYVGLQDGLKEADKIGSLPGQPQGVNFDQYAGYVTVDQKAGRALFYYFVESPQDSSTKPL  139

Query  377   VLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYS  556
             +LWLNGGPGCSS G G M E GPFRVN+D KTL+ N YAWNNVANVIFLESPAGVGFSYS
Sbjct  140   LLWLNGGPGCSSLGYGAMEEIGPFRVNNDRKTLFRNDYAWNNVANVIFLESPAGVGFSYS  199

Query  557   NRSSDYV-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNN  733
               +SDY   GDK+TA D+Y FL+NWLERFP+YKTRD FITGESYAGHYVPQLA  IL NN
Sbjct  200   YTTSDYGDVGDKRTAEDSYKFLVNWLERFPQYKTRDFFITGESYAGHYVPQLASTILLNN  259

Query  734   KITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPS  913
             K+T QT INLKGIAIGNA+ID+ T + G YD+ WTH++ SDET+ GI   C+FSS  + S
Sbjct  260   KVTKQTKINLKGIAIGNAWIDDSTGELGIYDYVWTHSMNSDETNAGIHKYCDFSS-GNFS  318

Query  914   DTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTP  1093
               CD +    +  +GN+  YNIYAP C   S  + S  + S   FDPCS +Y+  YLN  
Sbjct  319   SACDKYRSQVEEELGNVDIYNIYAPPC-KTSEPTKSLSKSSIDDFDPCSDNYVKTYLNLK  377

Query  1094  EVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKV  1273
             EVQ ALHA     P  W +C     V W D P T+LPTIK+L+ SGIS+W+YSGDIDG+V
Sbjct  378   EVQAALHAK----PTEWSACG---GVGWTDSPTTILPTIKQLIASGISLWIYSGDIDGRV  430

Query  1274  AVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERAL  1453
              VT++ YAIN     ++TPW  WYS G+VGGYV GY+ L+F TIRGAGH VPSYQP+R+L
Sbjct  431   PVTSSRYAINTFKLPLQTPWRAWYSNGQVGGYVAGYKGLTFTTIRGAGHMVPSYQPQRSL  490

Query  1454  TFFSAFVEGKLPPKS  1498
             TF S+F++GKLPP S
Sbjct  491   TFISSFLQGKLPPSS  505



>gb|KDO66312.1| hypothetical protein CISIN_1g039871mg [Citrus sinensis]
Length=503

 Score =   495 bits (1275),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 264/432 (61%), Positives = 319/432 (74%), Gaps = 13/432 (3%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLn  391
             Q G  + DKI+ALPGQP G+ F Q++GYVTVD QAGRALFYYF ES E  S  PLVLWLN
Sbjct  82    QTGSMEQDKINALPGQPNGIGFNQYAGYVTVDAQAGRALFYYFVESPENSSTNPLVLWLN  141

Query  392   ggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSD  571
             GGPGCSSFGNG M E GPFRVNSD KTL+ N+YAWNNVANVIFLESPAGVGFSYSN +SD
Sbjct  142   GGPGCSSFGNGAMTELGPFRVNSDGKTLFQNEYAWNNVANVIFLESPAGVGFSYSNTTSD  201

Query  572   Y-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQ  748
             Y   GD  TAAD+Y FL+NWLERFP+YK RD FITGESYAGHYVPQLA  I+ +NK+ NQ
Sbjct  202   YDHAGDNSTAADSYTFLVNWLERFPQYKNRDFFITGESYAGHYVPQLADTIVSHNKVANQ  261

Query  749   TIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDT  928
             TIINLKG+AIGN  +++ T + G  DFYW+HALISDE+++GI   C+F+S  S ++ CD 
Sbjct  262   TIINLKGVAIGNGVLNDPTDEWGAVDFYWSHALISDESYKGIHTYCDFTSENS-TEQCDK  320

Query  929   FVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKA  1108
             F+  +   +G+I+ YNIYAPFC      +  +  GS   FDPCS DY+  YLN+P+VQ A
Sbjct  321   FLSQSSDEIGDIFGYNIYAPFC--NGTGTQGNPSGSVNEFDPCSRDYVNTYLNSPQVQTA  378

Query  1109  LHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTT  1288
             LH N    P  W SCS    + W D P TVLP IK+LM +GI VW+YSGDIDG V +T+T
Sbjct  379   LHVN----PTKWSSCSA---IGWTDSPPTVLPLIKDLMANGIRVWIYSGDIDGVVPITST  431

Query  1289  TYAINKLNTSVKTPWYPWYSKgevggyvvgyeD-LSFVTIRGAGHFVPSYQPERALTFFS  1465
              Y+I+ LN  +KTPWYPWY      G  V   + L+FVT+RGAGHFVPSYQP+RAL   +
Sbjct  432   RYSISSLNLPIKTPWYPWYINANEVGGYVEGYEGLTFVTVRGAGHFVPSYQPKRALVMIA  491

Query  1466  AFVEGKLPPKSA  1501
             +F++G LPP  +
Sbjct  492   SFLQGILPPSES  503



>ref|XP_006470494.1| PREDICTED: serine carboxypeptidase-like 40-like [Citrus sinensis]
Length=503

 Score =   495 bits (1274),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 265/432 (61%), Positives = 319/432 (74%), Gaps = 13/432 (3%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLn  391
             Q G  + DKI+ALPGQP G+ F Q++GYVTVD QAGRALFYYF ES E  S  PLVLWLN
Sbjct  82    QTGSMEQDKINALPGQPNGIGFNQYAGYVTVDAQAGRALFYYFVESPENSSTNPLVLWLN  141

Query  392   ggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSD  571
             GGPGCSSFGNG M E GPFRVNSD KTL+ N+YAWNNVANVIFLESPAGVGFSYSN +SD
Sbjct  142   GGPGCSSFGNGAMTELGPFRVNSDGKTLFQNEYAWNNVANVIFLESPAGVGFSYSNTTSD  201

Query  572   Y-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQ  748
             Y   GD  TAAD+Y FL+NWLERFP+YK RD FITGESYAGHYVPQLA  I+ +NK+ NQ
Sbjct  202   YDHAGDNSTAADSYTFLVNWLERFPQYKNRDFFITGESYAGHYVPQLADTIVSHNKVANQ  261

Query  749   TIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDT  928
             TIINLKG+AIGN  +++ T + G  DFYW+HALISDE+++GI   C+F+S  S ++ CD 
Sbjct  262   TIINLKGVAIGNGVLNDPTDEWGAVDFYWSHALISDESYKGIHTYCDFTSENS-TEQCDK  320

Query  929   FVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKA  1108
             F+  +   +G+I+ YNIYAPFC      +  +  GS   FDPCS DY+  YLN+P+VQ A
Sbjct  321   FLSQSSDEIGDIFGYNIYAPFC--NGTGTQGNPSGSVNEFDPCSRDYVDTYLNSPQVQTA  378

Query  1109  LHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTT  1288
             LH N    P  W SCS    + W D P TVLP IK+LM +GI VW+YSGDIDG V VT+T
Sbjct  379   LHVN----PTKWSSCSA---IGWTDSPPTVLPLIKDLMANGIRVWIYSGDIDGVVPVTST  431

Query  1289  TYAINKLNTSVKTPWYPWYSKgevggyvvgyeD-LSFVTIRGAGHFVPSYQPERALTFFS  1465
              Y+I+ LN  +KTPWYPWY      G  V   + L+FVT+RGAGHFVPSYQP+RAL   +
Sbjct  432   RYSISSLNLPIKTPWYPWYLNANEVGGYVEGYEGLTFVTVRGAGHFVPSYQPKRALVMIA  491

Query  1466  AFVEGKLPPKSA  1501
             +F++G LPP  +
Sbjct  492   SFLQGILPPSES  503



>ref|XP_009777076.1| PREDICTED: putative serine carboxypeptidase-like 23 [Nicotiana 
sylvestris]
Length=489

 Score =   494 bits (1271),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 265/434 (61%), Positives = 322/434 (74%), Gaps = 8/434 (2%)
 Frame = +2

Query  200   VYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPS-DKPL  376
             V++  Q+ LK+ DKI  LPGQP+GV F Q+SGYVTVDP AGR LFYYF ES   S  KPL
Sbjct  60    VHVRPQNLLKENDKIEQLPGQPQGVDFNQYSGYVTVDPTAGRNLFYYFVESPQDSGSKPL  119

Query  377   VLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYS  556
             VLWLNGGPGCSS G G   E GPFRV+ D  +L  N+++W + AN+IFLESPAGVGFSY+
Sbjct  120   VLWLNGGPGCSSLGGGAFGELGPFRVSKDG-SLQRNQFSWISEANIIFLESPAGVGFSYT  178

Query  557   NRSSDY-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNN  733
             N S+DY  +GD+ TA D+Y FL+NWLERFPEYKTRD ++TGESYAGHYVPQLAQLIL +N
Sbjct  179   NTSTDYNSSGDRTTAIDSYTFLVNWLERFPEYKTRDFYLTGESYAGHYVPQLAQLILLHN  238

Query  734   KITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPS  913
               TN TIINLKGI IGNAY+D E    GT ++YW+HALISDE +  I ++CNFS+ +S S
Sbjct  239   NYTNHTIINLKGITIGNAYVDFEANMKGTTEYYWSHALISDELYYKITSSCNFSTPSSAS  298

Query  914   DTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTP  1093
               C   +D  D+ +GNI+ YNIYAP C      ++S    ++   DPC   YI  Y N P
Sbjct  299   KKCKDHLDQIDKEIGNIFLYNIYAPLC-----NNTSPSNTTTSEVDPCMPVYIQSYFNKP  353

Query  1094  EVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKV  1273
             EVQKA+HANVT +P PW SC+  +N++W+D P TVLP I++LM SG+ +WLYSGD+D  V
Sbjct  354   EVQKAIHANVTSLPYPWQSCNNTLNLSWKDRPLTVLPLIRQLMKSGLRIWLYSGDMDVVV  413

Query  1274  AVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERAL  1453
              VT T YAI KL   +KT WYPWY + EVGGYV  YE+L+ VTIRGAGHFVP+YQP RAL
Sbjct  414   PVTDTRYAIKKLKLPIKTAWYPWYFQEEVGGYVEEYENLTLVTIRGAGHFVPTYQPSRAL  473

Query  1454  TFFSAFVEGKLPPK  1495
              FFS F+ GKLPPK
Sbjct  474   AFFSYFLSGKLPPK  487



>ref|XP_006354958.1| PREDICTED: serine carboxypeptidase-like 40-like [Solanum tuberosum]
Length=496

 Score =   493 bits (1268),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 278/484 (57%), Positives = 342/484 (71%), Gaps = 21/484 (4%)
 Frame = +2

Query  77    ECYSIGGRKFDPLESLLKTQKQKRQNNNAQ-----TIIMSAQDLGSVYIGAQDGLKDADK  241
              CY    +   P+    K   +K   NN +     +    +Q    V+ G Q+ LK++DK
Sbjct  22    HCYK--PKSLKPIGHYFKQNLEKFTTNNPEFNSSSSSKFVSQRTSPVHFGTQNSLKESDK  79

Query  242   ISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSD---KPLVLWLnggpgcss  412
             I  LPG+PEGV F Q+SGYVTVD  AGRALFYYF ES  PSD   KPLVLWLNGGPGCSS
Sbjct  80    IEKLPGEPEGVDFNQYSGYVTVDSSAGRALFYYFVES--PSDSASKPLVLWLNGGPGCSS  137

Query  413   fgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDK  589
              G G   E GPFRVN D  TL  N+++W + AN+IFLESPAGVGFSY+N SSD+  +GD+
Sbjct  138   LGGGAFGELGPFRVNKDG-TLQRNQFSWISEANIIFLESPAGVGFSYTNTSSDFNFSGDR  196

Query  590   KTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTI--INL  763
              TA D+Y FL+NWLERFPEYK  D ++ GESYAGHYVPQLAQLIL++N  +N+TI  INL
Sbjct  197   TTARDSYTFLVNWLERFPEYKANDFYLIGESYAGHYVPQLAQLILQHNNNSNKTISTINL  256

Query  764   KGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDA  943
             KGIAIGNAY+D E    GT ++YW+HALIS+E +  II+ CNFSS +S S  C+ ++D  
Sbjct  257   KGIAIGNAYVDFEANMKGTTEYYWSHALISEELYNKIISTCNFSSPSSVSKKCNAYLDQI  316

Query  944   DRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANV  1123
             D   GNI+ YN+YAP C++GS  S+S         DPC  +YI  Y N PEVQKA+HANV
Sbjct  317   DEETGNIFIYNVYAPLCNNGSPSSTSISDV-----DPCLPNYIQSYFNIPEVQKAMHANV  371

Query  1124  TGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAIN  1303
             T +P PW+SC+  +N+NW+D P +VLP + +LM S + +WLYSGD+D  V VT T YAI 
Sbjct  372   TNLPYPWESCNNTLNLNWKDRPLSVLPLLHQLMKSELRIWLYSGDMDVVVPVTDTRYAIK  431

Query  1304  KLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGK  1483
             KLN SVKT WYPWY +GEVGGYV  YE+L+ VTIRGAGHFVP+YQP RAL FFS F+ GK
Sbjct  432   KLNLSVKTSWYPWYLQGEVGGYVEEYENLTLVTIRGAGHFVPTYQPNRALAFFSHFLSGK  491

Query  1484  LPPK  1495
              P K
Sbjct  492   PPHK  495



>ref|XP_010041326.1| PREDICTED: serine carboxypeptidase II-3-like [Eucalyptus grandis]
 gb|KCW44445.1| hypothetical protein EUGRSUZ_L02059 [Eucalyptus grandis]
Length=482

 Score =   492 bits (1266),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 275/468 (59%), Positives = 341/468 (73%), Gaps = 12/468 (3%)
 Frame = +2

Query  101   KFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQPEGVKF  280
             + D L++L K  + ++  N   +   + +   SVY+G Q GL +ADKI+ALPGQP+GV F
Sbjct  25    RADQLDNLKKLLESRKSRNLPDSKPWNLEKASSVYVGPQKGLMEADKITALPGQPDGVDF  84

Query  281   AQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMENGPFRVN  457
              Q++GYVTV+P+AGRALFYYF ES +  S KPLVLWLNGGPGCSS G G M E GPFRV+
Sbjct  85    DQYAGYVTVNPKAGRALFYYFVESPQNSSTKPLVLWLNGGPGCSSLGYGAMEELGPFRVH  144

Query  458   SDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYV-TGDKKTAADNYIFLLNWLE  634
             SD KTL+ N YAWNNVANVIFLESPAGVGFSYSN SSDY   GD  TA D+Y FL+NWL+
Sbjct  145   SDGKTLYRNNYAWNNVANVIFLESPAGVGFSYSNTSSDYAKAGDNSTADDSYTFLVNWLD  204

Query  635   RFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDS  814
             RFP+YKTRD +ITGESYAGHYVPQLA  I+  NK  NQT INLKGIAIGNA+ID+     
Sbjct  205   RFPQYKTRDFYITGESYAGHYVPQLAYTIVSRNKNPNQTHINLKGIAIGNAWIDDNMCLK  264

Query  815   GTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFC  994
             G Y+++WTHAL SDETH GI+ NC+F +  S S  CD +  ++ +  G++  YNIYAPFC
Sbjct  265   GMYEYFWTHALNSDETHAGIMKNCDFVTGKS-SIACDQYTSESAQEHGDLDIYNIYAPFC  323

Query  995   ssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVN  1174
                     SS  GS   FDPCS +Y+  YLN PEVQ ALHA     P  W +C+   +  
Sbjct  324   --KPTGPKSSSSGSVNDFDPCSDNYVDSYLNRPEVQAALHAK----PTQWSACT---DFP  374

Query  1175  WEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKg  1354
             W D P T+LPTI++L+ SGI VW+YSGDIDG+V VT++ Y++N L   VKT W PW+S G
Sbjct  375   WTDSPATILPTIQQLIASGIDVWVYSGDIDGRVPVTSSRYSLNALKLPVKTAWRPWHSNG  434

Query  1355  evggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
             EVGGYV+GY+ ++  T+RGAGH VPSY+PERALT  +AF++G+LPP S
Sbjct  435   EVGGYVIGYKGVTLTTVRGAGHTVPSYEPERALTLIAAFLQGQLPPIS  482



>gb|KCW66184.1| hypothetical protein EUGRSUZ_F00022 [Eucalyptus grandis]
Length=480

 Score =   491 bits (1265),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 271/468 (58%), Positives = 338/468 (72%), Gaps = 14/468 (3%)
 Frame = +2

Query  101   KFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQPEGVKF  280
             + D L++L K  + ++  N   +   + +   SVY+G Q GL +ADKI+ALPGQP+GV F
Sbjct  25    RADQLDNLKKLLESRKSRNLPDSKPWNLEKASSVYVGPQKGLMEADKITALPGQPDGVDF  84

Query  281   AQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMENGPFRVN  457
              Q++GYVTV+P+AGRALFYYF ES +  S KPLVLWLNGGPGCSS G G M E GPFRV+
Sbjct  85    DQYAGYVTVNPKAGRALFYYFVESPQNSSTKPLVLWLNGGPGCSSLGYGAMEELGPFRVH  144

Query  458   SDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYV-TGDKKTAADNYIFLLNWLE  634
             SD KTL+ N YAWNNVANVIFLESPAGVGFSYSN SSDY   GD  TA D+Y FL+NWL+
Sbjct  145   SDGKTLYRNNYAWNNVANVIFLESPAGVGFSYSNTSSDYAKAGDNSTADDSYTFLVNWLD  204

Query  635   RFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDS  814
             RFP+YKTRD +ITGESYAGHYVPQLA  I+  NK  NQT INLKGIAIGNA+ID+     
Sbjct  205   RFPQYKTRDFYITGESYAGHYVPQLAYTIVSRNKNPNQTHINLKGIAIGNAWIDDNMCLK  264

Query  815   GTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFC  994
             G Y+++WTHAL SDETH GI+ NC+F +  S S  CD +  ++ +  G++  YNIYAPFC
Sbjct  265   GMYEYFWTHALNSDETHAGIMKNCDFVTGKS-SIACDQYTSESAQEHGDLDIYNIYAPFC  323

Query  995   ssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVN  1174
                   +          FDPCS +Y+  YLN PEVQ ALHA     P  W +C+   +  
Sbjct  324   ----KPTGPKSAHLVNDFDPCSDNYVDSYLNRPEVQAALHAK----PTQWSACT---DFP  372

Query  1175  WEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKg  1354
             W D P T+LPTI++L+ SGI VW+YSGDIDG+V VT++ Y++N L   VKT W PW+S G
Sbjct  373   WTDSPATILPTIQQLIASGIDVWVYSGDIDGRVPVTSSRYSLNALKLPVKTAWRPWHSNG  432

Query  1355  evggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
             EVGGYV+GY+ ++  T+RGAGH VPSY+PERALT  +AF++G+LPP S
Sbjct  433   EVGGYVIGYKGVTLTTVRGAGHTVPSYEPERALTLIAAFLQGQLPPIS  480



>ref|XP_002282331.1| PREDICTED: serine carboxypeptidase II-3-like [Vitis vinifera]
Length=488

 Score =   490 bits (1261),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 283/468 (60%), Positives = 331/468 (71%), Gaps = 17/468 (4%)
 Frame = +2

Query  116   ESLLKTQKQKRQNNNAQTIIMSAQD-----LGSVYIGAQDGLKDADKISALPGQPEGVKF  280
             E+L +    +R  N  ++ +    D        +YIG QDGL   DKI +LPGQPEGV F
Sbjct  31    ENLYRLINSRRSANPPRSELWDELDGRDGNASPLYIGPQDGLMQDDKIESLPGQPEGVNF  90

Query  281   AQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMENGPFRVN  457
              Q++GYVTVDP+AGRALFYYF ES E  S KPLVLWLNGGPGCSS G G M E GPFRVN
Sbjct  91    DQYAGYVTVDPKAGRALFYYFVESPEDSSTKPLVLWLNGGPGCSSLGYGAMEELGPFRVN  150

Query  458   SDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYV-TGDKKTAADNYIFLLNWLE  634
              D KTL+ N+YAWNNV+NVIFLESPAGVGFSYSN SSDYV  GDKKTA D+Y FL+NWLE
Sbjct  151   PDGKTLFRNEYAWNNVSNVIFLESPAGVGFSYSNTSSDYVNVGDKKTAEDSYTFLINWLE  210

Query  635   RFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDS  814
             RFP+YKTRD FITGESY+GHYVPQLA  IL NN  TNQT+INLKGIAIGNA+ID+ T   
Sbjct  211   RFPQYKTRDFFITGESYSGHYVPQLAYTILSNNNKTNQTVINLKGIAIGNAWIDDNTSLK  270

Query  815   GTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFC  994
             G YD+ WTHAL SDE++ GI   C+F++  + S  C  +   A+  +GNI  YNIYAP C
Sbjct  271   GIYDYIWTHALSSDESNAGIQKYCDFTT-GNFSTKCLDYTYQAEGEVGNIDIYNIYAPLC  329

Query  995   ssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVN  1174
                S   +S   GS   FDPCS  Y+  YLN  EVQKALHA  T     W +CS    V 
Sbjct  330   --HSSGPTSRSVGSVNDFDPCSDYYVESYLNLAEVQKALHARNT----TWGACS---GVG  380

Query  1175  WEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKg  1354
             W D P T+LPTIK+LM SGISVW+YSGD DG+V VT++ Y+IN     VKT W PWY   
Sbjct  381   WTDSPTTILPTIKQLMASGISVWIYSGDTDGRVPVTSSRYSINTFKLPVKTAWRPWYYNK  440

Query  1355  evggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
             EVGGYVV Y+ + F T+RGAGH VPSYQP RALT  ++F++G LPP S
Sbjct  441   EVGGYVVEYKGVVFATVRGAGHLVPSYQPGRALTMIASFLQGTLPPPS  488



>ref|XP_008220190.1| PREDICTED: serine carboxypeptidase II-3-like [Prunus mume]
Length=490

 Score =   487 bits (1254),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 276/474 (58%), Positives = 336/474 (71%), Gaps = 18/474 (4%)
 Frame = +2

Query  98    RKFDPLESLLKTQKQKRQNNNAQTIIMSAQDL----GSVYIGAQDGLKDADKISALPGQP  265
              + + L  L+K++K      + + + +   D+      VY+G+Q GLK+ADKI ALPGQP
Sbjct  28    HQINNLNKLIKSRKSGTNPPHDRKLWVGLDDVEDSFSPVYVGSQHGLKEADKIEALPGQP  87

Query  266   EGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMENG  442
              GV F Q++GYVTVDP+AGRALFYYF ES    S KPLVLWLNGGPGCSS G G M E G
Sbjct  88    AGVNFDQYAGYVTVDPKAGRALFYYFVESPHNSSTKPLVLWLNGGPGCSSLGYGAMEELG  147

Query  443   PFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVT-GDKKTAADNYIFL  619
             PFRV+SD++TL+ N YAWN VANVIFLESPAGVGFSYSN SSDY + GDK+TA D+Y FL
Sbjct  148   PFRVSSDNRTLYRNDYAWNKVANVIFLESPAGVGFSYSNTSSDYESVGDKQTAKDSYTFL  207

Query  620   LNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQT-IINLKGIAIGNAYID  796
             +NWLERFP+YK RD FI GESYAGHYVPQLA  IL  NKITNQT IINLKGIAIGN ++D
Sbjct  208   VNWLERFPQYKPRDFFIAGESYAGHYVPQLAHTILSQNKITNQTKIINLKGIAIGNPWVD  267

Query  797   EETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYN  976
             +   D G YD+ WTHAL SDETH  I  +C   ++  PSDTC  +   +DR  G+IY  N
Sbjct  268   DYDGDMGVYDYLWTHALNSDETHAAIHKHCADFASDKPSDTCLKYQLRSDRECGDIY--N  325

Query  977   IYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCS  1156
             IYAP C      S S+       FDPCSS+Y+  YLN  +VQ ALH   T     W +C 
Sbjct  326   IYAPLCRISESKSVSTGSVHH--FDPCSSNYVDAYLNLVQVQSALHVKATN----WSACG  379

Query  1157  QDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWY  1336
                N+ W D P ++LPTIK+L  SGIS W+YSGD DG+V VT++ Y+IN L   ++T W 
Sbjct  380   ---NIGWTDSPVSLLPTIKQLTASGISFWIYSGDTDGRVPVTSSRYSINNLKLQLRTSWR  436

Query  1337  PWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
             PWYS GEVGGYV+GY+ L+F T+RGAGH VPSYQP+RALT  S+F++G+L P S
Sbjct  437   PWYSDGEVGGYVIGYKGLTFATVRGAGHMVPSYQPQRALTLISSFLKGELLPSS  490



>ref|XP_008813040.1| PREDICTED: serine carboxypeptidase II-3-like [Phoenix dactylifera]
Length=487

 Score =   486 bits (1252),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 271/467 (58%), Positives = 331/467 (71%), Gaps = 9/467 (2%)
 Frame = +2

Query  107   DPLESLLKTQKQKRQNNN-AQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQPEGVKFA  283
             D L  L+KT++    + + +   + +A  +  VY+  QDGL +AD+I +LPGQP GV+F 
Sbjct  27    DHLRRLIKTKRPTWPHQSYSWADLDAAVSVSPVYVSNQDGLMEADRIKSLPGQPTGVEFN  86

Query  284   QFSGYVTVDPQAGRALFYYFAESE-TPSDKPLVLWLnggpgcssfgnggMMENGPFRVNS  460
             Q+SGYVTVD + GRALFYYF ES+  PS KPL+LWLNGGPGCSS G G M E GPFRV+S
Sbjct  87    QYSGYVTVDTKNGRALFYYFVESQHNPSTKPLILWLNGGPGCSSLGYGAMQELGPFRVHS  146

Query  461   DSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFLLNWLER  637
             D KTL  NKYAWNNVANV+FLESPAGVGFSYSN SSDY + GD++TA D+Y FL+NW ER
Sbjct  147   DGKTLQRNKYAWNNVANVLFLESPAGVGFSYSNTSSDYDMNGDQRTAEDSYTFLVNWFER  206

Query  638   FPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDSG  817
             FP YK  + FITGESYAGHYVPQLA  IL +N  TNQT+INL+G+AIGNA++D  T D  
Sbjct  207   FPHYKNHEFFITGESYAGHYVPQLASTILHHNTQTNQTVINLQGVAIGNAFVDSATNDKA  266

Query  818   TYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFCs  997
              Y+F W H LISDET+      CNFS   S  D C    +DA    G+I  YNIYAP C 
Sbjct  267   GYEFMWNHNLISDETYAKFCKACNFSGIESTVD-CAAATEDAYVESGDIDPYNIYAPKC-  324

Query  998   sgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNW  1177
                  ++S    +   FDPCS+ Y+  YLN  EVQKALH     +P PW SCS   N+ W
Sbjct  325   -DDSNTTSMSGIAMADFDPCSTSYVDSYLNNLEVQKALHIKAPKLPNPWQSCS---NLAW  380

Query  1178  EDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKge  1357
              DM  T+LPTIK+L+ S I +WL+SGDID  V++T T YA+  LN  +K+ W  WYSK +
Sbjct  381   VDMAPTMLPTIKQLITSRIRLWLFSGDIDTVVSITATKYAVRNLNLPIKSSWRAWYSKSQ  440

Query  1358  vggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
             VGGYVVGYE L+FVT+RGAGH VPSYQPERALT  S+F++G+LPP S
Sbjct  441   VGGYVVGYEGLAFVTVRGAGHMVPSYQPERALTMISSFLKGELPPAS  487



>ref|XP_009607740.1| PREDICTED: serine carboxypeptidase-like 40 [Nicotiana tomentosiformis]
Length=448

 Score =   484 bits (1247),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 265/434 (61%), Positives = 328/434 (76%), Gaps = 8/434 (2%)
 Frame = +2

Query  200   VYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPL  376
             V++G Q+ LK+ D+I  LPGQP+GV F Q+SGYVTVDP AGR LFYYF ES +  + KPL
Sbjct  20    VHVGPQNSLKENDRIEQLPGQPQGVDFNQYSGYVTVDPTAGRNLFYYFVESPQDSASKPL  79

Query  377   VLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYS  556
             VLWLNGGPGCSS G G   E GPFRVN D  +L +N+++W + AN+IFLESPAGVGFSY+
Sbjct  80    VLWLNGGPGCSSLGGGAFGELGPFRVNKDG-SLNMNQFSWISEANIIFLESPAGVGFSYT  138

Query  557   NRSSDY-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNN  733
             N S+DY  +GD+ TA D+Y FL+NWLERFPEYKTRD ++TGESYAGHYVPQLAQLIL +N
Sbjct  139   NTSADYNFSGDRTTAIDSYTFLVNWLERFPEYKTRDFYLTGESYAGHYVPQLAQLILLHN  198

Query  734   KITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPS  913
               +NQTIINLKGI IGNAY+D E    GT ++YW+HALISDE +  II++CNFSS +S S
Sbjct  199   NYSNQTIINLKGITIGNAYVDFEANMKGTTEYYWSHALISDELYNKIISSCNFSSPSSAS  258

Query  914   DTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTP  1093
               C+ ++D  D+ +GNI+ YNIYAP C      + S    S+   DPC   YI  Y N P
Sbjct  259   KKCNDYLDQIDKEIGNIFLYNIYAPLC-----PNGSPSSTSTSEVDPCMPFYIQSYFNKP  313

Query  1094  EVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKV  1273
             EVQKA+HANV  +P PW+SC+  +N++W+D P TVLP +++LM S + +WLYSGD+D  V
Sbjct  314   EVQKAIHANVKNLPYPWESCNNTLNLSWKDRPLTVLPLLRQLMKSDLKIWLYSGDMDVVV  373

Query  1274  AVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERAL  1453
              VT T YAI KL   +KT WYPWY + EVGGYV  YE+L+ VTIRGAGHFVP+YQP RAL
Sbjct  374   PVTDTRYAIKKLKLPIKTAWYPWYFQEEVGGYVEEYENLTLVTIRGAGHFVPTYQPSRAL  433

Query  1454  TFFSAFVEGKLPPK  1495
             +FFS F+ GKLPPK
Sbjct  434   SFFSYFLSGKLPPK  447



>ref|XP_004238587.1| PREDICTED: putative serine carboxypeptidase-like 23 [Solanum 
lycopersicum]
Length=483

 Score =   486 bits (1250),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 264/431 (61%), Positives = 324/431 (75%), Gaps = 10/431 (2%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPS-DKPLVLWLn  391
             Q+ LK+++KI  LPG+PE V F Q+SGYVTVD  AGRALFYYF ES T S  KPLVLWLN
Sbjct  58    QNSLKESNKIEKLPGEPEDVDFNQYSGYVTVDSSAGRALFYYFTESPTHSASKPLVLWLN  117

Query  392   ggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSD  571
             GGPGCSS G G   E GPFRVN D  TL  N+++W + AN+IFLESPAGVGFSY+N SSD
Sbjct  118   GGPGCSSLGGGAFGELGPFRVNKDG-TLQRNQFSWISEANIIFLESPAGVGFSYTNTSSD  176

Query  572   Y-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQ  748
             +  +GD+ TA D+Y FL+NWLERFPEYK  D ++ GESYAGHY+PQLAQLIL +N  +++
Sbjct  177   FNFSGDRTTAHDSYTFLVNWLERFPEYKPNDFYLIGESYAGHYIPQLAQLILLHNSNSDE  236

Query  749   TI--INLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTC  922
             TI  INLKGIAIGNAY+D E    GT ++YW+HALIS+E +  II  CNFS+ +S S  C
Sbjct  237   TISTINLKGIAIGNAYVDFEANMKGTTEYYWSHALISEELYNKIILTCNFSTPSSVSKKC  296

Query  923   DTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQ  1102
             + ++D  D  +GNI+ YN+YAP C++ S  S+S+        DPC   YI  Y N PEVQ
Sbjct  297   NAYLDQIDEEIGNIFIYNVYAPLCTNRSPSSTSTSDV-----DPCLPSYIQSYFNIPEVQ  351

Query  1103  KALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVT  1282
             KA+HANVT +P PW+SC+  +N+NW+D P +VLP + +LM SG+ +WLYSGD+D  V VT
Sbjct  352   KAMHANVTNLPYPWESCNNTLNLNWKDRPLSVLPLLHQLMKSGLRIWLYSGDMDVVVPVT  411

Query  1283  TTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFF  1462
              T YAI KLN SVKT WYPWY +GEVGGYV  YE+L+FVTIRGAGHFVP+YQP RAL FF
Sbjct  412   DTRYAIKKLNLSVKTSWYPWYLQGEVGGYVEEYENLTFVTIRGAGHFVPTYQPNRALAFF  471

Query  1463  SAFVEGKLPPK  1495
             S F+ GK PPK
Sbjct  472   SQFLSGKPPPK  482



>ref|XP_004292826.1| PREDICTED: serine carboxypeptidase II-3-like [Fragaria vesca 
subsp. vesca]
Length=497

 Score =   485 bits (1249),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 282/479 (59%), Positives = 338/479 (71%), Gaps = 18/479 (4%)
 Frame = +2

Query  86    SIGGRKFDPLESLLKTQKQKRQN----NNAQTIIMSAQD--LGSVYIGAQDGLKDADKIS  247
             S   ++ D L  LL+  ++   N     ++  I+   +D     VYIG+QDG K+ADKI 
Sbjct  23    SCRAKQIDTLNKLLQQSRKSGLNPPRSQSSTDIVFDVEDDQYSPVYIGSQDGAKEADKID  82

Query  248   ALPGQP-EGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgn  421
             ALPGQP EG +F Q+SGYVTV+P+AGRALFYYF ES +  S KPLVLWLNGGPGCSSFG 
Sbjct  83    ALPGQPTEGAEFNQYSGYVTVNPKAGRALFYYFVESPQDSSSKPLVLWLNGGPGCSSFGY  142

Query  422   ggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYV-TGDKKTA  598
             G M E GPFRVN+D  +L+ N YAWNNVANV+FLESPAGVGFSYSN SSDY   GDK+TA
Sbjct  143   GAMEELGPFRVNNDKISLFANDYAWNNVANVLFLESPAGVGFSYSNTSSDYGNVGDKRTA  202

Query  599   ADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAI  778
              D+Y FL+NWLERFPEYK RD FITGESYAGHYVPQLA  I++ NKITNQT INLKGIAI
Sbjct  203   EDSYAFLVNWLERFPEYKNRDFFITGESYAGHYVPQLAYTIVQQNKITNQTKINLKGIAI  262

Query  779   GNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMG  958
             GNA+ID+ T   G  D+ WTHAL SDET+ GI   C+F+S  S SD CD +V    +  G
Sbjct  263   GNAWIDDNTSAWGIVDYLWTHALSSDETNAGIHKYCDFTSENS-SDLCDNYVHQLYKEKG  321

Query  959   NIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPG  1138
              I  YNIYAP C      ++ S  GS   FDPCS +Y+  YLN  EVQ ALH      P 
Sbjct  322   QIDIYNIYAPLCLEDGSKTTPSSVGSVFEFDPCSDEYVEAYLNLAEVQAALHVK----PT  377

Query  1139  PWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTS  1318
              W +C     V W D P+T+LPTI+ L+ +GI VW+YSGD D +V VT + Y+IN LN  
Sbjct  378   QWTACG---GVGWTDSPETILPTIQSLIETGIRVWIYSGDTDARVPVTASRYSINTLNLP  434

Query  1319  VKTPWYPWYSK-gevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
             V+TPW PW S   EVGGYVVGY+ L+F T+RGAGH VPSYQP+R+L F S+F++G LPP
Sbjct  435   VETPWRPWNSTPDEVGGYVVGYKGLTFATVRGAGHKVPSYQPQRSLVFISSFLQGTLPP  493



>ref|XP_010098713.1| Serine carboxypeptidase II-3 [Morus notabilis]
 gb|EXB75616.1| Serine carboxypeptidase II-3 [Morus notabilis]
Length=473

 Score =   481 bits (1237),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 272/471 (58%), Positives = 330/471 (70%), Gaps = 29/471 (6%)
 Frame = +2

Query  101   KFDPLESLLKTQKQ---KRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQPEG  271
             + + L  L+K+++     R  + A    ++ Q L  +Y+G+ +GLK+A+KI ALPGQPEG
Sbjct  27    QIEKLNELIKSRRSVNPPRAESWASLDELNGQYLSPLYVGSHEGLKEANKIEALPGQPEG  86

Query  272   VKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMENGPF  448
             V F Q+SGYVTVDP+AGRALFYYF ES +  + KPLVLWLNGGPGCSSFG G M E GPF
Sbjct  87    VDFNQYSGYVTVDPRAGRALFYYFVESPQDSATKPLVLWLNGGPGCSSFGYGAMEELGPF  146

Query  449   RVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYV-TGDKKTAADNYIFLLN  625
             RVNSD KTL+LN+YAWN            GVGFSYSNRSSDY   GDK+TA D+YIFL+N
Sbjct  147   RVNSDGKTLYLNEYAWNK-----------GVGFSYSNRSSDYYNVGDKRTAIDSYIFLVN  195

Query  626   WLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEET  805
             WLERFPEYK RD FI GESYAGHYVPQLA  IL NN  T +T+INLKGIAIGNA+ID++T
Sbjct  196   WLERFPEYKNRDFFIAGESYAGHYVPQLAHTILSNNNNTKRTVINLKGIAIGNAWIDDKT  255

Query  806   QDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYA  985
              + GTYD++WTHAL SDE+  GI+  C+F +  S    CD ++  AD  +G I  YNIYA
Sbjct  256   GEQGTYDYFWTHALTSDESQAGILKYCDFVNYTS---LCDKYLSQADNEVGYIDIYNIYA  312

Query  986   PFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDV  1165
             P C      +  S  GS   FDPCS DY+Y YLN  EVQ +LH      P  W SCS   
Sbjct  313   PMC---KSSAPKSSTGSVYDFDPCSDDYVYNYLNLKEVQTSLHVR----PTQWSSCS---  362

Query  1166  NVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWY  1345
              V W D P T+LPT+K+L+  GISVW+YSGD DG+V VT++ Y+IN L   V   W PWY
Sbjct  363   GVGWTDSPTTILPTLKQLIAYGISVWVYSGDTDGRVPVTSSRYSINTLKLPVVNAWRPWY  422

Query  1346  SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
             S  EVGG+VV Y+ L+  T+RGAGH VPSYQPERALT  S+F++ KLPP S
Sbjct  423   SSQEVGGHVVQYKGLTLTTVRGAGHLVPSYQPERALTLISSFLQRKLPPPS  473



>ref|XP_008809533.1| PREDICTED: putative serine carboxypeptidase-like 23 [Phoenix 
dactylifera]
Length=735

 Score =   490 bits (1261),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 259/434 (60%), Positives = 314/434 (72%), Gaps = 5/434 (1%)
 Frame = +2

Query  206   IGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESE-TPSDKPLVL  382
             + +Q GL +ADKI ALPGQPEGV F Q++GYVTVDP+  RALFYYF ES    S KPLVL
Sbjct  1     MSSQVGLMEADKIEALPGQPEGVNFNQYAGYVTVDPKKERALFYYFVESPYNSSTKPLVL  60

Query  383   WLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNR  562
             WLNGGPGCSSFG G M E GPFRV  D KTL  N+YAWNNVANV+FLESPAGVGFSYSN 
Sbjct  61    WLNGGPGCSSFGYGAMQELGPFRVERDGKTLSRNQYAWNNVANVLFLESPAGVGFSYSNT  120

Query  563   SSDYVT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKI  739
             S+DY + GDK+TA D+Y FL+NWLERFP+YK+RD FITGESY GHY PQLA +IL+ NK+
Sbjct  121   STDYTSNGDKRTAKDSYTFLVNWLERFPQYKSRDFFITGESYVGHYAPQLASVILQQNKL  180

Query  740   TNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDT  919
              N T+INL+GIAIGNAY+D +T D G YDF W+HALISDE +  ++  CNFSS    S +
Sbjct  181   PNHTVINLQGIAIGNAYVDTKTNDQGEYDFLWSHALISDEAYAEVLQACNFSSTEEDSTS  240

Query  920   CDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEV  1099
             C T  ++A  + GNI  YNIYAP C      + +    +   FDPC+ DY+  YLN P+V
Sbjct  241   CLTAANNARATSGNIDEYNIYAPIC--LHAENRTKSSLAMADFDPCTEDYVTSYLNNPKV  298

Query  1100  QKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSG-ISVWLYSGDIDGKVA  1276
              +ALH ++T    PW  CS  V  +W+D P +VLP IK+L+GS    +WLYSGD+DG  +
Sbjct  299   HEALHVDITKSTIPWQGCSDAVGYSWKDAPASVLPLIKKLIGSNETRIWLYSGDVDGVCS  358

Query  1277  VTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALT  1456
                T YAI +L   V+  W  WY   +VGGYVVGY+ L FVT+RGAGH VPSYQPERAL 
Sbjct  359   TAATKYAIKELKLPVRDSWKAWYYNEQVGGYVVGYQGLVFVTVRGAGHMVPSYQPERALA  418

Query  1457  FFSAFVEGKLPPKS  1498
               S+F++GKLPP S
Sbjct  419   LISSFIQGKLPPSS  432



>ref|XP_008813035.1| PREDICTED: putative serine carboxypeptidase-like 23 [Phoenix 
dactylifera]
Length=484

 Score =   478 bits (1230),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 263/469 (56%), Positives = 328/469 (70%), Gaps = 13/469 (3%)
 Frame = +2

Query  95    GRKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGS-VYIGAQDGLKDADKISALPGQPEG  271
              ++ D L SL+++ +      +    +++  +    +Y+  Q+GLKD DKI ALPGQP+G
Sbjct  24    AKQADLLRSLIRSNRSSSGRFDGFLHLVNGSEASPPIYVAPQNGLKDLDKIDALPGQPKG  83

Query  272   VKFAQFSGYVTVDPQAGRALFYYFAESETPSDK-PLVLWLnggpgcssfgnggMMENGPF  448
             V F Q++GYVTV+PQ GR LFYYF ES   S+K PL+LWLNGGPGCSS G G + E GPF
Sbjct  84    VSFDQYAGYVTVEPQNGRTLFYYFVESPRDSEKKPLLLWLNGGPGCSSLGYGALQELGPF  143

Query  449   RVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVT-GDKKTAADNYIFLLN  625
             RVN D KTL  N +AWNNVANVIFLESPAGVGFSY+N SSDY   GDK+TA D Y FL+N
Sbjct  144   RVNRDGKTLLRNNHAWNNVANVIFLESPAGVGFSYTNTSSDYKNRGDKRTAEDTYTFLVN  203

Query  626   WLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEET  805
             WLERFPEYKTRDLFITGESYAGHYVPQLA LIL NNK  N+ IINL+GIA+GNAYID   
Sbjct  204   WLERFPEYKTRDLFITGESYAGHYVPQLASLILLNNKNPNKPIINLRGIAMGNAYIDSNI  263

Query  806   QDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYA  985
              +   Y+F W H + SD TH+ I   CN S  +SP   C    + AD  +G+I  YN+YA
Sbjct  264   TEMAMYEFLWMHDMYSDRTHKLIRRTCNISDMSSPE--CKHATNLADMEIGSINPYNVYA  321

Query  986   PFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDV  1165
             P C +     ++ +  S+  FDPC+ +Y+ VYLN P VQK+LHA    +P  W  CS   
Sbjct  322   PLC-TEKSHKATCITSSNVEFDPCTDEYVDVYLNQPVVQKSLHA----VPSLWTHCSLG-  375

Query  1166  NVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWY  1345
                W D PDT+LP I++L  SGI +WLYSGD+D  V+VT+T Y++  L   +K+PW PW 
Sbjct  376   --GWRDSPDTMLPMIEQLTTSGIRIWLYSGDMDSIVSVTSTKYSLRMLGLPIKSPWRPWQ  433

Query  1346  SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
             + GEV GYVV Y+ L+FVT+RGAGH VPSYQPE+AL   SAF++GKLPP
Sbjct  434   ANGEVAGYVVAYKGLTFVTVRGAGHEVPSYQPEKALVMISAFLKGKLPP  482



>ref|XP_004306277.1| PREDICTED: serine carboxypeptidase II-3-like [Fragaria vesca 
subsp. vesca]
Length=479

 Score =   478 bits (1229),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 269/471 (57%), Positives = 321/471 (68%), Gaps = 15/471 (3%)
 Frame = +2

Query  98    RKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQP-EGV  274
              + D L  L+K+Q+ ++   +   I++          G QDG K+ DKI ALPGQP EGV
Sbjct  20    NQVDNLNKLIKSQRYQKPLQSQSQIVLDQVGDNPFSPGHQDGSKEDDKIDALPGQPTEGV  79

Query  275   KFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMENGPFR  451
              F Q++GYVTVD  AGRALFYYF ES +  S  PLVLWLNGGPGCSS G G M E GPFR
Sbjct  80    DFDQYAGYVTVDADAGRALFYYFVESPQNSSTAPLVLWLNGGPGCSSLGFGAMEELGPFR  139

Query  452   VNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYV-TGDKKTAADNYIFLLNW  628
             VNS+  +L++N YAWNN ANV+FLESPAGVGFSYSN +SDY   GD KTA+D+Y FL+NW
Sbjct  140   VNSNGNSLYMNDYAWNNEANVLFLESPAGVGFSYSNTTSDYQNVGDNKTASDSYKFLINW  199

Query  629   LERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQ  808
             LE+FPEYKTRD +ITGESYAGHYVPQLA  I+  NK+TNQT INLKGIAIGNA+ID  T 
Sbjct  200   LEKFPEYKTRDFYITGESYAGHYVPQLAYTIVSENKVTNQTKINLKGIAIGNAWIDASTG  259

Query  809   DSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAP  988
               G YD+ W+HAL SDET  GI   C+F  A + + +C+ ++  +D  +GNI SYNIYAP
Sbjct  260   AQGQYDYLWSHALNSDETMAGINKYCDF-VALNITSSCEKYMSQSDNEVGNIDSYNIYAP  318

Query  989   FCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVN  1168
              C      S +    S   FDPCS DY+  YLN PEVQ ALHA     P  W +C    N
Sbjct  319   LC---GTESPAPSASSVYEFDPCSDDYVNTYLNLPEVQAALHAR----PTQWSACG---N  368

Query  1169  VNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYS  1348
             V W D PDTVLP I+EL+ SGI +W+YSGD+D  VAVTTT  AIN +N    TP+ PWYS
Sbjct  369   VGWTDSPDTVLPIIQELIASGIRLWVYSGDVDSVVAVTTTRLAINTMNLKTTTPFRPWYS  428

Query  1349  KgevggyvvgyeD-LSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
                  G  V   + L F T+RGAGH VPSYQP RALT FSAF++G   P S
Sbjct  429   SPGEVGGYVIMYEGLVFATVRGAGHEVPSYQPGRALTLFSAFLQGAPLPSS  479



>ref|XP_009400122.1| PREDICTED: serine carboxypeptidase II-3-like [Musa acuminata 
subsp. malaccensis]
Length=488

 Score =   476 bits (1224),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 265/469 (57%), Positives = 312/469 (67%), Gaps = 15/469 (3%)
 Frame = +2

Query  116   ESLLKTQKQKRQNNNAQT---IIMSAQDLGS--VYIGAQDGLKDADKISALPGQPEGVKF  280
             E L++  + KR   + Q    + + A D  S  VY+G QDGL DADKI+ALPGQP GV F
Sbjct  27    EQLIRLTQSKRSTWSDQPDPWLDLDAADSASSSVYVGPQDGLSDADKITALPGQPRGVDF  86

Query  281   AQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMENGPFRVN  457
              Q++G+VTVDPQ GRALFYYF ES    S KPLVLWLNGGPGCSS   G M E GPFRV 
Sbjct  87    DQYAGHVTVDPQKGRALFYYFVESPRGSSSKPLVLWLNGGPGCSSLAYGAMEEFGPFRVK  146

Query  458   SDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFLLNWLE  634
             SD KTL  N YAWN  ANV+FLESPAGVGFSYSN ++DY  +GD +TA D + FLLNWLE
Sbjct  147   SDGKTLERNPYAWNEEANVLFLESPAGVGFSYSNTTTDYDQSGDNRTAEDTFTFLLNWLE  206

Query  635   RFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDS  814
             RFP+YK R  FI GESYAGHYVPQLA LIL  NK+ NQT+INL GIAIGNAY+D+ T   
Sbjct  207   RFPQYKNRMFFIAGESYAGHYVPQLASLILHRNKLANQTLINLSGIAIGNAYVDDATNSE  266

Query  815   GTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFC  994
             G Y+F W+HALISDET   I  +CNFS+    +  C+    DAD   GNI  YN YAP C
Sbjct  267   GRYEFLWSHALISDETFARIRRSCNFSAII--NQECNKATTDADAEAGNIDPYNAYAPVC  324

Query  995   ssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVN  1174
                   SSS    S    DPCS  Y+  YLN PEVQ+ALHANV  I GPW SC+   ++ 
Sbjct  325   --VDSNSSSESGISMADIDPCSDTYVEAYLNDPEVQRALHANVAKIDGPWSSCT---DLP  379

Query  1175  WEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYS-K  1351
             W D P + +P +K+L+ SG+ VWL+SGD D       T  AI  +   +K PW  WYS K
Sbjct  380   WNDSPKSTVPVMKQLVDSGLRVWLFSGDTDTVCPYRGTVEAIKIMKLPIKNPWRSWYSDK  439

Query  1352  gevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
                G  V     L+ VT+RGAGH VPSYQPERAL  FS+F+ G+LPP S
Sbjct  440   QVGGYVVGYGGGLTLVTVRGAGHMVPSYQPERALLMFSSFLRGELPPPS  488



>emb|CBI19568.3| unnamed protein product [Vitis vinifera]
Length=1017

 Score =   489 bits (1259),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 283/468 (60%), Positives = 331/468 (71%), Gaps = 17/468 (4%)
 Frame = +2

Query  116   ESLLKTQKQKRQNNNAQTIIMSAQD-----LGSVYIGAQDGLKDADKISALPGQPEGVKF  280
             E+L +    +R  N  ++ +    D        +YIG QDGL   DKI +LPGQPEGV F
Sbjct  560   ENLYRLINSRRSANPPRSELWDELDGRDGNASPLYIGPQDGLMQDDKIESLPGQPEGVNF  619

Query  281   AQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMENGPFRVN  457
              Q++GYVTVDP+AGRALFYYF ES E  S KPLVLWLNGGPGCSS G G M E GPFRVN
Sbjct  620   DQYAGYVTVDPKAGRALFYYFVESPEDSSTKPLVLWLNGGPGCSSLGYGAMEELGPFRVN  679

Query  458   SDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYV-TGDKKTAADNYIFLLNWLE  634
              D KTL+ N+YAWNNV+NVIFLESPAGVGFSYSN SSDYV  GDKKTA D+Y FL+NWLE
Sbjct  680   PDGKTLFRNEYAWNNVSNVIFLESPAGVGFSYSNTSSDYVNVGDKKTAEDSYTFLINWLE  739

Query  635   RFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDS  814
             RFP+YKTRD FITGESY+GHYVPQLA  IL NN  TNQT+INLKGIAIGNA+ID+ T   
Sbjct  740   RFPQYKTRDFFITGESYSGHYVPQLAYTILSNNNKTNQTVINLKGIAIGNAWIDDNTSLK  799

Query  815   GTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFC  994
             G YD+ WTHAL SDE++ GI   C+F++  + S  C  +   A+  +GNI  YNIYAP C
Sbjct  800   GIYDYIWTHALSSDESNAGIQKYCDFTT-GNFSTKCLDYTYQAEGEVGNIDIYNIYAPLC  858

Query  995   ssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVN  1174
                S   +S   GS   FDPCS  Y+  YLN  EVQKALHA  T     W +CS    V 
Sbjct  859   --HSSGPTSRSVGSVNDFDPCSDYYVESYLNLAEVQKALHARNT----TWGACS---GVG  909

Query  1175  WEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKg  1354
             W D P T+LPTIK+LM SGISVW+YSGD DG+V VT++ Y+IN     VKT W PWY   
Sbjct  910   WTDSPTTILPTIKQLMASGISVWIYSGDTDGRVPVTSSRYSINTFKLPVKTAWRPWYYNK  969

Query  1355  evggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
             EVGGYVV Y+ + F T+RGAGH VPSYQP RALT  ++F++G LPP S
Sbjct  970   EVGGYVVEYKGVVFATVRGAGHLVPSYQPGRALTMIASFLQGTLPPPS  1017


 Score =   447 bits (1150),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 265/493 (54%), Positives = 331/493 (67%), Gaps = 39/493 (8%)
 Frame = +2

Query  92    GGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQPEG  271
             GGR F+P+  L++    K + ++  T   ++  L +      DGLK++ KI +LPGQP G
Sbjct  40    GGRGFNPIGKLIREGLSKGRLSDEWT--WTSFPLNTTSKFPLDGLKESHKIESLPGQPNG  97

Query  272   VKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMENGPF  448
             V F QFSGYVTVD  AGRALFYYF ES +  + KPLVLWLNGGPGCSSFG G MME GPF
Sbjct  98    VDFDQFSGYVTVDSLAGRALFYYFVESPQNSTTKPLVLWLNGGPGCSSFGIGAMMELGPF  157

Query  449   RVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFLLN  625
             RVN D +TL+LNK+AWN  AN+IFLESPAGVGFSYS+ +SDY  +GD +TA+D+YIFLL+
Sbjct  158   RVNKDGETLYLNKHAWNKEANIIFLESPAGVGFSYSDTASDYNSSGDYRTASDSYIFLLS  217

Query  626   WLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEET  805
             WLE FPEYKTRD FI GE YAGHYVPQLAQ IL  N I +  IINL+GIA+GN Y+D ET
Sbjct  218   WLEIFPEYKTRDFFIAGEGYAGHYVPQLAQTILLFNSIPDLPIINLRGIAMGNPYVDRET  277

Query  806   QDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYA  985
                G  D+YW+HALISDE +  +I NCN SS  S S+ C  ++  AD +MGNI  Y+IYA
Sbjct  278   AFKGIVDYYWSHALISDEIYMELILNCNVSSEESASEECIAWLLQADNAMGNINVYDIYA  337

Query  986   PFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQ--  1159
             P C      +SS+   S   FDPCS +YI+ YLN P+VQ+ALHANVTG+P PW+ C Q  
Sbjct  338   PLC------NSSADSNSVSAFDPCSGNYIHAYLNIPQVQEALHANVTGLPCPWEFCRQCH  391

Query  1160  ------------------------DVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDG  1267
                                      V++   D+       +  L  S +   + SGD DG
Sbjct  392   PTKCNIYSSNYAAQHSGADEQRNTSVDIQARDLNQNEFEVLWILTKSNL---ICSGDTDG  448

Query  1268  KVAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPER  1447
              V VT++ Y I KL T V+TPW+PWY+ GEVGGY V Y++L+FVT+RG+GHFVPSYQP R
Sbjct  449   VVPVTSSRYFIKKLGTLVRTPWHPWYTHGEVGGYAVEYQNLTFVTVRGSGHFVPSYQPAR  508

Query  1448  ALTFFSAFVEGKL  1486
             +L  F +F+ G L
Sbjct  509   SLQLFCSFLNGTL  521



>ref|XP_006473369.1| PREDICTED: serine carboxypeptidase II-3-like [Citrus sinensis]
Length=485

 Score =   471 bits (1213),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 270/479 (56%), Positives = 335/479 (70%), Gaps = 18/479 (4%)
 Frame = +2

Query  80    CYSIG--GRKFDPLESLLKTQKQKR-QNNNAQTIIMSAQDLGS-VYIGAQDGLKDADKIS  247
             CY +     + D L  L+ ++K +  Q     T     +++ S V  G Q+G+ +ADKI 
Sbjct  19    CYQLACYANQIDNLNRLINSKKSRNPQRTEPWTDQSKVRNVMSPVDSGPQEGMMEADKIK  78

Query  248   ALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgng  424
              LPGQP+GV F Q++GY+TVDP+AGRALFYYF ES ++ S KPLVLWLNGGPGCSS G G
Sbjct  79    TLPGQPQGVDFDQYAGYLTVDPKAGRALFYYFVESPQSSSTKPLVLWLNGGPGCSSLGYG  138

Query  425   gMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVT-GDKKTAA  601
              M E GPFRVNSD KTL+ N+YAWNNVANV+FLE+PAGVGFSYSN SSDY   GD  TA 
Sbjct  139   AMEELGPFRVNSDGKTLYRNEYAWNNVANVLFLETPAGVGFSYSNTSSDYSNPGDNNTAE  198

Query  602   DNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIG  781
             D+Y FL+NW ERFP+YK RD FITGESYAGHYVPQLA  IL  N  T++TIINLKGIAIG
Sbjct  199   DSYTFLVNWFERFPQYKNRDFFITGESYAGHYVPQLAHTILSKN--TSKTIINLKGIAIG  256

Query  782   NAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGN  961
             NA+ID+     G +DF+WTHAL SDET+  I   C+F++    S +CD +     R  G 
Sbjct  257   NAWIDDNLCTKGMFDFFWTHALNSDETNAAINKYCDFATGQL-STSCDQYQTQGVREFGQ  315

Query  962   IYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGP  1141
             I  YN+YAP C S +    ++       +DPCS  Y+  YLN  EVQ ALHA  T     
Sbjct  316   IDLYNVYAPLCKSSAPPPPTAGVIRE--YDPCSDKYVNSYLNLAEVQAALHAKHTN----  369

Query  1142  WDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSV  1321
             W +CS   ++ W D P TVLPTI++L+ SGI VW+YSGD DG+V VT++ Y+IN LN  V
Sbjct  370   WSTCS---DLTWTDSPSTVLPTIQQLIASGIRVWIYSGDTDGRVPVTSSRYSINALNLPV  426

Query  1322  KTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
             +T WYPWY+ GEVGGYV+GY+ + F T+RGAGH VP+YQP+RAL   S+F+EGKLPP S
Sbjct  427   ETAWYPWYADGEVGGYVLGYKGVIFTTVRGAGHLVPTYQPQRALIMISSFLEGKLPPSS  485



>ref|XP_010932885.1| PREDICTED: serine carboxypeptidase-like 40 isoform X2 [Elaeis 
guineensis]
Length=450

 Score =   468 bits (1205),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 258/443 (58%), Positives = 311/443 (70%), Gaps = 12/443 (3%)
 Frame = +2

Query  170   IIMSAQDLGSVYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAE  349
             ++  ++ L  +Y+  Q+GLK+ DKI ALPGQP+GV F Q++GYV V+PQ GR LFYYF E
Sbjct  17    LLNGSEALPPIYVAPQNGLKELDKIDALPGQPKGVNFDQYAGYVMVEPQHGRTLFYYFVE  76

Query  350   S-ETPSDKPLVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLE  526
             S   P  KPL+LWLNGGPGCSS G G M E GPFRV SD KTL  NK+AWNNVANV+FLE
Sbjct  77    SPRDPERKPLLLWLNGGPGCSSLGGGAMQELGPFRVQSDGKTLHRNKHAWNNVANVVFLE  136

Query  527   SPAGVGFSYSNRSSDYVT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVP  703
             SPAGVGFSY+  SSDY   GDK+TA D Y FL+NWLERFPEYKTRD F+TGESYAGHYVP
Sbjct  137   SPAGVGFSYTKTSSDYENRGDKRTAEDTYTFLVNWLERFPEYKTRDFFVTGESYAGHYVP  196

Query  704   QLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIAN  883
             QLA LI+ NNK  N+  INL+GIAIGNAYID  T   G Y+F W HA+ SD T+R I   
Sbjct  197   QLASLIVLNNKKPNKPTINLRGIAIGNAYIDTNTTLMGMYEFLWMHAMYSDRTYRLIRRK  256

Query  884   CNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSS  1063
             C  S     S  C+   + AD  +G+I  +N+Y P C +      +SV  S+  FDPC+ 
Sbjct  257   CKISDMY--SSECENATNLADFEIGSIDRFNVYVPLC-TKKLHQPTSVTSSNVEFDPCAG  313

Query  1064  DYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVW  1243
             +Y+Y YLN PEVQK+LHA    IP  W  CS+     W D P T+LP IK+L  SGI +W
Sbjct  314   NYVYAYLNLPEVQKSLHA----IPFLWTYCSRG---GWRDSPYTMLPMIKQLATSGIRMW  366

Query  1244  LYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHF  1423
             LYSGD+D  V+VT+T Y +  L   +K+PW PW +  EV GYVV Y  L+FVT+RGAGH 
Sbjct  367   LYSGDMDSVVSVTSTKYFLRMLGLPIKSPWRPWQANSEVAGYVVAYNGLTFVTVRGAGHE  426

Query  1424  VPSYQPERALTFFSAFVEGKLPP  1492
             VPSYQPER+L   SAF+EGKLPP
Sbjct  427   VPSYQPERSLIMISAFLEGKLPP  449



>gb|KHN46300.1| Serine carboxypeptidase II-3 [Glycine soja]
Length=445

 Score =   467 bits (1202),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 263/434 (61%), Positives = 314/434 (72%), Gaps = 12/434 (3%)
 Frame = +2

Query  206   IGAQDGLKDADKISALPGQP-EGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLV  379
             +  Q GL + DK+ ALPGQP +GV F Q++GYVTVD +AGRALFYYF ES    S+KPLV
Sbjct  17    VKEQSGLMEGDKVKALPGQPSQGVDFDQYAGYVTVDAKAGRALFYYFVESPHNASNKPLV  76

Query  380   LWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSN  559
             LWLNGGPGCSSFG G M E GPFRVNSD KTL+ N+YAWNNVANVIFLESPAGVGFSYSN
Sbjct  77    LWLNGGPGCSSFGYGAMQELGPFRVNSDGKTLYRNQYAWNNVANVIFLESPAGVGFSYSN  136

Query  560   RSSDYV-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNK  736
              SSDY  TGDK TA D+Y FLLNWLERFP+YKTRDLFITGESYAGHYVPQLA  IL  NK
Sbjct  137   TSSDYTKTGDKSTAMDSYTFLLNWLERFPQYKTRDLFITGESYAGHYVPQLADTILTYNK  196

Query  737   ITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSD  916
             +TN T+INLKGIA+GN +ID+     G Y+++WTHAL SDETH GI   C+F S  + + 
Sbjct  197   LTNHTVINLKGIAVGNGWIDDNMCGKGMYEYFWTHALNSDETHEGIQRYCDFES-GNLTG  255

Query  917   TCDTFVDDADRSMGNIYSYNIYAPFCssgsglssss-vqgssrgFDPCSSDYIYVYLNTP  1093
              C  +    D  +G+I  Y+IYAP C S +  + SS        FDPCS DY   YLN  
Sbjct  256   ECSKYQSRGDTEIGSIDIYDIYAPPCDSAAKKAGSSPATNYDSNFDPCSDDYTNSYLNLA  315

Query  1094  EVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKV  1273
             EVQ+ALHA  +     W  C     V W D P T+LPTI  L+ SGI+ W+YSGD DG+V
Sbjct  316   EVQEALHAKAS----VWYPCR---GVGWTDSPATILPTINRLISSGINTWIYSGDTDGRV  368

Query  1274  AVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERAL  1453
              +T++ Y++N L   V+T W PWYS  EVGGY+VGY+ L+ +T+RGAGH VPSYQP+RAL
Sbjct  369   PITSSRYSVNALKLPVETTWRPWYSSNEVGGYLVGYKGLTLITVRGAGHMVPSYQPQRAL  428

Query  1454  TFFSAFVEGKLPPK  1495
             T  S F+ G+LPP+
Sbjct  429   TMISFFLLGELPPE  442



>ref|XP_003544446.1| PREDICTED: serine carboxypeptidase II-3-like isoform X1 [Glycine 
max]
Length=495

 Score =   469 bits (1207),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 270/470 (57%), Positives = 329/470 (70%), Gaps = 17/470 (4%)
 Frame = +2

Query  113   LESLLKTQK-QKRQNNNAQTI---IMSAQDLGSVYI-GAQDGLKDADKISALPGQP-EGV  274
             L   ++T++ QKR    A ++   +   +    VY+   Q GL + DK+ ALPGQP +GV
Sbjct  31    LYKFIQTKRAQKRSYGEASSMATNLGGDEHFSKVYVVKEQSGLMEGDKVKALPGQPSQGV  90

Query  275   KFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMENGPFR  451
              F Q++GYVTVD +AGRALFYYF ES    S++PLVLWLNGGPGCSSFG G M E GPFR
Sbjct  91    DFDQYAGYVTVDAKAGRALFYYFVESPHNASNRPLVLWLNGGPGCSSFGYGAMQELGPFR  150

Query  452   VNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYV-TGDKKTAADNYIFLLNW  628
             VNSD KTL+ N+YAWNNVANVIFLESPAGVGFSYSN SSDY  TGDK TA D+Y FLLNW
Sbjct  151   VNSDGKTLYRNQYAWNNVANVIFLESPAGVGFSYSNTSSDYTKTGDKSTAMDSYTFLLNW  210

Query  629   LERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQ  808
             LERFP+YKTRDLFITGESYAGHYVPQLA  IL  NK+TN T+INLKGIA+GN +ID+   
Sbjct  211   LERFPQYKTRDLFITGESYAGHYVPQLADTILTYNKLTNHTVINLKGIAVGNGWIDDNMC  270

Query  809   DSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAP  988
               G Y+++WTHAL SDETH GI   C+F S  + +  C  +    D  +G+I  Y+IYAP
Sbjct  271   GKGMYEYFWTHALNSDETHEGIQRYCDFES-GNLTGECSKYQSRGDTEIGSIDIYDIYAP  329

Query  989   FCssgsgl-ssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDV  1165
              C S +    SS        FDPCS DY   YLN  EVQ+ALHA  +     W  C    
Sbjct  330   PCDSAAKKPGSSPATNYDSNFDPCSDDYTNSYLNLAEVQEALHAKAS----VWYPCR---  382

Query  1166  NVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWY  1345
              V W D P T+LPTI  L+ SGI+ W+YSGD DG+V +T++ Y++N L   V+T W PWY
Sbjct  383   GVGWTDSPATILPTINRLISSGINTWIYSGDTDGRVPITSSRYSVNALKLPVETTWRPWY  442

Query  1346  SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPK  1495
             S  EVGGY+VGY+ L+ +T+RGAGH VPSYQP+RALT  S F+ G+LPP+
Sbjct  443   SSNEVGGYLVGYKGLTLITVRGAGHMVPSYQPQRALTMISFFLLGELPPE  492



>ref|XP_010932884.1| PREDICTED: putative serine carboxypeptidase-like 23 isoform X1 
[Elaeis guineensis]
Length=483

 Score =   468 bits (1205),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 258/443 (58%), Positives = 311/443 (70%), Gaps = 12/443 (3%)
 Frame = +2

Query  170   IIMSAQDLGSVYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAE  349
             ++  ++ L  +Y+  Q+GLK+ DKI ALPGQP+GV F Q++GYV V+PQ GR LFYYF E
Sbjct  50    LLNGSEALPPIYVAPQNGLKELDKIDALPGQPKGVNFDQYAGYVMVEPQHGRTLFYYFVE  109

Query  350   S-ETPSDKPLVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLE  526
             S   P  KPL+LWLNGGPGCSS G G M E GPFRV SD KTL  NK+AWNNVANV+FLE
Sbjct  110   SPRDPERKPLLLWLNGGPGCSSLGGGAMQELGPFRVQSDGKTLHRNKHAWNNVANVVFLE  169

Query  527   SPAGVGFSYSNRSSDYVT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVP  703
             SPAGVGFSY+  SSDY   GDK+TA D Y FL+NWLERFPEYKTRD F+TGESYAGHYVP
Sbjct  170   SPAGVGFSYTKTSSDYENRGDKRTAEDTYTFLVNWLERFPEYKTRDFFVTGESYAGHYVP  229

Query  704   QLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIAN  883
             QLA LI+ NNK  N+  INL+GIAIGNAYID  T   G Y+F W HA+ SD T+R I   
Sbjct  230   QLASLIVLNNKKPNKPTINLRGIAIGNAYIDTNTTLMGMYEFLWMHAMYSDRTYRLIRRK  289

Query  884   CNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSS  1063
             C  S     S  C+   + AD  +G+I  +N+Y P C +      +SV  S+  FDPC+ 
Sbjct  290   CKISDMY--SSECENATNLADFEIGSIDRFNVYVPLC-TKKLHQPTSVTSSNVEFDPCAG  346

Query  1064  DYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVW  1243
             +Y+Y YLN PEVQK+LHA    IP  W  CS+     W D P T+LP IK+L  SGI +W
Sbjct  347   NYVYAYLNLPEVQKSLHA----IPFLWTYCSRG---GWRDSPYTMLPMIKQLATSGIRMW  399

Query  1244  LYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHF  1423
             LYSGD+D  V+VT+T Y +  L   +K+PW PW +  EV GYVV Y  L+FVT+RGAGH 
Sbjct  400   LYSGDMDSVVSVTSTKYFLRMLGLPIKSPWRPWQANSEVAGYVVAYNGLTFVTVRGAGHE  459

Query  1424  VPSYQPERALTFFSAFVEGKLPP  1492
             VPSYQPER+L   SAF+EGKLPP
Sbjct  460   VPSYQPERSLIMISAFLEGKLPP  482



>ref|XP_004502015.1| PREDICTED: serine carboxypeptidase-like 40-like [Cicer arietinum]
Length=489

 Score =   468 bits (1204),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 266/436 (61%), Positives = 312/436 (72%), Gaps = 10/436 (2%)
 Frame = +2

Query  197   SVYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESET-PSDKP  373
             S Y+  Q+GL+ ADKI  LPGQP GV F  +SGYVTVDP+AGR LFYYFAES   PS KP
Sbjct  59    SAYVAPQEGLRLADKIDTLPGQPYGVDFDHYSGYVTVDPKAGRELFYYFAESPYFPSSKP  118

Query  374   LVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSY  553
             L+LWLNGGPGCSS G G   E GPFRVNSD KTL+ NKYAWN VANV+FLESPAGVGFSY
Sbjct  119   LILWLNGGPGCSSLGYGAFEELGPFRVNSDGKTLYRNKYAWNEVANVLFLESPAGVGFSY  178

Query  554   SNRSSDY-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRN  730
             S+ +SDY  +GDK+TA D Y+FL+NWLERFP+YKTRD +ITGESYAGHYVPQLA  IL N
Sbjct  179   SDTTSDYDKSGDKRTANDAYVFLINWLERFPQYKTRDFYITGESYAGHYVPQLAYTILSN  238

Query  731   NKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASP  910
             NK+ N+TIINLKGI+IGNA+ID+ T   G YD++WTHAL SD+TH  I   C+F+S    
Sbjct  239   NKLYNKTIINLKGISIGNAWIDDATSLKGLYDYFWTHALNSDQTHELIDKYCDFTSEKI-  297

Query  911   SDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNT  1090
             S  C    + A    G+I  YNIYAP C        +   GS   FDPCS +Y   YLN 
Sbjct  298   SAICVNATEKALIEKGHIDFYNIYAPQC--HDSSLKNGSTGSVYEFDPCSDNYGIAYLNR  355

Query  1091  PEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGK  1270
             PEVQKALHA     P  W  CS DV + W D P T+LPTIK L+ SGI +W+YSGD D +
Sbjct  356   PEVQKALHAK----PTNWTHCS-DVILKWNDSPVTILPTIKYLIDSGIKLWIYSGDTDAR  410

Query  1271  VAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERA  1450
             V VT++ Y+IN L   +   W PWYS  EVGGYV GY+ L+ VT+RGAGH VPS+QP RA
Sbjct  411   VPVTSSRYSINTLKLPITAAWRPWYSGKEVGGYVEGYKGLTLVTVRGAGHLVPSWQPARA  470

Query  1451  LTFFSAFVEGKLPPKS  1498
             LT  S+F+ G LPP S
Sbjct  471   LTLISSFIYGILPPVS  486



>gb|KHN12757.1| Serine carboxypeptidase II-3 [Glycine soja]
Length=445

 Score =   466 bits (1199),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 261/434 (60%), Positives = 314/434 (72%), Gaps = 12/434 (3%)
 Frame = +2

Query  206   IGAQDGLKDADKISALPGQP-EGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLV  379
             +  Q GL + DK+ ALPGQP +GV F Q++GYVTVD +AGRALFYYF ES    S+KPLV
Sbjct  17    VKEQSGLMEGDKVKALPGQPAQGVDFDQYAGYVTVDAKAGRALFYYFVESPHNASNKPLV  76

Query  380   LWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSN  559
             LWLNGGPGCSSFG G M E GPFRVNSD +TL+ N+YAWNNVANVIFLESPAGVGFSYSN
Sbjct  77    LWLNGGPGCSSFGYGAMQELGPFRVNSDGRTLYTNQYAWNNVANVIFLESPAGVGFSYSN  136

Query  560   RSSDYV-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNK  736
              SSDY  TGDK TA D+Y FLLNWLERFP+YKTRDLFITGESYAGHYVPQLA  IL  NK
Sbjct  137   TSSDYTKTGDKSTAMDSYTFLLNWLERFPQYKTRDLFITGESYAGHYVPQLADTILTYNK  196

Query  737   ITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSD  916
             +TN T+INLKGIA+GN +ID+     G Y+++WTHAL SDETH GI  +C+F +    S+
Sbjct  197   LTNHTVINLKGIAVGNGWIDDNMCGKGMYEYFWTHALNSDETHEGIQRHCDFENGNLTSE  256

Query  917   TCDTFVDDADRSMGNIYSYNIYAPFCssgsglssss-vqgssrgFDPCSSDYIYVYLNTP  1093
              C  +    D  +G I  Y IYAP C S +  + +S    S   +DPCS DY   YLN  
Sbjct  257   -CSKYQIRGDIEIGTIDIYGIYAPPCDSAATKAGASPATNSDSNYDPCSDDYTNSYLNLA  315

Query  1094  EVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKV  1273
             EVQ+ALHA  +     W  C     V W D P T+LPTI  L+ SGI+ W+YSGD DG+V
Sbjct  316   EVQEALHAKAS----VWYPCR---GVGWTDSPATILPTINRLISSGINTWIYSGDTDGRV  368

Query  1274  AVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERAL  1453
              +T++ Y+IN +   V+T W PWYS  EVGGY+VGY+ L+ +T+RGAGH VPSYQP+RAL
Sbjct  369   PITSSRYSINSMKLPVETTWRPWYSSNEVGGYLVGYKGLTLITVRGAGHMVPSYQPQRAL  428

Query  1454  TFFSAFVEGKLPPK  1495
             T  S F+ G+LPP+
Sbjct  429   TMISFFLRGELPPE  442



>ref|XP_006853073.1| hypothetical protein AMTR_s00038p00085900 [Amborella trichopoda]
 gb|ERN14540.1| hypothetical protein AMTR_s00038p00085900 [Amborella trichopoda]
Length=494

 Score =   468 bits (1203),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 257/465 (55%), Positives = 322/465 (69%), Gaps = 7/465 (2%)
 Frame = +2

Query  116   ESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIG-AQDGLKDADKI-SALPGQPEGVKFAQF  289
             E+L K  K K    +   ++   +  G V     Q GLK+ D+I   L GQPEGV+F Q+
Sbjct  31    EALTKLMKAKMTGESRVEMVQKWESFGEVARALPQHGLKEKDEIVGGLHGQPEGVEFKQY  90

Query  290   SGYVTVDPQAGRALFYYFAESETPSDKPLVLWLnggpgcssfgnggMMENGPFRVNSDSK  469
             +GYVT+D  AGRALFYYFAE+  P  KPL+LWLNGGPGCSS G G M E GPFRV SD K
Sbjct  91    AGYVTLDETAGRALFYYFAEAVDPLSKPLLLWLNGGPGCSSLGYGAMEELGPFRVQSDGK  150

Query  470   TLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFLLNWLERFPE  646
             TL+ N+YAWN  ANV+FLESPAGVGFSYSN +SDY ++GD +TA+D Y FL+NW ERFPE
Sbjct  151   TLYKNRYAWNKAANVLFLESPAGVGFSYSNTTSDYELSGDSRTASDAYTFLINWFERFPE  210

Query  647   YKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDSGTYD  826
             YK RD +I+GESYAGHYVPQLA  +L +N+   +TIINLKGIAIGNA I++ET   G YD
Sbjct  211   YKNRDFYISGESYAGHYVPQLAYQVLSHNQKAGKTIINLKGIAIGNAVINDETDGPGMYD  270

Query  827   FYWTHALISDETHRGIIANCNFS-SAASPSDTCDTFVDDADRSMGNIYSYNIYAPFCssg  1003
             ++W HA ISDET   I   C+FS +A S +  C     +AD+++  I  YNIYAP C + 
Sbjct  271   YFWNHAFISDETIGAIHKYCDFSPNATSQNQQCHDAAREADKNVNPIDIYNIYAPLC-NF  329

Query  1004  sglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWED  1183
             SG +    +     FDPC+  Y+  YLN PEVQKA HANVT +  PW +CS D+  +W D
Sbjct  330   SGFTHKPHKRVVLEFDPCTDYYVDNYLNLPEVQKAFHANVTRLNYPWSACS-DIITHWND  388

Query  1184  MPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYS-Kgev  1360
              P T+LP +K+ M +GI V +YSGD DG+V VT T Y++N LN SVKTPWYPWY+ K   
Sbjct  389   SPSTILPLLKDFMANGIRVLVYSGDTDGRVPVTGTRYSLNMLNLSVKTPWYPWYTRKEVG  448

Query  1361  ggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPK  1495
             G  V+    L+F T+RGAGH VPSYQP R+LT  +AF++GK  P+
Sbjct  449   GYSVIYNGGLTFATVRGAGHEVPSYQPARSLTLVNAFLKGKPLPR  493



>ref|XP_006434836.1| hypothetical protein CICLE_v10000968mg [Citrus clementina]
 gb|ESR48076.1| hypothetical protein CICLE_v10000968mg [Citrus clementina]
Length=485

 Score =   467 bits (1202),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 269/479 (56%), Positives = 333/479 (70%), Gaps = 18/479 (4%)
 Frame = +2

Query  80    CYSIG--GRKFDPLESLLKTQKQKR-QNNNAQTIIMSAQDLGS-VYIGAQDGLKDADKIS  247
             CY +     + D L  L+ ++K +  Q     T     +++ S V IG Q+G+ +ADKI 
Sbjct  19    CYQLACYANQIDNLNRLINSKKSRNPQRTEPWTDQSKVRNVMSPVDIGPQEGMMEADKIK  78

Query  248   ALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgng  424
              LPGQPEGV F Q++GY+TVDP+AGRALFYYF ES ++ S KPLVLWLNGGPGCSS G G
Sbjct  79    TLPGQPEGVDFDQYAGYLTVDPKAGRALFYYFVESPQSSSSKPLVLWLNGGPGCSSLGYG  138

Query  425   gMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVT-GDKKTAA  601
              M E GPFRVNSD KTL+ N+YAWNNVANV+FLE+PAGVGFSYSN SSDY   GD  TA 
Sbjct  139   AMEELGPFRVNSDGKTLYRNEYAWNNVANVLFLETPAGVGFSYSNTSSDYSNLGDNNTAE  198

Query  602   DNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIG  781
             D+Y FL+NW ERFP+YK RD FITGESYAGHYVPQLA  IL  N  T++TIINLKGIAIG
Sbjct  199   DSYTFLVNWFERFPQYKNRDFFITGESYAGHYVPQLAYTILSKN--TSKTIINLKGIAIG  256

Query  782   NAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGN  961
             NA+ID+     G +DF+WTHAL SDET+  I   C+F++    S +CD +     R  G 
Sbjct  257   NAWIDDNLCTKGMFDFFWTHALNSDETNAAINKYCDFATGQL-STSCDQYQTQGVREYGQ  315

Query  962   IYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGP  1141
             I  YN+YAP C S +    ++       +DPCS  Y+  YLN  EVQ ALHA  T     
Sbjct  316   IDLYNVYAPLCKSSAPPPPTAGVIRE--YDPCSDKYVNSYLNLAEVQAALHAKHTN----  369

Query  1142  WDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSV  1321
             W +C    ++ W D P TVLPTI++L+ SGI VW+YSGD DG+V VT++ Y+IN LN  V
Sbjct  370   WTTCG---DLRWTDSPSTVLPTIQQLIASGIRVWIYSGDTDGRVPVTSSRYSINALNLPV  426

Query  1322  KTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
             +T WYPWY+ GEVGGYV+GY+ + F T+RGAGH VP+ QP+RAL   S+F+EG LPP S
Sbjct  427   ETAWYPWYTDGEVGGYVLGYKGVVFTTVRGAGHMVPTNQPQRALIMISSFLEGNLPPSS  485



>ref|XP_004292825.1| PREDICTED: serine carboxypeptidase II-3-like [Fragaria vesca 
subsp. vesca]
Length=495

 Score =   467 bits (1202),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 262/476 (55%), Positives = 328/476 (69%), Gaps = 22/476 (5%)
 Frame = +2

Query  113   LESLLKTQKQKRQNNNAQTIIMSAQDLGS------VYIGAQDGLKDADKISALPGQP-EG  271
             +++L K  K ++  N+ Q  +    D  +      VY+G+Q GL  AD+I ALPGQP EG
Sbjct  28    IDNLNKLIKSRKSANSPQAELSWENDFLADDRFLPVYVGSQAGLMGADEIDALPGQPGEG  87

Query  272   VKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMENGPF  448
             + F Q++GYV+V+P+AGR LFYYF ES    S KPL+LWLNGGPGCSSFG G + E GPF
Sbjct  88    MGFKQYAGYVSVEPKAGRELFYYFVESPHNSSTKPLLLWLNGGPGCSSFGYGALEELGPF  147

Query  449   RVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVT-GDKKTAADNYIFLLN  625
             RVNSD KTL+ N YAWNNVAN++FLESPAGVGFSYSN  SDY + GDK+TA D+Y FL+N
Sbjct  148   RVNSDGKTLFPNDYAWNNVANILFLESPAGVGFSYSNTKSDYESVGDKRTALDSYTFLVN  207

Query  626   WLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEET  805
             WL+RFP+YKTRD FI GESYAGHYVPQLA  I+  NK+TNQT INLKGIAIGNA+ID+  
Sbjct  208   WLDRFPQYKTRDFFIAGESYAGHYVPQLAYTIVTKNKVTNQTKINLKGIAIGNAWIDDNH  267

Query  806   QDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYA  985
              + G +++ WTHAL SDET+ GI   C+F S  + S  C  +++ A   +G++  YNIYA
Sbjct  268   GEMGIFEYLWTHALNSDETYEGINKYCDFVS-GNFSSKCTKYLNQASDELGDVDIYNIYA  326

Query  986   PFCssgsgls----sssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSC  1153
             P C+  S  S     S       GFDPCS  Y+Y YLN  EVQ ALH      P  W +C
Sbjct  327   PLCNLSSSSSDTIYISVGSAVVNGFDPCSDYYVYAYLNLKEVQAALHVK----PTNWSAC  382

Query  1154  SQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPW  1333
             S    V W D P T+LPTIK L+ SGI+VW+YSGD DG+V VT++ Y+++ L+  ++ PW
Sbjct  383   S---GVGWTDSPPTILPTIKHLLESGITVWIYSGDTDGRVPVTSSRYSLHNLSLPIQAPW  439

Query  1334  YPWYS-KgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
              PWYS K   G        L+F T+RGAGH VPSYQP+RALT  S+F+ GKLPP S
Sbjct  440   RPWYSDKEVGGYVTGYKGGLAFATVRGAGHEVPSYQPKRALTMISSFLHGKLPPSS  495



>gb|AAT78819.1| putative serine carboxypeptidase [Oryza sativa Japonica Group]
Length=486

 Score =   466 bits (1199),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 251/436 (58%), Positives = 312/436 (72%), Gaps = 8/436 (2%)
 Frame = +2

Query  200   VYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAE-SETPSDKPL  376
             +Y+ +QDGLK+ADK+S LPGQP    F Q++GYVTV+  +G+ALFYYFAE ++ PS KPL
Sbjct  55    LYMSSQDGLKEADKVSELPGQPGRAGFDQYAGYVTVNATSGKALFYYFAEATDDPSTKPL  114

Query  377   VLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYS  556
             VLWLNGGPGCSS G+G M+E GPF VN D++TL +N+YAWNNVAN++FLESPAGVGFSYS
Sbjct  115   VLWLNGGPGCSSLGDGAMLEIGPFLVNGDNRTLSINRYAWNNVANMLFLESPAGVGFSYS  174

Query  557   NRSSDY-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNN  733
             N +SDY  TGD  TAAD Y FL NWLERFPEYK RD FITGESY GHY+PQLA  IL NN
Sbjct  175   NTTSDYDNTGDTSTAADAYTFLTNWLERFPEYKGRDFFITGESYGGHYIPQLANAILSNN  234

Query  734   KITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPS  913
              ITN TIINLKG+AIGNAY+D+ T    T D+YWTHALIS ETH  +  NC+F+      
Sbjct  235   NITNVTIINLKGVAIGNAYLDDSTNTRATIDYYWTHALISKETHLAVQRNCSFNGTYMAQ  294

Query  914   DTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTP  1093
               C   + +AD   G I  YNIYAP C   +  +   + GS+   DPCS  Y+  YLN P
Sbjct  295   --CRNALAEADTEKGVIDPYNIYAPLC--WNASNPRQLHGSAINVDPCSRYYVESYLNRP  350

Query  1094  EVQKALHANVTGIPGPWDSCSQDVN-VNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGK  1270
             EVQ+ LHAN TG+  PW  CS  +   NW+D P ++LP+I+ L+ SG+S WLYSGDID  
Sbjct  351   EVQRTLHANTTGLKQPWSGCSNIITPENWKDAPVSMLPSIQGLISSGVSTWLYSGDIDAV  410

Query  1271  VAVTTTTYAINKLNTSVKTPWYPWYSKgevggy-vvgyeDLSFVTIRGAGHFVPSYQPER  1447
               VT+T Y+++ L   + + W PWYS        VVGY+ L F T+R +GH VP+YQP+R
Sbjct  411   CPVTSTLYSLDILELPINSSWRPWYSDDNEVAGYVVGYKGLVFATVRESGHMVPTYQPQR  470

Query  1448  ALTFFSAFVEGKLPPK  1495
             ALT FS+F++G LPP+
Sbjct  471   ALTLFSSFLQGILPPE  486



>ref|XP_003592240.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=497

 Score =   466 bits (1200),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 263/442 (60%), Positives = 317/442 (72%), Gaps = 11/442 (2%)
 Frame = +2

Query  179   SAQDLGSVYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESE-  355
             S  D  + Y+  Q+GL+ ADKI  LPGQP GV F Q+SGYVTV+P+AGR LFYYF ES  
Sbjct  55    SKTDSSAPYVTPQEGLRQADKIDTLPGQPYGVNFDQYSGYVTVNPEAGRELFYYFVESPY  114

Query  356   TPSDKPLVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPA  535
               S KPLVLWLNGGPGCSS G G   E GPFR+NSD KTL+ N+YAWN VANV+FLESPA
Sbjct  115   NSSTKPLVLWLNGGPGCSSLGYGAFQELGPFRINSDGKTLYRNQYAWNEVANVLFLESPA  174

Query  536   GVGFSYSNRSSDY-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLA  712
             GVGFSYSN +SDY  +GDK TA D+Y+FL+NWLERFP+YKTR  +I GESYAGHYVPQLA
Sbjct  175   GVGFSYSNTTSDYDKSGDKSTAKDSYVFLINWLERFPQYKTRAFYIAGESYAGHYVPQLA  234

Query  713   QLILRNNKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNF  892
               IL NNK+ N T+INLKGI+IGNA+ID+ T   G +D++WTHAL SD+TH  I   C+F
Sbjct  235   STILHNNKLYNNTVINLKGISIGNAWIDDATSLKGLFDYFWTHALNSDQTHELIEKYCDF  294

Query  893   S---SAASPSDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSS  1063
             +   ++ + S  C+   D A    G I  YNIYAP C   S L + S    S  FDPCS 
Sbjct  295   TVDFTSGNTSAICNNVTDRAYTEKGKIDFYNIYAPLC-HDSSLKNGSTGYVSNDFDPCSD  353

Query  1064  DYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVW  1243
              Y   YLN PEVQ+ALHA     P  W  CS+ +N  W+D P TVLPTIK L+ SGI +W
Sbjct  354   YYGIAYLNRPEVQQALHAK----PTNWSYCSE-INSKWKDSPITVLPTIKYLIDSGIKLW  408

Query  1244  LYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHF  1423
             +YSGD DG+V VT++ Y+IN L   +   W+PWYS  E+GGYVVGY+ L+FVT+RGAGH 
Sbjct  409   IYSGDTDGRVPVTSSRYSINTLKLPINDAWHPWYSGKEIGGYVVGYKGLTFVTVRGAGHL  468

Query  1424  VPSYQPERALTFFSAFVEGKLP  1489
             VPS+QPERALT  S+F+ G LP
Sbjct  469   VPSWQPERALTLISSFLYGSLP  490



>ref|XP_011090479.1| PREDICTED: serine carboxypeptidase II-3-like [Sesamum indicum]
Length=483

 Score =   466 bits (1198),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 272/466 (58%), Positives = 322/466 (69%), Gaps = 18/466 (4%)
 Frame = +2

Query  125   LKTQKQKRQNNNAQTI------IMSAQDLGSVYIGAQDGLKDADKISALPGQPEGVKFAQ  286
             L +Q + R + N+ +       + + ++   V++ +QDG   ADKIS LPGQP+ V F Q
Sbjct  28    LHSQLKSRISQNSISYSDSWSQLHAQREYSPVFLTSQDGQMQADKISTLPGQPDNVDFDQ  87

Query  287   FSGYVTVDPQAGRALFYYFAESET-PSDKPLVLWLnggpgcssfgnggMMENGPFRVNSD  463
             +SGY+TVDPQAGRALFYYF ES T  S  PLVLWLNGGPGCSSFG G M E GPFRVNSD
Sbjct  88    YSGYITVDPQAGRALFYYFVESPTNSSTNPLVLWLNGGPGCSSFGFGAMEELGPFRVNSD  147

Query  464   SKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFLLNWLERF  640
              KTL+ N YAWNNVANVIFLESPAGVGFSYSN S+DY  TGD +TA D Y FL+NWL+RF
Sbjct  148   GKTLFRNNYAWNNVANVIFLESPAGVGFSYSNTSADYDTTGDIRTAGDAYTFLVNWLDRF  207

Query  641   PEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDSGT  820
             P+YK RD +ITGESYAGHYVPQLA  IL NNK TNQT+INLKGIAIGNA +D+     G 
Sbjct  208   PQYKDRDFYITGESYAGHYVPQLAYTILINNKRTNQTVINLKGIAIGNALVDDSMLGQGF  267

Query  821   YDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFCss  1000
             +D  WT+AL SDETH GI+  C+F +  + SD C +FV  +    G+    NIYAP C  
Sbjct  268   FDHLWTYALNSDETHAGILKYCDFVNGTA-SDKCFSFVQKSSDEAGDFDINNIYAPVC--  324

Query  1001  gsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWE  1180
              + +  +   GS   FDPCS  Y+  YLNT EVQ A H      P  W  C      +W 
Sbjct  325   LNPVLKNGSTGSVNFFDPCSDTYVKYYLNTAEVQGAFHVR----PTTWSGCR---GFHWT  377

Query  1181  DMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgev  1360
             D    VLPTI++LM SG+ VWLYSGDID  V VT+T YAIN L   V+T W PWY   EV
Sbjct  378   DWQSNVLPTIQDLMASGMRVWLYSGDIDANVPVTSTRYAINSLKLPVQTAWRPWYLDDEV  437

Query  1361  ggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
             GGYVVGYE L+FVT+RGAGH VPSYQP+RAL   S+F++G LPP S
Sbjct  438   GGYVVGYEGLTFVTVRGAGHLVPSYQPQRALAMISSFLQGVLPPSS  483



>ref|XP_006480243.1| PREDICTED: serine carboxypeptidase II-3-like [Citrus sinensis]
Length=485

 Score =   465 bits (1196),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 252/416 (61%), Positives = 306/416 (74%), Gaps = 13/416 (3%)
 Frame = +2

Query  101   KFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQPEGVKF  280
             ++D L   +K Q++ R    +     + ++  + YIG Q+GLK+ADKI  LPGQP GV+ 
Sbjct  25    EYDLLGKFIKAQQEGRYVEYSGAPKEAGKE-STAYIGPQEGLKEADKIEKLPGQPYGVEI  83

Query  281   AQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLnggpgcssfgnggMMENGPFRVNS  460
              Q+SGYVTVDP+AGRALFYYF ES+  S KPLVLW NGGPGCSSFG G MME GPFRVNS
Sbjct  84    DQYSGYVTVDPKAGRALFYYFVESQNSSTKPLVLWHNGGPGCSSFGFGAMMELGPFRVNS  143

Query  461   DSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFLLNWLER  637
             D K+L  N+YAWNNVAN++FLESPAGVGFSYSN SSDY + GD++TAAD+Y FLLNW ER
Sbjct  144   DGKSLSHNEYAWNNVANMLFLESPAGVGFSYSNTSSDYDMNGDERTAADSYTFLLNWFER  203

Query  638   FPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDSG  817
             FPEYK+R  F+ GESYAGHY+PQ+A  IL+ NK  NQT INLKG+A+G+A+ID ET + G
Sbjct  204   FPEYKSRAFFLAGESYAGHYIPQVALTILQFNK--NQTFINLKGLAMGDAWIDTETGNKG  261

Query  818   TYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFCs  997
              +DFYWTHALISDE   GI +NCNF+     S  C +++  A  SMGNI   +IYAP CS
Sbjct  262   MFDFYWTHALISDEVIHGINSNCNFTKF---SKACASYLIKAYESMGNINILDIYAPLCS  318

Query  998   sgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNW  1177
             S    SS         FDPCS  Y++ YLN+P+VQK+LHANVTGI GPW  CS  V  +W
Sbjct  319   SSFSTSSVLP------FDPCSEIYVHSYLNSPQVQKSLHANVTGIRGPWQDCSDTVLRHW  372

Query  1178  EDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWY  1345
             +D P TVLP+I+ELM SGISV++YSGD DG V   +T Y+INKL   VKT WYPWY
Sbjct  373   KDSPLTVLPSIQELMTSGISVYIYSGDTDGMVPTISTRYSINKLEAKVKTAWYPWY  428



>ref|XP_006650145.1| PREDICTED: serine carboxypeptidase II-3-like [Oryza brachyantha]
Length=487

 Score =   465 bits (1196),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 250/436 (57%), Positives = 311/436 (71%), Gaps = 8/436 (2%)
 Frame = +2

Query  200   VYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPL  376
             +Y+ +QDGLK+ADK+S LPGQP    F Q++GYVTV+  +G+ALFYYF E+ + PS KPL
Sbjct  56    LYMSSQDGLKEADKVSELPGQPSRADFDQYAGYVTVNATSGKALFYYFVEAVQDPSTKPL  115

Query  377   VLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYS  556
             VLWLNGGPGCSS G+G M+E GPF VNSD++TL +N+YAWNNVAN++F+ESPAGVGFSYS
Sbjct  116   VLWLNGGPGCSSLGDGAMLEIGPFFVNSDNRTLSINRYAWNNVANMLFIESPAGVGFSYS  175

Query  557   NRSSDYV-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNN  733
             N +S+Y  TGD+ T AD Y FL NWLERFPEYK RD FITGESY GHY+PQLA  IL NN
Sbjct  176   NATSEYNNTGDRSTTADAYTFLTNWLERFPEYKGRDFFITGESYGGHYIPQLANAILSNN  235

Query  734   KITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPS  913
              ITN TIINLKG+AIGNAY+D+ T    T D+YWTHALIS ETH  +  +C+F       
Sbjct  236   NITNATIINLKGVAIGNAYLDDSTNTRATIDYYWTHALISKETHLAVQQHCSFDGTYMAQ  295

Query  914   DTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTP  1093
               C   +  A+   G I  YNIYAP C   +      + G +   DPCS  YI  YLN P
Sbjct  296   --CRNALAAAENEKGVIDPYNIYAPLC--WNASDPQQLHGLAINVDPCSRYYIDSYLNRP  351

Query  1094  EVQKALHANVTGIPGPWDSCSQDVN-VNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGK  1270
             EVQ+ALHAN TG+  PW  CS  +   NW+D P ++LP+I+EL+ SG+S WLYSGDID  
Sbjct  352   EVQRALHANATGLKQPWSDCSNIITPENWKDAPMSMLPSIQELISSGVSTWLYSGDIDAV  411

Query  1271  VAVTTTTYAINKLNTSVKTPWYPWYSKgevggy-vvgyeDLSFVTIRGAGHFVPSYQPER  1447
               VT+T Y+++ L   + + W PWYS     G  VVGY+ L F T+R AGH VP+YQP+R
Sbjct  412   CPVTSTLYSLDILELPISSFWRPWYSDDNEVGGYVVGYKGLVFATVREAGHMVPTYQPQR  471

Query  1448  ALTFFSAFVEGKLPPK  1495
             ALT FS+F++G LPP+
Sbjct  472   ALTLFSSFLQGTLPPE  487



>ref|XP_006830191.1| hypothetical protein AMTR_s00173p00045470 [Amborella trichopoda]
 gb|ERM97607.1| hypothetical protein AMTR_s00173p00045470 [Amborella trichopoda]
Length=489

 Score =   465 bits (1196),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 269/465 (58%), Positives = 319/465 (69%), Gaps = 17/465 (4%)
 Frame = +2

Query  116   ESLLKTQKQKRQNN--NAQTIIMSA--QDLGSVYIGAQDGLKDADKISALPGQPEGVKFA  283
             E L K  K+KR      ++  +  +  ++   VY+  QDGLK  DKI  LPGQP+GV F 
Sbjct  32    ELLYKLIKEKRGGKVFTSEPYVSRSRRENYSPVYVAPQDGLKAIDKIEKLPGQPQGVDFE  91

Query  284   QFSGYVTVDPQAGRALFYYFAESETPS-DKPLVLWLnggpgcssfgnggMMENGPFRVNS  460
             Q+SGYVTVDP AGRALFYYF ES   S  KPLV+WLNGGPGCSS G G M E GPFRV S
Sbjct  92    QYSGYVTVDPTAGRALFYYFVESPADSATKPLVIWLNGGPGCSSLGYGAMEELGPFRVMS  151

Query  461   DSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFLLNWLER  637
             D KTL+ N YAWN VAN++FLESPAGVGFSYSN SSDY ++GDK+TA D Y FL+NWLER
Sbjct  152   DGKTLFRNPYAWNQVANMLFLESPAGVGFSYSNTSSDYKLSGDKRTARDAYTFLVNWLER  211

Query  638   FPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDSG  817
             FPEYKTRD FITGESYAGHYVPQLA  IL     +N + I  KGIAIGNA+ID+ET   G
Sbjct  212   FPEYKTRDFFITGESYAGHYVPQLAYTIL----TSNNSNIKFKGIAIGNAWIDDETNTLG  267

Query  818   TYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSM-GNIYSYNIYAPFC  994
              YD++WTHALISD+T   I   C+FS  A+ SD CD  V+ A+      I  YNIYAP C
Sbjct  268   MYDYFWTHALISDDTIGAIHTYCDFSPNATNSDHCDAAVNAANSVFYDQIDIYNIYAPLC  327

Query  995   ssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVN  1174
              + +     +       FDPCSS Y+  YLN  EVQ ALHA     P  W +CS  V   
Sbjct  328   HTANTTLPPTGSIDY--FDPCSSTYVENYLNLKEVQAALHAK----PTSWTACSGIVGAY  381

Query  1175  WEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKg  1354
             W D P T+LPTI+ L+ SGISVW+YSGDIDG+V VT++ Y++N LN +  TPW+ WY   
Sbjct  382   WNDSPATLLPTIRRLLDSGISVWIYSGDIDGRVPVTSSRYSVNSLNLTKVTPWHSWYLNE  441

Query  1355  evggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLP  1489
             EV GYV GY+ L+ VT+RGAGH VPSYQP RAL   S F++ KLP
Sbjct  442   EVAGYVEGYKGLALVTVRGAGHTVPSYQPARALAMLSFFLQNKLP  486



>gb|KDO47634.1| hypothetical protein CISIN_1g011108mg [Citrus sinensis]
Length=493

 Score =   464 bits (1194),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 264/467 (57%), Positives = 318/467 (68%), Gaps = 16/467 (3%)
 Frame = +2

Query  116   ESLLKTQKQKRQNNNAQTIIMSAQD-----LGSVYIGAQD-GLKDADKISALPGQPEGVK  277
             ++L +  K KR  N +Q  + +  +         YI  Q   L  ADKI  LPGQP+GV 
Sbjct  32    DNLYRLIKSKRLKNRSQAELKADDEEYYYSATKTYINPQQYDLMLADKIKWLPGQPDGVD  91

Query  278   FAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMENGPFRV  454
             F Q++GYVTVDP+ GR+LFYYFAES +  S  PL+LWLNGGPGCSS G G M E GPFRV
Sbjct  92    FDQYAGYVTVDPKTGRSLFYYFAESPQNSSTNPLLLWLNGGPGCSSLGYGAMSELGPFRV  151

Query  455   NSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFLLNWL  631
             N D KTL+ N YAWNNVANV+FLESPAGVGFSYS+  SDY + GDK TA D+Y FL+NWL
Sbjct  152   NKDGKTLFRNNYAWNNVANVVFLESPAGVGFSYSSTKSDYELNGDKLTAQDSYTFLVNWL  211

Query  632   ERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQD  811
             ERFP+YK RD +I GESYAGHYVPQLA  IL NNK T  T+INLKGIAIGNA ID  T+ 
Sbjct  212   ERFPQYKKRDFYIAGESYAGHYVPQLAYTILLNNKNTKNTVINLKGIAIGNALIDGPTRS  271

Query  812   SGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPF  991
              G Y+  WTHAL SD+TH+GI   C+F+   + +  C+TF++ A   +G+I  YNIYAP 
Sbjct  272   MGVYENLWTHALNSDQTHKGIFTYCDFAREGNDTKECETFLEKASDEIGDIDIYNIYAPI  331

Query  992   CssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNV  1171
             C   +    +   GS   +DPC+  Y+  YLNT EVQ  LH      P  W +CS     
Sbjct  332   C--INPAFQNGSIGSVHNYDPCTDYYVEAYLNTREVQTVLHVK----PTNWTACSNL--F  383

Query  1172  NWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSK  1351
             NW D P TVLPTIK L+ SGI VW+YSGD+DG V  T + Y+IN LN  V+ PWYPWY+ 
Sbjct  384   NWTDSPSTVLPTIKNLIASGIRVWIYSGDVDGIVPTTASRYSINALNLPVEIPWYPWYTN  443

Query  1352  gevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
              EVGGYV  Y+ L+ VT+RGAGH VPS QPERALT  S+F+ G LPP
Sbjct  444   DEVGGYVEAYQGLTLVTVRGAGHLVPSDQPERALTLISSFLHGILPP  490



>ref|XP_003601337.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=497

 Score =   464 bits (1194),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 262/442 (59%), Positives = 316/442 (71%), Gaps = 11/442 (2%)
 Frame = +2

Query  179   SAQDLGSVYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESE-  355
             S  D  + Y+  Q+GL+ ADKI  LPGQP GV F Q+SGYVTV+P+AGR LFYYF ES  
Sbjct  55    SKTDSSAPYVTPQEGLRQADKIDTLPGQPYGVNFDQYSGYVTVNPEAGRELFYYFVESPY  114

Query  356   TPSDKPLVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPA  535
               S KPLVLWLNGGPGCSS G G   E GPFR+NSD KTL+ N+YAW  VANV+FLESPA
Sbjct  115   NSSTKPLVLWLNGGPGCSSLGYGAFQELGPFRINSDGKTLYRNQYAWTEVANVLFLESPA  174

Query  536   GVGFSYSNRSSDY-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLA  712
             GVGFSYSN +SDY  +GDK TA D+Y+FL+NWLERFP+YKTR  +I GESYAGHYVPQLA
Sbjct  175   GVGFSYSNTTSDYDKSGDKSTAKDSYVFLINWLERFPQYKTRAFYIAGESYAGHYVPQLA  234

Query  713   QLILRNNKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNF  892
               IL NNK+ N T+INLKGI+IGNA+ID+ T   G +D++WTHAL SD+TH  I   C+F
Sbjct  235   STILHNNKLYNNTVINLKGISIGNAWIDDATSLKGLFDYFWTHALNSDQTHELIEKYCDF  294

Query  893   S---SAASPSDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSS  1063
             +   ++ + S  C+   D A    G I  YNIYAP C   S L + S    S  FDPCS 
Sbjct  295   TVDFTSGNTSAICNNVTDRAYTEKGKIDFYNIYAPLC-HDSSLKNGSTGYVSNDFDPCSD  353

Query  1064  DYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVW  1243
              Y   YLN PEVQ+ALHA     P  W  CS+ +N  W+D P TVLPTIK L+ SGI +W
Sbjct  354   YYGIAYLNRPEVQQALHAK----PTNWSYCSE-INSKWKDSPITVLPTIKYLIDSGIKLW  408

Query  1244  LYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHF  1423
             +YSGD DG+V VT++ Y+IN L   +   W+PWYS  E+GGYVVGY+ L+FVT+RGAGH 
Sbjct  409   IYSGDTDGRVPVTSSRYSINTLKLPINDAWHPWYSGKEIGGYVVGYKGLTFVTVRGAGHL  468

Query  1424  VPSYQPERALTFFSAFVEGKLP  1489
             VPS+QPERALT  S+F+ G LP
Sbjct  469   VPSWQPERALTLISSFLYGSLP  490



>ref|XP_007015556.1| Serine carboxypeptidase II-3, expressed, putative isoform 1 [Theobroma 
cacao]
 gb|EOY33175.1| Serine carboxypeptidase II-3, expressed, putative isoform 1 [Theobroma 
cacao]
Length=496

 Score =   464 bits (1194),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 269/432 (62%), Positives = 306/432 (71%), Gaps = 12/432 (3%)
 Frame = +2

Query  203   YIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLV  379
             Y+  QDG  +ADKI ALPGQP  V F  ++GYVTVD QAGRALFYYFAES E  S  PLV
Sbjct  74    YVQPQDGSMEADKIGALPGQPNAVDFDHYAGYVTVDSQAGRALFYYFAESPENSSTNPLV  133

Query  380   LWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSN  559
             LWLNGGPGCSS     M E GPFRVNSD KTL+ N YAWNNVANVIFLESPAGVGFSYSN
Sbjct  134   LWLNGGPGCSSLTGA-MTELGPFRVNSDGKTLFRNIYAWNNVANVIFLESPAGVGFSYSN  192

Query  560   RSSDY-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNK  736
              SSDY  TGDK TA D Y FL+NWLERFP+YKTRD +ITGESYAGHYVPQLA  IL NNK
Sbjct  193   TSSDYDRTGDKSTAEDAYTFLVNWLERFPQYKTRDFYITGESYAGHYVPQLAYTILLNNK  252

Query  737   ITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSD  916
              +NQT INLKGIA+GN  I++ T   G +DF WTHAL SDET++GI   C++ +   P  
Sbjct  253   NSNQTAINLKGIAVGNGLIEDITFYLGRFDFLWTHALNSDETNKGIHTYCHYFNGKDPKQ  312

Query  917   TCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPE  1096
              CD F + A    G+I  YNIYAP C     +S+   QGS   FDPCS  Y+  YLN PE
Sbjct  313   -CDDFQNRAYDEAGDIDGYNIYAPLC-QEYSVSNKGSQGSVNSFDPCSGAYMISYLNRPE  370

Query  1097  VQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVA  1276
             VQ ALHA ++     W  CS   + +W D P TVLP IK LM SG+ VWLYSGD+D  V 
Sbjct  371   VQTALHAKLS----EWHQCS---SFDWADSPATVLPIIKSLMASGLRVWLYSGDVDAVVP  423

Query  1277  VTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALT  1456
             +TTT Y IN LN  +KT W  W +  EVGGYVV YE L+ VT+R AGHFVPSYQP RALT
Sbjct  424   ITTTRYGINILNPPIKTAWRSWSNNDEVGGYVVEYEGLTLVTVREAGHFVPSYQPARALT  483

Query  1457  FFSAFVEGKLPP  1492
               S+F++G LPP
Sbjct  484   MISSFLQGTLPP  495



>ref|XP_004984185.1| PREDICTED: serine carboxypeptidase II-3-like isoform X3 [Setaria 
italica]
Length=499

 Score =   462 bits (1190),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 249/436 (57%), Positives = 310/436 (71%), Gaps = 9/436 (2%)
 Frame = +2

Query  200   VYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPL  376
             +Y+G QDGLK  DKIS LPGQP    F Q++GYVTVD  +G+ALFYYFAE+ E PS KPL
Sbjct  69    IYVGPQDGLKKVDKISELPGQPGKAVFDQYAGYVTVDATSGKALFYYFAEAAEEPSTKPL  128

Query  377   VLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYS  556
             VLWLNGGPGCSS G   M+E GPF VN D+KTL  NKYAWNNVAN++FLESPAGVGFSYS
Sbjct  129   VLWLNGGPGCSSLGGA-MLEIGPFFVNRDNKTLSRNKYAWNNVANMLFLESPAGVGFSYS  187

Query  557   NRSSDYV-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNN  733
             NR+SDY  TGD+ T AD Y FL+NWLERFPEYK    FITGESY GHY+PQLA  IL NN
Sbjct  188   NRTSDYNNTGDRSTTADAYTFLINWLERFPEYKGHSFFITGESYGGHYIPQLANTILSNN  247

Query  734   KITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPS  913
             KI N T+INLKGIAIGNAY++++T    T D+YWTHA+IS ETH+ +  NC+F+   + +
Sbjct  248   KIMNITMINLKGIAIGNAYLNDDTNTRATIDYYWTHAMISKETHKAVQENCSFN--GTYT  305

Query  914   DTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTP  1093
               C T ++ A+   G I   NIYA FC   S         ++   DPC+S Y+  YLN  
Sbjct  306   GLCRTAIEAANNEKGLIDQSNIYASFCWDASAPRQHHASVTNT--DPCASYYMRSYLNRQ  363

Query  1094  EVQKALHANVTGIPGPWDSCSQDVN-VNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGK  1270
             EVQ+A HAN TG+  PW  CS  ++  NW+D   ++LP+I++L+ SGI  WLYSGDID  
Sbjct  364   EVQRAFHANTTGLKQPWLDCSHIISPENWKDAQVSMLPSIQQLISSGIRTWLYSGDIDAV  423

Query  1271  VAVTTTTYAINKLNTSVKTPWYPWYSKgevggy-vvgyeDLSFVTIRGAGHFVPSYQPER  1447
               VT+T Y+++ L   + +PW  WYS     G  VV Y+ L F T+RGAGH VP+YQP+R
Sbjct  424   CPVTSTLYSLDILGLQINSPWRAWYSDDGEVGGYVVEYKGLVFATVRGAGHMVPTYQPQR  483

Query  1448  ALTFFSAFVEGKLPPK  1495
             ALT FS+F++GK+PP+
Sbjct  484   ALTLFSSFLQGKMPPE  499



>ref|NP_001242872.1| uncharacterized protein LOC100820473 precursor [Glycine max]
 gb|ACU18820.1| unknown [Glycine max]
Length=496

 Score =   462 bits (1189),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 268/465 (58%), Positives = 325/465 (70%), Gaps = 22/465 (5%)
 Frame = +2

Query  134   QKQKRQNNNAQTIIMSAQDLGS------VYI-GAQDGLKDADKISALPGQP-EGVKFAQF  289
             + QKR    A ++   A +LG       VY+   Q GL + DK+ ALPGQP +GV F Q+
Sbjct  40    RAQKRSYGEASSM---ATNLGGDGKFSKVYVVKEQSGLMEGDKVKALPGQPAQGVDFDQY  96

Query  290   SGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMENGPFRVNSDS  466
             +GYVTVD +AGRALFYYF ES    S+KPLVLWLNGGPGCSSFG G M E GPFRVNSD 
Sbjct  97    AGYVTVDAKAGRALFYYFVESPHNASNKPLVLWLNGGPGCSSFGYGAMQELGPFRVNSDG  156

Query  467   KTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYV-TGDKKTAADNYIFLLNWLERFP  643
             +TL+ N+YAWNNVANVIFLESPAGVGFSYSN SSDY  TGDK TA D+Y FLLNWLERFP
Sbjct  157   RTLYTNQYAWNNVANVIFLESPAGVGFSYSNTSSDYTKTGDKSTAMDSYTFLLNWLERFP  216

Query  644   EYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDSGTY  823
             +YKTRDLFITGESYAGHYVPQLA  IL  NK+TN T+INLKGIA+GN +ID+     G Y
Sbjct  217   QYKTRDLFITGESYAGHYVPQLADTILTYNKLTNHTVINLKGIAVGNGWIDDNMCGKGMY  276

Query  824   DFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFCssg  1003
             +++WTHAL SDETH  I  +C+F +    S+ C  +    D  +G I  Y IYAP C S 
Sbjct  277   EYFWTHALNSDETHEEIQRHCDFENGNLTSE-CSKYQIRGDIEIGTIDIYGIYAPPCDSA  335

Query  1004  sglssss-vqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWE  1180
             +  + +S    S   +DPCS DY   YLN  EVQ+ALHA  +     W  C     V W 
Sbjct  336   ATKAGASPATNSDSNYDPCSDDYTNSYLNLAEVQEALHAKAS----VWYPCR---GVGWT  388

Query  1181  DMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgev  1360
             D P T+LPTI  L+ SGI+ W+YSGD DG+V +T++ Y+IN +   V+T W PWYS  EV
Sbjct  389   DSPATILPTINRLISSGINTWIYSGDTDGRVPITSSRYSINSMKLPVETTWRPWYSSNEV  448

Query  1361  ggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPK  1495
             GGY+VGY+ L+ +T+RGAGH VPSYQP+RALT  S  + G+LPP+
Sbjct  449   GGYLVGYKGLTLITVRGAGHMVPSYQPQRALTMISFSLRGELPPE  493



>ref|XP_006446687.1| hypothetical protein CICLE_v10015024mg [Citrus clementina]
 gb|ESR59927.1| hypothetical protein CICLE_v10015024mg [Citrus clementina]
Length=493

 Score =   461 bits (1187),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 263/467 (56%), Positives = 317/467 (68%), Gaps = 16/467 (3%)
 Frame = +2

Query  116   ESLLKTQKQKRQNNNAQTIIMSAQD-----LGSVYIGAQD-GLKDADKISALPGQPEGVK  277
             ++L +  K KR  N +Q  + +  +         YI  Q   L  A+KI  LPGQP+GV 
Sbjct  32    DNLYRLIKSKRLKNRSQAELKADDEEYYYSATKTYINPQQYDLMLANKIKWLPGQPDGVD  91

Query  278   FAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMENGPFRV  454
             F Q++GYVTVDP+ GR+LFYYFAES +  S  PL+LWLNGGPGCSS G G M E GPFRV
Sbjct  92    FDQYAGYVTVDPKTGRSLFYYFAESPQNSSTNPLLLWLNGGPGCSSLGYGAMSELGPFRV  151

Query  455   NSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFLLNWL  631
             N D KTL+ N YAWNNVANV+FLESPAGVGFSYS+  SDY + GDK TA D+Y FL+NWL
Sbjct  152   NKDGKTLFRNNYAWNNVANVVFLESPAGVGFSYSSTKSDYELNGDKLTAQDSYTFLVNWL  211

Query  632   ERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQD  811
             ERFP+YKTRD +I GESYAGHYVPQLA  IL NNK T  T+INLKGIAIGNA ID  T+ 
Sbjct  212   ERFPQYKTRDFYIAGESYAGHYVPQLAYTILLNNKNTKNTVINLKGIAIGNALIDGPTRS  271

Query  812   SGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPF  991
              G Y+  WTHAL SD TH+GI   C+F+   + +  C+TF++ A   +G+I  YNIYAP 
Sbjct  272   MGVYENLWTHALNSDHTHKGIFTYCDFAREGNDTKECETFLEKASDEIGDIDIYNIYAPI  331

Query  992   CssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNV  1171
             C   +    +   GS   +DPC+  Y+  YLN  EVQ  LH      P  W +CS     
Sbjct  332   C--INPAFQNGSIGSVYNYDPCTDYYVEAYLNAREVQTVLHVK----PTNWTACSNL--F  383

Query  1172  NWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSK  1351
             NW D P TVLPTIK L+ SGI VW+YSGD+DG V  T + Y+IN LN  V+ PWYPWY+ 
Sbjct  384   NWTDSPSTVLPTIKNLIASGIRVWIYSGDVDGIVPTTASRYSINALNLPVEIPWYPWYTN  443

Query  1352  gevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
              EVGGYV  Y+ L+ VT+RGAGH VPS QPERALT  S+F+ G LPP
Sbjct  444   DEVGGYVEAYQGLTLVTVRGAGHLVPSDQPERALTLISSFLHGILPP  490



>emb|CDP01380.1| unnamed protein product [Coffea canephora]
Length=496

 Score =   461 bits (1187),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 272/484 (56%), Positives = 321/484 (66%), Gaps = 32/484 (7%)
 Frame = +2

Query  86    SIGGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQ-DLGSVYIGAQDGLKDADKISALPGQ  262
             SIGG K   +E LL  Q++  QN  +          L S Y+ +Q G K+ DKI  LPGQ
Sbjct  28    SIGGLK---MEELL--QEEPSQNFASPKFGSDTSFSLSSAYLYSQSGRKENDKIQRLPGQ  82

Query  263   PEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMEN  439
             P+GV F Q+SGYVTVDP +GRALFYYF ES    S  PLVLWLNGGPGCSS G G + E 
Sbjct  83    PDGVDFNQYSGYVTVDPNSGRALFYYFVESPRNSSSNPLVLWLNGGPGCSSLGAGALTEL  142

Query  440   GPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIF  616
             GPFRV    K L+ N+YAWN  AN+IFLESPAGVGFSY+N +SDY  TGD++TA D Y F
Sbjct  143   GPFRVEKGGKILYRNQYAWNADANIIFLESPAGVGFSYTNTTSDYDFTGDERTAVDTYTF  202

Query  617   LLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYID  796
             L+NWLERFPEYKTRD FI GESYAGHYVPQLAQ+IL  N  TN T INLKGIA+GN  ID
Sbjct  203   LVNWLERFPEYKTRDFFIAGESYAGHYVPQLAQVILHANTNTNHTKINLKGIAVGNGLID  262

Query  797   EETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYN  976
              E+   G  D+YWTHALISDE + G  +NCNFSS A PSD C  + D    +  +IYSY+
Sbjct  263   YESYSRGWLDYYWTHALISDEMYIGHKSNCNFSSPAPPSDICRQYQDQVTNATKDIYSYD  322

Query  977   IYAPFCssgsglssss------------vqgssrgFDPCSSDYIYVYLNTPEVQKALHAN  1120
             I+AP C+S S  + +S            V      FDPCS DY + YLN P VQ ALH +
Sbjct  323   IFAPLCNSTSSSTLASIYQFFIFSKCANVVDQIYVFDPCSLDYAFDYLNNPAVQIALHVD  382

Query  1121  VTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAI  1300
                 P PW+ C+  +N +W+D    +LP I +            GD DG V VT++ YAI
Sbjct  383   AATFPYPWELCNLTMNGSWKDRRLPILPIITD------------GDTDGAVPVTSSRYAI  430

Query  1301  NKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEG  1480
             NKL  SVKTPWYPWY + EVGGYVV YE+L FVTIRG+GHFVPSYQP RAL  FS+F+  
Sbjct  431   NKLGISVKTPWYPWYLQNEVGGYVVEYENLMFVTIRGSGHFVPSYQPARALALFSSFINQ  490

Query  1481  KLPP  1492
             KL P
Sbjct  491   KLLP  494



>ref|XP_007160822.1| hypothetical protein PHAVU_001G019500g [Phaseolus vulgaris]
 gb|ESW32816.1| hypothetical protein PHAVU_001G019500g [Phaseolus vulgaris]
Length=486

 Score =   461 bits (1185),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 254/471 (54%), Positives = 326/471 (69%), Gaps = 15/471 (3%)
 Frame = +2

Query  92    GGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQPEG  271
             G ++ + L  L+++++ ++  +   ++     D     +  +  L + DK+  LPG+PEG
Sbjct  27    GNQQGEYLYKLIRSKRGEKVRSEEASMATKIGDGEIWKVEEERVLMEDDKVKGLPGEPEG  86

Query  272   VKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMENGPF  448
             V F Q+ GYVTVD +AGR LFYYF ES    S+KPLVLWLNGGPGCSS G G M E GPF
Sbjct  87    VDFDQYGGYVTVDAKAGRRLFYYFVESPHNASNKPLVLWLNGGPGCSSLGYGAMQELGPF  146

Query  449   RVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYV-TGDKKTAADNYIFLLN  625
             RVNSD +TL  N+YAWNNVANVIFLESPAGVGFSYSN SSDY  +GDK TA D+Y FL+N
Sbjct  147   RVNSDGRTLRKNEYAWNNVANVIFLESPAGVGFSYSNTSSDYSDSGDKSTAMDSYTFLIN  206

Query  626   WLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEET  805
             WL RFP YK+RDLFITGESYAGHYVPQLA  IL +N +TN T++NLKG+AIGN +ID+  
Sbjct  207   WLNRFPHYKSRDLFITGESYAGHYVPQLAHTILTHNNLTNHTLLNLKGVAIGNGWIDDNM  266

Query  806   QDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYA  985
                G Y+++WTHA+ SDETH GI  +C+F S    S+ C+ +    D  +G I  Y+IYA
Sbjct  267   CGKGMYEYFWTHAMNSDETHEGIERHCDFESGNLTSE-CNKYQRRGDDEIGVIDIYDIYA  325

Query  986   PFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDV  1165
             P C       ++    S   FDPCS +Y   YLN  +VQ+ALHA V+     W SCS   
Sbjct  326   PLC-----DPAAQTPPSDSNFDPCSDEYTKSYLNLAQVQEALHAKVS----EWSSCSP--  374

Query  1166  NVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWY  1345
              V W D P T+LPTI  L+ SGI  W+YSGD DG+V +T++ Y++N L   V+T W PWY
Sbjct  375   -VGWTDSPATILPTISGLISSGIRTWIYSGDTDGRVPITSSRYSVNALKLPVETTWRPWY  433

Query  1346  SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
             S  EVGGY++GY+ L+ +T+RGAGH VPSYQP+RALT  S F++G+LPP+S
Sbjct  434   SGNEVGGYLIGYKGLTLITVRGAGHMVPSYQPKRALTMISFFLQGELPPES  484



>ref|XP_006470157.1| PREDICTED: serine carboxypeptidase II-3-like isoform X2 [Citrus 
sinensis]
Length=492

 Score =   461 bits (1186),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 263/467 (56%), Positives = 316/467 (68%), Gaps = 17/467 (4%)
 Frame = +2

Query  116   ESLLKTQKQKRQNNNAQTIIMSAQD-----LGSVYIGAQD-GLKDADKISALPGQPEGVK  277
             ++L +  K KR  N +Q  + +  +         YI  Q   L  ADKI  LPGQP+GV 
Sbjct  32    DNLYRLIKSKRLKNRSQAELKADDEEYYYSATKTYINPQQYDLMLADKIKWLPGQPDGVD  91

Query  278   FAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMENGPFRV  454
             F Q++GYVTVDP+ GR+LFYYFAES +  S  PL+LWLNGGPGCSS G G M E GPFRV
Sbjct  92    FDQYAGYVTVDPKTGRSLFYYFAESPQNSSTNPLLLWLNGGPGCSSLGYGAMSELGPFRV  151

Query  455   NSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFLLNWL  631
             N D KTL+ N YAWNNVANV+FLESPAGVGFSYS+  SDY + GDK TA D+Y FL NWL
Sbjct  152   NKDGKTLFRNNYAWNNVANVVFLESPAGVGFSYSSTKSDYELNGDKLTAQDSYTFLANWL  211

Query  632   ERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQD  811
             ERFP+YK RD +I GESYAGHYVPQLA  IL NNK T  T+INLKGIAIGNA ID  T+ 
Sbjct  212   ERFPQYKKRDFYIAGESYAGHYVPQLAYTILLNNKNTKNTVINLKGIAIGNALIDGPTRS  271

Query  812   SGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPF  991
              G Y+  WTHAL SD+TH+GI   C+F+   + +  C+TF++ A   +G+I  YNIYAP 
Sbjct  272   MGVYENLWTHALNSDQTHKGIFTYCDFAREGNDTKECETFLEKASDEIGDIDIYNIYAPI  331

Query  992   CssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNV  1171
             C   +    +   GS   +DPC+  Y+  YLNT EVQ  LH      P  W +CS     
Sbjct  332   C--INPAFQNGSIGSVHNYDPCTDYYVEAYLNTREVQTVLHVK----PTNWTACSL---F  382

Query  1172  NWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSK  1351
             NW D P TVLPTIK L+ SGI VW+YSGD+DG V    + Y+IN LN  V+ PWYPWY+ 
Sbjct  383   NWTDSPSTVLPTIKNLIASGIRVWIYSGDVDGIVPTIASRYSINALNLPVEIPWYPWYTN  442

Query  1352  gevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
              EVGGYV  Y+ L+ VT+RGAGH VPS QPERALT  S+F+ G LPP
Sbjct  443   DEVGGYVEAYQGLTLVTVRGAGHLVPSDQPERALTLISSFLHGILPP  489



>ref|XP_006470156.1| PREDICTED: serine carboxypeptidase II-3-like isoform X1 [Citrus 
sinensis]
Length=493

 Score =   461 bits (1186),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 263/467 (56%), Positives = 316/467 (68%), Gaps = 16/467 (3%)
 Frame = +2

Query  116   ESLLKTQKQKRQNNNAQTIIMSAQD-----LGSVYIGAQD-GLKDADKISALPGQPEGVK  277
             ++L +  K KR  N +Q  + +  +         YI  Q   L  ADKI  LPGQP+GV 
Sbjct  32    DNLYRLIKSKRLKNRSQAELKADDEEYYYSATKTYINPQQYDLMLADKIKWLPGQPDGVD  91

Query  278   FAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMENGPFRV  454
             F Q++GYVTVDP+ GR+LFYYFAES +  S  PL+LWLNGGPGCSS G G M E GPFRV
Sbjct  92    FDQYAGYVTVDPKTGRSLFYYFAESPQNSSTNPLLLWLNGGPGCSSLGYGAMSELGPFRV  151

Query  455   NSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFLLNWL  631
             N D KTL+ N YAWNNVANV+FLESPAGVGFSYS+  SDY + GDK TA D+Y FL NWL
Sbjct  152   NKDGKTLFRNNYAWNNVANVVFLESPAGVGFSYSSTKSDYELNGDKLTAQDSYTFLANWL  211

Query  632   ERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQD  811
             ERFP+YK RD +I GESYAGHYVPQLA  IL NNK T  T+INLKGIAIGNA ID  T+ 
Sbjct  212   ERFPQYKKRDFYIAGESYAGHYVPQLAYTILLNNKNTKNTVINLKGIAIGNALIDGPTRS  271

Query  812   SGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPF  991
              G Y+  WTHAL SD+TH+GI   C+F+   + +  C+TF++ A   +G+I  YNIYAP 
Sbjct  272   MGVYENLWTHALNSDQTHKGIFTYCDFAREGNDTKECETFLEKASDEIGDIDIYNIYAPI  331

Query  992   CssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNV  1171
             C   +    +   GS   +DPC+  Y+  YLNT EVQ  LH      P  W +CS     
Sbjct  332   C--INPAFQNGSIGSVHNYDPCTDYYVEAYLNTREVQTVLHVK----PTNWTACSSL--F  383

Query  1172  NWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSK  1351
             NW D P TVLPTIK L+ SGI VW+YSGD+DG V    + Y+IN LN  V+ PWYPWY+ 
Sbjct  384   NWTDSPSTVLPTIKNLIASGIRVWIYSGDVDGIVPTIASRYSINALNLPVEIPWYPWYTN  443

Query  1352  gevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
              EVGGYV  Y+ L+ VT+RGAGH VPS QPERALT  S+F+ G LPP
Sbjct  444   DEVGGYVEAYQGLTLVTVRGAGHLVPSDQPERALTLISSFLHGILPP  490



>ref|XP_006438918.1| hypothetical protein CICLE_v10031327mg [Citrus clementina]
 gb|ESR52158.1| hypothetical protein CICLE_v10031327mg [Citrus clementina]
Length=497

 Score =   461 bits (1186),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 243/476 (51%), Positives = 330/476 (69%), Gaps = 16/476 (3%)
 Frame = +2

Query  116   ESLLKTQKQK---------RQNNNAQT-IIMSAQDLGSVYIGAQDGLKDADKISALPGQP  265
             E+  K Q+Q+         ++N+   T +  +  ++    I +QDGLK+ D+I  LPGQP
Sbjct  23    ETHAKKQEQRLGHLYKAKLKENSGVDTSLFKTIHNVSRATIHSQDGLKENDRIEKLPGQP  82

Query  266   EGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK-PLVLWLnggpgcssfgnggMMENG  442
             E V+F+Q+ GYVTVD  AGRA++YYF E++   D  PL+LWLNGGPGCSS   G M E G
Sbjct  83    E-VEFSQYGGYVTVDESAGRAMYYYFVEAQKSKDSAPLLLWLNGGPGCSSLAYGAMQELG  141

Query  443   PFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFL  619
             PFRV SD K+L+ N+Y+WNN ANV+FLESPAGVGFSYSNR+SDY  +GD+KTAADNY+FL
Sbjct  142   PFRVRSDGKSLFRNRYSWNNAANVLFLESPAGVGFSYSNRTSDYDESGDRKTAADNYMFL  201

Query  620   LNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDE  799
             +NWLERFPEYK R+ +I+GESYAGHY PQLA  IL +NK  N TIINLKGI IGNA I++
Sbjct  202   VNWLERFPEYKGREFYISGESYAGHYAPQLAHTILYHNKKANTTIINLKGIMIGNAVIND  261

Query  800   ETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNI  979
             ET   G Y+++ +HALISDE    I   C+FS  A+ SD C+   ++A+ ++ ++  YNI
Sbjct  262   ETDVRGMYEYFQSHALISDEAAYQIQKYCDFSPNATRSDECNAATEEAEENISHLDIYNI  321

Query  980   YAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQ  1159
             YAP C S S L++   + S   FDPCS  Y+Y YLN P+VQ+ALHANVT +   W+ CS 
Sbjct  322   YAPLC-SNSSLTARPKKASITNFDPCSDYYVYAYLNRPDVQQALHANVTKLDHDWEPCS-  379

Query  1160  DVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYP  1339
             D+   W+D P T++P ++E M +G+ +W++SGD DG++ VT+T  +IN +   +KTPW+ 
Sbjct  380   DILRKWQDSPSTIIPLLREFMENGLRLWIFSGDTDGRIPVTSTKNSINTMKLPIKTPWHA  439

Query  1340  WY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKSAE  1504
             WY      G   +   D++F T+RGAGH VPSYQP+RAL+    F++G   P ++ 
Sbjct  440   WYLYGEVGGYTQMYKGDITFATVRGAGHQVPSYQPKRALSLVKHFLDGSPLPNTSR  495



>ref|XP_010685501.1| PREDICTED: serine carboxypeptidase II-3-like [Beta vulgaris subsp. 
vulgaris]
Length=490

 Score =   461 bits (1185),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 271/465 (58%), Positives = 328/465 (71%), Gaps = 12/465 (3%)
 Frame = +2

Query  113   LESLLKTQKQKRQNNNAQTIIMSAQ-DLGSVYIGAQDGLKDADKISALPGQPEGVKFAQF  289
             L  LLK +  K  +  A    + AQ     V+IG Q+GL  ADKI++LPGQP+GV F Q+
Sbjct  35    LYKLLKHKNSKNPSLAASWATLPAQIKETRVHIGPQNGLMKADKITSLPGQPDGVDFDQY  94

Query  290   SGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMENGPFRVNSDS  466
             +GYVTVDP   +ALFYYFAES +  S KPLVLWLNGGPGCSSFGNGG++E GPFRV SD 
Sbjct  95    AGYVTVDPAHDKALFYYFAESPKNSSLKPLVLWLNGGPGCSSFGNGGLLELGPFRVKSDG  154

Query  467   KTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFLLNWLERFP  643
             KTL  N Y+WNN ANVIFLESPAGVGFSY N S  Y  TGD  TA D Y FL+NW ERFP
Sbjct  155   KTLIRNPYSWNNDANVIFLESPAGVGFSYGNESIIYEQTGDMSTAKDAYTFLVNWFERFP  214

Query  644   EYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDSGTY  823
             +YKTR+ ++TGESYAGHYVPQLA  IL +NK    T INLKGIAIGNA++D+ T  +G Y
Sbjct  215   QYKTREFYLTGESYAGHYVPQLAYTILHHNKNAKHTSINLKGIAIGNAWVDDVTNTAGMY  274

Query  824   DFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFCssg  1003
             D+ W+HA+ SDET+  I   CNF SA S S  C  + + A   +G I  YNIYAP C   
Sbjct  275   DYLWSHAMYSDETYYKIQKYCNF-SATSTSQKCQDYSEKAGEEVGIIDVYNIYAPVC-LT  332

Query  1004  sglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWED  1183
             SG S + V  S   +DPCSS+Y+  YLN+ +VQKALH      P  W SCS      W+D
Sbjct  333   SGNSKARVLDSVEVYDPCSSNYVDTYLNSKDVQKALHVK----PTKWLSCSL---FEWQD  385

Query  1184  MPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevg  1363
              P TVLP I++L+ S ISVW+YSGD+DG+V VT++ Y++  L   +KT W PWYS  ++G
Sbjct  386   SPSTVLPVIQKLIASNISVWVYSGDVDGRVPVTSSKYSLKTLKLPIKTAWRPWYSDHQIG  445

Query  1364  gyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
             GYVVGYE L FVT+RGAGH VPSYQP+RALT  S+F++G LPPKS
Sbjct  446   GYVVGYEGLVFVTVRGAGHLVPSYQPQRALTMLSSFLQGNLPPKS  490



>ref|XP_006482952.1| PREDICTED: serine carboxypeptidase-like 40-like [Citrus sinensis]
Length=497

 Score =   461 bits (1185),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 244/476 (51%), Positives = 330/476 (69%), Gaps = 16/476 (3%)
 Frame = +2

Query  116   ESLLKTQKQK---------RQNNNAQT-IIMSAQDLGSVYIGAQDGLKDADKISALPGQP  265
             E+  K Q+Q+         ++N+   T +  +  ++    I +QDGLK+ D+I  LPGQP
Sbjct  23    ETHAKKQEQRLGHLYKAKLKENSGVDTSLFKTIHNVSRATIHSQDGLKENDRIEKLPGQP  82

Query  266   EGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK-PLVLWLnggpgcssfgnggMMENG  442
             E V+F+Q+ GYVTVD  AGRA++YYF E++   D  PL+LWLNGGPGCSS   G M E G
Sbjct  83    E-VEFSQYGGYVTVDESAGRAMYYYFVEAQKSKDSAPLLLWLNGGPGCSSLAYGAMQELG  141

Query  443   PFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFL  619
             PFRV SD K+L+ N+Y+WNN ANV+FLESPAGVGFSYSNR+SDY  +GD+KTAADNY+FL
Sbjct  142   PFRVRSDGKSLFRNRYSWNNAANVLFLESPAGVGFSYSNRTSDYDESGDRKTAADNYMFL  201

Query  620   LNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDE  799
             +NWLERFPEYK R+ +I+GESYAGHY PQLA  IL +NK  N TIINLKGI IGNA I++
Sbjct  202   VNWLERFPEYKGREFYISGESYAGHYAPQLAHTILYHNKKANTTIINLKGIMIGNAVIND  261

Query  800   ETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNI  979
             ET   G Y+++ +HALISDE    I   C+FS  A+ SD C+   ++A+ ++ ++  YNI
Sbjct  262   ETDVRGMYEYFQSHALISDEAAYQIQKYCDFSPNATRSDECNAATEEAEENISHLDIYNI  321

Query  980   YAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQ  1159
             YAP C S S L++   + S   FDPCS  Y+Y YLN P+VQ+ALHANVT +   W+ CS 
Sbjct  322   YAPLC-SNSSLTARPKKASITNFDPCSDYYVYAYLNRPDVQQALHANVTKLDHDWEPCS-  379

Query  1160  DVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYP  1339
             D+   W+D P T++P ++E M +G+ +W++SGD DG++ VT+T  +IN +   +KTPW+ 
Sbjct  380   DILRKWQDSPSTIIPLLREFMENGLRLWIFSGDTDGRIPVTSTKNSINTMKLPIKTPWHA  439

Query  1340  WY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKSAE  1504
             WY      G   V   D++F T+RGAGH VPSYQP+RAL+    F++G   P ++ 
Sbjct  440   WYLYGEVGGYTQVYKGDITFATVRGAGHQVPSYQPKRALSLVKHFLDGSPLPNTSR  495



>gb|AES71588.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=497

 Score =   459 bits (1182),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 260/442 (59%), Positives = 315/442 (71%), Gaps = 11/442 (2%)
 Frame = +2

Query  179   SAQDLGSVYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESE-  355
             S  D  + Y+  Q+GL+ ADKI  LPGQP GV F Q+SGYVTV+P+AGR LFYYF ES  
Sbjct  55    SKTDSSAPYVTPQEGLRQADKIDTLPGQPYGVNFDQYSGYVTVNPEAGRELFYYFVESPY  114

Query  356   TPSDKPLVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPA  535
               S KPLVLWLNGGPGCSS G G   E GPFR+NSD KTL+ N+YAW  VANV+FLESPA
Sbjct  115   NSSTKPLVLWLNGGPGCSSLGYGAFQELGPFRINSDGKTLYRNQYAWTEVANVLFLESPA  174

Query  536   GVGFSYSNRSSDY-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLA  712
             GVGFSYSN +SDY  +GDK TA D+Y+FL+NWLERFP+YKTR  +I GESYAGHYVPQLA
Sbjct  175   GVGFSYSNTTSDYDKSGDKSTAKDSYVFLINWLERFPQYKTRAFYIAGESYAGHYVPQLA  234

Query  713   QLILRNNKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNF  892
               IL NNK+ N T+INLKGI++ NA+ID+ T   G +D++WTHAL SD+TH  I   C+F
Sbjct  235   STILHNNKLYNNTVINLKGISVWNAWIDDATSLKGLFDYFWTHALNSDQTHELIEKYCDF  294

Query  893   S---SAASPSDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSS  1063
             +   ++ + S  C+   D A    G I  YNIYAP C   S L + S    S  FDPCS 
Sbjct  295   TVDFTSGNTSAICNNVTDRAYTEKGKIDFYNIYAPLC-HDSSLKNGSTGYVSNDFDPCSD  353

Query  1064  DYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVW  1243
              Y   YLN PEVQ+ALHA     P  W  CS+ +N  W+D P TVLPTIK L+ SGI +W
Sbjct  354   YYGIAYLNRPEVQQALHAK----PTNWSYCSE-INSKWKDSPITVLPTIKYLIDSGIKLW  408

Query  1244  LYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHF  1423
             +YSGD DG+V VT++ Y+IN L   +   W+PWYS  E+GGYVVGY+ L+FVT+RGAGH 
Sbjct  409   IYSGDTDGRVPVTSSRYSINTLKLPINDAWHPWYSGKEIGGYVVGYKGLTFVTVRGAGHL  468

Query  1424  VPSYQPERALTFFSAFVEGKLP  1489
             VPS+QPERALT  S+F+ G LP
Sbjct  469   VPSWQPERALTLISSFLYGSLP  490



>ref|XP_007146042.1| hypothetical protein PHAVU_006G007800g [Phaseolus vulgaris]
 gb|ESW18036.1| hypothetical protein PHAVU_006G007800g [Phaseolus vulgaris]
Length=489

 Score =   459 bits (1181),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 265/436 (61%), Positives = 311/436 (71%), Gaps = 12/436 (3%)
 Frame = +2

Query  197   SVYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESE-TPSDKP  373
             S Y+  Q+GL+ ADKI ALPGQ  GV F Q+SGYVTVDP+AGRALFYYF ES   PS KP
Sbjct  59    SAYVAPQEGLQQADKIVALPGQSYGVNFDQYSGYVTVDPEAGRALFYYFVESPYNPSTKP  118

Query  374   LVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSY  553
             LVLWLNGGPGCSS G G   E GPFR+NSD KTL+ NKYAWN VANV+FLESPAGVGFSY
Sbjct  119   LVLWLNGGPGCSSLGYGAFEELGPFRINSDGKTLYRNKYAWNEVANVLFLESPAGVGFSY  178

Query  554   SNRSSDY-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRN  730
             SN SSDY   GDK TA D Y+FL+NWLERFP+YKTRD +ITGESYAGHYVPQLA  IL N
Sbjct  179   SNTSSDYDHAGDKSTAKDAYVFLINWLERFPQYKTRDFYITGESYAGHYVPQLAYTILLN  238

Query  731   NKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASP  910
             NK ++Q I N+K IAIGNA+ID+ T   G  D+ W+HAL SD+TH  I   C+FS A + 
Sbjct  239   NKYSHQNI-NIKSIAIGNAWIDDVTGSKGIVDYLWSHALNSDQTHELIQKYCDFS-AENV  296

Query  911   SDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNT  1090
             S+ C      A    GNI  YNIYAP C   S  + S+   S   FDPCS  Y   YLN 
Sbjct  297   SEICANATRTALIEKGNIDFYNIYAPLCLDSSLKNGSTGSVSD--FDPCSDYYGEAYLNR  354

Query  1091  PEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGK  1270
             PEVQ ALHA     P  W  CS    ++W D P T+LP IK L+ SGI +W+YSGD D +
Sbjct  355   PEVQLALHAK----PTNWTLCSD--QLSWNDSPTTILPVIKYLIDSGIGLWIYSGDTDAR  408

Query  1271  VAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERA  1450
             V VT++ Y+IN L   ++ PW PWYS+ EVGGYVV Y+ ++FVT+RGAGH VPS+QP+RA
Sbjct  409   VPVTSSRYSINSLKLPIQVPWRPWYSEKEVGGYVVKYKGVTFVTVRGAGHLVPSWQPKRA  468

Query  1451  LTFFSAFVEGKLPPKS  1498
             LTF S+F+ G LPP S
Sbjct  469   LTFVSSFLYGILPPAS  484



>ref|NP_001148004.1| serine carboxypeptidase precursor [Zea mays]
 gb|ACG29366.1| serine carboxypeptidase [Zea mays]
Length=498

 Score =   459 bits (1180),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 248/437 (57%), Positives = 309/437 (71%), Gaps = 10/437 (2%)
 Frame = +2

Query  200   VYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES--ETPSDKP  373
             VY+G QDGLK ADKIS LPGQP    F Q++GYVTVD  +G+ALFYYF E+  E PS KP
Sbjct  67    VYVGLQDGLKKADKISELPGQPGKATFDQYAGYVTVDATSGKALFYYFVEAAAEDPSTKP  126

Query  374   LVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSY  553
             LVLWLNGGPGCSS G   M E GPF VN D+KTL  NKYAWN+VAN++FLESPAGVGFSY
Sbjct  127   LVLWLNGGPGCSSLGGA-MHEIGPFFVNRDNKTLSKNKYAWNSVANMLFLESPAGVGFSY  185

Query  554   SNRSSDYV-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRN  730
             SNR+SDY  TGD+ TAAD Y FL+NWLERFPEYK    F+TGESY GHY+PQLA  IL N
Sbjct  186   SNRTSDYNNTGDRSTAADAYTFLVNWLERFPEYKGHSFFLTGESYGGHYIPQLANTILSN  245

Query  731   NKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASP  910
             NKI N T+INL+G+AIGNAY+D++T      D+YWTHA+IS ETH  +  NC F+   + 
Sbjct  246   NKIINTTMINLQGVAIGNAYLDDDTNTRAIIDYYWTHAMISKETHTAVQENCGFN--GTY  303

Query  911   SDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNT  1090
             +  C T +++A+   G I   NIYAPFC + S         ++   DPC+S Y+  YLN 
Sbjct  304   TGLCRTAIEEANNEKGLIDESNIYAPFCWNASDPQKQHASVTNN--DPCASYYMRSYLNR  361

Query  1091  PEVQKALHANVTGIPGPWDSCSQDVN-VNWEDMPDTVLPTIKELMGSGISVWLYSGDIDG  1267
              EVQ+ALHAN T +  PW  CS  ++  NW+D   ++LP+I++L+ SG+S WLYSGDID 
Sbjct  362   QEVQRALHANTTRLKQPWSDCSNIISPENWKDAQVSMLPSIQQLISSGVSTWLYSGDIDA  421

Query  1268  KVAVTTTTYAINKLNTSVKTPWYPWYSKgevggy-vvgyeDLSFVTIRGAGHFVPSYQPE  1444
                VT+T Y+++ L   + + W  WYS     G  VV Y+ L F T+RGAGH VP+YQP+
Sbjct  422   VCPVTSTLYSLDILGLKINSSWRAWYSDDGEVGGYVVEYKGLIFATVRGAGHMVPTYQPQ  481

Query  1445  RALTFFSAFVEGKLPPK  1495
             RAL+ FSAF+ GKLPP+
Sbjct  482   RALSLFSAFLNGKLPPE  498



>gb|EEE59169.1| hypothetical protein OsJ_11092 [Oryza sativa Japonica Group]
Length=482

 Score =   458 bits (1178),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 249/435 (57%), Positives = 310/435 (71%), Gaps = 10/435 (2%)
 Frame = +2

Query  200   VYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAE-SETPSDKPL  376
             +Y+ +QDGLK+ADK+S LPGQP    F Q++GYVTV+  +G+ALFYYFAE ++ PS KPL
Sbjct  55    LYMSSQDGLKEADKVSELPGQPGRAGFDQYAGYVTVNATSGKALFYYFAEATDDPSTKPL  114

Query  377   VLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYS  556
             VLWLNGGPGCSS G+G M+E GPF VN D++TL +N+YAWNNVAN++FLESPAGVGFSYS
Sbjct  115   VLWLNGGPGCSSLGDGAMLEIGPFLVNGDNRTLSINRYAWNNVANMLFLESPAGVGFSYS  174

Query  557   NRSSDY-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNN  733
             N +SDY  TGD  TAAD Y FL NWLERFPEYK RD FITGESY GHY+PQLA  IL NN
Sbjct  175   NTTSDYDNTGDTSTAADAYTFLTNWLERFPEYKGRDFFITGESYGGHYIPQLANAILSNN  234

Query  734   KITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPS  913
              ITN TIINLKG+AIGNAY+D+ T    T D+YWTHALIS ETH  +  NC+F+      
Sbjct  235   NITNVTIINLKGVAIGNAYLDDSTNTRATIDYYWTHALISKETHLAVQRNCSFNGTYMAQ  294

Query  914   DTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTP  1093
               C   + +AD   G I  YNIYAP C   +  +   + GS+   DPCS  Y+  YLN P
Sbjct  295   --CRNALAEADTEKGVIDPYNIYAPLC--WNASNPRQLHGSAINVDPCSRYYVESYLNRP  350

Query  1094  EVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKV  1273
             EVQ+ LHAN TG+  P   C+     NW+D P ++LP+I+ L+ SG+S WLYSGDID   
Sbjct  351   EVQRTLHANTTGLKQP---CNIITPENWKDAPVSMLPSIQGLISSGVSTWLYSGDIDAVC  407

Query  1274  AVTTTTYAINKLNTSVKTPWYPWYSKgevggy-vvgyeDLSFVTIRGAGHFVPSYQPERA  1450
              VT+T Y+++ L   + + W PWYS        VVGY+ L F T+R +GH VP+YQP+RA
Sbjct  408   PVTSTLYSLDILELPINSSWRPWYSDDNEVAGYVVGYKGLVFATVRESGHMVPTYQPQRA  467

Query  1451  LTFFSAFVEGKLPPK  1495
             LT FS+F++G LPP+
Sbjct  468   LTLFSSFLQGILPPE  482



>gb|EEC75382.1| hypothetical protein OsI_11848 [Oryza sativa Indica Group]
Length=482

 Score =   457 bits (1176),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 249/435 (57%), Positives = 310/435 (71%), Gaps = 10/435 (2%)
 Frame = +2

Query  200   VYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAE-SETPSDKPL  376
             +Y+ +QDGLK+ADK+S LPGQP    F Q++GYVTV+  +G+ALFYYFAE ++ PS KPL
Sbjct  55    LYMSSQDGLKEADKVSELPGQPGRAGFDQYAGYVTVNATSGKALFYYFAEATDDPSTKPL  114

Query  377   VLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYS  556
             VLWLNGGPGCSS G+G M+E GPF VN D++TL +N+YAWNNVAN++FLESPAGVGFSYS
Sbjct  115   VLWLNGGPGCSSLGDGAMLEIGPFFVNGDNRTLSINRYAWNNVANMLFLESPAGVGFSYS  174

Query  557   NRSSDY-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNN  733
             N +SDY  TGD  TAAD Y FL NWLERFPEYK RD FITGESY GHY+PQLA  IL NN
Sbjct  175   NTTSDYDNTGDTSTAADAYTFLTNWLERFPEYKGRDFFITGESYGGHYIPQLANAILSNN  234

Query  734   KITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPS  913
              ITN TIINLKG+AIGNAY+D+ T    T D+YWTHALIS ETH  +  NC+F+      
Sbjct  235   NITNVTIINLKGVAIGNAYLDDSTNTRATIDYYWTHALISKETHLAVQRNCSFNGTYMAQ  294

Query  914   DTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTP  1093
               C   + +AD   G I  YNIYAP C   +  +   + GS+   DPCS  Y+  YLN P
Sbjct  295   --CRNALAEADTEKGVIDPYNIYAPLC--WNASNPRQLHGSAINVDPCSRYYVESYLNRP  350

Query  1094  EVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKV  1273
             EVQ+ LHAN TG+  P   C+     NW+D P ++LP+I+ L+ SG+S WLYSGDID   
Sbjct  351   EVQRTLHANTTGLKQP---CNIITPENWKDAPVSMLPSIQGLISSGVSTWLYSGDIDAVC  407

Query  1274  AVTTTTYAINKLNTSVKTPWYPWYSKgevggy-vvgyeDLSFVTIRGAGHFVPSYQPERA  1450
              VT+T Y+++ L   + + W PWYS        VVGY+ L F T+R +GH VP+YQP+RA
Sbjct  408   PVTSTLYSLDILELPINSSWRPWYSDDNEVAGYVVGYKGLVFATVRESGHMVPTYQPQRA  467

Query  1451  LTFFSAFVEGKLPPK  1495
             LT FS+F++G LPP+
Sbjct  468   LTLFSSFLQGILPPE  482



>ref|XP_006593897.1| PREDICTED: serine carboxypeptidase II-3-like [Glycine max]
Length=490

 Score =   457 bits (1175),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 271/470 (58%), Positives = 320/470 (68%), Gaps = 18/470 (4%)
 Frame = +2

Query  107   DPLESLLKTQKQKRQNNNAQTIIMSAQDL----GSVYIGAQDGLKDADKISALPGQPEGV  274
             D LE L+ ++  ++      T+  + +D      S Y+ +Q+G K ADKI+ALPGQP GV
Sbjct  28    DKLEELILSRSSQKP---PVTLSWAEEDALKTHSSAYVASQEGQKQADKIAALPGQPYGV  84

Query  275   KFAQFSGYVTVDPQAGRALFYYFAESE-TPSDKPLVLWLnggpgcssfgnggMMENGPFR  451
              F Q+SGYVTVDP+AGRALFYYF ES   PS KPLVLWLNGGPGCSS G G   E GPFR
Sbjct  85    NFDQYSGYVTVDPKAGRALFYYFVESPYNPSTKPLVLWLNGGPGCSSLGYGAFEELGPFR  144

Query  452   VNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFLLNW  628
             +NSD KTL+ NKYAWN VANV+FLESPAGVGFSYSN +SDY  +GDK TA D Y+FL+NW
Sbjct  145   INSDGKTLYRNKYAWNEVANVLFLESPAGVGFSYSNTTSDYDHSGDKPTAKDAYVFLINW  204

Query  629   LERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQ  808
             LERFPEYKTR+ +ITGESYAGHYVPQLA  IL NNK + Q I NLKGIAIGNA+ID+ T 
Sbjct  205   LERFPEYKTRNFYITGESYAGHYVPQLAYTILVNNKFSQQNI-NLKGIAIGNAWIDDVTG  263

Query  809   DSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAP  988
               G  D+ WTHAL SD+TH  I   C++SS  + S  C      A    GNI  YNIYAP
Sbjct  264   TKGIVDYLWTHALNSDQTHELIEKYCDYSSE-NISQICSNATRRALTEKGNIDFYNIYAP  322

Query  989   FCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVN  1168
              C   S  + SS       FDPCS  Y   YLN PEVQ ALHA     P  W  CS  ++
Sbjct  323   LCHDSSLKNESSSGSVYD-FDPCSDYYGEAYLNRPEVQLALHAK----PTNWSHCSDLID  377

Query  1169  VNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYS  1348
               W D P T+LP IK L  S I +W+YSGD D +V VT++ YAIN L   ++ PW PWYS
Sbjct  378   --WNDSPTTILPVIKYLTDSNIVLWIYSGDTDARVPVTSSRYAINTLKLPIQVPWRPWYS  435

Query  1349  KgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
               EVGGYVV Y+ ++FVT+RGAGH VPS+QP RALT   +F+ G LPP S
Sbjct  436   GNEVGGYVVKYKGVTFVTVRGAGHLVPSWQPARALTLIFSFLYGSLPPAS  485



>ref|XP_006578498.1| PREDICTED: serine carboxypeptidase II-3-like [Glycine max]
Length=545

 Score =   459 bits (1180),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 266/436 (61%), Positives = 308/436 (71%), Gaps = 11/436 (3%)
 Frame = +2

Query  197   SVYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESE-TPSDKP  373
             S Y+ +Q+G K+ADKI ALPGQP GV F Q+SGYVTVDP+AGRALFYYF ES   PS KP
Sbjct  114   SAYVASQEGQKEADKIVALPGQPYGVNFDQYSGYVTVDPEAGRALFYYFVESSYNPSTKP  173

Query  374   LVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSY  553
             LVLWLNGGPGCSS G G   E GPFR+NSD KTL+ NKYAWN VANV+FLESPAGVGFSY
Sbjct  174   LVLWLNGGPGCSSLGYGAFEELGPFRINSDGKTLYRNKYAWNVVANVLFLESPAGVGFSY  233

Query  554   SNRSSDYV-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRN  730
             SN  SDY  +GDK TA D Y+FL+NWLERFPEYKTRD +ITGESYAGHYVPQLA  IL N
Sbjct  234   SNTISDYEHSGDKSTAKDAYVFLINWLERFPEYKTRDFYITGESYAGHYVPQLAYTILVN  293

Query  731   NKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASP  910
             NK + Q I NLKGIAIGNA+ID+ T   G YD+ WTHAL SD+TH  I   C+F+S  + 
Sbjct  294   NKFSQQNI-NLKGIAIGNAWIDDVTSLKGIYDYIWTHALSSDQTHELIEKYCDFTSE-NV  351

Query  911   SDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNT  1090
             S  C      A    GNI  YNIYAP C   S  + S+   S+  FDPCS  Y   YLN 
Sbjct  352   SAICANATRTAFEENGNIDPYNIYAPLCQDSSLKNGSTGSVSND-FDPCSDYYGEAYLNR  410

Query  1091  PEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGK  1270
             PEVQ ALHA     P  W  CS D+ +NW D P ++LP IK L+ S I +W+YSGD D  
Sbjct  411   PEVQLALHAK----PTNWTHCS-DI-INWNDSPASILPVIKYLIDSDIGLWIYSGDTDSV  464

Query  1271  VAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERA  1450
             V VT++ Y+IN L   ++ PW PWYS  EVGGYVV Y  ++FVT+RGAGH VPS+QP R 
Sbjct  465   VPVTSSRYSINTLKLPIQVPWRPWYSGNEVGGYVVKYNGVTFVTVRGAGHLVPSWQPSRT  524

Query  1451  LTFFSAFVEGKLPPKS  1498
             LT   +F+ G LPP S
Sbjct  525   LTLIFSFLHGSLPPTS  540



>ref|XP_007017341.1| Serine carboxypeptidase II-3 chain B isoform 1 [Theobroma cacao]
 ref|XP_007017342.1| Serine carboxypeptidase II-3 chain B isoform 1 [Theobroma cacao]
 gb|EOY14566.1| Serine carboxypeptidase II-3 chain B isoform 1 [Theobroma cacao]
 gb|EOY14567.1| Serine carboxypeptidase II-3 chain B isoform 1 [Theobroma cacao]
Length=501

 Score =   456 bits (1174),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 273/487 (56%), Positives = 330/487 (68%), Gaps = 31/487 (6%)
 Frame = +2

Query  86    SIGGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGS-------VYIGAQDGLKDADKI  244
             S  G + D L  L++++K    +N  +    + QD  +       VY+ +Q  L  ADKI
Sbjct  23    SCKGNQIDNLNRLIESRKS---SNPPRPESWAQQDDDTEDSHTPPVYVASQKLLMQADKI  79

Query  245   SALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESET-PSDKPLVLWLnggpgcssfgn  421
             +ALPGQPEGV F Q++GYVTVDP A RALFYYF ES   PS KPLVLWLNGGPGCSSFG 
Sbjct  80    NALPGQPEGVGFDQYAGYVTVDPVADRALFYYFVESPVDPSKKPLVLWLNGGPGCSSFGY  139

Query  422   ggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVT-GDKKTA  598
             G M E GPFRVNSD +TL+ N+YAWNNVANVIFLESPAGVGFSYS  SSDY + GD+KTA
Sbjct  140   GAMQELGPFRVNSDGETLYRNEYAWNNVANVIFLESPAGVGFSYSKNSSDYTSVGDRKTA  199

Query  599   ADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAI  778
              D+YIFL+NWLERFP+YKTRD +ITGESYAGHYVPQLA  IL  NK T QT+INLKGIAI
Sbjct  200   QDSYIFLINWLERFPQYKTRDFYITGESYAGHYVPQLAYYILARNKNTTQTVINLKGIAI  259

Query  779   GNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDT---------CDTF  931
             GNA++D+     G +DF WTHAL SDET+ GI   CNF+S  S +           C  +
Sbjct  260   GNAWVDDVACTKGLFDFLWTHALNSDETNEGINKYCNFASEDSLTKKADADDNPIQCGKY  319

Query  932   VDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKAL  1111
                    +G+I  Y IYAP C   +    S   G+ + +DPC+  Y+  YLN  +VQ AL
Sbjct  320   QKQGLLELGDINLYGIYAPPC--YTSALKSGSTGNVKNYDPCAEYYVNSYLNLAKVQAAL  377

Query  1112  HANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTT  1291
             H   T     W  CS   +V W D P T+LP I+ L    I VW YSGD DG+V VT++ 
Sbjct  378   HTKATN----WSGCS---DVGWTDSPTTILPEIRHL-AREIRVWKYSGDTDGRVPVTSSR  429

Query  1292  YAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAF  1471
             Y+IN LN  V+T W+PWYS  EVGGYVVGY+ + F T+RGAGH VPSYQPERALT  ++F
Sbjct  430   YSINNLNLQVETAWHPWYSNSEVGGYVVGYKGVIFATVRGAGHTVPSYQPERALTMITSF  489

Query  1472  VEGKLPP  1492
             ++GKLPP
Sbjct  490   LQGKLPP  496



>gb|ABF96315.1| Serine carboxypeptidase II-3 precursor, putative, expressed [Oryza 
sativa Japonica Group]
Length=503

 Score =   456 bits (1174),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 245/453 (54%), Positives = 306/453 (68%), Gaps = 25/453 (6%)
 Frame = +2

Query  200   VYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAE-SETPSDKPL  376
             +Y+ +QDGLK+ADK+S LPGQP    F Q++GYVTV+  +G+ALFYYFAE ++ PS KPL
Sbjct  55    LYMSSQDGLKEADKVSELPGQPGRAGFDQYAGYVTVNATSGKALFYYFAEATDDPSTKPL  114

Query  377   VLWLnggpgcssfgng-----------------gMMENGPFRVNSDSKTLWLNKYAWNNV  505
             VLWLNGG  C  +                     M+E GPF VN D++TL +N+YAWNNV
Sbjct  115   VLWLNGGLTCEFYRMTKLYLEISGPGCSSLGDGAMLEIGPFLVNGDNRTLSINRYAWNNV  174

Query  506   ANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGES  682
             AN++FLESPAGVGFSYSN +SDY  TGD  TAAD Y FL NWLERFPEYK RD FITGES
Sbjct  175   ANMLFLESPAGVGFSYSNTTSDYDNTGDTSTAADAYTFLTNWLERFPEYKGRDFFITGES  234

Query  683   YAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDET  862
             Y GHY+PQLA  IL NN ITN TIINLKG+AIGNAY+D+ T    T D+YWTHALIS ET
Sbjct  235   YGGHYIPQLANAILSNNNITNVTIINLKGVAIGNAYLDDSTNTRATIDYYWTHALISKET  294

Query  863   HRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssr  1042
             H  +  NC+F+        C   + +AD   G I  YNIYAP C   +  +   + GS+ 
Sbjct  295   HLAVQRNCSFNGTYMAQ--CRNALAEADTEKGVIDPYNIYAPLC--WNASNPRQLHGSAI  350

Query  1043  gFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVN-VNWEDMPDTVLPTIKEL  1219
               DPCS  Y+  YLN PEVQ+ LHAN TG+  PW  CS  +   NW+D P ++LP+I+ L
Sbjct  351   NVDPCSRYYVESYLNRPEVQRTLHANTTGLKQPWSGCSNIITPENWKDAPVSMLPSIQGL  410

Query  1220  MGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggy-vvgyeDLSF  1396
             + SG+S WLYSGDID    VT+T Y+++ L   + + W PWYS        VVGY+ L F
Sbjct  411   ISSGVSTWLYSGDIDAVCPVTSTLYSLDILELPINSSWRPWYSDDNEVAGYVVGYKGLVF  470

Query  1397  VTIRGAGHFVPSYQPERALTFFSAFVEGKLPPK  1495
              T+R +GH VP+YQP+RALT FS+F++G LPP+
Sbjct  471   ATVRESGHMVPTYQPQRALTLFSSFLQGILPPE  503



>ref|XP_003592242.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 ref|XP_003601339.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=494

 Score =   456 bits (1172),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 267/469 (57%), Positives = 323/469 (69%), Gaps = 10/469 (2%)
 Frame = +2

Query  101   KFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGA-QDGLKDADKISALPGQPEGVK  277
             K D L    K+Q   +  +  +   +      + Y+ A Q+ L+ ADKI  LPGQP+GV 
Sbjct  30    KLDELFLSRKSQNPPKTLSWEEGEALKTLSSSAAYVAAPQEELRLADKIVTLPGQPDGVD  89

Query  278   FAQFSGYVTVDPQAGRALFYYFAESE-TPSDKPLVLWLnggpgcssfgnggMMENGPFRV  454
             F Q+SGYVTV+P+AGRALFYYF ES    S KPLVLWLNGGPGCSS G G   E GPFRV
Sbjct  90    FDQYSGYVTVEPEAGRALFYYFVESPYNSSTKPLVLWLNGGPGCSSLGYGAFEELGPFRV  149

Query  455   NSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYV-TGDKKTAADNYIFLLNWL  631
             NSD KTL+ N+YAW+ VAN++FLESPAGVGFSYSN +SDY   GDK TA D Y+FL+NWL
Sbjct  150   NSDGKTLYRNQYAWSEVANILFLESPAGVGFSYSNTTSDYKKAGDKSTAKDAYVFLINWL  209

Query  632   ERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQD  811
             ERFP+YKTRD +ITGESYAGHYVPQLA  IL ++K+ N+TIINLKGI+IGNA+ID+ T D
Sbjct  210   ERFPQYKTRDFYITGESYAGHYVPQLASTILHHHKLYNKTIINLKGISIGNAWIDDATGD  269

Query  812   SGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPF  991
              G +D++WTHAL SD+TH  I   C+F+   + S  C    D A    G I  YNIYAP 
Sbjct  270   KGLFDYFWTHALNSDQTHELIEKYCDFTK-QNYSTICINVTDWAFIEKGKIDFYNIYAPL  328

Query  992   CssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNV  1171
             C   S L + S    +  FDPCS +Y   YLN PEVQKALHA     P  W  C  D+  
Sbjct  329   C-HDSSLKNGSTGYVTNDFDPCSDNYGIAYLNRPEVQKALHAK----PTNWSHCG-DLIT  382

Query  1172  NWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSK  1351
             +W D P T+LPTIK L+ S I +W+YSGD D +V VTT+ YAIN L   +   W PWYS 
Sbjct  383   HWNDSPITILPTIKYLIESNIKLWIYSGDTDARVPVTTSRYAINTLKLPINASWRPWYSG  442

Query  1352  gevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
              E+GGYVVGY+ L+FVT+RGAGH VPS+QPERALT  S+F+ G L P S
Sbjct  443   KEIGGYVVGYKGLTFVTVRGAGHLVPSWQPERALTMISSFLYGSLLPTS  491



>ref|XP_006595959.1| PREDICTED: serine carboxypeptidase II-3-like isoform X2 [Glycine 
max]
Length=531

 Score =   456 bits (1174),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 269/499 (54%), Positives = 332/499 (67%), Gaps = 39/499 (8%)
 Frame = +2

Query  113   LESLLKTQK-QKRQNNNAQTI---IMSAQDLGSVYI-GAQDGLKDADKISALPGQP-EGV  274
             L   ++T++ QKR    A ++   +   +    VY+   Q GL + DK+ ALPGQP +GV
Sbjct  31    LYKFIQTKRAQKRSYGEASSMATNLGGDEHFSKVYVVKEQSGLMEGDKVKALPGQPSQGV  90

Query  275   KFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMENGPFR  451
              F Q++GYVTVD +AGRALFYYF ES    S++PLVLWLNGGPGCSSFG G M E GPFR
Sbjct  91    DFDQYAGYVTVDAKAGRALFYYFVESPHNASNRPLVLWLNGGPGCSSFGYGAMQELGPFR  150

Query  452   VNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYV-TGDKKTAADNYIFLLNW  628
             VNSD KTL+ N+YAWNNVANVIFLESPAGVGFSYSN SSDY  TGDK TA D+Y FLLNW
Sbjct  151   VNSDGKTLYRNQYAWNNVANVIFLESPAGVGFSYSNTSSDYTKTGDKSTAMDSYTFLLNW  210

Query  629   LERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQ  808
             LERFP+YKTRDLFITGESYAGHYVPQLA  IL  NK+TN T+INLKGIA+GN +ID+   
Sbjct  211   LERFPQYKTRDLFITGESYAGHYVPQLADTILTYNKLTNHTVINLKGIAVGNGWIDDNMC  270

Query  809   DSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAP  988
               G Y+++WTHAL SDETH GI   C+F S  + +  C  +    D  +G+I  Y+IYAP
Sbjct  271   GKGMYEYFWTHALNSDETHEGIQRYCDFES-GNLTGECSKYQSRGDTEIGSIDIYDIYAP  329

Query  989   FCssgsgl-ssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVT-------------  1126
              C S +    SS        FDPCS DY   YLN  EVQ+ALHA  +             
Sbjct  330   PCDSAAKKPGSSPATNYDSNFDPCSDDYTNSYLNLAEVQEALHAKASVWYPCRYTKFSNY  389

Query  1127  ---GIPGPWDSCSQDVN-------------VNWEDMPDTVLPTIKELMGSGISVWLYSGD  1258
                     + +C   ++             V W D P T+LPTI  L+ SGI+ W+YSGD
Sbjct  390   VYLATFSKYTNCKCYISRIVLMFLMLLFRGVGWTDSPATILPTINRLISSGINTWIYSGD  449

Query  1259  IDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQ  1438
              DG+V +T++ Y++N L   V+T W PWYS  EVGGY+VGY+ L+ +T+RGAGH VPSYQ
Sbjct  450   TDGRVPITSSRYSVNALKLPVETTWRPWYSSNEVGGYLVGYKGLTLITVRGAGHMVPSYQ  509

Query  1439  PERALTFFSAFVEGKLPPK  1495
             P+RALT  S F+ G+LPP+
Sbjct  510   PQRALTMISFFLLGELPPE  528



>ref|XP_003557804.1| PREDICTED: serine carboxypeptidase 24-like [Brachypodium distachyon]
Length=500

 Score =   455 bits (1171),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 245/437 (56%), Positives = 310/437 (71%), Gaps = 9/437 (2%)
 Frame = +2

Query  197   SVYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKP  373
             ++ +  QDG+K+ADK+S LPGQP    F Q++GYVTV+  +G+ALFYYFAE+ E PS KP
Sbjct  69    AMKVSPQDGMKEADKVSELPGQPGRALFDQYAGYVTVNSTSGKALFYYFAEAAEDPSTKP  128

Query  374   LVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSY  553
             LVLWLNGGPGCSS G   M+E GPF VNSD++TL  NKYAWNNVAN++FLESPAGVGFSY
Sbjct  129   LVLWLNGGPGCSSLGGA-MLEIGPFFVNSDNRTLSTNKYAWNNVANMLFLESPAGVGFSY  187

Query  554   SNRSSDYV-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRN  730
             SN +SDY  TGD  TA D+Y FL+NWLERFPEYK RD FITGESY GHY+PQLA  IL N
Sbjct  188   SNTTSDYNNTGDSSTATDSYTFLVNWLERFPEYKGRDFFITGESYGGHYIPQLANTILSN  247

Query  731   NKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASP  910
             NKITN   INLKG+AIGNAY+D+ T    T D++WTHA+IS E H+ +  NC+F+   + 
Sbjct  248   NKITNAPFINLKGVAIGNAYLDDNTNTRATMDYFWTHAMISREAHQAVQKNCSFN--GTY  305

Query  911   SDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNT  1090
             +  C T +  A+  +G I  YNIYA  C + S         ++   DPC+  YI  YLN 
Sbjct  306   TGGCRTAITAANMELGIIDPYNIYASVCWNASNPQELHGMAANT--DPCALYYIQTYLNN  363

Query  1091  PEVQKALHANVTGIPGPWDSCSQDVN-VNWEDMPDTVLPTIKELMGSGISVWLYSGDIDG  1267
             PEVQ+ALHAN TG+  PW  CS  +   NW+D P ++LP+I+ L+ S +S WLYSGD+D 
Sbjct  364   PEVQRALHANTTGLKRPWTDCSDIITPENWKDAPVSMLPSIRRLISSEVSTWLYSGDVDS  423

Query  1268  KVAVTTTTYAINKLNTSVKTPWYPWYSKgevggy-vvgyeDLSFVTIRGAGHFVPSYQPE  1444
                VT+T Y+++ L     + W  WYS  +  G  V+GY+ L F T+RGAGH VP+YQP 
Sbjct  424   VCPVTSTQYSLDLLGLPTNSSWRSWYSDDDQVGGYVIGYKGLVFATVRGAGHMVPTYQPR  483

Query  1445  RALTFFSAFVEGKLPPK  1495
             RALT FS+F++GKLPP+
Sbjct  484   RALTLFSSFLQGKLPPE  500



>ref|XP_010279511.1| PREDICTED: serine carboxypeptidase-like 40 isoform X1 [Nelumbo 
nucifera]
Length=493

 Score =   455 bits (1170),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 259/474 (55%), Positives = 319/474 (67%), Gaps = 8/474 (2%)
 Frame = +2

Query  95    GRKFDPLESLLKTQKQKRQNNNAQTI--IMSAQDLGSVYIGAQDGLKDADKISALPGQPE  268
             GR+ D L  L + + Q +   +  +   +   Q +    +  Q+GLK+ D I  LPGQP 
Sbjct  23    GRQADALARLYQAKLQNKAGIDLTSSYEMKMTQIINEAEVLPQEGLKEKDMIERLPGQPP  82

Query  269   GVKFAQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLnggpgcssfgnggMMENGPF  448
              V F Q+ GYVTVD  AGRALFYYF E++ P  KPL+LWLNGGPGCSS G G M E GPF
Sbjct  83    -VGFKQYGGYVTVDESAGRALFYYFVEAQDPKSKPLLLWLNGGPGCSSLGYGAMEELGPF  141

Query  449   RVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVT-GDKKTAADNYIFLLN  625
             RV+SD KTL+ N+Y+WN V NV+FLESPAGVGFSYSNR+SDY T GD+ TA DNY+FL+N
Sbjct  142   RVHSDGKTLYENRYSWNRVVNVLFLESPAGVGFSYSNRTSDYATRGDQSTAEDNYVFLVN  201

Query  626   WLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEET  805
             WLERFPEYKTRD +I GESYAGHYVPQ A  IL++NKI    IINLKGI IGNA I++ET
Sbjct  202   WLERFPEYKTRDFYIAGESYAGHYVPQFAHTILQHNKIEQNNIINLKGIMIGNAVINDET  261

Query  806   QDSGTYDFYWTHALISDETHRGIIANCNFS-SAASPSDTCDTFVDDADRSMGNIYSYNIY  982
                G YD+ WTHAL SDET+  I   CNFS S    SD C    ++A  +   I  YNIY
Sbjct  262   DQKGMYDYAWTHALSSDETNIAINKYCNFSESELEWSDECINSTNEAFMNEVLIDIYNIY  321

Query  983   APFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQD  1162
                C   S L+    + S   FDPCS +Y+  YLN P+VQ+ALHAN+T +   W  CS D
Sbjct  322   GSQC-FSSNLTEKPKKASLMNFDPCSDNYVVAYLNQPDVQEALHANITKLKYDWQPCS-D  379

Query  1163  VNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPW  1342
             V   W D P TV+  ++E M +GI V ++SGD+DG+V VT+T Y++NKL   V T WYPW
Sbjct  380   VLTKWNDSPSTVVYLLQEFMDNGIRVLVFSGDVDGRVPVTSTRYSLNKLQLQVNTSWYPW  439

Query  1343  YSKgev-ggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKSA  1501
             Y+K EV G  VV    L+F T+RGAGH VPSYQP RALT  + F+ GK  P++A
Sbjct  440   YTKREVGGYTVVYKGGLTFATVRGAGHEVPSYQPLRALTLVNYFLHGKPLPRNA  493



>ref|XP_010279510.1| PREDICTED: serine carboxypeptidase-like 40 [Nelumbo nucifera]
Length=493

 Score =   455 bits (1170),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 247/430 (57%), Positives = 300/430 (70%), Gaps = 6/430 (1%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESE-TPSDKPLVLWLn  391
             Q+GLK+ D+I  LPGQP  V+F+Q+ GYVTVD  AGRAL+YYFAES      KPL+LWLN
Sbjct  62    QEGLKEKDRIKRLPGQPP-VRFSQYGGYVTVDESAGRALYYYFAESHYNKKSKPLLLWLN  120

Query  392   ggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSD  571
             GGPGCSS G G M E GPFRV SD KTL+ N +AWN VANV+FLESPAGVGFSYSNR+SD
Sbjct  121   GGPGCSSLGYGAMEELGPFRVKSDGKTLYENPFAWNKVANVLFLESPAGVGFSYSNRTSD  180

Query  572   YVT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQ  748
             Y T GD+ TA DNY+FL+NWLERFPEYKTRD +I GESYAGHYVPQ A  IL++NKI+ +
Sbjct  181   YATRGDRNTAEDNYVFLVNWLERFPEYKTRDFYIAGESYAGHYVPQFAHTILQHNKISQK  240

Query  749   TIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDT  928
              IINLKGI IGNA I++ET   G  D++WTHAL SDE    I   C+FS  A+ +D C  
Sbjct  241   NIINLKGIMIGNAVINDETDTKGMLDYFWTHALTSDEDKYAIDKYCDFSPGANITDKCIE  300

Query  929   FVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKA  1108
              V++    +  I  YNIYAP C   S L+      S   FDPC+  Y+Y YLN P+VQ A
Sbjct  301   AVNEDYEDIDPIDMYNIYAPLC-HSSNLTEKPKLASIEEFDPCTDYYVYAYLNRPDVQNA  359

Query  1109  LHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTT  1288
             LHANVT +   W  CS DV  NW D P T+LP ++E M +G+ VW+YSGD+D +V VT+T
Sbjct  360   LHANVTKLKYDWQPCS-DVLNNWTDSPSTILPLLQEFMANGLRVWVYSGDVDARVPVTST  418

Query  1289  TYAINKLNTSVKTPWYPW-YSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFS  1465
              Y++NKL  +V T WYPW  S    G  VV   +L+F T+RGAGH VPSYQP R L    
Sbjct  419   RYSLNKLQLAVNTSWYPWALSNEVGGYSVVYKGNLTFATVRGAGHEVPSYQPRRGLALIY  478

Query  1466  AFVEGKLPPK  1495
              +++G   PK
Sbjct  479   YYLQGGPLPK  488



>gb|KHN05141.1| Serine carboxypeptidase II-3 [Glycine soja]
Length=490

 Score =   453 bits (1165),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 269/470 (57%), Positives = 319/470 (68%), Gaps = 18/470 (4%)
 Frame = +2

Query  107   DPLESLLKTQKQKRQNNNAQTIIMSAQDL----GSVYIGAQDGLKDADKISALPGQPEGV  274
             D LE L+ ++  ++      T+  + +D      S Y+ +Q+G K ADKI+ALPGQP GV
Sbjct  28    DKLEELILSRSSQKP---PVTLSWAEEDALKTHSSAYVASQEGQKQADKIAALPGQPYGV  84

Query  275   KFAQFSGYVTVDPQAGRALFYYFAESE-TPSDKPLVLWLnggpgcssfgnggMMENGPFR  451
              F Q+SGYVTVDP+AGRALFYYF ES   PS KPLVLWLNGGPGCSS G G   E GPFR
Sbjct  85    NFDQYSGYVTVDPKAGRALFYYFVESPYNPSTKPLVLWLNGGPGCSSLGYGAFEELGPFR  144

Query  452   VNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFLLNW  628
             +NSD KTL+ NKYAWN VANV+FLESPAGVGFSYSN +SDY  +GDK TA D Y+FL+NW
Sbjct  145   INSDGKTLYRNKYAWNEVANVLFLESPAGVGFSYSNTTSDYDHSGDKPTAKDAYVFLINW  204

Query  629   LERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQ  808
             LERFPEYKTR+ +ITGESYAGHYVPQLA  IL NNK + Q I NLKGIA+ NA+ID+ T 
Sbjct  205   LERFPEYKTRNFYITGESYAGHYVPQLAYTILVNNKFSQQNI-NLKGIAVWNAWIDDVTG  263

Query  809   DSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAP  988
               G  D+ WTHAL SD+TH  I   C++SS  + S  C      A    GNI  YNIYAP
Sbjct  264   TKGIVDYLWTHALNSDQTHELIEKYCDYSSE-NISQICSNATRRALTEKGNIDFYNIYAP  322

Query  989   FCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVN  1168
              C   S  + SS       FDPCS  Y   YLN PEVQ ALHA     P  W  CS    
Sbjct  323   LCHDSSLKNESSSGSVYD-FDPCSDYYGEAYLNRPEVQLALHAK----PTNWSHCSD--L  375

Query  1169  VNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYS  1348
             ++W D P T+LP IK L  S I +W+YSGD D +V VT++ YAIN L   ++ PW PWYS
Sbjct  376   IDWNDSPTTILPVIKYLTDSNIVLWIYSGDTDARVPVTSSRYAINTLKLPIQVPWRPWYS  435

Query  1349  KgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
               EVGGYVV Y+ ++FVT+RGAGH VPS+QP RALT   +F+ G LPP S
Sbjct  436   GNEVGGYVVKYKGVTFVTVRGAGHLVPSWQPARALTLIFSFLYGSLPPAS  485



>ref|XP_007223971.1| hypothetical protein PRUPE_ppa014620mg, partial [Prunus persica]
 gb|EMJ25170.1| hypothetical protein PRUPE_ppa014620mg, partial [Prunus persica]
Length=557

 Score =   455 bits (1171),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 273/487 (56%), Positives = 323/487 (66%), Gaps = 60/487 (12%)
 Frame = +2

Query  200   VYIGAQDGLKDADKISALPGQP-EGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKP  373
             VY+G Q GLK+ADKI ALPGQP EGV F Q++GYVTVDP+AGRALFYYF ES    S KP
Sbjct  77    VYVGPQHGLKEADKIEALPGQPAEGVNFDQYAGYVTVDPRAGRALFYYFVESPHNSSTKP  136

Query  374   LVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSY  553
             LVLWLNGGPGCSS G G M E GPFRV+SD+KTL+ N YAWN VANVIFLESPAGVGFSY
Sbjct  137   LVLWLNGGPGCSSLGYGAMEELGPFRVSSDNKTLYRNDYAWNKVANVIFLESPAGVGFSY  196

Query  554   SNRSSDYVT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRN  730
             SN SSDY + GDK+TA D+Y FL+NWLERFP+YKTRD FI GESYAGHYVPQLA  +L  
Sbjct  197   SNTSSDYESVGDKQTAKDSYTFLVNWLERFPQYKTRDFFIAGESYAGHYVPQLAHTVLSQ  256

Query  731   NKITNQT-IINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAAS  907
             NKI NQT IINLKGIAIGN ++D+   + G YD+ WTHAL SDETH  I  +C   ++  
Sbjct  257   NKINNQTKIINLKGIAIGNPWVDDYDGEMGVYDYLWTHALNSDETHAAIHKHCADFASDK  316

Query  908   PSDTCDTFVDDADRSMG--NIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVY  1081
             PSD C  +   ++R +G  NI  YNIYAP C      S S   GS   FDPCSS+Y+  Y
Sbjct  317   PSDICLKYQLRSERELGDDNIDIYNIYAPLC--RKSESKSVSTGSVHHFDPCSSNYVESY  374

Query  1082  LNTPEVQKALHANVTGIPGPWDSC----SQDV---------------------NVNWEDM  1186
             LN  +VQ ALH   T     W +C    S D+                     N+ W D 
Sbjct  375   LNLVQVQSALHVKATN----WSACGWILSNDIRAEKTGSEFLTLFLFLCIICSNIGWTDS  430

Query  1187  PDTVLPTIKELMGSGIS-----------------------VWLYSGDIDGKVAVTTTTYA  1297
             P +VLPTIK+L  SGI+                       +  YSGD DG+V VT++ Y+
Sbjct  431   PVSVLPTIKQLTASGITFNYNQNPFQHIIFIHKFLKMHGCMLTYSGDTDGRVPVTSSRYS  490

Query  1298  INKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVE  1477
             IN L   ++T W PWYS GEVGGYV+ Y+ L+F T+RGAGH VPSYQP+RALT  S+F++
Sbjct  491   INNLKLQLRTSWRPWYSDGEVGGYVIRYKGLTFATVRGAGHMVPSYQPQRALTLISSFLK  550

Query  1478  GKLPPKS  1498
             GKL P S
Sbjct  551   GKLLPSS  557



>ref|XP_003592237.1| Serine carboxypeptidase II-3 [Medicago truncatula]
 ref|XP_003601334.1| Serine carboxypeptidase II-3 [Medicago truncatula]
 gb|AES71585.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=495

 Score =   452 bits (1164),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 258/433 (60%), Positives = 306/433 (71%), Gaps = 8/433 (2%)
 Frame = +2

Query  206   IGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESE-TPSDKPLVL  382
             +  Q+GL  ADKI  LPGQP GV F Q+SGYVTVDP+AGR LFYYF ES    S KPLVL
Sbjct  66    VAPQEGLMQADKIDTLPGQPYGVNFDQYSGYVTVDPEAGRELFYYFVESPYNSSTKPLVL  125

Query  383   WLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNR  562
             WLNGGPGCSS G G   E GPFR+NSD KTL+ N YAWN VANV+FLESPAGVGFSYSN 
Sbjct  126   WLNGGPGCSSLGYGAFQELGPFRINSDGKTLYRNPYAWNEVANVLFLESPAGVGFSYSNT  185

Query  563   SSDY-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKI  739
             +SDY  +GDK TA D Y+FL+NWLERFP+YKTRD +ITGESYAGHYVPQLA  IL NNK+
Sbjct  186   TSDYDKSGDKSTAKDTYVFLVNWLERFPQYKTRDFYITGESYAGHYVPQLASTILHNNKL  245

Query  740   TNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDT  919
              N TI+NLKGI+IGNA+ID+ T   G +D+ WTHAL SD+TH  I   C+F++    +  
Sbjct  246   YNNTIVNLKGISIGNAWIDDATSLKGFFDYLWTHALNSDQTHELIEKYCDFTTENVSAIC  305

Query  920   CDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEV  1099
              +     A    G I  YNIYAP C   S L + S    S  FDPCS  Y   YLN PEV
Sbjct  306   INNVTLKAFFEHGKIDLYNIYAPLC-HDSSLKNGSTGYVSNDFDPCSDYYGSAYLNRPEV  364

Query  1100  QKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAV  1279
             QKALHA     P  W  CS+ +  +W+D P T+LPT+K L+ SGI +W+YSGD D  V+V
Sbjct  365   QKALHAK----PTNWTHCSRLL-TDWKDSPITILPTVKYLINSGIKLWIYSGDTDAVVSV  419

Query  1280  TTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTF  1459
             T++ Y+IN L   +   W PWYS  E+GGYVVGY+ L+FVT+RGAGH VPS+QPERALT 
Sbjct  420   TSSRYSINTLKLPINAAWSPWYSGKEIGGYVVGYKGLTFVTVRGAGHLVPSWQPERALTM  479

Query  1460  FSAFVEGKLPPKS  1498
              S+F+ G L P S
Sbjct  480   ISSFLYGSLLPSS  492



>ref|XP_010279514.1| PREDICTED: serine carboxypeptidase-like 40 [Nelumbo nucifera]
Length=491

 Score =   452 bits (1163),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 249/428 (58%), Positives = 301/428 (70%), Gaps = 5/428 (1%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLng  394
             Q+GLK+ D I  LPGQP  V F Q+ GYVTVD  AGRALFYYFAE++    KPL+LWLNG
Sbjct  65    QEGLKEKDMIERLPGQPP-VGFKQYGGYVTVDESAGRALFYYFAEAQDAKSKPLLLWLNG  123

Query  395   gpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY  574
             GPGCSSFG G M+E GPFRV+SD KTL+ N Y+WN VANV+FLESPAGVGFSYSN++SDY
Sbjct  124   GPGCSSFGYGAMVELGPFRVHSDGKTLYENHYSWNRVANVVFLESPAGVGFSYSNKTSDY  183

Query  575   VT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQT  751
              T GD  TA DNY+FL+NWLERFPEYKTRD +I GESYAGHYVPQLA  IL +NKI    
Sbjct  184   NTRGDGNTAQDNYVFLVNWLERFPEYKTRDFYIAGESYAGHYVPQLAHTILLHNKIAPNN  243

Query  752   IINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTF  931
              INLKGI IGNA +++ET   G YD+ WTHAL SDET++ I   CNF +A   S+ C   
Sbjct  244   TINLKGIMIGNAVLNDETDMKGMYDYVWTHALSSDETNKAINTYCNF-NATKLSEKCLNS  302

Query  932   VDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKAL  1111
             + +A+ ++G I  YNIY P C   S L+      S   FDPCS  Y+  YLN P+VQ+AL
Sbjct  303   LIEAEMNVGFIDIYNIYGPLC-FSSNLTEKPKMASLMKFDPCSDYYVIAYLNHPDVQEAL  361

Query  1112  HANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTT  1291
             HAN+T +   W  C+ ++  NW D   TVLP ++ELM  GI V ++SGD+DG+V VT+T 
Sbjct  362   HANITKLKYKWRPCNHEIYSNWSDSASTVLPLLQELMAEGIRVLVFSGDVDGRVPVTSTK  421

Query  1292  YAINKLNTSVKTPWYPWYSKgev-ggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSA  1468
             Y++NKL   V T WYPWY+  EV G  VV    L+F T+RGAGH VPSYQP RAL     
Sbjct  422   YSLNKLQLLVNTSWYPWYTNNEVGGYTVVYKGGLTFSTVRGAGHEVPSYQPLRALDLVKY  481

Query  1469  FVEGKLPP  1492
             F+ GK  P
Sbjct  482   FLHGKPLP  489



>ref|XP_007052442.1| Serine carboxypeptidase-like 40 [Theobroma cacao]
 gb|EOX96599.1| Serine carboxypeptidase-like 40 [Theobroma cacao]
Length=542

 Score =   453 bits (1165),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 247/478 (52%), Positives = 324/478 (68%), Gaps = 9/478 (2%)
 Frame = +2

Query  86    SIGGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQP  265
             S G ++   L  L +T K K  +    ++    Q +    +  Q+G+K+ D+I  LPGQP
Sbjct  67    SHGKKQTQALGDLYRT-KMKGSSGIVTSLFEPIQSISKASVHPQEGMKEKDRIEKLPGQP  125

Query  266   EGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK-PLVLWLnggpgcssfgnggMMENG  442
             + V+F+Q+ GYVTVD  AGRAL+YYFAE++   +  PL+LWLNGGPGCSS   G M E G
Sbjct  126   D-VQFSQYGGYVTVDKSAGRALYYYFAEAQHSKESLPLLLWLNGGPGCSSLAYGAMQELG  184

Query  443   PFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFL  619
             PFRV+S  KTL+ N Y+WN  ANV+FLESPAGVGFSYSNR+SDY  +GD KTAADNY+FL
Sbjct  185   PFRVHSTGKTLYRNSYSWNYAANVLFLESPAGVGFSYSNRTSDYNESGDSKTAADNYVFL  244

Query  620   LNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDE  799
             LNWLERFPEYK RD +I+GESYAGHYVPQLA  IL++N+  N+T+INLKGI IGNA I++
Sbjct  245   LNWLERFPEYKGRDFYISGESYAGHYVPQLAHTILQHNQKANKTLINLKGIIIGNAVIND  304

Query  800   ETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDT--CDTFVDDADRSMGNIYSY  973
             ET   G YD++ +HALIS++T   I  +CN  S  + + T  C   VD+ADR    +  Y
Sbjct  305   ETDVKGMYDYFESHALISEDTASRIKKHCNLLSEDTTNATRKCIAAVDEADRDTYYLDIY  364

Query  974   NIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSC  1153
             +IYAP C   S L++   + S    DPCS +Y+Y YLN  +VQ+ALHANVT +   W+ C
Sbjct  365   SIYAPLC-HNSNLTARPKKASVMNIDPCSDNYVYAYLNRADVQEALHANVTKLDHDWEPC  423

Query  1154  SQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPW  1333
             S D+   W D P T++P ++E M +G+ VW++SGD DG+V VT+T Y+INK+   VKT W
Sbjct  424   S-DILGKWRDSPSTIIPLLQEFMANGLRVWVFSGDTDGRVPVTSTQYSINKMKLPVKTKW  482

Query  1334  YPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKSAE  1504
             +PWY      G   V   DL+F T+RGAGH VPSYQP+RAL     F+ G   P ++ 
Sbjct  483   HPWYLDAEVGGYTQVYKGDLTFATVRGAGHQVPSYQPKRALALIKHFLTGAPLPDTSR  540



>gb|EYU35986.1| hypothetical protein MIMGU_mgv1a026061mg [Erythranthe guttata]
Length=484

 Score =   451 bits (1159),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 273/468 (58%), Positives = 319/468 (68%), Gaps = 16/468 (3%)
 Frame = +2

Query  113   LESLLKTQKQKRQNNNAQT--IIMSAQDLGSVYIGAQDGLKDADKISALPGQPEGVKFAQ  286
             L  LLK+++   + +++ T   +   ++     +  QDGL  AD+I  LPGQP+ V F Q
Sbjct  27    LHKLLKSRRSNSRISDSDTWSQLHEEREYSPALLAPQDGLMQADRIVELPGQPDDVDFDQ  86

Query  287   FSGYVTVDPQAGRALFYYFAESET-PSDKPLVLWLnggpgcssfgnggMMENGPFRVNSD  463
             +SGYVTVDP AGRALFYYF ES T  S  PLVLWLNGGPGCSSFG G M E GPFRVNSD
Sbjct  87    YSGYVTVDPTAGRALFYYFVESPTNSSTNPLVLWLNGGPGCSSFGFGAMEELGPFRVNSD  146

Query  464   SKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVT-GDKKTAADNYIFLLNWLERF  640
              KTL+ N YAWNNVANVIFLESP GVGFSYSN S+DY + GD +TA D Y FL+NWLERF
Sbjct  147   GKTLFRNNYAWNNVANVIFLESPVGVGFSYSNTSADYGSNGDSRTAVDAYTFLVNWLERF  206

Query  641   PEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQT--IINLKGIAIGNAYIDEETQDS  814
             P+YKTRD FITGESYAGHY PQLA  IL NNK  N    +INLKG+AIGNA+ID+     
Sbjct  207   PQYKTRDFFITGESYAGHYAPQLANTILLNNKKNNTNQTVINLKGVAIGNAWIDDTIMLP  266

Query  815   GTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFC  994
             G +D  WTHAL SD TH  I+  CNF +  S SD C  FVD ++  MGNI   NIYAP C
Sbjct  267   GYFDHVWTHALNSDGTHEDILKFCNFEND-SVSDECRVFVDKSNGEMGNIEINNIYAPIC  325

Query  995   ssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVN  1174
              +    +SS+   +   FDPCS  Y+  YLNT  VQ ALH      P  W  C     +N
Sbjct  326   LNPVLKNSSTGSVNF--FDPCSDTYVEYYLNTARVQNALHVK----PTTWVGCKF---LN  376

Query  1175  WEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKg  1354
             W D    VLP I+ LM S ISVWLYSGDID  V VT+T YAIN L   V+TPW PWY   
Sbjct  377   WTDAQINVLPMIESLMASDISVWLYSGDIDINVPVTSTRYAINSLKLPVETPWRPWYLDN  436

Query  1355  evggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
             EVGGYV GY+ L+FVT+RGAGH VPSYQP+RAL+  S+F++G LPP S
Sbjct  437   EVGGYVEGYKGLTFVTVRGAGHLVPSYQPQRALSVISSFLQGILPPSS  484



>gb|AES59494.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=490

 Score =   451 bits (1159),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 258/461 (56%), Positives = 317/461 (69%), Gaps = 14/461 (3%)
 Frame = +2

Query  128   KTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKD--ADKISALPGQPEGVKFAQFSGYV  301
             +  +QK  +  A +  +  + +  V++  +  L+   A K+ +LPGQP+GV F Q++GY+
Sbjct  36    RRYQQKPSHVEAYSSTIVNEHVSKVHVNVEQHLRSRKAYKVKSLPGQPKGVNFDQYAGYI  95

Query  302   TVDPQAGRALFYYFAESET-PSDKPLVLWLnggpgcssfgnggMMENGPFRVNSDSKTLW  478
             TVD +A R LFYYF ES +  S KPLVLWLNGGPGCSS G G M E GPFRVNSD  TL 
Sbjct  96    TVDAKARRKLFYYFVESPSNSSTKPLVLWLNGGPGCSSLGYGAMQELGPFRVNSDGTTLS  155

Query  479   LNKYAWNNVANVIFLESPAGVGFSYSNRSSDYV-TGDKKTAADNYIFLLNWLERFPEYKT  655
             LNK AWN VANVIFLESPAGVGFSYSN S DY   GD +TA D+YIFLLNWLERFP+YKT
Sbjct  156   LNKDAWNVVANVIFLESPAGVGFSYSNNSLDYSNVGDNRTAIDSYIFLLNWLERFPQYKT  215

Query  656   RDLFITGESYAGHYVPQLAQLIL-RNNKITNQTIINLKGIAIGNAYIDEETQDSGTYDFY  832
             RD FI GESYAGHYVPQLA LIL +N K  N  +INLKGIA+GN  ID++    G YD+Y
Sbjct  216   RDFFIAGESYAGHYVPQLAHLILSKNKKRKNHNVINLKGIAVGNGLIDDKLSTKGMYDYY  275

Query  833   WTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFCssgsgl  1012
             WTHALISDETH GI  NC      +    C  +   AD  + +I  YNIYAP C+S +  
Sbjct  276   WTHALISDETHAGIEKNCGDFRNVTNLRECFLYEFKADDELVDIDVYNIYAPVCNSSATK  335

Query  1013  ssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPD  1192
             + +S   S+   DPC+ DY   YLN PEVQKALH      P  W  CS    V W D P 
Sbjct  336   NGASYFVSN--IDPCAEDYTAAYLNLPEVQKALHVK----PIKWSHCS---GVGWTDSPT  386

Query  1193  TVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggyv  1372
             ++LPTI +L+ SGIS+W+YSGD+DG+V +T+T Y+IN L   V T W PWY+  EVGGYV
Sbjct  387   SILPTINQLISSGISIWIYSGDLDGRVPITSTKYSINSLKLPVHTAWRPWYTGKEVGGYV  446

Query  1373  vgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPK  1495
             +GY+ L+ VT+RGAGH VP+ QP RALT  S+F+ G+LPP+
Sbjct  447   IGYKGLTLVTVRGAGHMVPTDQPYRALTMISSFLLGQLPPQ  487



>ref|XP_003592239.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 ref|XP_003601336.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES71587.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=495

 Score =   451 bits (1159),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 262/444 (59%), Positives = 307/444 (69%), Gaps = 9/444 (2%)
 Frame = +2

Query  176   MSAQDLGSVYIGA-QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES  352
             +      + Y+   Q+ L+ ADKI  LPGQP GV F Q+SGYVTVDP+AGR LFYYF ES
Sbjct  55    LKTHSFSAAYVAPPQEELRLADKIVTLPGQPYGVNFDQYSGYVTVDPEAGRELFYYFVES  114

Query  353   ETPS-DKPLVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLES  529
                S  KPL+LWLNGGPGCSS G G   E GPFRVNSD KTL+ N YAWN VANV+FLES
Sbjct  115   PHNSYTKPLILWLNGGPGCSSLGYGAFEELGPFRVNSDGKTLYRNPYAWNEVANVLFLES  174

Query  530   PAGVGFSYSNRSSDY-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQ  706
             PAGVGFSYSN SSDY  +GDK TA D Y+FL+NWLERFP+YKTRD +ITGESYAGHYVPQ
Sbjct  175   PAGVGFSYSNTSSDYDNSGDKSTAKDAYVFLINWLERFPQYKTRDFYITGESYAGHYVPQ  234

Query  707   LAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANC  886
             LA  IL NNK+ N TIINLKGI+IGNA+ID+ T   G YD  WTHAL SD+TH  I   C
Sbjct  235   LASTILYNNKLYNNTIINLKGISIGNAWIDDATNLKGIYDNLWTHALNSDQTHELIEKYC  294

Query  887   NFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSD  1066
             +F+   + S  C+   D A    G I  YNI+AP C   S  + SS    S  FDPCS  
Sbjct  295   DFTK-ENVSAICNNATDKAFVETGKIDIYNIHAPLCHDSSLKNGSSTGYVSNDFDPCSDY  353

Query  1067  YIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWL  1246
             Y+  YLN PEVQKALHA     P  W  C+  +   W+D P TVLPT+K L+ SGI +W+
Sbjct  354   YVTAYLNRPEVQKALHAK----PTNWTHCTHLL-TTWKDSPATVLPTVKYLIDSGIKLWI  408

Query  1247  YSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFV  1426
             YSGD D  V  T++ Y IN L   + + W PWYS  E+GGYVVGY+ L+FVT+RGAGH V
Sbjct  409   YSGDTDVVVPTTSSRYLINTLKLPINSAWRPWYSGKEIGGYVVGYKGLTFVTVRGAGHLV  468

Query  1427  PSYQPERALTFFSAFVEGKLPPKS  1498
             PS+QPERALT  S+F+ G LP  S
Sbjct  469   PSWQPERALTLISSFLYGILPSGS  492



>gb|AAQ63884.1| putative serine carboxypeptidase [Medicago truncatula]
Length=495

 Score =   451 bits (1159),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 266/469 (57%), Positives = 316/469 (67%), Gaps = 9/469 (2%)
 Frame = +2

Query  101   KFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGA-QDGLKDADKISALPGQPEGVK  277
             KF+      K+Q   +  +  +   +      + Y+   Q+ L+ ADKI  LPGQP GV 
Sbjct  30    KFNEFILSRKSQNPPKTLSWEEGDALKTHSFSAAYVAPPQEELRLADKIVTLPGQPYGVN  89

Query  278   FAQFSGYVTVDPQAGRALFYYFAESETPS-DKPLVLWLnggpgcssfgnggMMENGPFRV  454
             F Q+SGYVTVDP+AGR LFYYF ES   S  KPL+LWLNGGPGCSS G G   E GPFRV
Sbjct  90    FDQYSGYVTVDPEAGRELFYYFVESPHNSYTKPLILWLNGGPGCSSLGYGAFEELGPFRV  149

Query  455   NSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFLLNWL  631
             NSD KTL+ N YAWN VANV+FLESPAGVGFSYSN SSDY  +GDK TA D Y+FL+NWL
Sbjct  150   NSDGKTLYRNPYAWNEVANVLFLESPAGVGFSYSNTSSDYDNSGDKSTAKDAYVFLINWL  209

Query  632   ERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQD  811
             ERFP+YKTRD +ITGESYAGHYVPQLA  IL NNK+ N TIINLKGI+IGNA+ID+ T  
Sbjct  210   ERFPQYKTRDFYITGESYAGHYVPQLASTILYNNKLYNNTIINLKGISIGNAWIDDATNL  269

Query  812   SGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPF  991
              G YD  WTHAL SD+TH  I   C+F+   + S  C+   D A    G I  YNI+AP 
Sbjct  270   KGIYDNLWTHALNSDQTHELIEKYCDFTK-ENVSAICNNATDKAFVETGKIDIYNIHAPL  328

Query  992   CssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNV  1171
             C   S  + SS    S  FDPCS  Y+  YLN PEVQKALHA     P  W  C+  +  
Sbjct  329   CHDSSLKNGSSTGYVSNDFDPCSDYYVTAYLNRPEVQKALHAK----PTNWTHCTHLL-T  383

Query  1172  NWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSK  1351
              W+D P TVLPT+K L+ SGI +W+YSGD D  V  T++ Y IN L   + + W PWYS 
Sbjct  384   TWKDSPATVLPTVKYLIDSGIKLWIYSGDTDVVVPTTSSRYLINTLKLPINSAWRPWYSG  443

Query  1352  gevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
              E+GGYVVGY+ L+FVT+RGAGH VPS+QPERALT  S+F+ G LP  S
Sbjct  444   KEIGGYVVGYKGLTFVTVRGAGHLVPSWQPERALTLISSFLYGILPSGS  492



>ref|XP_003542323.2| PREDICTED: serine carboxypeptidase-like 40-like isoform X1 [Glycine 
max]
 ref|XP_006593895.1| PREDICTED: serine carboxypeptidase-like 40-like isoform X2 [Glycine 
max]
Length=488

 Score =   450 bits (1158),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 257/436 (59%), Positives = 310/436 (71%), Gaps = 13/436 (3%)
 Frame = +2

Query  197   SVYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKP  373
             + Y+  Q+GL+ ADKI  LPGQP GV F Q+SG+VTVDP+ GR+LFYYF ES    S KP
Sbjct  59    AAYVAPQEGLRQADKIVTLPGQPHGVNFDQYSGHVTVDPKTGRSLFYYFVESPHNSSAKP  118

Query  374   LVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSY  553
             LVLWLNGGPGCSS G G   E GPFRVNSD KTL+ NKYAWN VANV+FLESPAGVGFSY
Sbjct  119   LVLWLNGGPGCSSLGYGAFEELGPFRVNSDGKTLFHNKYAWNEVANVLFLESPAGVGFSY  178

Query  554   SNRSSDY-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRN  730
             SN +SDY  +GDK TA D Y+FL+NWLERFPEYKTR+ +ITGESYAGHYVPQLA  IL N
Sbjct  179   SNTTSDYDRSGDKSTAKDAYVFLINWLERFPEYKTREFYITGESYAGHYVPQLAYTILVN  238

Query  731   NKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASP  910
             NK + Q+I NLKGIAIGNA ID+ T   G +D++WTHAL SD+TH  I   C+F+S  + 
Sbjct  239   NKFSQQSI-NLKGIAIGNALIDDVTTIKGIFDYFWTHALNSDQTHHLIKKYCDFTSE-NI  296

Query  911   SDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNT  1090
             S  C      +    G+I S NIYAP C   S  + S+       FDPCS+ Y+  YLN 
Sbjct  297   SAACINATISSILEKGSIDSSNIYAPLCYDSSLKNGSTGSVYD--FDPCSAYYVEAYLNR  354

Query  1091  PEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGK  1270
             PEVQKALHA     P  W  CS     +W+D P T+LP I+ L+ S I +W+YSGD D  
Sbjct  355   PEVQKALHAK----PTNWTHCS---GFDWKDSPTTILPIIEYLIASHIKLWIYSGDTDAT  407

Query  1271  VAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERA  1450
             V VT++ Y+IN L   ++  W+PWYS  EVGGYVVGY+ ++FVT+RGAGHFVPS+QP R+
Sbjct  408   VPVTSSRYSINTLRLPIQVDWHPWYSGNEVGGYVVGYKAVTFVTVRGAGHFVPSWQPARS  467

Query  1451  LTFFSAFVEGKLPPKS  1498
             LT  S+F+ G LPP S
Sbjct  468   LTMISSFLSGTLPPAS  483



>ref|XP_006595329.1| PREDICTED: serine carboxypeptidase II-3-like [Glycine max]
Length=489

 Score =   450 bits (1157),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 260/434 (60%), Positives = 304/434 (70%), Gaps = 12/434 (3%)
 Frame = +2

Query  203   YIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESE-TPSDKPLV  379
             Y+  Q+G K+AD+I ALPGQP GV F Q+SGYVTVDP+AGRALFYYF ES   PS KPLV
Sbjct  61    YVAPQEGQKEADRIVALPGQPYGVNFDQYSGYVTVDPKAGRALFYYFVESPYNPSTKPLV  120

Query  380   LWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSN  559
             LWLNGGPGCSS G G   E GPFR+NSD +TL+ NKYAWN VANV+FLESPAGVGFSYSN
Sbjct  121   LWLNGGPGCSSLGYGAFEELGPFRINSDGETLYRNKYAWNEVANVLFLESPAGVGFSYSN  180

Query  560   RSSDY-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNK  736
              +SDY  +GDK TA D Y+FL+NWLERFPEYKTRD +ITGESYAGHYVPQLA  IL NNK
Sbjct  181   TTSDYGHSGDKSTAKDAYVFLINWLERFPEYKTRDFYITGESYAGHYVPQLAYTILVNNK  240

Query  737   ITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSD  916
              + Q I  LKGIAIGNA+ID+     G YD+ WTHAL SD+TH  I   C+ +S  + S 
Sbjct  241   FSQQKI-KLKGIAIGNAWIDDVASIKGIYDYIWTHALSSDQTHELIEKYCDVTSE-NVSA  298

Query  917   TCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPE  1096
              C      A   +GNI  YNIYAP C   S  + S+       FDPCS  Y   YLN PE
Sbjct  299   MCVNATRTAAIEIGNIDDYNIYAPLCHDSSLKNGSAGSVYD--FDPCSDYYGEAYLNRPE  356

Query  1097  VQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVA  1276
             VQ ALHA     P  W  CS    +NW+D P T+LP IK L+ S I +W+YSGD D  V 
Sbjct  357   VQLALHAK----PTNWAHCSD--LINWKDSPATILPVIKYLIDSDIGLWIYSGDTDSVVP  410

Query  1277  VTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALT  1456
             VT++ Y+IN L   ++ PW PWYS  EVGGYVV Y+ ++FVT+RGAGH VPS+QP RALT
Sbjct  411   VTSSRYSINTLKLPIQVPWRPWYSGNEVGGYVVKYKGVTFVTVRGAGHLVPSWQPSRALT  470

Query  1457  FFSAFVEGKLPPKS  1498
                +F+ G LPP S
Sbjct  471   LIFSFLYGSLPPAS  484



>ref|XP_004292824.1| PREDICTED: serine carboxypeptidase II-3-like [Fragaria vesca 
subsp. vesca]
Length=492

 Score =   450 bits (1157),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 264/471 (56%), Positives = 319/471 (68%), Gaps = 27/471 (6%)
 Frame = +2

Query  101   KFDPLESLLKTQKQKRQNNNAQTIIMSAQDL------GSVYIGAQDGLKDADKISALPGQ  262
             + D L  L+KT++ K  N +  ++  +  D+        V +  QDGLK+ADKI  LPGQ
Sbjct  27    QIDNLNRLIKTRRFK-TNRSPHSLSFAVSDVEDHEFSSPVCVAPQDGLKEADKIDTLPGQ  85

Query  263   PE---GVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggM  430
             P+   G +F Q++GYV VD  AGRALFYYF ES +  S KPLVLWLNGGPGCSSFG G M
Sbjct  86    PKLNPGEEFNQYAGYVRVDHVAGRALFYYFVESPQNSSTKPLVLWLNGGPGCSSFGYGAM  145

Query  431   MENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYV-TGDKKTAADN  607
              E GPFRVNSD KTL+ N +AWNNVANV+FLESPAGVGFSYSN  SDY   GDK+TA D+
Sbjct  146   EELGPFRVNSDGKTLFRNDHAWNNVANVLFLESPAGVGFSYSNNKSDYENVGDKRTAEDS  205

Query  608   YIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNA  787
             Y FL+NWLERFPEY+ RD FITGESYAGHY PQLA+ IL  N  T +T INLKGIAIGN 
Sbjct  206   YKFLVNWLERFPEYRDRDFFITGESYAGHYAPQLARTILSKNNSTKKTKINLKGIAIGNP  265

Query  788   YIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIY  967
             +IDE     G YD+ WTH L SDETH GI  NC+F+S  + S+TC  +++ ++  +G+I 
Sbjct  266   WIDENDGTLGEYDYLWTHDLNSDETHAGIHKNCDFAS-GNKSETCIIYMNKSEDEIGDID  324

Query  968   SYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWD  1147
              YNIYAP C         S       FDPCS  Y+  YLN  EV+ ALHA     P  W 
Sbjct  325   PYNIYAPKC-------DMSSGTKVNSFDPCSDKYVEAYLNLAEVRAALHAK----PTNWT  373

Query  1148  SCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKT  1327
              CS   +V W D P T+LP IK L+ SGI +W+YSGD D  V  T+T Y+I +L   +K 
Sbjct  374   FCS---DVGWIDAPITILPGIKRLIASGIRLWMYSGDTDANVPGTSTRYSIKRLKLPIKK  430

Query  1328  PWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEG  1480
             PW PW S GEVGGYV+GY  L+F T+RGAGH VPSYQP RALT  S+F++G
Sbjct  431   PWRPWNSDGEVGGYVIGYRGLTFATVRGAGHLVPSYQPRRALTLISSFLQG  481



>ref|XP_003592238.1| Serine carboxypeptidase II-3 [Medicago truncatula]
 ref|XP_003601335.1| Serine carboxypeptidase II-3 [Medicago truncatula]
 gb|AES71586.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=495

 Score =   450 bits (1157),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 261/444 (59%), Positives = 308/444 (69%), Gaps = 10/444 (2%)
 Frame = +2

Query  176   MSAQDLGSVYIGA-QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES  352
             +      + Y+   Q+ L+ ADKI  LPGQP GV F Q+SGYVTVDP+AGR LFYYF ES
Sbjct  56    LKTHSFSAAYVAPPQEELRLADKIVTLPGQPYGVNFDQYSGYVTVDPEAGRELFYYFVES  115

Query  353   E-TPSDKPLVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLES  529
                 S KPLVLW NGGPGCSS G G   E GPFRVNSD KTL+ N YAWN VANV+FLES
Sbjct  116   PYNSSTKPLVLWFNGGPGCSSLGYGAFQELGPFRVNSDGKTLYRNPYAWNEVANVLFLES  175

Query  530   PAGVGFSYSNRSSDY-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQ  706
             PAGVGFSYSN +SDY  +GDK TA D Y+FL+NWLERFP+YKTR  +ITGESYAGHYVPQ
Sbjct  176   PAGVGFSYSNTTSDYDNSGDKSTAKDAYVFLINWLERFPQYKTRAFYITGESYAGHYVPQ  235

Query  707   LAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANC  886
             LA  IL NNK+ N T INLKGI+IGNA+ID+ T   G +D+ WTHAL SD+TH  I   C
Sbjct  236   LASTILHNNKLYNNTTINLKGISIGNAWIDDATGLRGLFDYLWTHALNSDQTHELIEKYC  295

Query  887   NFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSD  1066
             +F+S  + S  C      A    G I SYNIYAP C   S L + S    +  FDPCS  
Sbjct  296   DFTS-ENVSSICINATHKAFLEQGKIDSYNIYAPLC-HDSSLKNGSTGYVTNDFDPCSDY  353

Query  1067  YIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWL  1246
             Y   YLNTPEVQKALHA     P  W  C+  +  +W+D P T+LPT+K L+ SGI +W+
Sbjct  354   YGAAYLNTPEVQKALHAK----PTNWTHCTHLL-TDWKDSPITILPTVKYLIDSGIKLWI  408

Query  1247  YSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFV  1426
             YSGD D  V VT++ Y+IN L   +   W PWYS  E+GGYVVGY+ L+FVT+RGAGH V
Sbjct  409   YSGDTDSVVPVTSSRYSINTLKLPINAAWRPWYSGKEIGGYVVGYKGLTFVTVRGAGHLV  468

Query  1427  PSYQPERALTFFSAFVEGKLPPKS  1498
             PS+QPERALT  S+F+ G LPP S
Sbjct  469   PSWQPERALTLISSFLYGILPPAS  492



>ref|XP_011008273.1| PREDICTED: serine carboxypeptidase-like 40 [Populus euphratica]
Length=496

 Score =   450 bits (1157),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 242/471 (51%), Positives = 320/471 (68%), Gaps = 8/471 (2%)
 Frame = +2

Query  92    GGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQPEG  271
             G R+ + L  L K + +   N ++  +  + + +       Q+GLK+ D+I +LPGQP+ 
Sbjct  25    GTRQSEALGHLCKAKLEGNSNVDS-ALFQAIEHVDISKFHHQEGLKEKDRIESLPGQPK-  82

Query  272   VKFAQFSGYVTVDPQAGRALFYYFAESE-TPSDKPLVLWLnggpgcssfgnggMMENGPF  448
             V+F+Q+ GYVTVD  AGRAL+YYF E++ +    PL+LWLNGGPGCSS   G M E GPF
Sbjct  83    VEFSQYGGYVTVDKSAGRALYYYFVEAQHSKESSPLLLWLNGGPGCSSLAYGAMQELGPF  142

Query  449   RVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFLLN  625
             RV SD K L+ N+Y+WN  ANV+FLESPAGVGFSYSN +SDY  +GDK+TA DNY+FL+N
Sbjct  143   RVYSDGKKLYKNRYSWNYAANVLFLESPAGVGFSYSNTTSDYEKSGDKRTAEDNYVFLVN  202

Query  626   WLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEET  805
             WLERF EYK R+ +I+GESYAGHYVP+LA  IL +NK   +TIINLKGI IGNA I+ ET
Sbjct  203   WLERFSEYKDREFYISGESYAGHYVPELAHTILYHNKKAKKTIINLKGILIGNAVINPET  262

Query  806   QDSGTYDFYWTHALISDETHRGIIANCNFSSAASP-SDTCDTFVDDADRSMGNIYSYNIY  982
                G YD+  +HA+ISDE    +  +CNFS  A+P SD C+  VD+  R   +I  YNIY
Sbjct  263   DRIGMYDYLGSHAIISDELVHKVRTHCNFSFNATPQSDECNEAVDEVRRDTHHIDIYNIY  322

Query  983   APFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQD  1162
             AP C      ++   + S   FDPCS  Y+Y YLN P+VQ+A+HANVT +   W+ CS D
Sbjct  323   APSC-FHKSTTAKPKKPSLMNFDPCSDYYVYAYLNRPDVQEAMHANVTKLTHDWEPCS-D  380

Query  1163  VNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPW  1342
             V  +W D P T++P ++ELM +G+ VW++SGD D +V VT+T Y+INK+   VKT W+PW
Sbjct  381   VITSWSDSPSTIIPLLQELMANGLRVWIFSGDTDARVPVTSTQYSINKMKLQVKTEWHPW  440

Query  1343  YSK-gevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
             Y K    G   V   D++F T+RGAGH VP+YQP RAL+    F++G   P
Sbjct  441   YLKGEVGGYTQVYRGDMTFATVRGAGHQVPTYQPLRALSLIKHFLDGTSLP  491



>ref|XP_002517751.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF44558.1| serine carboxypeptidase, putative [Ricinus communis]
Length=507

 Score =   450 bits (1157),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 254/488 (52%), Positives = 320/488 (66%), Gaps = 19/488 (4%)
 Frame = +2

Query  86    SIGGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQ------------DLGSVYIGAQDGLK  229
             S G R+ D L  L K +     N +  +  +  Q             + +V   ++ G K
Sbjct  22    SHGKRQGDALNKLFKAKFSGNSNIDTSSYEVFDQFQAEKIRGLNKTSINTVIASSETGSK  81

Query  230   DADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLnggpgcs  409
             +AD+I  LPGQP+ VKF+Q+ GYVTVD  AGRA +YYF E+E     PL+LWLNGGPGCS
Sbjct  82    EADRIVRLPGQPQ-VKFSQYGGYVTVDKVAGRAYYYYFVEAEISKSLPLLLWLNGGPGCS  140

Query  410   sfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYV-TGD  586
             S   G M E GPFRV+SD KTL+ N++AWNNVANV+FLESPAGVGFSYSNR+SDY  +GD
Sbjct  141   SLAYGAMQELGPFRVHSDGKTLYSNQFAWNNVANVLFLESPAGVGFSYSNRTSDYNNSGD  200

Query  587   KKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLK  766
             + TAADNY+FLL WLERFPEYK RD +I+GESYAGHYVPQLA  IL +N+   + IINLK
Sbjct  201   RHTAADNYMFLLRWLERFPEYKDRDFYISGESYAGHYVPQLAHNILYHNRKAGKNIINLK  260

Query  767   GIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSS--AASPSDTCDTFVDD  940
             GIAIGNA I++ET   G YD++ THAL S E  + I  +CNFS     + S  C      
Sbjct  261   GIAIGNAVINDETDSIGMYDYFATHALTSPENVQNIKQHCNFSPQFKNNQSSECLAATRK  320

Query  941   ADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHAN  1120
             +DR   NI  YNIYAP C   S L++   + S   FDPCS  Y + Y N  +VQ+A+HAN
Sbjct  321   SDRDTVNIDIYNIYAPLC-HNSNLAAKPKRASLTEFDPCSDYYSFAYFNRADVQEAMHAN  379

Query  1121  VTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAI  1300
             VT +   WD CS  V  +W+D P T+LP ++E M SG+ VW+YSGD DG+V VT+T Y+I
Sbjct  380   VTKLNHVWDLCSV-VLGDWKDSPSTILPLLQEFMSSGLRVWVYSGDTDGRVPVTSTQYSI  438

Query  1301  NKLNTSVKTPWYPW-YSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVE  1477
             NK+N   KTPWYPW       G   V   DL+F T+RGAGH VP+YQP RAL+    F+ 
Sbjct  439   NKMNLPTKTPWYPWALDGEVGGYAQVYKGDLTFATVRGAGHEVPAYQPARALSLIKNFLS  498

Query  1478  GKLPPKSA  1501
             G+  P++A
Sbjct  499   GQPLPQAA  506



>ref|XP_010067798.1| PREDICTED: serine carboxypeptidase-like 40 [Eucalyptus grandis]
 gb|KCW66000.1| hypothetical protein EUGRSUZ_G03290 [Eucalyptus grandis]
Length=496

 Score =   449 bits (1154),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 251/471 (53%), Positives = 325/471 (69%), Gaps = 7/471 (1%)
 Frame = +2

Query  92    GGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQPEG  271
             G ++ + L+SL + + +K   + +        ++    I  Q+GLK+ D+I  LPGQP  
Sbjct  27    GKKQGEVLDSLYRAKSKKSGIDTSLFQASVHPEILDSKIYHQEGLKEKDRIKMLPGQPP-  85

Query  272   VKFAQFSGYVTVDPQAGRALFYYFAESETPSD-KPLVLWLnggpgcssfgnggMMENGPF  448
             VKF  + GYVTVD  AGRA +YYF+E+E   +  PL+LWLNGGPGCSS   G M E+GPF
Sbjct  86    VKFDHYGGYVTVDELAGRAFYYYFSEAERNKELMPLLLWLNGGPGCSSLAYGAMQEHGPF  145

Query  449   RVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFLLN  625
             RV+SD KTL+ NK+ WN  ANV+FLESPAGVGFSYSN +SDY   GD KTAADNY+FLLN
Sbjct  146   RVHSDGKTLFRNKFGWNAAANVLFLESPAGVGFSYSNTTSDYNANGDSKTAADNYVFLLN  205

Query  626   WLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEET  805
             WLERFPEYK RD +I+GESYAGHYVPQLA  IL NNK  N+T+INLKGI IGNA I++ET
Sbjct  206   WLERFPEYKNRDFYISGESYAGHYVPQLAHNILSNNKKANKTLINLKGIIIGNAVINDET  265

Query  806   QDSGTYDFYWTHALISDETHRGIIANCNFS-SAASPSDTCDTFVDDADRSMGNIYSYNIY  982
               SG Y+++ THAL SDET   I   CNFS +  +  D C+  +++AD  + +I  YNIY
Sbjct  266   DQSGMYEYFATHALASDETWYAIQKYCNFSPNVTNQVDQCNAALNEADNDVSSIDIYNIY  325

Query  983   APFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQD  1162
             AP C   S L+S   + +   FDPC   Y+Y YLN  +VQ+ALHANVT +   W+ CS D
Sbjct  326   APLC-FSSNLTSLPKKANILNFDPCGDYYVYAYLNREDVQEALHANVTKLNHDWEPCS-D  383

Query  1163  VNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPW  1342
             V   W D P T++P ++E M +G+ VW++SGD DG+V VT+T  +++K++   K+ W PW
Sbjct  384   VIQQWGDSPSTIIPLLQEFMSNGLRVWVFSGDTDGRVPVTSTQRSLSKMSLPTKSKWRPW  443

Query  1343  YSKgevgg-yvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
             + KGEVGG   V   DL+F T+RGAGH VPSYQP+RAL+  S F+ G L P
Sbjct  444   FFKGEVGGYVQVYEGDLTFATVRGAGHMVPSYQPKRALSLISHFLAGSLLP  494



>ref|XP_009354385.1| PREDICTED: serine carboxypeptidase-like 40 [Pyrus x bretschneideri]
Length=502

 Score =   449 bits (1154),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 239/432 (55%), Positives = 307/432 (71%), Gaps = 7/432 (2%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK-PLVLWLn  391
             Q+GLK+ D+I  LPGQP  VKF+Q+ GYVTVD +AGRALFYY  E+E   D  PL+LWLN
Sbjct  70    QEGLKEKDRIDKLPGQPN-VKFSQYGGYVTVDKKAGRALFYYLVEAEKAKDSSPLLLWLN  128

Query  392   ggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSD  571
             GGPGCSS   G M+E GPFR++SD KTL+ N+++WN+ ANV+FLESPAGVGFSYSNR+SD
Sbjct  129   GGPGCSSLAYGAMLELGPFRIHSDGKTLYRNRFSWNHAANVLFLESPAGVGFSYSNRTSD  188

Query  572   Y-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQ  748
             Y  +GD+ TAADNY+FL+NWLERFPEYK R+ +I+GESYAGHYVPQLA  IL +NK  N+
Sbjct  189   YDASGDRNTAADNYVFLVNWLERFPEYKGREFYISGESYAGHYVPQLAHTILNHNKRANK  248

Query  749   TIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSS-AASPSDTCD  925
             TIINLKGI IGNA I++ET   GTYD+  THALISD+T   I   CNF++   +    C+
Sbjct  249   TIINLKGIIIGNAAINDETDSKGTYDYLATHALISDKTANNINKYCNFAANVTTQPKECN  308

Query  926   TFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQK  1105
                D AD+    +  +NIYAP C   + L++   + S   FDPCS  Y Y YLN P+VQ+
Sbjct  309   DATDAADKDTYYVDIFNIYAPLC-LSTNLTAKPKRTSIFEFDPCSEYYAYGYLNRPDVQQ  367

Query  1106  ALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTT  1285
             ALHANVT +   W+ CS D+  NW D   TVLP + E + +G+ VW++SGDIDG+V+VT+
Sbjct  368   ALHANVTKLSHDWEPCS-DIITNWGDSASTVLPLLHEFLDNGLRVWIFSGDIDGRVSVTS  426

Query  1286  TTYAINKLNTSVKTPWYPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFF  1462
             T Y+I+K+N +VKT W+ W+ S    G   V    L+F T+R AGH VPSYQP R L+  
Sbjct  427   TKYSIDKMNLAVKTEWHAWFLSGEVGGYTQVYEGGLTFATVREAGHQVPSYQPARGLSLI  486

Query  1463  SAFVEGKLPPKS  1498
               F++G   P +
Sbjct  487   KHFLDGTPLPDT  498



>gb|KEH40059.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=501

 Score =   449 bits (1154),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 258/460 (56%), Positives = 319/460 (69%), Gaps = 16/460 (3%)
 Frame = +2

Query  128   KTQKQKRQNNNAQTIIMSAQDLGSVYIGAQD-GLKDADKISALPGQPEGVKFAQFSGYVT  304
             K  +QK  +  + +  +  + +  V++  Q   L + DK+ ALPGQP+GV F Q++GYVT
Sbjct  51    KRSQQKPSHVESYSSTIVDEHVSKVHVVEQQLRLMEDDKVKALPGQPKGVDFDQYAGYVT  110

Query  305   VDPQAGRALFYYFAESE-TPSDKPLVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWL  481
             VD + GR LFYYF ES    S KPL+LWLNGGPGCSSFG G M E GPFRVNSD  TL L
Sbjct  111   VDSKGGRELFYYFVESSLNSSTKPLILWLNGGPGCSSFGYGAMQELGPFRVNSDGTTLSL  170

Query  482   NKYAWNNVANVIFLESPAGVGFSYSNRSSDYVT-GDKKTAADNYIFLLNWLERFPEYKTR  658
             NK AWN VAN+IFLESPAGVGFSYS  S DY   GD  TA D+YIFLLNWLERFP+YKTR
Sbjct  171   NKDAWNKVANIIFLESPAGVGFSYSKNSLDYSNIGDNSTAKDSYIFLLNWLERFPQYKTR  230

Query  659   DLFITGESYAGHYVPQLAQLILRNNK-ITNQTIINLKGIAIGNAYIDEETQDSGTYDFYW  835
             D FI GESY GHYVPQLA LIL NNK + N T INL+GIA+GN +ID+     G YD++W
Sbjct  231   DFFIAGESYGGHYVPQLAHLILSNNKKLKNHTRINLRGIAVGNGWIDDNLCTKGMYDYFW  290

Query  836   THALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFCssgsgls  1015
                L SDETH GI   C+F +  + ++ C+ +   A+  +GNI  YNIYAPFC+S +  +
Sbjct  291   MAGLNSDETHEGIDKLCDFGNF-NYTNECNLYQSRANDELGNIDIYNIYAPFCNSSATKT  349

Query  1016  sssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDT  1195
             S S       FDPCS DY   YLN P+VQ+ALH      P  W SCS   +++W D P +
Sbjct  350   SYSGSD----FDPCSEDYTNAYLNLPKVQEALHVK----PTKWSSCS---DLSWTDSPAS  398

Query  1196  VLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvv  1375
             +LPTI  L+ SGIS+W+YSGDIDG+V +T+T Y+IN L   V T W PWY+  EVGGYV+
Sbjct  399   ILPTINGLISSGISIWIYSGDIDGRVPITSTKYSINSLKLPVHTAWRPWYTGKEVGGYVI  458

Query  1376  gyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPK  1495
             GY+ L+ VT+RGAGH VPS QP RALT  S+F+ G+LPP+
Sbjct  459   GYKGLALVTVRGAGHMVPSDQPYRALTMISSFLLGQLPPQ  498



>ref|XP_002314061.1| hypothetical protein POPTR_0009s06080g [Populus trichocarpa]
 gb|EEE88016.1| hypothetical protein POPTR_0009s06080g [Populus trichocarpa]
Length=499

 Score =   449 bits (1154),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 246/474 (52%), Positives = 325/474 (69%), Gaps = 8/474 (2%)
 Frame = +2

Query  86    SIGGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQP  265
             + G R+ + L  L K +  K   +   ++  + Q + +    AQ+GLK+ D+I +LPGQP
Sbjct  24    AAGKRQSEALGHLYKAKYSKGNLSVDNSLFQAIQHVDTSRFHAQEGLKEKDRIESLPGQP  83

Query  266   EGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK--PLVLWLnggpgcssfgnggMMEN  439
             + V+F+Q+ GYVTVD   GRAL+YYFAE++  + +  PL+LWLNGGPGCSS   G M E 
Sbjct  84    K-VEFSQYGGYVTVDKSTGRALYYYFAEAQHSNKESLPLLLWLNGGPGCSSLSYGAMQEL  142

Query  440   GPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYV-TGDKKTAADNYIF  616
             GPFRV SD + L+ N+++WN  ANV+FLESPAGVGFSYSN +SDY  +GDK TA DNY+F
Sbjct  143   GPFRVYSDGQALYKNRHSWNYAANVLFLESPAGVGFSYSNTTSDYKKSGDKMTAEDNYVF  202

Query  617   LLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYID  796
             L+NWLERFPEYK RD +I+GESYAGHYVPQLA  IL +N    +TI+NLKGI IGNA I+
Sbjct  203   LVNWLERFPEYKDRDFYISGESYAGHYVPQLAHTILYHNNKAKKTIVNLKGILIGNAVIN  262

Query  797   EETQDSGTYDFYWTHALISDETHRGIIANCNFS-SAASPSDTCDTFVDDADRSMGNIYSY  973
             +ET   G Y ++  HALISDE  + I+ +C+FS +A S SD C+   + A +    I  Y
Sbjct  263   DETDSIGMYSYFGNHALISDEMVQKILKSCDFSPNATSQSDECNQAAEAAGKDTSYINIY  322

Query  974   NIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSC  1153
             NIY P C    G ++   + S   FDPCS  Y+Y YLN P+VQ+A+HANVT +   W+ C
Sbjct  323   NIYGPLC-LREGTTAKPKKPSLVDFDPCSDYYVYAYLNRPDVQEAMHANVTKLTHDWEPC  381

Query  1154  SQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPW  1333
             S D+  +W D P T++P ++E M +G+ VWL+SGD DG+V  T+T Y+INK+   VKT W
Sbjct  382   S-DIIPSWSDSPSTIIPLLQEFMANGLRVWLFSGDTDGRVPFTSTQYSINKMKLQVKTEW  440

Query  1334  YPWYSKgevgg-yvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
             +PWY KGEVGG   V   DL+F T+RGAGH VPSYQP RAL+    F++G   P
Sbjct  441   HPWYVKGEVGGYTQVYKGDLTFATVRGAGHQVPSYQPLRALSLVKHFLDGTPLP  494



>ref|XP_011091773.1| PREDICTED: serine carboxypeptidase-like 40 [Sesamum indicum]
Length=499

 Score =   448 bits (1153),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 240/437 (55%), Positives = 303/437 (69%), Gaps = 7/437 (2%)
 Frame = +2

Query  206   IGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK-PLVL  382
             + AQ G K++D+I  LPGQP  VKF Q+ GYVTVD +AGRA +YYF E++      PL+L
Sbjct  65    VHAQVGSKESDRIERLPGQPP-VKFKQYGGYVTVDRKAGRAFYYYFVEAQRSHKSLPLLL  123

Query  383   WLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNR  562
             WLNGGPGCSS   G M E GPFRV+SD KTL+ N++AWN  ANV+FLESPAGVGFSYSN 
Sbjct  124   WLNGGPGCSSLAYGAMQELGPFRVHSDGKTLYKNRFAWNYAANVLFLESPAGVGFSYSNT  183

Query  563   SSDY-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKI  739
             ++D+ + GD+KTA DNY+FLLNWL+RFPEYK RD +I+GESYAGHYVPQLA  IL +N  
Sbjct  184   TTDFEIGGDRKTAMDNYVFLLNWLKRFPEYKNRDFYISGESYAGHYVPQLAHTILYHNLK  243

Query  740   TNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPS-D  916
              N TIINLKGI IGNA ID+ET   G Y+++ THAL+SDET   I+  C+FS  A+   D
Sbjct  244   ANNTIINLKGIIIGNAVIDDETDVKGMYEYFGTHALVSDETTNRIMKYCDFSPNATQQLD  303

Query  917   TCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPE  1096
              C+   ++ADR +  I  YNIYAP C S S L+    + +    DPCS  Y+Y YLN PE
Sbjct  304   ECNEAANEADRCINAIDIYNIYAPLC-SNSSLTEKPKKANGVSLDPCSDSYVYAYLNRPE  362

Query  1097  VQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVA  1276
             VQ+ALHANVT IP  W  CS+ V   W D P T++P +KE M  G+ VW++SGDIDG++ 
Sbjct  363   VQEALHANVTKIPYAWQPCSE-VLKKWTDSPATIIPLLKEFMAHGLRVWIFSGDIDGRIP  421

Query  1277  VTTTTYAINKLNTSVKTPWYPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERAL  1453
             VT+T  +I K+   +KT W+PW+      G   V   +L+F T+RGAGH VPSYQP RAL
Sbjct  422   VTSTKQSIQKMKLPIKTSWHPWFLGGEVGGYTQVYEGNLTFATVRGAGHQVPSYQPARAL  481

Query  1454  TFFSAFVEGKLPPKSAE  1504
             +    F+ G   P S+ 
Sbjct  482   SLIMHFLAGTDLPDSSR  498



>ref|XP_004984183.1| PREDICTED: serine carboxypeptidase II-3-like isoform X1 [Setaria 
italica]
 ref|XP_004984184.1| PREDICTED: serine carboxypeptidase II-3-like isoform X2 [Setaria 
italica]
Length=526

 Score =   449 bits (1154),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 249/463 (54%), Positives = 310/463 (67%), Gaps = 36/463 (8%)
 Frame = +2

Query  200   VYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPL  376
             +Y+G QDGLK  DKIS LPGQP    F Q++GYVTVD  +G+ALFYYFAE+ E PS KPL
Sbjct  69    IYVGPQDGLKKVDKISELPGQPGKAVFDQYAGYVTVDATSGKALFYYFAEAAEEPSTKPL  128

Query  377   VLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNN------------------  502
             VLWLNGGPGCSS G   M+E GPF VN D+KTL  NKYAWNN                  
Sbjct  129   VLWLNGGPGCSSLGGA-MLEIGPFFVNRDNKTLSRNKYAWNNGRLIPTRLHMAVNTLNTS  187

Query  503   ---------VANVIFLESPAGVGFSYSNRSSDYV-TGDKKTAADNYIFLLNWLERFPEYK  652
                      VAN++FLESPAGVGFSYSNR+SDY  TGD+ T AD Y FL+NWLERFPEYK
Sbjct  188   VLTDHSWMTVANMLFLESPAGVGFSYSNRTSDYNNTGDRSTTADAYTFLINWLERFPEYK  247

Query  653   TRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDSGTYDFY  832
                 FITGESY GHY+PQLA  IL NNKI N T+INLKGIAIGNAY++++T    T D+Y
Sbjct  248   GHSFFITGESYGGHYIPQLANTILSNNKIMNITMINLKGIAIGNAYLNDDTNTRATIDYY  307

Query  833   WTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFCssgsgl  1012
             WTHA+IS ETH+ +  NC+F+   + +  C T ++ A+   G I   NIYA FC   S  
Sbjct  308   WTHAMISKETHKAVQENCSFN--GTYTGLCRTAIEAANNEKGLIDQSNIYASFCWDASAP  365

Query  1013  ssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVN-VNWEDMP  1189
                    ++   DPC+S Y+  YLN  EVQ+A HAN TG+  PW  CS  ++  NW+D  
Sbjct  366   RQHHASVTNT--DPCASYYMRSYLNRQEVQRAFHANTTGLKQPWLDCSHIISPENWKDAQ  423

Query  1190  DTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggy  1369
              ++LP+I++L+ SGI  WLYSGDID    VT+T Y+++ L   + +PW  WYS     G 
Sbjct  424   VSMLPSIQQLISSGIRTWLYSGDIDAVCPVTSTLYSLDILGLQINSPWRAWYSDDGEVGG  483

Query  1370  -vvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPK  1495
              VV Y+ L F T+RGAGH VP+YQP+RALT FS+F++GK+PP+
Sbjct  484   YVVEYKGLVFATVRGAGHMVPTYQPQRALTLFSSFLQGKMPPE  526



>ref|XP_011025504.1| PREDICTED: serine carboxypeptidase-like 40 isoform X1 [Populus 
euphratica]
Length=498

 Score =   447 bits (1151),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 246/471 (52%), Positives = 324/471 (69%), Gaps = 7/471 (1%)
 Frame = +2

Query  92    GGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQPEG  271
             G R+ + L  L K +      +   ++  + Q + +    AQ+GLK+ D+I +LPGQP+ 
Sbjct  26    GKRQSEALGHLYKAKYSMGNLSIDNSLFQAIQHVDTSRFHAQEGLKEKDRIESLPGQPK-  84

Query  272   VKFAQFSGYVTVDPQAGRALFYYFAESETPSDK-PLVLWLnggpgcssfgnggMMENGPF  448
             V+F+Q+ GYVTVD  AGRAL+YYFAE++   +  PL+LWLNGGPGCSS   G M E GPF
Sbjct  85    VEFSQYGGYVTVDESAGRALYYYFAEAQHSKESLPLLLWLNGGPGCSSLSYGAMQELGPF  144

Query  449   RVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYV-TGDKKTAADNYIFLLN  625
             RV SD + L+ N+++WN  ANV+FLESPAGVGFSYSN +SDY  +GDK TA DNY+FL+N
Sbjct  145   RVYSDGQALYKNRHSWNYAANVLFLESPAGVGFSYSNTTSDYKKSGDKMTAEDNYVFLVN  204

Query  626   WLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEET  805
             WLERFPEYK RD +I+GESYAGHYVPQLA  IL +N    +TI+NLKGI IGNA I++ET
Sbjct  205   WLERFPEYKDRDFYISGESYAGHYVPQLAHTILYHNNKAKKTIVNLKGILIGNAVINDET  264

Query  806   QDSGTYDFYWTHALISDETHRGIIANCNFS-SAASPSDTCDTFVDDADRSMGNIYSYNIY  982
                G Y ++  HALISDE  + I+ +C+FS +A S SD C+   + A +    I  YNIY
Sbjct  265   DSIGMYSYFGNHALISDEMVQKILKSCDFSPNATSQSDECNQAAEAAGKDTSYINIYNIY  324

Query  983   APFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQD  1162
              P C    G +++  + S   FDPCS  Y+Y YLN P+VQ+A+HANVT +   W+ CS D
Sbjct  325   GPLC-LREGTTANPKKPSLVDFDPCSDYYVYAYLNRPDVQEAIHANVTKLTHDWEPCS-D  382

Query  1163  VNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPW  1342
             +  +W D P T++P ++E M +G+ VWL+SGD DG+V  T+T Y+INK+   VKT W+PW
Sbjct  383   IIPSWSDSPSTIIPLLQEFMANGLRVWLFSGDTDGRVPFTSTQYSINKMKLQVKTEWHPW  442

Query  1343  YSKgevgg-yvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
             Y KGEVGG   V   DL+F T+RGAGH VPSYQP RAL+    F++G   P
Sbjct  443   YVKGEVGGYTQVYKGDLTFATVRGAGHQVPSYQPLRALSLVKHFLDGTPLP  493



>emb|CDP08507.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   441 bits (1135),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 231/364 (63%), Positives = 269/364 (74%), Gaps = 23/364 (6%)
 Frame = +2

Query  428   MMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVTGDKKTAADN  607
             M E  PFRV++  K LW N  A NNVANV+FLESPAGVGFS+SN SS+Y+ GD KTAAD+
Sbjct  1     MTELAPFRVSNGGKMLWENPCARNNVANVLFLESPAGVGFSHSNTSSNYIIGDTKTAADS  60

Query  608   YIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNA  787
             + FL+NWLERFPEYKTRD FITGE+YAG YVP+LAQLIL NNKITNQT+INLKG  IGN 
Sbjct  61    FTFLVNWLERFPEYKTRDFFITGENYAGRYVPRLAQLILHNNKITNQTVINLKGATIGNG  120

Query  788   YIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIY  967
               D ETQ+ GTYD+YWTHALISDE H+GI++NCNFSSA  PSD C T+   A   +G+I 
Sbjct  121   EYDIETQNRGTYDYYWTHALISDEIHQGIVSNCNFSSADPPSDACQTYKSQAHSDIGHID  180

Query  968   SYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWD  1147
             S NIYAP                   +DPCS +Y+Y YLNTP VQK+LHAN TGIPGPW 
Sbjct  181   SNNIYAPL----------------YEYDPCSDNYVYPYLNTPAVQKSLHANTTGIPGPWK  224

Query  1148  S---CSQDV----NVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINK  1306
             +      DV      NW+D  DTVLP IKE    GISVWLY+GDID   +VTTT YA+NK
Sbjct  225   NYKYICYDVFGYIGHNWDDEIDTVLPVIKEHPSGGISVWLYNGDIDSVCSVTTTRYALNK  284

Query  1307  LNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKL  1486
             L  S KTPW+ WY++GEVGGY V YE+L+FVT+RGAGH VPSYQP RALT FS+F+ GKL
Sbjct  285   LRLSAKTPWHAWYTQGEVGGYTVEYENLTFVTVRGAGHLVPSYQPARALTLFSSFLVGKL  344

Query  1487  PPKS  1498
             PP +
Sbjct  345   PPSN  348



>gb|AES71590.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=503

 Score =   446 bits (1148),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 266/478 (56%), Positives = 323/478 (68%), Gaps = 19/478 (4%)
 Frame = +2

Query  101   KFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGA-QDGLKDADKISALPGQPEGVK  277
             K D L    K+Q   +  +  +   +      + Y+ A Q+ L+ ADKI  LPGQP+GV 
Sbjct  30    KLDELFLSRKSQNPPKTLSWEEGEALKTLSSSAAYVAAPQEELRLADKIVTLPGQPDGVD  89

Query  278   FAQFSGYVTVDPQAGRALFYYFAESE-TPSDKPLVLWLnggpgcssfgnggMMENGPFRV  454
             F Q+SGYVTV+P+AGRALFYYF ES    S KPLVLWLNGGPGCSS G G   E GPFRV
Sbjct  90    FDQYSGYVTVEPEAGRALFYYFVESPYNSSTKPLVLWLNGGPGCSSLGYGAFEELGPFRV  149

Query  455   NSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYV-TGDKKTAADNYIFLLNWL  631
             NSD KTL+ N+YAW+ VAN++FLESPAGVGFSYSN +SDY   GDK TA D Y+FL+NWL
Sbjct  150   NSDGKTLYRNQYAWSEVANILFLESPAGVGFSYSNTTSDYKKAGDKSTAKDAYVFLINWL  209

Query  632   ERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQD  811
             ERFP+YKTRD +ITGESYAGHYVPQLA  IL ++K+ N+TIINLKGI+IGNA+ID+ T D
Sbjct  210   ERFPQYKTRDFYITGESYAGHYVPQLASTILHHHKLYNKTIINLKGISIGNAWIDDATGD  269

Query  812   SGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPF  991
              G +D++WTHAL SD+TH  I   C+F+   + S  C    D A    G I  YNIYAP 
Sbjct  270   KGLFDYFWTHALNSDQTHELIEKYCDFTK-QNYSTICINVTDWAFIEKGKIDFYNIYAPL  328

Query  992   CssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNV  1171
             C   S L + S    +  FDPCS +Y   YLN PEVQKALHA     P  W  C  D+  
Sbjct  329   C-HDSSLKNGSTGYVTNDFDPCSDNYGIAYLNRPEVQKALHAK----PTNWSHCG-DLIT  382

Query  1172  NWEDMPDTVLPTIKELMGSGISVWLY---------SGDIDGKVAVTTTTYAINKLNTSVK  1324
             +W D P T+LPTIK L+ S I +W+Y         +GD D +V VTT+ YAIN L   + 
Sbjct  383   HWNDSPITILPTIKYLIESNIKLWIYRQVQFHYCINGDTDARVPVTTSRYAINTLKLPIN  442

Query  1325  TPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
               W PWYS  E+GGYVVGY+ L+FVT+RGAGH VPS+QPERALT  S+F+ G L P S
Sbjct  443   ASWRPWYSGKEIGGYVVGYKGLTFVTVRGAGHLVPSWQPERALTMISSFLYGSLLPTS  500



>ref|XP_010938742.1| PREDICTED: serine carboxypeptidase II-3-like [Elaeis guineensis]
Length=489

 Score =   445 bits (1145),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 261/474 (55%), Positives = 317/474 (67%), Gaps = 13/474 (3%)
 Frame = +2

Query  92    GGRKFDPLESL-LKTQKQKRQN-NNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQP  265
               R+ D L  L     K KR    +A T   +A    S  +  Q GLK+ DKI  LPGQP
Sbjct  21    AARQGDALNKLYFDVFKLKRPAPASADTYATNALSDLSFKVYPQQGLKEGDKIGKLPGQP  80

Query  266   EGVKFAQFSGYVTVDPQAGRALFYYFAE--SETPSDKPLVLWLnggpgcssfgnggMMEN  439
             E + F Q+ GYVTVD +AGRALFYYFAE  S  PS KPLVLWLNGGPGCSS G G M E 
Sbjct  81    ERIDFDQYGGYVTVDAEAGRALFYYFAEAVSADPSSKPLVLWLNGGPGCSSLGYGAMEEL  140

Query  440   GPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIF  616
             GPFRV SD KTL+ N YAWN VANV+FLESPAGVGFSYSN +SDY  +GD++TA D Y+F
Sbjct  141   GPFRVMSDGKTLFRNPYAWNRVANVLFLESPAGVGFSYSNTTSDYDKSGDRRTAEDAYVF  200

Query  617   LLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYID  796
             L+NW+ERFPEYK RD FI GESYAGHYVPQLA  IL++    N T INLKGI IGN  I+
Sbjct  201   LVNWMERFPEYKGRDFFIAGESYAGHYVPQLAHTILQH----NDTNINLKGIMIGNGVIN  256

Query  797   EETQDSGTYDFYWTHALISDETHRGIIANCNFS-SAASPSDTCDTFVDDADRSMGNIYSY  973
             +ET + G YD++WTHALISDET   I   CNFS  A   +  C   VD  D+    +  Y
Sbjct  257   DETDNKGLYDYFWTHALISDETIDAIHKYCNFSPDATDQTKQCYQAVDVTDQVFEMLDIY  316

Query  974   NIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSC  1153
             NIYAP C S SG++ S  + S + FDPC+ DY+  YLNT EVQ+ALHANVT +   W  C
Sbjct  317   NIYAPLC-SSSGVTPSPKRYSIKNFDPCTYDYVAAYLNTAEVQEALHANVTKLNYTWSGC  375

Query  1154  SQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPW  1333
             S+     W D P TVLP IKE M + + VW+YSGD+DG+V VT++ Y++N+LN S+KT W
Sbjct  376   SRQF-AQWMDSPSTVLPLIKECMANDVRVWVYSGDVDGRVPVTSSRYSLNQLNLSIKTEW  434

Query  1334  YPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
              PW+ +    G  ++   +L+F T+RGAGH +PSYQ  RAL     F+ GK  P
Sbjct  435   QPWFINNEVGGYSIIYDGNLTFATVRGAGHEIPSYQALRALILVKFFLNGKPLP  488



>gb|KHN35601.1| Serine carboxypeptidase II-3 [Glycine soja]
Length=495

 Score =   445 bits (1145),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 262/441 (59%), Positives = 303/441 (69%), Gaps = 17/441 (4%)
 Frame = +2

Query  197   SVYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESE-TPSDKP  373
             S Y+ +Q+G K+ADKI ALPGQP GV F Q+SGYVTVDP+AGRALFYYF ES   PS KP
Sbjct  60    SAYVASQEGQKEADKIVALPGQPYGVNFDQYSGYVTVDPEAGRALFYYFVESSYNPSTKP  119

Query  374   LVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSY  553
             LVLWLNGGPGCSS G G   E GPFR+NSD KTL+ NKYAWN VANV+FLESPAGVGFSY
Sbjct  120   LVLWLNGGPGCSSLGYGAFEELGPFRINSDGKTLYRNKYAWNVVANVLFLESPAGVGFSY  179

Query  554   SNRSSDYV-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRN  730
             SN  SDY  +GDK TA D Y+FL+NWLERFPEYKTRD +ITGESYAGHYVPQLA  IL N
Sbjct  180   SNTISDYEHSGDKSTAKDAYVFLINWLERFPEYKTRDFYITGESYAGHYVPQLAYTILVN  239

Query  731   NKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASP  910
             NK + Q  INLKGIA+ NA+ID+ T   G YD+ WTHAL SD+TH  I   C+F+S  + 
Sbjct  240   NKFSQQN-INLKGIAVWNAWIDDVTSLKGIYDYIWTHALSSDQTHELIEKYCDFTS-ENV  297

Query  911   SDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNT  1090
             S  C      A    GNI  YNIYAP C        +   GS   FDPCS  Y   YLN 
Sbjct  298   SAICANATRTAFEENGNIDPYNIYAPLC--QDSSLKNGSTGSVYDFDPCSDYYGEAYLNR  355

Query  1091  PEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYS-----G  1255
             PEVQ ALHA     P  W  CS D+ +NW D P ++LP IK L+ S I +W+Y      G
Sbjct  356   PEVQLALHAK----PTNWTHCS-DI-INWNDSPASILPVIKYLIDSDIGLWIYRQVQFLG  409

Query  1256  DIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSY  1435
             D D  V VT++ Y+IN L   ++ PW PWYS  EVGGYVV Y  ++FVT+RGAGH VPS+
Sbjct  410   DTDSVVPVTSSRYSINTLKLPIQVPWRPWYSGNEVGGYVVKYNGVTFVTVRGAGHLVPSW  469

Query  1436  QPERALTFFSAFVEGKLPPKS  1498
             QP R LT   +F+ G LPP S
Sbjct  470   QPSRTLTLIFSFLHGSLPPTS  490



>ref|XP_003589243.1| Serine carboxypeptidase II-3 [Medicago truncatula]
Length=489

 Score =   444 bits (1143),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 257/461 (56%), Positives = 316/461 (69%), Gaps = 15/461 (3%)
 Frame = +2

Query  128   KTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKD--ADKISALPGQPEGVKFAQFSGYV  301
             +  +QK  +  A +  +  + +  V++  +  L+   A K+ +LPGQP+GV F Q++GY+
Sbjct  36    RRYQQKPSHVEAYSSTIVNEHVSKVHVNVEQHLRSRKAYKVKSLPGQPKGVNFDQYAGYI  95

Query  302   TVDPQAGRALFYYFAESET-PSDKPLVLWLnggpgcssfgnggMMENGPFRVNSDSKTLW  478
             TVD +A R LFYYF ES +  S KPLVLWLNGGPGCSS G G M E GPFRVNSD  TL 
Sbjct  96    TVDAKARRKLFYYFVESPSNSSTKPLVLWLNGGPGCSSLGYGAMQELGPFRVNSDGTTLS  155

Query  479   LNKYAWNNVANVIFLESPAGVGFSYSNRSSDYV-TGDKKTAADNYIFLLNWLERFPEYKT  655
             LNK AWN VANVIFLESPAGVGFSYSN S DY   GD +TA D+YIFLLNWLERFP+YKT
Sbjct  156   LNKDAWNVVANVIFLESPAGVGFSYSNNSLDYSNVGDNRTAIDSYIFLLNWLERFPQYKT  215

Query  656   RDLFITGESYAGHYVPQLAQLIL-RNNKITNQTIINLKGIAIGNAYIDEETQDSGTYDFY  832
             RD FI GESYAGHYVPQLA LIL +N K  N  +INLKGI +GN  ID++    G YD+Y
Sbjct  216   RDFFIAGESYAGHYVPQLAHLILSKNKKRKNHNVINLKGI-VGNGLIDDKLSTKGMYDYY  274

Query  833   WTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFCssgsgl  1012
             WTHALISDETH GI  NC      +    C  +   AD  + +I  YNIYAP C+S +  
Sbjct  275   WTHALISDETHAGIEKNCGDFRNVTNLRECFLYEFKADDELVDIDVYNIYAPVCNSSATK  334

Query  1013  ssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPD  1192
             + +S   S+   DPC+ DY   YLN PEVQKALH      P  W  CS    V W D P 
Sbjct  335   NGASYFVSN--IDPCAEDYTAAYLNLPEVQKALHVK----PIKWSHCS---GVGWTDSPT  385

Query  1193  TVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggyv  1372
             ++LPTI +L+ SGIS+W+YSGD+DG+V +T+T Y+IN L   V T W PWY+  EVGGYV
Sbjct  386   SILPTINQLISSGISIWIYSGDLDGRVPITSTKYSINSLKLPVHTAWRPWYTGKEVGGYV  445

Query  1373  vgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPK  1495
             +GY+ L+ VT+RGAGH VP+ QP RALT  S+F+ G+LPP+
Sbjct  446   IGYKGLTLVTVRGAGHMVPTDQPYRALTMISSFLLGQLPPQ  486



>ref|XP_010103278.1| Serine carboxypeptidase-like 40 [Morus notabilis]
 gb|EXB95303.1| Serine carboxypeptidase-like 40 [Morus notabilis]
Length=505

 Score =   445 bits (1144),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 246/436 (56%), Positives = 303/436 (69%), Gaps = 7/436 (2%)
 Frame = +2

Query  209   GAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK-PLVLW  385
             G  +GLK+ D+   LPGQP  V F Q+ GYVTVD  AGR+L+YYFAE+    D  PL+LW
Sbjct  73    GIHEGLKERDRTGRLPGQPR-VNFTQYGGYVTVDKTAGRSLYYYFAEAHYHQDSLPLLLW  131

Query  386   LnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRS  565
             LNGGPGCSS   G M E GPFRV SD KTL+ NKY+WN  ANV+FLESPAGVGFSYSNRS
Sbjct  132   LNGGPGCSSLAYGAMQELGPFRVYSDGKTLYTNKYSWNYAANVLFLESPAGVGFSYSNRS  191

Query  566   SDYV-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKIT  742
             SDY  +GDKKTA DNY FL+NWL+RFPEYK RD +I+GESYAGHYVPQLA  IL +NK  
Sbjct  192   SDYADSGDKKTAEDNYRFLVNWLKRFPEYKGRDFYISGESYAGHYVPQLAHTILHHNKRA  251

Query  743   NQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFS-SAASPSDT  919
             N+TIINLKGI IGNA I++ET + G YD+   HALISD     I ++C+FS +A   S  
Sbjct  252   NKTIINLKGILIGNAVINDETDEKGMYDYLANHALISDHAANIIQSHCDFSPNATKQSPA  311

Query  920   CDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEV  1099
             C   VD+A++ +  I  YNIYAP C + S L++   + S R FDPCS  Y+  YLN  +V
Sbjct  312   CSDAVDEANKDLYYIDIYNIYAPSC-ASSNLTAKPKKASLRNFDPCSDYYVLAYLNREDV  370

Query  1100  QKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAV  1279
             Q ALHANVT +P  W+ CS DV   W D P T++P ++E M  G+ VW++SGDIDG+V V
Sbjct  371   QAALHANVTKLPYDWEPCS-DVLKKWNDSPSTIIPLLREFMAKGLRVWIFSGDIDGRVPV  429

Query  1280  TTTTYAINKLNTSVKTPWYPW-YSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALT  1456
             T+T Y+I K+N  VKT W+PW +     G   V   DL+F TIR AGH VPSYQP RAL+
Sbjct  430   TSTKYSIAKMNLPVKTEWHPWFFGGEVGGFTEVYKGDLTFATIREAGHQVPSYQPARALS  489

Query  1457  FFSAFVEGKLPPKSAE  1504
                 F++G   P + +
Sbjct  490   LVKHFLDGTPLPDTTK  505



>ref|XP_004303115.1| PREDICTED: serine carboxypeptidase-like 40-like [Fragaria vesca 
subsp. vesca]
Length=505

 Score =   444 bits (1143),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 239/437 (55%), Positives = 308/437 (70%), Gaps = 10/437 (2%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK---PLVLW  385
             Q+GLK+ D+I++LPGQP+ V F Q+ GYVTVD +AGRA FYYFAE+E    K   PL+LW
Sbjct  70    QEGLKEKDRITSLPGQPK-VNFNQYGGYVTVDKKAGRAFFYYFAEAEDQQAKDSLPLLLW  128

Query  386   LnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRS  565
             LNGGPGCSS   G M+E GPFR++SD KTL+ N+++WN  ANV+FLESPAGVGFSYSN +
Sbjct  129   LNGGPGCSSLAYGAMLELGPFRIHSDGKTLYRNRFSWNYAANVLFLESPAGVGFSYSNTT  188

Query  566   SDY-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKIT  742
             SDY  +GD++TAADNY+FL+NWLERFPEYK R+ +I+GESYAGHYVPQLAQ IL +NK  
Sbjct  189   SDYDKSGDRRTAADNYVFLVNWLERFPEYKGREFYISGESYAGHYVPQLAQTILHHNKKA  248

Query  743   NQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDT-  919
             N+TIINLKGI IGNA I++ET   G YD+  THALISDE    +   C+FS  ++  +T 
Sbjct  249   NKTIINLKGIIIGNAVINDETDTKGMYDYLATHALISDEIANQVHKYCDFSPNSTTDETK  308

Query  920   -CDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPE  1096
              C   +D  DR+   I  YNIYAP C + S L+    + S   FDPCS +Y Y YLN P+
Sbjct  309   ECGDAMDAIDRATYYIDIYNIYAPLC-TSSNLTVKPKKASILKFDPCSENYAYAYLNRPD  367

Query  1097  VQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVA  1276
             VQ+ALHANVT +   W+ CS DV  +W D   T+LP + E M +G+ VW++SGD DG+V 
Sbjct  368   VQEALHANVTKLSHDWEPCS-DVITHWGDSSTTILPLLHEFMDNGLRVWIFSGDTDGRVP  426

Query  1277  VTTTTYAINKLNTSVKTPWYPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERAL  1453
             VT+T Y++ K+N  +KT W+ W+ S    G   V   D++F T+R AGH VPSYQP RAL
Sbjct  427   VTSTKYSLEKMNLPIKTAWHAWFLSGQVGGYTQVYEGDITFATVREAGHQVPSYQPARAL  486

Query  1454  TFFSAFVEGKLPPKSAE  1504
             +    F++G   P +  
Sbjct  487   SLIKHFLDGTPLPDTTR  503



>gb|KDP43605.1| hypothetical protein JCGZ_16892 [Jatropha curcas]
Length=498

 Score =   444 bits (1143),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 240/432 (56%), Positives = 302/432 (70%), Gaps = 7/432 (2%)
 Frame = +2

Query  221   GLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK-PLVLWLngg  397
             G K+ D+I  LPGQP  V+F+Q+ GYVTVD  AGRA +YYF E++   D  PL+LWLNGG
Sbjct  69    GSKENDRIVRLPGQPN-VRFSQYGGYVTVDKSAGRAFYYYFVEAQHSKDSLPLLLWLNGG  127

Query  398   pgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-  574
             PGCSS   G M E GPFRV+SD KTL+ N+Y+WN  ANV+FLESPAGVGFSYSNR+SDY 
Sbjct  128   PGCSSLAYGAMQELGPFRVHSDGKTLYKNRYSWNYAANVLFLESPAGVGFSYSNRTSDYD  187

Query  575   VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTI  754
               GDKKTA DNYIFL+NWL+RFPEYK RD +I+GESYAGHYVPQLA  IL NNK   +TI
Sbjct  188   NNGDKKTAEDNYIFLVNWLKRFPEYKDRDFYISGESYAGHYVPQLAHTILYNNKKAKKTI  247

Query  755   INLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFS-SAASPSDTCDTF  931
             INLKGI IGNA I++ET + G YD++  HAL+S++    I  +C+FS +A + S TC + 
Sbjct  248   INLKGILIGNAVINDETDNIGMYDYFAGHALVSNDAVNNIKKHCDFSPNATTQSATCISA  307

Query  932   VDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKAL  1111
              +  +R + ++  YNIYAP C      ++     S   FDPCS  Y+Y YLNTPEVQ+A+
Sbjct  308   NNQIERDISHLDIYNIYAPLC-FSPTTTAKPKIASLENFDPCSDYYVYAYLNTPEVQEAM  366

Query  1112  HANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTT  1291
             HANVT +   W+ CS DV   W D   TVLP ++E M +G+ VW+YSGD DG+V  T+T 
Sbjct  367   HANVTKLKHDWEPCS-DVISQWLDSSATVLPLLQEFMANGLRVWIYSGDTDGRVPFTSTI  425

Query  1292  YAINKLNTSVKTPWYPWYSK-gevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSA  1468
             Y+I+KLN  +KT W+PWY K    G   V   DL+F T+RGAGH VPS+QP RAL+    
Sbjct  426   YSIDKLNLPIKTEWHPWYLKGEVGGYTQVYKGDLTFATVRGAGHEVPSFQPLRALSLIKH  485

Query  1469  FVEGKLPPKSAE  1504
             FV+G   P +  
Sbjct  486   FVDGTPLPDTKR  497



>gb|KHG12237.1| Serine carboxypeptidase-like 40 [Gossypium arboreum]
Length=502

 Score =   444 bits (1142),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 237/440 (54%), Positives = 302/440 (69%), Gaps = 10/440 (2%)
 Frame = +2

Query  206   IGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK-PLVL  382
             I  Q+ +K+ D+I  LPGQP  V+F+Q+ GYVTVD +AGRAL+YYF E+    +  PL+L
Sbjct  64    IHGQEEMKEKDRIPKLPGQPH-VRFSQYGGYVTVDKKAGRALYYYFVEAHHSKESLPLLL  122

Query  383   WLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNR  562
             WLNGGPGCSS   G M E GPFRV+S+ KT++ N+Y+WN+ ANV+FLESPAGVGFSYSN 
Sbjct  123   WLNGGPGCSSLAYGAMEEIGPFRVHSNGKTVYRNRYSWNHAANVLFLESPAGVGFSYSNT  182

Query  563   SSDY-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKI  739
             +SDY  +GD KTA DNY+FL+NWLERFPEYK RD +I+GESYAGHYVPQLA  IL +NK 
Sbjct  183   TSDYDKSGDSKTAVDNYVFLINWLERFPEYKERDFYISGESYAGHYVPQLAHTILLHNKK  242

Query  740   TNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSA----AS  907
              N T+INLKGI IGNA I++ET   G YDF+ +HALISDET   I   CN  S     A 
Sbjct  243   ANTTLINLKGIIIGNAVINDETDVKGMYDFFKSHALISDETAYRISKYCNLESENNMDAE  302

Query  908   PSDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLN  1087
              S  C    D+ +R   NI  YNIYAP C   S L     + S   FDPCS +Y+Y YLN
Sbjct  303   SSTECKAATDEVNRDTYNIDIYNIYAPLC-HDSSLRVQPKEPSVVNFDPCSDNYVYAYLN  361

Query  1088  TPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDG  1267
               +VQ+A+HANVT +   W+ CS ++   W D P TV+P ++ELM + + VW++SGDIDG
Sbjct  362   RADVQEAIHANVTKLDHGWEPCS-NIITTWGDSPSTVIPLLRELMANRLRVWIFSGDIDG  420

Query  1268  KVAVTTTTYAINKLNTSVKTPWYPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPE  1444
             ++ VT+T Y+I K+N  +KT W+PWY      G   V   DL+  T+RGAGH VPSYQP+
Sbjct  421   RIPVTSTKYSIQKMNLPIKTKWHPWYLDGEVGGYTQVYKGDLTLATVRGAGHQVPSYQPK  480

Query  1445  RALTFFSAFVEGKLPPKSAE  1504
             RAL+    F+ G   P ++ 
Sbjct  481   RALSLIKHFLAGTPLPDTSR  500



>ref|XP_010938507.1| PREDICTED: serine carboxypeptidase II-3-like isoform X1 [Elaeis 
guineensis]
Length=492

 Score =   443 bits (1140),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 248/431 (58%), Positives = 305/431 (71%), Gaps = 12/431 (3%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAE--SETPSDKPLVLWL  388
             Q GLK++DKIS LPGQPEG+ F Q+ GYVTVD +AGRALFYYF E  S+ PS KPLVLWL
Sbjct  68    QKGLKESDKISKLPGQPEGIDFDQYGGYVTVDAEAGRALFYYFTEAVSDDPSSKPLVLWL  127

Query  389   nggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSS  568
             NGGPGCSS G G M E GPFRV SD KTL+ N YAWN VANV+FLESPAGVGFSYSN +S
Sbjct  128   NGGPGCSSLGYGAMEELGPFRVMSDGKTLFRNPYAWNTVANVLFLESPAGVGFSYSNTTS  187

Query  569   DY-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITN  745
             DY   GD +TA D+Y+FL+NW++RFPEYK RD FI GESYAGHYVPQLA  IL++    N
Sbjct  188   DYGENGDSRTAEDSYVFLVNWMDRFPEYKGRDFFIAGESYAGHYVPQLAHTILQH----N  243

Query  746   QTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFS-SAASPSDTC  922
              T INLKGI IGN  I++ET + G  D+ WTHALISDET   I   CNFS  A++ ++ C
Sbjct  244   NTHINLKGIMIGNGAINDETDNKGLCDYLWTHALISDETIDAIHKYCNFSPDASNQTNQC  303

Query  923   DTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQ  1102
                V   ++    +  YNIYAP C   SG++ S  + S   FDPCS  Y+  YLN+ +VQ
Sbjct  304   YQAVGVVNQVFDTLDIYNIYAPLC-FSSGVTPSPKRYSIENFDPCSDYYVSAYLNSAQVQ  362

Query  1103  KALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVT  1282
             +ALHANVT +   W +C Q     W D P TVLP IKE M + + VW+YSGD+DG++ VT
Sbjct  363   EALHANVTKLNYTWSACRQ--FAQWTDSPSTVLPLIKECMANDVRVWVYSGDVDGRIPVT  420

Query  1283  TTTYAINKLNTSVKTPWYPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTF  1459
             ++ Y++N+LN SVKT W PW+ +K   G  ++   +L+FVT+RGAGH VPSYQ  RAL  
Sbjct  421   SSRYSLNQLNLSVKTKWQPWFVNKEVGGYSIIYDGNLTFVTVRGAGHEVPSYQALRALVL  480

Query  1460  FSAFVEGKLPP  1492
                F++GKL P
Sbjct  481   IKFFLDGKLLP  491



>ref|XP_008363303.1| PREDICTED: serine carboxypeptidase-like 40 [Malus domestica]
Length=502

 Score =   443 bits (1140),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 237/434 (55%), Positives = 306/434 (71%), Gaps = 7/434 (2%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK-PLVLWLn  391
             Q+GLK+ D+I  LPGQP+ VKF+Q+ GYVTVD +AGRALFYY  E+E   D  PL+LWLN
Sbjct  70    QEGLKEKDRIDKLPGQPK-VKFSQYGGYVTVDKKAGRALFYYLVEAEKAKDSSPLLLWLN  128

Query  392   ggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSD  571
             GGPGCSS   G M+E GPFR++SD KTL+ N+++WN  ANV+FLESPAGVGFSYSNR+SD
Sbjct  129   GGPGCSSLAYGAMLELGPFRIHSDGKTLYRNRFSWNYAANVLFLESPAGVGFSYSNRTSD  188

Query  572   Y-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQ  748
             Y  +GD+ TAADNY+FL+NWLERFPEYK R+ +I+GESYAGHYVPQLA  IL +NK  N+
Sbjct  189   YDASGDRNTAADNYVFLVNWLERFPEYKGREFYISGESYAGHYVPQLAHTILNHNKRANK  248

Query  749   TIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSS-AASPSDTCD  925
             TIINLKGI IGNA I++ET   G YD+  +HALISD+T   I   CNF++ A +    C+
Sbjct  249   TIINLKGIIIGNAVINDETDSKGMYDYLASHALISDKTANNINKYCNFAANATTQPKECN  308

Query  926   TFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQK  1105
                D A++    +  YNIYAP C   + L++   + S   FDPCS  Y Y YLN P+VQ+
Sbjct  309   DATDAANKDTYYVDIYNIYAPLC-LSTNLTAKPKRTSIFEFDPCSEYYAYGYLNRPDVQQ  367

Query  1106  ALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTT  1285
             ALHANVT +   W+ CS D+  +W D   TVLP + E + +G+ VW++SGDIDG+V VT+
Sbjct  368   ALHANVTKLSHDWEPCS-DIITHWGDSASTVLPLLHEFLDNGLRVWIFSGDIDGRVPVTS  426

Query  1286  TTYAINKLNTSVKTPWYPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFF  1462
             T Y+I+K+N +VKT W+ W+ S    G   V    L+F T+R AGH VPSYQP R L+  
Sbjct  427   TKYSIDKMNLAVKTEWHAWFLSGEVGGYTQVYEGGLTFATVREAGHQVPSYQPARGLSLI  486

Query  1463  SAFVEGKLPPKSAE  1504
               F++G   P +  
Sbjct  487   KHFLDGTPLPDTTR  500



>ref|XP_008393840.1| PREDICTED: serine carboxypeptidase II-3-like [Malus domestica]
Length=474

 Score =   442 bits (1137),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 250/468 (53%), Positives = 319/468 (68%), Gaps = 18/468 (4%)
 Frame = +2

Query  113   LESLLKTQKQKR--QNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQPEGVKFAQ  286
             L  L+K++K      + +   + ++      VY+G+Q+GL +ADKI ALPGQPEGV F  
Sbjct  4     LNKLIKSRKSGNPLHSKSWDRLDVAPDHYSPVYVGSQEGLMEADKIDALPGQPEGVNFNH  63

Query  287   FSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMEN-GPFRVNS  460
             ++GYVTVDP+AGR  FYYF ES +  S  PLV+ L+GGPG  S    G +E  GPFRV+S
Sbjct  64    YAGYVTVDPKAGRESFYYFVESPQNSSTNPLVVSLHGGPGGCSPFGYGALEELGPFRVSS  123

Query  461   DSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVT-GDKKTAADNYIFLLNWLER  637
             D+KTL  N YAWNNVANV+FLE+P G GFSYSN SSDY T GD+ TA DNY+FL+NWLER
Sbjct  124   DNKTLISNDYAWNNVANVLFLETPLGTGFSYSNTSSDYETVGDQSTAEDNYVFLVNWLER  183

Query  638   FPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDSG  817
             FP+YKTRDLFITGES AGHY PQLA  IL NN +TNQT INLKGIAIGN YID+ T    
Sbjct  184   FPQYKTRDLFITGESSAGHYAPQLAYTILSNNNVTNQTKINLKGIAIGNPYIDDNTALLA  243

Query  818   TYDFYWTHALISDETHRGIIANCNFSSAA-SPSDTCDTFVDDADRSMG-NIYSYNIYAPF  991
              +D  WTHA  SDET+ GI   CN ++   +PS+ C  +V  A   +G +I   NIYAP 
Sbjct  244   IFDNLWTHAFNSDETNAGIHKYCNLTNLGDNPSEECRXYVSQAXMELGEDIDIANIYAPV  303

Query  992   Cssg---sglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQD  1162
             C++    S   S+S    +  FDPCS +Y+  YLN  EVQ ALHA     P  W +CS  
Sbjct  304   CTTSEDDSEPKSASTGSVAADFDPCSDNYVEAYLNLAEVQSALHAR----PTKWTACS--  357

Query  1163  VNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPW  1342
              + +W D P T+LPTI++L+ SGIS+W+YSGD DG  +VT++ YA++ LN  ++TPW PW
Sbjct  358   -DTDWTDSPTTMLPTIQQLIESGISLWIYSGDTDGYXSVTSSRYALHILNLPIQTPWRPW  416

Query  1343  YSKgevggyvvgyeD-LSFVTIRGAGHFVPSYQPERALTFFSAFVEGK  1483
             +S  E  G  V   + L+F T+RGAG  VP+YQPERALT  S+F++G+
Sbjct  417   HSSTEEVGGYVVGYEGLTFATVRGAGLMVPTYQPERALTLISSFLQGQ  464



>ref|XP_003599510.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES69761.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=497

 Score =   442 bits (1138),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 238/432 (55%), Positives = 303/432 (70%), Gaps = 7/432 (2%)
 Frame = +2

Query  206   IGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK-PLVL  382
             + +QDG+K+ DKI  LPGQP  VKF+Q+ GYVT+D  AG A +YYF E+    +  PL+L
Sbjct  63    VHSQDGMKEKDKIEKLPGQPN-VKFSQYGGYVTIDKIAGSAFYYYFVEAHHSKETLPLLL  121

Query  383   WLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNR  562
             WLNGGPGCSS   G M E GPFRVNSD KTL+ N Y+WN  ANV+FLESPAGVGFSYSN+
Sbjct  122   WLNGGPGCSSLAYGAMQEVGPFRVNSDGKTLYKNNYSWNYAANVLFLESPAGVGFSYSNK  181

Query  563   SSDYVT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKI  739
             SSDY T GD++TAADNYIFL+NWLERFPEYK RD +I GESYAGHYVPQLA  IL +NK 
Sbjct  182   SSDYDTSGDRRTAADNYIFLMNWLERFPEYKNRDFYIAGESYAGHYVPQLAHNILHHNKK  241

Query  740   TNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDT  919
              N+TIINLKGI IGNA I+++T + G YDF  THA+ISD+T   I   CNFSS ++ +  
Sbjct  242   ANRTIINLKGIMIGNAVINDDTDEQGMYDFLATHAIISDQTAYNIKKFCNFSSTSNQTTE  301

Query  920   CDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEV  1099
             C     + D++   +  YNIYAP C   +   ++  +  S   DPCS DYI  Y N  +V
Sbjct  302   CSDAASEVDKNTLFLDIYNIYAPVC--TNHSLTNRPKKVSDVLDPCSDDYIQAYFNRGDV  359

Query  1100  QKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAV  1279
             Q+ALHANVT +   W++CS  ++ NW D P T++P + EL+ +G+ VW++SGDIDG+V V
Sbjct  360   QEALHANVTKLEHDWEACSTIIS-NWGDSPTTIIPLLHELLNNGLRVWIFSGDIDGRVPV  418

Query  1280  TTTTYAINKLNTSVKTPWYPWYSKgevgg-yvvgyeDLSFVTIRGAGHFVPSYQPERALT  1456
             T T Y++ K+   ++T WYPW+ KGE+GG   V    L+F T+R AGH VPSYQP RAL+
Sbjct  419   TGTKYSLKKMKLPIETTWYPWFIKGEIGGYAEVYKGGLTFATVREAGHQVPSYQPARALS  478

Query  1457  FFSAFVEGKLPP  1492
                 F+ G   P
Sbjct  479   LIMHFLNGTPLP  490



>gb|KHN30516.1| Serine carboxypeptidase-like 40 [Glycine soja]
Length=496

 Score =   442 bits (1137),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 257/444 (58%), Positives = 308/444 (69%), Gaps = 21/444 (5%)
 Frame = +2

Query  197   SVYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKP  373
             + Y+  Q+GL+ ADKI  LPGQP GV F Q+SG+VTVDP+ GR+LFYYF ES    S KP
Sbjct  59    AAYVAPQEGLRQADKIVTLPGQPHGVNFDQYSGHVTVDPKTGRSLFYYFVESPHNSSAKP  118

Query  374   LVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSY  553
             LVLWLNGGPGCSS G G   E GPFRVNSD KTL+ NKYAWN VANV+FLESPAGVGFSY
Sbjct  119   LVLWLNGGPGCSSLGYGAFEELGPFRVNSDGKTLFHNKYAWNEVANVLFLESPAGVGFSY  178

Query  554   SNRSSDY-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRN  730
             SN +SDY  +GDK TA D Y+FL+NWLERFPEYKTR  +ITGESYAGHYVPQLA  IL N
Sbjct  179   SNTTSDYDRSGDKSTAKDAYVFLINWLERFPEYKTRKFYITGESYAGHYVPQLAYTILVN  238

Query  731   NKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASP  910
             NK + Q+ INLKGIAIGNA ID+ T   G +D++WTHAL SD+TH  I   C+F+S  + 
Sbjct  239   NKFSQQS-INLKGIAIGNALIDDVTTIKGIFDYFWTHALNSDQTHHLIKKYCDFTS-ENI  296

Query  911   SDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNT  1090
             S  C      +    G+I S NIYAP C        +   GS   FDPCS+ Y+  YLN 
Sbjct  297   SAACINATISSILEKGSIDSSNIYAPLC--YDSSLKNGSTGSVYDFDPCSAYYVEAYLNR  354

Query  1091  PEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLY-------  1249
             PEVQKALHA     P  W  CS     +W+D P T+LP I+ L+ S I +W+Y       
Sbjct  355   PEVQKALHAK----PTNWTHCS---GFDWKDSPTTILPIIEYLIASHIKLWIYRQANFNY  407

Query  1250  -SGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFV  1426
              SGD D  V VT++ Y+IN L   ++  W+PWYS  EVGGYVVGY+ ++FVT+RGAGHFV
Sbjct  408   VSGDTDATVPVTSSRYSINTLRLPIQVDWHPWYSGNEVGGYVVGYKAVTFVTVRGAGHFV  467

Query  1427  PSYQPERALTFFSAFVEGKLPPKS  1498
             PS+QP R+LT  S+F+ G LPP S
Sbjct  468   PSWQPARSLTMISSFLSGTLPPAS  491



>ref|XP_010068957.1| PREDICTED: serine carboxypeptidase-like 40 [Eucalyptus grandis]
Length=585

 Score =   445 bits (1145),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 244/474 (51%), Positives = 320/474 (68%), Gaps = 7/474 (1%)
 Frame = +2

Query  89    IGGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQPE  268
             +G ++ D L+SL K +    + + +   + +  +  +  I  Q+GLK+ D+I  LPGQP 
Sbjct  114   LGKKQGDALDSLYKAKYDNSRIDMSPFQVSNHDENFNFRIYHQEGLKEKDRIKRLPGQPP  173

Query  269   GVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK-PLVLWLnggpgcssfgnggMMENGP  445
              VKF  + GYVTVD  A RA +YYFAE+    D  PL+LWLNGGPGCSS   G M E GP
Sbjct  174   -VKFDHYGGYVTVDESASRAFYYYFAEAGQNKDSMPLLLWLNGGPGCSSLNYGAMQELGP  232

Query  446   FRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFLL  622
             FRV+SD KTL+ NK+AWN  ANV+FLESPAGVGFSYSN++SDY  +GD KTA DNY+FLL
Sbjct  233   FRVHSDGKTLYRNKFAWNIAANVLFLESPAGVGFSYSNKTSDYSASGDSKTATDNYVFLL  292

Query  623   NWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEE  802
             NWLERFPEYK RD +I GESYAGHYVPQLA  IL NNK  N+T+INLKGI IGNA I++E
Sbjct  293   NWLERFPEYKNRDFYIAGESYAGHYVPQLAHNILYNNKKANKTLINLKGIIIGNAVINDE  352

Query  803   TQDSGTYDFYWTHALISDETHRGIIANCNFSSAASP-SDTCDTFVDDADRSMGNIYSYNI  979
             T + G Y++Y THALISDET   I   CNF+   +  +  C + +  AD  +  I +YNI
Sbjct  353   TDNKGMYEYYATHALISDETWYAIQKYCNFAPTGTDLASQCTSALIKADDDVSPIDNYNI  412

Query  980   YAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQ  1159
             YAP C   S L+S   + +   FDPC   Y++ YLN  +VQ+ALHANV  +   W SC+ 
Sbjct  413   YAPLC-FSSNLTSHPKKTNIMNFDPCGGHYVHAYLNREDVQEALHANVAKLHHEWQSCND  471

Query  1160  DVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYP  1339
             D+  NW D P T++P ++E+M +G+ +W+YSGD D  V VT+T  +++K++   K+PW P
Sbjct  472   DIQKNWRDSPSTIIPLLQEVMSTGLRLWVYSGDTDAVVPVTSTQRSLSKMSLRTKSPWSP  531

Query  1340  WY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEG-KLPPK  1495
             W+      G   V   +L+F T+RGAGH VPSYQP+RAL+  S F+ G +LP K
Sbjct  532   WFLGGEVGGYVQVYEGELTFATVRGAGHQVPSYQPKRALSLISHFLAGSRLPFK  585



>ref|XP_009367487.1| PREDICTED: serine carboxypeptidase II-3-like [Pyrus x bretschneideri]
Length=499

 Score =   442 bits (1136),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 246/435 (57%), Positives = 305/435 (70%), Gaps = 16/435 (4%)
 Frame = +2

Query  200   VYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPL  376
             VY+G+Q+GL +ADKI ALPGQPEGV F  ++GYVTVDP+AGR LFYYF ES +  S  PL
Sbjct  35    VYVGSQEGLMEADKIDALPGQPEGVNFNHYAGYVTVDPKAGRELFYYFVESPQNSSTNPL  94

Query  377   VLWLnggpgcssfgnggMMEN-GPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSY  553
             V+ L+GGPG  S    G +E  GPFRV+SD+KTL  N YAWNNVANV+FLE+P G GFSY
Sbjct  95    VVSLHGGPGGCSPFGYGALEELGPFRVSSDNKTLISNDYAWNNVANVLFLETPLGTGFSY  154

Query  554   SNRSSDYVT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRN  730
             SN SSDY T GD+ TA DNY+FL+NWLERFP+YKTRDLFITGES AGHY PQLA  IL N
Sbjct  155   SNTSSDYKTVGDQSTAEDNYVFLVNWLERFPQYKTRDLFITGESDAGHYAPQLAYTILSN  214

Query  731   NKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAA-S  907
             N +TNQT INLKGIAIGN YID+ T     +D  WTHAL SDET+ GI   CN ++   +
Sbjct  215   NNVTNQTQINLKGIAIGNPYIDDNTALLAIFDNLWTHALNSDETNAGIHKYCNLTNLGDN  274

Query  908   PSDTCDTFVDDADRSMGN-IYSYNIYAPFCssg---sglssssvqgssrgFDPCSSDYIY  1075
             PS+ C  ++  A   +G  I   NIYAP C +    S   S+S    +  FDPCS +Y+ 
Sbjct  275   PSEECSKYLSQASMELGEYIDIANIYAPVCPTSEDDSEPKSASTGSVAADFDPCSDNYVE  334

Query  1076  VYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSG  1255
              YLN  EVQ ALHA     P  W +CS   + +W D P T+LPTI++L+ SGIS+W+YSG
Sbjct  335   AYLNLAEVQSALHAR----PTKWTACS---DTDWTDSPTTMLPTIQQLIESGISLWIYSG  387

Query  1256  DIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeD-LSFVTIRGAGHFVPS  1432
             D DG  +VT++ YA++ LN  ++TPW PW+S  E  G  V   + L+F T+RGAG  VP+
Sbjct  388   DTDGYFSVTSSRYALHILNLPIQTPWRPWHSSTEEVGGYVVGYEGLTFATVRGAGLMVPT  447

Query  1433  YQPERALTFFSAFVE  1477
             YQPERALT  S+F++
Sbjct  448   YQPERALTLISSFLQ  462



>ref|XP_009370170.1| PREDICTED: serine carboxypeptidase II-3-like isoform X2 [Pyrus 
x bretschneideri]
Length=474

 Score =   441 bits (1133),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 246/428 (57%), Positives = 299/428 (70%), Gaps = 19/428 (4%)
 Frame = +2

Query  86    SIGGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGS-----VYIGAQDGLKDADKISA  250
             S    + D L  L+K++K     N  +  +    ++       VY+G QDGLK+ADKI +
Sbjct  40    SCNANQIDNLNKLIKSRKSA---NPPRADLWDGSNVADDQFSPVYVGLQDGLKEADKIGS  96

Query  251   LPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgngg  427
             LPGQP+GV F Q++GYVTVD +AGRALFYYF ES +  S KPL+LWLNGGPGCSS G G 
Sbjct  97    LPGQPQGVNFDQYAGYVTVDQKAGRALFYYFVESPQDSSTKPLLLWLNGGPGCSSLGYGA  156

Query  428   MMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYV-TGDKKTAAD  604
             M E GPFRVN+D KTL+ N YAWNNVANVIFLESPAGVGFSYS  +SDY   GDK+TA D
Sbjct  157   MEEIGPFRVNNDRKTLFRNDYAWNNVANVIFLESPAGVGFSYSYTTSDYGDVGDKRTAED  216

Query  605   NYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGN  784
             +Y FL+NWLERFP+YKTRD FITGESYAGHYVPQLA  IL NNK+T QT INLKGIAIGN
Sbjct  217   SYKFLVNWLERFPQYKTRDFFITGESYAGHYVPQLASTILLNNKVTKQTKINLKGIAIGN  276

Query  785   AYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNI  964
             A+ID+ T + G YD+ WTH++ SDET+ GI   C+FSS  + S  CD +    +  +GN+
Sbjct  277   AWIDDSTGELGIYDYVWTHSMNSDETNAGIHKYCDFSS-GNFSSACDKYRSQVEEELGNV  335

Query  965   YSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPW  1144
               YNIYAP C   S  + S  + S   FDPCS +Y+  YLN  EVQ ALHA     P  W
Sbjct  336   DIYNIYAPPC-KTSEPTKSLSKSSIDDFDPCSDNYVKTYLNLKEVQAALHAK----PTEW  390

Query  1145  DSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVK  1324
              +C     V W D P T+LPTIK+L+ SGIS+W+YSGDIDG+V VT++ YAIN     ++
Sbjct  391   SACG---GVGWTDSPTTILPTIKQLIASGISLWIYSGDIDGRVPVTSSRYAINTFKLPLQ  447

Query  1325  TPWYPWYS  1348
             TPW  WYS
Sbjct  448   TPWRAWYS  455



>gb|KHG19786.1| Serine carboxypeptidase-like 40 [Gossypium arboreum]
Length=497

 Score =   441 bits (1135),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 239/460 (52%), Positives = 310/460 (67%), Gaps = 8/460 (2%)
 Frame = +2

Query  134   QKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDP  313
             +K KR +   ++   +   +    +  Q G+K+ D+I  LPGQP GV F Q+ GYVTVD 
Sbjct  37    RKMKRSSGIDKSGFKAVHYINKSRVHTQQGMKEKDRIEKLPGQP-GVLFQQYGGYVTVDK  95

Query  314   QAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKY  490
              AGRAL+YYF E+  +    PL+LWLNGGPGCSS   G M E GPFRV+S+ KTL+ N+Y
Sbjct  96    AAGRALYYYFVEAYHSKESLPLLLWLNGGPGCSSLAYGAMEELGPFRVHSNGKTLYRNRY  155

Query  491   AWNNVANVIFLESPAGVGFSYSNRSSDYV-TGDKKTAADNYIFLLNWLERFPEYKTRDLF  667
             +WN  ANV+FLESPAGVGFSY+N +SDY  +GD KTA DNY+FLLNWLERFPEY  R  +
Sbjct  156   SWNYAANVLFLESPAGVGFSYANTTSDYDDSGDSKTAVDNYVFLLNWLERFPEYSNRKFY  215

Query  668   ITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHAL  847
             I GESYAGHYVPQLA  IL++NK  N TIINLKGI IGNA I++ET   G YD+  +HAL
Sbjct  216   IAGESYAGHYVPQLAHTILQHNKNANTTIINLKGILIGNAVINDETDVKGMYDYLASHAL  275

Query  848   ISDETHRGIIANCNFSSA--ASPSDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglsss  1021
             ISDET  GI  +CNF+    +  S  CD   D+A + +  +  YNIYAP C   S L+  
Sbjct  276   ISDETANGIEKHCNFAPEDDSESSRECDAATDEAGQDIYYVDIYNIYAPLC-HNSSLTIR  334

Query  1022  svqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVL  1201
               + S   FDPCS  Y+Y YLN  +VQ+A+HANVT +   W+ CS D+   W D P T++
Sbjct  335   PKEPSVANFDPCSDYYVYAYLNRDDVQEAMHANVTKLDHDWEPCS-DIIRRWGDSPSTII  393

Query  1202  PTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWY-SKgevggyvvg  1378
             P ++ELM +G+ VW++SGD DG++ VT+T Y+I K+  +VKT W+PWY      G   V 
Sbjct  394   PLLQELMANGLRVWIFSGDADGRIPVTSTKYSIKKMKLAVKTKWHPWYLDGEVGGYTEVY  453

Query  1379  yeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
               DL+F T+RGAGH VPS+QP+RAL+    F++G   P +
Sbjct  454   KGDLTFATVRGAGHQVPSFQPKRALSLIKHFLDGTPLPDT  493



>ref|XP_002298413.2| putative serine carboxypeptidase family protein [Populus trichocarpa]
 gb|EEE83218.2| putative serine carboxypeptidase family protein [Populus trichocarpa]
Length=496

 Score =   441 bits (1135),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 239/471 (51%), Positives = 316/471 (67%), Gaps = 8/471 (2%)
 Frame = +2

Query  92    GGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQPEG  271
             G R+ + L  L K + +     ++  +  + + +       Q+GLK+ D+I +LPGQP+ 
Sbjct  25    GMRQSEALGHLYKAKLEGNSKVDS-ALFQATEHVDISKFHHQEGLKEKDRIESLPGQPK-  82

Query  272   VKFAQFSGYVTVDPQAGRALFYYFAESE-TPSDKPLVLWLnggpgcssfgnggMMENGPF  448
             V+F+Q+ GYVTVD  AGRAL+YYF E++ +    PL+LWLNGGPGCSS   G M E GPF
Sbjct  83    VEFSQYGGYVTVDKSAGRALYYYFVEAQHSKESSPLLLWLNGGPGCSSLAYGAMQELGPF  142

Query  449   RVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFLLN  625
             RV SD K L+ N+Y+WN  ANV+FLESPAGVGFSYSN +SDY  +GDK+TA DNY+FL+N
Sbjct  143   RVYSDGKKLYKNRYSWNYAANVLFLESPAGVGFSYSNTTSDYEKSGDKRTAEDNYVFLVN  202

Query  626   WLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEET  805
             WLERF EYK R+ +I+GESYAGHYVP+LA  IL +NK   + IINLKGI IGNA I+ ET
Sbjct  203   WLERFSEYKDREFYISGESYAGHYVPELAHTILYHNKKAKKAIINLKGILIGNAVINPET  262

Query  806   QDSGTYDFYWTHALISDETHRGIIANCNFSSAASP-SDTCDTFVDDADRSMGNIYSYNIY  982
                G YD+  +HA+ISD     +  +CNFS  A+P SD C+  VD+  +   +I  YNIY
Sbjct  263   DRIGMYDYLGSHAIISDVLVHKVRTHCNFSFNATPQSDECNEAVDEVRKDTHHIDIYNIY  322

Query  983   APFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQD  1162
             AP C      ++   + S   FDPCS  Y+Y YLN P+VQ+A+HANVT +   W+ CS D
Sbjct  323   APSC-FYKSTTAKPKKPSLVNFDPCSDYYVYAYLNRPDVQEAMHANVTKLTHDWEPCS-D  380

Query  1163  VNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPW  1342
             V  +W D P T++P ++ELM +G+ VW++SGD D +V VT+T Y+INK+   VKT W+PW
Sbjct  381   VITSWSDSPSTIIPLLQELMANGLRVWIFSGDTDARVPVTSTQYSINKMKLQVKTEWHPW  440

Query  1343  YSK-gevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
             Y K    G   V   DL+F T+RGAGH VP+YQP RAL+    F+ G   P
Sbjct  441   YLKGEVGGYTQVYRGDLTFATVRGAGHQVPTYQPLRALSLIKHFLHGTSLP  491



>emb|CDP16362.1| unnamed protein product [Coffea canephora]
Length=490

 Score =   441 bits (1133),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 247/432 (57%), Positives = 306/432 (71%), Gaps = 9/432 (2%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESE---TPSDKPLVLW  385
             Q+GLK+ D I  LPGQP  V F Q+ GY+T++   GRAL+YYF E++      D PL+LW
Sbjct  62    QEGLKEKDIIHKLPGQPP-VSFKQYGGYITINATVGRALYYYFTEAQDTMVAKDLPLLLW  120

Query  386   LnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRS  565
             L GGPGCSS G G M E GPFRV SD KTL+ N+YAWN+VANV+FLESPAGVGFSYSN +
Sbjct  121   LAGGPGCSSLGIGAMQELGPFRVGSDGKTLYKNQYAWNHVANVLFLESPAGVGFSYSNTT  180

Query  566   SDYV-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKIT  742
             SD++  GD+KTAADNYIF+LNWLERFPEYK RD +I GESYAGHYVPQLA  I+ +NK  
Sbjct  181   SDFMKVGDRKTAADNYIFILNWLERFPEYKNRDFYIAGESYAGHYVPQLAHNIVYHNKKA  240

Query  743   NQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTC  922
             N+TIINLKGI +GNA I++ET   G  D++ +HALIS E+ R  + NCNFSS A  SD C
Sbjct  241   NRTIINLKGILVGNALINDETDTLGLIDYFASHALISSESSRK-LHNCNFSSNAETSDEC  299

Query  923   DTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQ  1102
                V       GNI  YNIY P C     L+S   + S   FDPC+  Y+Y YLN P VQ
Sbjct  300   HDIVKKLKNVAGNINIYNIYYPLC-LDGNLTSIPKRFSIMEFDPCTVYYVYSYLNLPVVQ  358

Query  1103  KALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVT  1282
             +A+HANVT +   W  CS+ V  +WED   TVLP I+ELM +G+ VW++SGD+DG++ VT
Sbjct  359   EAIHANVTKLYYDWQPCSE-VLKHWEDRSSTVLPFIQELMENGVRVWIFSGDVDGRMPVT  417

Query  1283  TTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeD-LSFVTIRGAGHFVPSYQPERALTF  1459
             +T Y+I  +N +   PW+ WY  GEVGGYV  Y D L+FVT+RGAGH VPSY+P+RAL+ 
Sbjct  418   STQYSIEVMNVTTLNPWHAWYRDGEVGGYVQEYRDNLTFVTVRGAGHEVPSYKPDRALSL  477

Query  1460  FSAFVEGKLPPK  1495
              S F+ G   PK
Sbjct  478   VSNFIAGTPLPK  489



>ref|XP_008800209.1| PREDICTED: serine carboxypeptidase II-3-like [Phoenix dactylifera]
Length=498

 Score =   441 bits (1133),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 250/431 (58%), Positives = 302/431 (70%), Gaps = 11/431 (3%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAE--SETPSDKPLVLWL  388
             Q GLK++DKI  LPGQPEGV F Q+ GYVTVD +AGRALFYYFAE  S  PS +PLVLWL
Sbjct  73    QQGLKESDKIIKLPGQPEGVDFDQYGGYVTVDMEAGRALFYYFAEAASADPSSRPLVLWL  132

Query  389   nggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSS  568
             NGGPGCSS G G M E GPFRV SD KTL+ N YAWN VANV+FLESPAGVGFSYSN +S
Sbjct  133   NGGPGCSSLGYGAMEELGPFRVMSDGKTLFRNPYAWNRVANVLFLESPAGVGFSYSNTTS  192

Query  569   DYV-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITN  745
             DY  +GD KTA D Y+FL+NW+ERFPEYK RD +I GESY GHYVPQLA  IL++     
Sbjct  193   DYGNSGDSKTAKDAYVFLVNWMERFPEYKGRDFYIAGESYGGHYVPQLAHTILQH----K  248

Query  746   QTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFS-SAASPSDTC  922
              +IINL+GI IGN  I++ET + G +D++WTHALISDE   GI   CNFS +A+S    C
Sbjct  249   NSIINLRGIMIGNGVINDETDNEGMFDYFWTHALISDEAINGIHNYCNFSPNASSQPQQC  308

Query  923   DTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQ  1102
                +D A +S+G I  YNIYAP C +  G++ S  + S + FDPC+ DY+  YLNT EVQ
Sbjct  309   QQAMDVASQSIGTIDVYNIYAPLC-TSPGITPSPKRYSIKNFDPCTDDYVSAYLNTAEVQ  367

Query  1103  KALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVT  1282
             +ALHANVT +   W  CSQ V   W D P TVLP IKE M + + V +YSGD+DG+V VT
Sbjct  368   EALHANVTKLNYTWSGCSQ-VITQWTDRPYTVLPLIKECMANDVRVLVYSGDVDGRVPVT  426

Query  1283  TTTYAINKLNTSVKTPWYPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTF  1459
             ++ Y++N+LN  VKT W  W       G  VV   +L+F T+RGAGH VPSYQ  RAL  
Sbjct  427   SSRYSLNQLNLRVKTQWKSWLIENEVGGYSVVYDGNLTFATVRGAGHEVPSYQALRALVL  486

Query  1460  FSAFVEGKLPP  1492
                F++ K  P
Sbjct  487   AKFFLDRKPLP  497



>ref|XP_003592243.1| Serine carboxypeptidase II-3 [Medicago truncatula]
 ref|XP_003601340.1| Serine carboxypeptidase II-3 [Medicago truncatula]
Length=493

 Score =   440 bits (1131),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 256/427 (60%), Positives = 303/427 (71%), Gaps = 11/427 (3%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESE-TPSDKPLVLWLn  391
             Q+ L+ ADKI  LPGQP GV F Q+SGYVTVDP+ GR LFYYF ES    S KPLVLWLN
Sbjct  69    QEELRLADKIVTLPGQPYGVNFDQYSGYVTVDPETGRELFYYFVESPCNSSTKPLVLWLN  128

Query  392   ggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSD  571
             GGPGCSS G G   E GPFRVNSD KTL+ N YAWN VANV+FLESPAG+GFSYSN +SD
Sbjct  129   GGPGCSSLGYGAFQELGPFRVNSDGKTLYRNPYAWNEVANVLFLESPAGIGFSYSNTTSD  188

Query  572   Y-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQ  748
             Y  +GDK TA D+Y+FL+NWLERFP+YKTRD +I+GESYAGHYVPQLA  IL NNK+   
Sbjct  189   YDKSGDKSTAKDSYVFLINWLERFPQYKTRDFYISGESYAGHYVPQLASTILHNNKLYKN  248

Query  749   TIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDT  928
             TIINLKGI++GNA+ID+ T   G YD  WTHAL SD+TH  I   C+F+   + S  C  
Sbjct  249   TIINLKGISLGNAWIDDATSLKGLYDNLWTHALNSDQTHELIEKYCDFTK-QNYSAICTN  307

Query  929   FVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKA  1108
              ++ +    G I S+NIYAP C   S L + S    S   DPCS  Y   YLN PEVQKA
Sbjct  308   AMNMSMIEKGKIDSFNIYAPLC-HDSTLKNGSTGYVSNDLDPCSDYYGTAYLNRPEVQKA  366

Query  1109  LHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTT  1288
             LHA     P  W  CS  +N+NW+D P T+LPTIK L+ +GI +W+YSGD D  V VT +
Sbjct  367   LHAK----PTNWSHCS--INLNWKDSPITILPTIKYLIDNGIKLWIYSGDTDA-VGVTIS  419

Query  1289  TYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSA  1468
              Y IN L   + + W PWYS  E+GGYVVGY+ L+FVT+RGAGH VPS+QPERALT  S+
Sbjct  420   RYPINTLKLPIDSTWRPWYSGKEIGGYVVGYKGLTFVTVRGAGHLVPSWQPERALTLISS  479

Query  1469  FVEGKLP  1489
             F+ G LP
Sbjct  480   FLYGILP  486



>gb|EMT20722.1| Serine carboxypeptidase II-3 [Aegilops tauschii]
Length=518

 Score =   440 bits (1132),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 242/435 (56%), Positives = 312/435 (72%), Gaps = 7/435 (2%)
 Frame = +2

Query  200   VYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPL  376
             V+ G+QD  +  DKI A+PGQ E  +F Q++GYVTVD  AGRALFYYFAE+ + PS+KPL
Sbjct  88    VHGGSQDYQRKRDKIIAMPGQMEEAEFTQYAGYVTVDANAGRALFYYFAEAPQDPSNKPL  147

Query  377   VLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYS  556
             VLW+NGGPGCSSFG G M+E GPF V+SD+KTL+  K+AWN VAN++F+E PAGVG+SYS
Sbjct  148   VLWMNGGPGCSSFGAGAMLELGPFSVHSDNKTLYKKKHAWNTVANMLFVEIPAGVGYSYS  207

Query  557   NRSSDYV-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNN  733
             N +SDY  TGDK++  D Y FL+NWLERFP+Y+ RD FITGESYAGHYVP+LA LI+ NN
Sbjct  208   NTTSDYHNTGDKRSTDDAYTFLVNWLERFPKYRDRDFFITGESYAGHYVPELANLIISNN  267

Query  734   KITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPS  913
             +    T + LKG+AIGNA +        T+D++W HA+IS +T+R + ANC F+   + +
Sbjct  268   RARGATNVKLKGVAIGNADLQYNLTLRATFDYFWMHAMISGKTYRTVQANCGFN--GTYT  325

Query  914   DTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTP  1093
               CD  ++ A +  GN+  YNIYAP C   S    SS        DPC++ Y+  YLN P
Sbjct  326   KDCDNAMNLAIKEKGNVDDYNIYAPICRDASSPLRSSDPVVFG--DPCTNHYVSSYLNRP  383

Query  1094  EVQKALHANVTGIPGPWDSC-SQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGK  1270
             EVQ+ALHAN TG+  PW  C SQ V  NW+D P+TVLP+I++L+ SG  VWLYSGD+D  
Sbjct  384   EVQRALHANTTGLNYPWTDCSSQLVFDNWKDSPETVLPSIRKLISSGTRVWLYSGDMDAV  443

Query  1271  VAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERA  1450
              +VT+T YA++ L+   +T W PW    EV GYVVGY+ L F T++GAGH VP YQP RA
Sbjct  444   CSVTSTQYALDILDLPTETSWRPWRVNNEVAGYVVGYKGLVFATVKGAGHMVPYYQPRRA  503

Query  1451  LTFFSAFVEGKLPPK  1495
             L  FS+F+EGKLPP+
Sbjct  504   LALFSSFLEGKLPPQ  518



>ref|XP_009399958.1| PREDICTED: serine carboxypeptidase II-3-like [Musa acuminata 
subsp. malaccensis]
Length=503

 Score =   439 bits (1130),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 248/431 (58%), Positives = 304/431 (71%), Gaps = 8/431 (2%)
 Frame = +2

Query  218   DGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES--ETPSDKPLVLWLn  391
             DGLK+ DKI  LPGQP+GV F Q++GYVTVD ++GRALFYYFAE+     S KPL+LW N
Sbjct  74    DGLKEKDKIVKLPGQPQGVDFDQYAGYVTVDARSGRALFYYFAEAVGRDNSSKPLLLWFN  133

Query  392   ggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSD  571
             GGPGCSSFG G M E GPFRV SD +TL+ N YAWN VANV+FLESPAGVGFSYSN +SD
Sbjct  134   GGPGCSSFGYGAMEELGPFRVMSDGRTLYRNPYAWNAVANVLFLESPAGVGFSYSNTTSD  193

Query  572   Y-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRN-NKITN  745
             Y  +GD++TA D Y+FLLNW+ERFPEYK RD ++ GESYAGHYVPQLA  IL++ N+  +
Sbjct  194   YDKSGDQRTAEDAYVFLLNWMERFPEYKGRDFYLAGESYAGHYVPQLALTILQHENRSAS  253

Query  746   QTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSA-ASPSDTC  922
                INLKGIAIGNA ID E+ + G YDF+WTHALISD T   I  +CNFSS   +    C
Sbjct  254   AAAINLKGIAIGNAAIDMESDNRGMYDFFWTHALISDATVDAIHKHCNFSSEDDTQPPQC  313

Query  923   DTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQ  1102
                + DA+R    +  YNIYAP C S S LS +  +     FDPCS  YI  YLN P+VQ
Sbjct  314   AQALQDAERVFEELDIYNIYAPRC-SSSSLSPTPKKPEIDNFDPCSGVYIKAYLNDPDVQ  372

Query  1103  KALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVT  1282
             KALHANVT +  PW  CSQ V  NW+D P T+LP I+++  +G+ V +YSGDIDG+V VT
Sbjct  373   KALHANVTKLDYPWSGCSQ-VIPNWKDSPSTILPIIRQIQANGVQVLVYSGDIDGRVPVT  431

Query  1283  TTTYAINKLNTSVKTPWYPW-YSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTF  1459
             +TTY+++ L   VK PW  W  +    G  VV   +L+F T+RGAGH VPSYQP R+L  
Sbjct  432   STTYSLSLLKLPVKAPWRSWTVNDQVGGYAVVYDGNLTFATVRGAGHEVPSYQPARSLEM  491

Query  1460  FSAFVEGKLPP  1492
               +F+ G+  P
Sbjct  492   IKSFLNGENLP  502



>ref|XP_007219043.1| hypothetical protein PRUPE_ppa004618mg [Prunus persica]
 gb|EMJ20242.1| hypothetical protein PRUPE_ppa004618mg [Prunus persica]
Length=499

 Score =   439 bits (1130),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 248/473 (52%), Positives = 322/473 (68%), Gaps = 7/473 (1%)
 Frame = +2

Query  89    IGGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQPE  268
             +G ++   L  L K++ ++    +         D G+  I  Q+GLK+ D+I +LPGQP 
Sbjct  27    LGNKQSQALAQLYKSKLKEGAGIDTSQFKAILHDNGAK-IHPQEGLKEKDRIDSLPGQPH  85

Query  269   GVKFAQFSGYVTVDPQAGRALFYYFAESETPSDKP-LVLWLnggpgcssfgnggMMENGP  445
              V F+Q+ GYVTVD +AGRALFYYF E+E   D   L+LWLNGGPGCSS G G M+E GP
Sbjct  86    -VNFSQYGGYVTVDKEAGRALFYYFVEAEKAKDSSRLLLWLNGGPGCSSLGYGAMLELGP  144

Query  446   FRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFLL  622
             FR++SD KTL+ N+++WN  ANV+FLESPAGVGFSYSN++SDY  +GD+ TAADNY+FL+
Sbjct  145   FRIHSDGKTLYRNRFSWNYAANVLFLESPAGVGFSYSNKTSDYDASGDRITAADNYVFLV  204

Query  623   NWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEE  802
             NWLERFPEYK R+ +I+GESYAGHYVPQLA  IL +NK  N+TIINLKGI IGNA I++E
Sbjct  205   NWLERFPEYKDREFYISGESYAGHYVPQLAHTILYHNKRANKTIINLKGIMIGNAVINDE  264

Query  803   TQDSGTYDFYWTHALISDETHRGIIANCNFS-SAASPSDTCDTFVDDADRSMGNIYSYNI  979
             T   G YD+  +HA+ISD+T   I   C+FS +A +    C    D A +    I  YNI
Sbjct  265   TDSRGMYDYLASHAVISDQTANKINKYCDFSPNATTQPKECTDATDAAAKDTYYIDIYNI  324

Query  980   YAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQ  1159
             YA  C   S +++   + S   FDPCS  Y Y YLN P+VQ+ALHANVT +   W+ CS 
Sbjct  325   YASSC-VSSNVTAKPKKASIFEFDPCSEYYAYAYLNRPDVQQALHANVTKLTHDWEPCS-  382

Query  1160  DVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYP  1339
             DV  NW D   TVLP +KE + + + VW++SGDID +V VT+T Y+I KLN  +KT W+ 
Sbjct  383   DVITNWSDGASTVLPLLKEFLANDVRVWIFSGDIDARVPVTSTKYSIEKLNLPIKTEWHA  442

Query  1340  WYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
             W+  GEVGGY   Y +L+F T+RGAGH VPSYQP R L+    F++G   P +
Sbjct  443   WFLGGEVGGYTQVYGELTFATVRGAGHQVPSYQPARGLSLIKHFLDGTPLPDT  495



>emb|CDP16361.1| unnamed protein product [Coffea canephora]
Length=491

 Score =   438 bits (1127),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 250/432 (58%), Positives = 305/432 (71%), Gaps = 8/432 (2%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETP---SDKPLVLW  385
             QDGLK+ D I  LPGQP  V F Q+ GY+T++  AGRA +YYF E++ P    D PL+LW
Sbjct  62    QDGLKEKDIIQELPGQPP-VNFKQYGGYITINATAGRAFYYYFTEAQDPKKAQDLPLLLW  120

Query  386   LnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRS  565
             LNGGPGCSS G G M E GPFRV SD KTL+ N+YAWN+VANV+FLESPAGVGFSYSN +
Sbjct  121   LNGGPGCSSLGFGAMQELGPFRVGSDGKTLYKNQYAWNHVANVLFLESPAGVGFSYSNTT  180

Query  566   SDYVTG-DKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKIT  742
             SD+V G D+KTAADNYIFLLNWLERFPEYK RD +I GESYAGHYVPQLA  I+ +NK  
Sbjct  181   SDFVKGGDRKTAADNYIFLLNWLERFPEYKNRDFYIAGESYAGHYVPQLAHNIVYHNKKA  240

Query  743   NQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTC  922
             N+TIINLKGI IGNA I++ET   G  D++ +HALIS E+   I   CNFS  A  SD C
Sbjct  241   NKTIINLKGILIGNAVINQETDSIGMIDYWASHALISLESSIKIHKYCNFSLDAQRSDEC  300

Query  923   DTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQ  1102
             ++ +D+A   +G+I  YNIY P C     ++S   + S    DPCS  Y+Y Y N PEVQ
Sbjct  301   NSALDEAGNMVGDIDIYNIYYPLC-FDGNVTSIPKRFSIMEIDPCSGYYVYSYFNLPEVQ  359

Query  1103  KALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVT  1282
             +A+HANVT +   W  CS DV  +WED   TVLP +KELM   I VW++SGD DG+V VT
Sbjct  360   EAIHANVTKLHYDWQPCS-DVLEDWEDRQSTVLPFLKELMEKEIRVWIFSGDTDGRVPVT  418

Query  1283  TTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeD-LSFVTIRGAGHFVPSYQPERALTF  1459
             +T Y++  +N +    W  WY   EVGGYV  Y+D L+FVT+RGAGH VPSY+P+RAL+ 
Sbjct  419   STQYSLEVMNITTLNSWRAWYRDREVGGYVQEYKDNLTFVTVRGAGHEVPSYRPDRALSL  478

Query  1460  FSAFVEGKLPPK  1495
              S FV G   PK
Sbjct  479   VSYFVAGIPLPK  490



>ref|XP_010067792.1| PREDICTED: serine carboxypeptidase-like 40 [Eucalyptus grandis]
 gb|KCW65996.1| hypothetical protein EUGRSUZ_G03286 [Eucalyptus grandis]
Length=496

 Score =   438 bits (1127),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 247/473 (52%), Positives = 314/473 (66%), Gaps = 8/473 (2%)
 Frame = +2

Query  89    IGGRK-FDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQP  265
             I GRK  D L+SL K + +K + + +         + +  I +Q+GL++ D+I  LPGQP
Sbjct  25    IQGRKQGDVLDSLYKAKSEKSRIDTSLFQATDHHGILNSRIYSQEGLREKDRIKRLPGQP  84

Query  266   EGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMENG  442
               VKF  + GYVTV+  AGRA +YYFAE        PL+LWLNGGPGCSS G G M E G
Sbjct  85    S-VKFDHYGGYVTVNESAGRAFYYYFAEGVRNKESMPLLLWLNGGPGCSSLGYGAMQELG  143

Query  443   PFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVT-GDKKTAADNYIFL  619
             PFRV+SD KTL+ NK+AWNN ANV+FLESPAGVGFSYSN ++DY + GD +TAADNY+FL
Sbjct  144   PFRVHSDGKTLYKNKFAWNNAANVLFLESPAGVGFSYSNTTADYSSSGDSETAADNYVFL  203

Query  620   LNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDE  799
             LNWLERFPEYK RD +I+GESYAGHYVPQLA  IL NNK  N+T+INLKGI IGNA I++
Sbjct  204   LNWLERFPEYKDRDFYISGESYAGHYVPQLAHNILSNNKRANKTLINLKGIIIGNAVIND  263

Query  800   ETQDSGTYDFYWTHALISDETHRGIIANCNFS-SAASPSDTCDTFVDDADRSMGNIYSYN  976
             ET   G Y+++ THALISDET   I   C+FS +A S    C +   DA   +  +  YN
Sbjct  264   ETDQRGMYEYFATHALISDETGFAIQKYCDFSPNATSQVSQCLSAAQDASNDVSALDIYN  323

Query  977   IYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCS  1156
             IYAP C   S L+S   + +    DPC   Y+  Y+N  +VQ+ALHANVT +   W+ CS
Sbjct  324   IYAPLC-FSSNLTSHPKKTNIMDLDPCGDIYVQAYMNREDVQEALHANVTKLDHDWEGCS  382

Query  1157  QDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWY  1336
               +   W D P TVLP ++E M SG+ VW+ SGD DG+V VT+T  +++K+    K+PW 
Sbjct  383   SVIQA-WVDSPSTVLPLLREFMSSGLRVWVISGDTDGRVPVTSTRRSLSKMKLPTKSPWR  441

Query  1337  PWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
             PW+      G   V   DL+F T+RGAGH VPSYQP+RAL+  S F+ G   P
Sbjct  442   PWFLGGEVGGYVQVYKGDLTFATVRGAGHQVPSYQPKRALSLISHFLAGSPLP  494



>ref|XP_002517750.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF44557.1| serine carboxypeptidase, putative [Ricinus communis]
Length=513

 Score =   437 bits (1125),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 239/433 (55%), Positives = 307/433 (71%), Gaps = 8/433 (2%)
 Frame = +2

Query  221   GLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK--PLVLWLng  394
             G K+ D+I  LPGQP+ V+F Q+ GYVT D  AGRAL+YYF E++  + +  PL+LWLNG
Sbjct  83    GSKEKDRIERLPGQPD-VEFTQYGGYVTTDKSAGRALYYYFVEAQHYAKESFPLLLWLNG  141

Query  395   gpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY  574
             GPGCSS G G M E GPFRV+SD KTL+ N+Y+WN  ANV+FLESPAGVGFSYSN SSDY
Sbjct  142   GPGCSSLGYGAMQELGPFRVHSDGKTLYKNRYSWNYAANVLFLESPAGVGFSYSNTSSDY  201

Query  575   -VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQT  751
                GDK TA DNY+FL+NWLERFPEYK RD +I+GESYAGHYVPQLA  IL +NK   +T
Sbjct  202   EKCGDKATAEDNYLFLVNWLERFPEYKDRDFYISGESYAGHYVPQLAHTILYHNKKAKKT  261

Query  752   IINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFS-SAASPSDTCDT  928
             II+LKGI IGNA I++ET + G YD++ THALIS E    I  +C+FS +A + SD C++
Sbjct  262   IIDLKGILIGNAVINDETDNIGMYDYFATHALISQEAISSIKKHCDFSPNATTQSDECNS  321

Query  929   FVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKA  1108
                 A +    +  YNIYAP C +    ++   + S   FDPCS  Y+Y YLN PEVQ+A
Sbjct  322   ATYQASKDTAFLDIYNIYAPLC-TSQNTTAKPKKASLAEFDPCSDYYVYAYLNLPEVQEA  380

Query  1109  LHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTT  1288
             +HAN+T +   W+ CS DV  NW D P T++P ++E M +G+ VW++SGD DG+V VT+T
Sbjct  381   MHANITKLEHDWEPCS-DVIKNWLDSPATIIPLLQEFMANGLRVWIFSGDTDGRVPVTST  439

Query  1289  TYAINKLNTSVKTPWYPWYSKgevgg-yvvgyeDLSFVTIRGAGHFVPSYQPERALTFFS  1465
              Y+IN++   +KT W+PWY KGEVGG   V   DL+F T+RGAGH VPSY+P RAL+   
Sbjct  440   QYSINEMKLPIKTEWHPWYLKGEVGGYTQVYKGDLTFATVRGAGHQVPSYKPLRALSLIK  499

Query  1466  AFVEGKLPPKSAE  1504
              F++G   P +  
Sbjct  500   HFLDGTPLPDTTR  512



>ref|XP_009391583.1| PREDICTED: serine carboxypeptidase II-3 [Musa acuminata subsp. 
malaccensis]
Length=491

 Score =   437 bits (1123),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 254/472 (54%), Positives = 319/472 (68%), Gaps = 13/472 (3%)
 Frame = +2

Query  95    GRKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQPEGV  274
             GR+ D L+ L   +K     +++     +  DL S  + A  G K+ D+I  LPGQP GV
Sbjct  25    GRQGDALDKL---RKGATVTSSSDFDTFAFSDLTS-RLYADSGSKENDRIVELPGQPAGV  80

Query  275   KFAQFSGYVTVDPQAGRALFYYFAES--ETPSDKPLVLWLnggpgcssfgnggMMENGPF  448
              F Q+ GYVTVD + GRALFYYFAE+  +  S KPL+LWLNGGPGCSSFG G M E GPF
Sbjct  81    DFVQYGGYVTVDDRNGRALFYYFAEAAGKQSSSKPLLLWLNGGPGCSSFGIGAMQELGPF  140

Query  449   RVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYV-TGDKKTAADNYIFLLN  625
             RV SD +TL+ N YAWN+VANV+FLESPAGVGFSYSN +SDY  +GDKKTA D ++FL+N
Sbjct  141   RVMSDGRTLYRNPYAWNSVANVLFLESPAGVGFSYSNTTSDYSKSGDKKTAEDAFVFLVN  200

Query  626   WLERFPEYKTRDLFITGESYAGHYVPQLAQLILRN-NKITNQTIINLKGIAIGNAYIDEE  802
             W+ERFPEYK RD +I GESYAGHYVPQLA  IL+N N+      INLKGIAIGNA I++E
Sbjct  201   WMERFPEYKGRDFYIAGESYAGHYVPQLAYTILQNKNQSAAGAAINLKGIAIGNAVINDE  260

Query  803   TQDSGTYDFYWTHALISDETHRGIIANCNFS-SAASPSDTCDTFVDDADRSMGNIYSYNI  979
             T   G YDF+WTHALISD T   I   CNFS +A      C     +AD+    +  YNI
Sbjct  261   TDSRGIYDFFWTHALISDATVEAIHKYCNFSPNAVKEPQQCLDAASEADKVFEELDIYNI  320

Query  980   YAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQ  1159
             YAP C   S L+S   + S   FDPC+S Y+  YLN PEVQKALHAN+T +   W SCS+
Sbjct  321   YAPLC-FSSNLTSPPKKPSIEDFDPCTSIYVNAYLNDPEVQKALHANITRLNYSWSSCSR  379

Query  1160  DVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYP  1339
              ++ NW D P T+LP I++++  G+ + +YSGD DG+V VT+T Y++N LN  +K+PW  
Sbjct  380   VIS-NWVDSPSTILPIIQQILAHGVQILVYSGDTDGRVPVTSTRYSLNVLNLPIKSPWRS  438

Query  1340  W-YSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEG-KLP  1489
             W  +    G  VV   +L+F T+RGAGH VPSYQP RAL    +F+ G +LP
Sbjct  439   WTINSEVGGYTVVYDRNLTFATVRGAGHEVPSYQPARALVLIDSFLHGLQLP  490



>gb|EMT05424.1| Serine carboxypeptidase II-3 [Aegilops tauschii]
Length=504

 Score =   437 bits (1123),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 241/442 (55%), Positives = 296/442 (67%), Gaps = 21/442 (5%)
 Frame = +2

Query  212   AQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES---------ETPS  364
             A+ G K+AD++ ALPGQP GV FAQ++GYVTVD  AGRALFYY AE+          +  
Sbjct  64    AEVGRKEADRVDALPGQPRGVDFAQYAGYVTVDAAAGRALFYYLAEAVGCHASGDGSSSK  123

Query  365   DKPLVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVG  544
              KPL+LWLNGGPGCSS G G M E GPFRV SD KTL+ N Y+WN+ ANV+FLESPAGVG
Sbjct  124   GKPLLLWLNGGPGCSSLGYGAMEELGPFRVMSDGKTLYRNPYSWNHAANVLFLESPAGVG  183

Query  545   FSYSNRSSDY-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLI  721
             +SYSN ++DY  +GD +TA D Y FL +W+ERFPEYK RD +I GESYAGH+ PQLA  +
Sbjct  184   YSYSNTTADYDRSGDNRTAEDAYAFLASWMERFPEYKGRDFYIAGESYAGHFAPQLAHAV  243

Query  722   LRNNKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSA  901
             LR+  +     INLKG+ IGNA I+E T   GT+DFYWTHALISDET  G+  NCNF++ 
Sbjct  244   LRHASLA----INLKGVMIGNAVINEGTDKKGTFDFYWTHALISDETAAGVNQNCNFTNG  299

Query  902   ASPSDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVY  1081
             A  +D CD   DD   ++ +I +YNIYAP C    GL +  +  S   FD C+S+Y+  Y
Sbjct  300   AQSNDLCDQANDDVVENLRDIDNYNIYAPNC-QTEGLVTPPITPSIESFDTCTSNYVEAY  358

Query  1082  LNTPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDI  1261
             LN P+VQKA HANVT +  PW +CS+ V   W D   TVLP I+ELM + I VW+YSGD 
Sbjct  359   LNKPDVQKAFHANVTRLDHPWLACSE-VLTRWIDSTTTVLPIIRELMKNNIRVWVYSGDT  417

Query  1262  DGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggy-----vvgyeDLSFVTIRGAGHFV  1426
             DG V VT T Y+IN+L   V   W  W+S  +  G      V     LS VT+RGAGH V
Sbjct  418   DGNVPVTATRYSINQLQLPVAAKWRRWFSSTKGAGEVGGYVVQYKGGLSLVTVRGAGHEV  477

Query  1427  PSYQPERALTFFSAFVEGKLPP  1492
             PSYQP+RAL    AF+ G   P
Sbjct  478   PSYQPQRALQLLQAFLAGTTLP  499



>ref|XP_008783277.1| PREDICTED: serine carboxypeptidase II-3-like [Phoenix dactylifera]
Length=499

 Score =   437 bits (1123),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 254/431 (59%), Positives = 299/431 (69%), Gaps = 11/431 (3%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESET--PSDKPLVLWL  388
             Q GLK++DKI  LPGQPEGV F Q+ GYVTVD +AGRALFYY  E+ T  PS +PLVLWL
Sbjct  74    QQGLKESDKIIKLPGQPEGVDFDQYGGYVTVDKEAGRALFYYLTEAATADPSSRPLVLWL  133

Query  389   nggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSS  568
             NGGPGCSSFG G M E GPFRV SD KTL+ N YAWN VANV+FLESPAGVGFSYSN +S
Sbjct  134   NGGPGCSSFGIGAMEELGPFRVMSDGKTLFRNPYAWNRVANVLFLESPAGVGFSYSNTTS  193

Query  569   DYV-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITN  745
             DY  +GD KTA D Y+FL+NW+ERFPEYK RD +I GESY GHYVPQLA  IL++ K   
Sbjct  194   DYGNSGDSKTAKDAYVFLVNWMERFPEYKGRDFYIAGESYGGHYVPQLAHTILQHKK---  250

Query  746   QTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFS-SAASPSDTC  922
              + INLKGI IGN  I+ ET   G +D++WTHALISDE    I   CNFS +A+S    C
Sbjct  251   -SKINLKGIMIGNGVINTETDGKGMFDYFWTHALISDEAIDVIHNYCNFSPNASSQPKQC  309

Query  923   DTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQ  1102
                VD A  S+G I  YNIYAP C +   ++ S    S   FDPC++DY+  YLNT EVQ
Sbjct  310   LQAVDVAAESLGTINLYNIYAPLC-TSPTITRSPKGYSIENFDPCTADYVSAYLNTAEVQ  368

Query  1103  KALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVT  1282
              ALHANVT +   W  CSQ V   W D P TVLP IKE M   + V +YSGD+DG+V VT
Sbjct  369   MALHANVTRLNYTWSGCSQ-VLTQWTDSPFTVLPLIKESMAHDVQVLVYSGDVDGRVPVT  427

Query  1283  TTTYAINKLNTSVKTPWYPWYSKgevggyvvgy-eDLSFVTIRGAGHFVPSYQPERALTF  1459
             ++ Y++N+L   VKT W PW+ K EVGGY V Y  +L+F T+RGAGH VPSYQ  RAL  
Sbjct  428   SSRYSLNQLKLRVKTQWQPWFIKNEVGGYSVVYDGNLTFATVRGAGHQVPSYQALRALVL  487

Query  1460  FSAFVEGKLPP  1492
                F+  K  P
Sbjct  488   IKFFLNRKPLP  498



>emb|CDP16360.1| unnamed protein product [Coffea canephora]
Length=491

 Score =   436 bits (1120),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 243/433 (56%), Positives = 303/433 (70%), Gaps = 8/433 (2%)
 Frame = +2

Query  212   AQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETP---SDKPLVL  382
              QDGLK+ D I  LPGQP  V F Q+ GY+T++  AGRA +YYF E++ P    D PL+L
Sbjct  61    VQDGLKEKDIIQKLPGQP-SVSFKQYGGYITINATAGRAFYYYFTEAQDPKKAQDLPLLL  119

Query  383   WLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNR  562
             WLNGGPGCSS   G M E GPFRV SD KTL+ N+YAWN+VANV+F+ESPAGVGFSYSN 
Sbjct  120   WLNGGPGCSSLAYGAMQELGPFRVGSDGKTLYKNQYAWNHVANVLFVESPAGVGFSYSNT  179

Query  563   SSDYVTG-DKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKI  739
             +SD+V G D+KTAADNYIFL+NWLERFPEYK RD +I GESYAGHYVPQLA  I+ +NK 
Sbjct  180   TSDFVKGGDRKTAADNYIFLINWLERFPEYKDRDFYIAGESYAGHYVPQLAHNIVYHNKK  239

Query  740   TNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDT  919
              N+TIINLKGI IGNA I+ ET + G  D++ +HALIS E+ R I   CNFS     SD 
Sbjct  240   ANKTIINLKGILIGNADINHETDNIGMIDYWASHALISLESSRKIHKYCNFSLDDQRSDE  299

Query  920   CDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEV  1099
             C + + +    + +I  YNIY P C   + ++S   + S    DPCS +Y+Y Y N PEV
Sbjct  300   CSSTLGEVSNMLEDIDIYNIYYPLC-LDANVTSIPKRFSIMEIDPCSDNYVYSYFNLPEV  358

Query  1100  QKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAV  1279
             Q+ +HANVT +   W SCS  +   WED   TVLP I+ELM +GI VWL+SGD+DG+V V
Sbjct  359   QEQIHANVTKLHYDWQSCSGVIE-RWEDRASTVLPFIEELMENGIRVWLFSGDMDGRVPV  417

Query  1280  TTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeD-LSFVTIRGAGHFVPSYQPERALT  1456
             T+T Y++  +N +   PW  WY   EVGGYV  Y+D L+FVT+RGAGH VPSY+P+RAL+
Sbjct  418   TSTQYSLEVMNITTLNPWRAWYRDREVGGYVQEYKDNLTFVTVRGAGHEVPSYRPDRALS  477

Query  1457  FFSAFVEGKLPPK  1495
                 F+ G   PK
Sbjct  478   LVLNFIAGTPLPK  490



>ref|XP_009368057.1| PREDICTED: serine carboxypeptidase-like 40 [Pyrus x bretschneideri]
Length=502

 Score =   436 bits (1121),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 234/431 (54%), Positives = 300/431 (70%), Gaps = 9/431 (2%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK-PLVLWLn  391
             Q+GLK  D+I  LPGQP  VKF+Q+ GYVTVD +AGRA+FYY  E+E   D  PL+LWLN
Sbjct  70    QEGLKVKDRIVKLPGQPN-VKFSQYGGYVTVDKKAGRAMFYYLVEAEQAKDSSPLLLWLN  128

Query  392   ggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSD  571
             GGPGCSS   G M+E GPFR++SD KTL+ N+++WN+ ANV+FLESPAGVGFSYSNR+SD
Sbjct  129   GGPGCSSLAYGAMLELGPFRIHSDGKTLYRNRFSWNHAANVLFLESPAGVGFSYSNRTSD  188

Query  572   Y-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQ  748
             Y  +GD+ TAADNY+FL+NWLERFPEYK R+ +I+GESYAGHYVPQLA  IL +NK  N+
Sbjct  189   YDASGDRNTAADNYVFLVNWLERFPEYKGREFYISGESYAGHYVPQLAHTILYHNKRANK  248

Query  749   TIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSS--AASPSDTC  922
             TIINLKGI IGNA I++ET   G YD+  +HA+ISD+T   I   CNF+          C
Sbjct  249   TIINLKGIIIGNAVINDETDTKGMYDYLASHAIISDKTANVINNYCNFAPNVKTDQRKEC  308

Query  923   DTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQ  1102
                 DDA +    +  YNIYAP C   + L++   + S   FDPCS DY+Y YLN P+VQ
Sbjct  309   SDATDDAAKDTYYVDIYNIYAPSC-LSTNLTAKPKRTSIFKFDPCSEDYVYAYLNRPDVQ  367

Query  1103  KALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVT  1282
             +ALHANVT +   W+ CS DV + W D   TVLP + E + +G+ +W++SGDIDG+V VT
Sbjct  368   QALHANVTKLSHDWEPCS-DV-ITWGDSASTVLPLLHEFLENGLRLWIFSGDIDGRVPVT  425

Query  1283  TTTYAINKLNTSVKTPWYPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTF  1459
             +T Y+++K+N  VKT W+ W+ S    G        L+F T+R AGH VPSYQP R L+ 
Sbjct  426   STKYSLDKMNLPVKTEWHAWFLSGEVAGYTQEFKGGLTFATVRQAGHQVPSYQPARGLSL  485

Query  1460  FSAFVEGKLPP  1492
                F++G   P
Sbjct  486   IKHFLDGTPLP  496



>emb|CDP16351.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   435 bits (1119),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 249/427 (58%), Positives = 300/427 (70%), Gaps = 9/427 (2%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESE---TPSDKPLVLW  385
             Q GLK+ D+I  LPGQP  V F Q+ GY+T++  AGRA FYYF E++    P D PL+LW
Sbjct  64    QKGLKEKDRIDRLPGQPH-VGFKQYGGYITINETAGRAFFYYFVEAQGRKKPEDVPLLLW  122

Query  386   LnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRS  565
             LNGGPGCSS   G   E GPFRV S+ KTL+ N++AWN VANV+FLESPAGVGFSYSN +
Sbjct  123   LNGGPGCSSLAYGAFQELGPFRVGSNGKTLFKNRFAWNYVANVLFLESPAGVGFSYSNTT  182

Query  566   SDYVTG-DKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKIT  742
             SD+V+G D+KTAADNYIFLLNWLERFPEYK RD +I+GESYAGHYVPQLA  I+ +NK  
Sbjct  183   SDFVSGGDRKTAADNYIFLLNWLERFPEYKNRDFYISGESYAGHYVPQLAHNIVYHNKKA  242

Query  743   NQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTC  922
             N+TIINLKGI IGNA I++ T D G YD++ +HALIS ET + I   CNFS A   S  C
Sbjct  243   NRTIINLKGILIGNAVINDATDDPGMYDYFASHALISPETVKKIHKFCNFSEAEL-SANC  301

Query  923   DTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQ  1102
                +  AD     +  YNIY P C     L+S   Q S   FD CS  Y + Y N P VQ
Sbjct  302   QNILSVADGVFDEVDIYNIYYPRC-FDDSLTSVPKQFSILEFDECSEYYGHSYFNHPNVQ  360

Query  1103  KALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVT  1282
             +ALHANVT IP  W  CS DV  NW D   TVLP +KE + +G+ VW++SGD+DG+V VT
Sbjct  361   EALHANVTKIPYDWQPCS-DVLQNWTDWQSTVLPFLKEFLANGLKVWIFSGDVDGRVPVT  419

Query  1283  TTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeD-LSFVTIRGAGHFVPSYQPERALTF  1459
              + YAI  LN S+ TPW PWY   EVGGYV  Y+D L+FVT+RGAGH VPSY+P+RAL+ 
Sbjct  420   GSQYAIEALNVSIVTPWQPWYRDLEVGGYVQIYQDNLTFVTVRGAGHQVPSYKPDRALSL  479

Query  1460  FSAFVEG  1480
              S F+ G
Sbjct  480   ISHFISG  486



>ref|NP_001060508.1| Os07g0656900 [Oryza sativa Japonica Group]
 dbj|BAF22422.1| Os07g0656900, partial [Oryza sativa Japonica Group]
Length=444

 Score =   433 bits (1114),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 240/437 (55%), Positives = 294/437 (67%), Gaps = 16/437 (4%)
 Frame = +2

Query  227   KDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESE----TPSDKPLVLWLng  394
             K+AD+++ LPGQP GV FAQ++GYVTVD  AGRALFYY AE++      S  PL+LWLNG
Sbjct  1     KEADRVAGLPGQPAGVGFAQYAGYVTVDAAAGRALFYYLAEADGGAAASSKAPLLLWLNG  60

Query  395   gpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY  574
             GPGCSS G G M E GPFRV SD  +L+ N Y+WNNVANV+FLESP GVGFSYSN ++DY
Sbjct  61    GPGCSSLGYGAMEELGPFRVKSDGVSLYRNPYSWNNVANVMFLESPIGVGFSYSNTTADY  120

Query  575   V-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKIT---  742
                GD  TA D Y FL+NW+ERFPEYK RD ++ GESYAGHYVPQLA  ILR++      
Sbjct  121   SRMGDNSTAEDAYKFLVNWMERFPEYKGRDFYLAGESYAGHYVPQLAHAILRHSSAAAGG  180

Query  743   --NQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSD  916
               + + INLKGI IGNA I++ T   G YDF+WTHALISDE + GI  +CNF+  A  + 
Sbjct  181   KPSSSPINLKGIMIGNAVINDWTDTKGMYDFFWTHALISDEANDGITKHCNFTDGADANS  240

Query  917   TCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPE  1096
              CD     AD  + +I  YNIYAP C S   + S  V  S   FDPC+  Y+  YLN P+
Sbjct  241   LCDDATSLADDCLQDIDIYNIYAPNCQSPGLVVSPPVTPSIESFDPCTDYYVEAYLNNPD  300

Query  1097  VQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVA  1276
             VQKALHAN+T +  PW +CS  V   W D   TVLP IKEL+ + I VW+YSGD DG+V 
Sbjct  301   VQKALHANITRLDHPWSACS-GVLRRWVDSASTVLPIIKELLKNNIRVWVYSGDTDGRVP  359

Query  1277  VTTTTYAINKLNTSVKTPWYPWYSKgevgg-----yvvgyeDLSFVTIRGAGHFVPSYQP  1441
             VT++ Y++N+LN  V   W PW+S  +  G      V    +LS VT+RGAGH VPSYQP
Sbjct  360   VTSSRYSVNQLNLPVAAKWRPWFSNTQGVGDVGGYIVQYKGNLSLVTVRGAGHEVPSYQP  419

Query  1442  ERALTFFSAFVEGKLPP  1492
             +RAL     F+EGK  P
Sbjct  420   QRALVLVQYFLEGKTLP  436



>ref|XP_008802653.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase II-3-like 
[Phoenix dactylifera]
Length=490

 Score =   435 bits (1119),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 246/432 (57%), Positives = 298/432 (69%), Gaps = 13/432 (3%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSD---KPLVLW  385
             Q GLK+ DKIS LPGQPEGV F Q+ GYVTVD ++GRALFYYFAE+   +D   KPLVLW
Sbjct  65    QQGLKENDKISKLPGQPEGVDFDQYGGYVTVDAESGRALFYYFAEAAASADTSSKPLVLW  124

Query  386   LnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRS  565
             LNGGPGCSS G G M E GPFRV SD KTL+ N YAWN VANV+FLESPAGVGFSYSN +
Sbjct  125   LNGGPGCSSLGYGAMEELGPFRVMSDGKTLFRNPYAWNRVANVLFLESPAGVGFSYSNTT  184

Query  566   SDY-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKIT  742
             SDY  +GD +TAAD Y+FL NW+ERFPEYK RD FI GESY GHYVPQLA  IL++    
Sbjct  185   SDYDKSGDSRTAADAYVFLENWMERFPEYKGRDFFIAGESYGGHYVPQLAHTILQH----  240

Query  743   NQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFS-SAASPSDT  919
             N T INL+GI IGN  I+ ET   G +D++WTHALISDET   I   CNFS  A +    
Sbjct  241   NNTSINLRGIMIGNGVINAETDSKGMFDYFWTHALISDETIDAIHKYCNFSPDAVNQPKQ  300

Query  920   CDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEV  1099
             CD  ++  +     +  YNIYAP C   SG++ S  + S + FDPC+ DY+  YLN  EV
Sbjct  301   CDQALEVTNNVFETLDIYNIYAPLC-FSSGVTPSPKRYSIKNFDPCTDDYVSAYLNIAEV  359

Query  1100  QKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAV  1279
             Q+A HANVT +   W +C     + W D P TVLP IKE M + I VW+YSGD+DG+V V
Sbjct  360   QEAFHANVTKLNYTWSACRH--FMQWTDSPYTVLPLIKECMANDIRVWVYSGDVDGRVPV  417

Query  1280  TTTTYAINKLNTSVKTPWYPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALT  1456
             T++ Y++N+LN  VKT W PW+ +K   G  V+  ++L+F T+RGAGH VPSYQ  R L 
Sbjct  418   TSSRYSLNQLNLLVKTEWQPWFINKEVGGYSVIYDDNLTFATVRGAGHEVPSYQALRVLV  477

Query  1457  FFSAFVEGKLPP  1492
                 F+EGK  P
Sbjct  478   LVKFFLEGKPLP  489



>ref|XP_003557803.1| PREDICTED: serine carboxypeptidase-like 27 [Brachypodium distachyon]
Length=496

 Score =   435 bits (1119),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 249/471 (53%), Positives = 323/471 (69%), Gaps = 17/471 (4%)
 Frame = +2

Query  101   KFDPLESLLK--TQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQPEGV  274
             +FD L    K   +KQ    NN  T         SV+ G QD L++ DKI A+PGQ E V
Sbjct  37    EFDQLNISTKYVPEKQHASMNNGTTS-------PSVHNGLQDYLREKDKIRAMPGQLEEV  89

Query  275   KFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMENGPFR  451
             +F Q++GY+TVD  AGRALFYYF E+   P +KPLVLWLNGGPGCSSFG G M+E GPF 
Sbjct  90    EFDQYAGYITVDANAGRALFYYFVEAPRDPLNKPLVLWLNGGPGCSSFGAGAMLELGPFS  149

Query  452   VNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYV-TGDKKTAADNYIFLLNW  628
             V+SD+KTL+  ++AWN VAN++F+E PAGVG+SYSN +SDY  TGDK+T  D Y FL+NW
Sbjct  150   VHSDNKTLYKKRHAWNTVANMLFVEIPAGVGYSYSNTTSDYHNTGDKRTTEDAYSFLVNW  209

Query  629   LERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQ  808
             +ERFPEY+ RD FI+GESYAGHYVP+LA LI+ NN+ +N T + L+G+AIGNA + +   
Sbjct  210   MERFPEYRDRDFFISGESYAGHYVPELANLIVSNNRDSNATSVMLRGVAIGNADLHDNLT  269

Query  809   DSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAP  988
                ++D+YW HA+IS +T+R I ANC F+     ++ C   ++ A +  GN+  YN+YAP
Sbjct  270   LRASFDYYWMHAMISGKTYRTIQANCGFNETY--TNDCLNAMNLAIKEKGNVDDYNVYAP  327

Query  989   FCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDV-  1165
              C   S    SS        DPC++ Y+  YLN  EVQ+ LHAN TG+  PW  CSQ V 
Sbjct  328   QCHDASNPPRSSDSVVFG--DPCTNHYVSSYLNRLEVQRTLHANTTGLSYPWMDCSQLVF  385

Query  1166  -NVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPW  1342
              N NW+D P+T+LP+IK+L+ SG  VWLYSGD+D   +VT+T YA++ L    +T W PW
Sbjct  386   DNWNWKDSPETMLPSIKKLISSGTRVWLYSGDMDAVCSVTSTQYALDILGLPTETSWRPW  445

Query  1343  YSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPK  1495
                 EV GYVVGY+ L F T++GAGH VP YQP RAL  FS+F+EGKLPP+
Sbjct  446   RIDNEVAGYVVGYKGLVFATVKGAGHMVPYYQPRRALAMFSSFLEGKLPPQ  496



>ref|XP_010067796.1| PREDICTED: serine carboxypeptidase-like 40 isoform X1 [Eucalyptus 
grandis]
 gb|KCW66004.1| hypothetical protein EUGRSUZ_G03295 [Eucalyptus grandis]
Length=502

 Score =   435 bits (1119),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 248/437 (57%), Positives = 299/437 (68%), Gaps = 7/437 (2%)
 Frame = +2

Query  206   IGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK-PLVL  382
             + +Q GLK  DKI  LPGQP  V+F  + GYVTVD  AGRA FYYF E+    D  PL+L
Sbjct  69    LHSQKGLKGKDKIWRLPGQPP-VEFNHYGGYVTVDKLAGRAFFYYFVEALRDKDSLPLLL  127

Query  383   WLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNR  562
             WLNGGPGCSS   G M E GPFRV+SD KTL+ NK+AWN  ANV+FLESPAGVGFSYSN 
Sbjct  128   WLNGGPGCSSLAYGAMQELGPFRVHSDGKTLYRNKFAWNIAANVLFLESPAGVGFSYSNT  187

Query  563   SSDYVT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKI  739
             +SDY T GD+KTA DNY+F+LNWLERFPEYK RDL+++GESYAGHYVPQLA  IL +NK 
Sbjct  188   TSDYSTNGDRKTAEDNYVFILNWLERFPEYKNRDLYLSGESYAGHYVPQLAHDILHHNKE  247

Query  740   TNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASP-SD  916
              N+T+INLKGI IGNA ID+E    G YD+  THALI DET   I   CNFS+ AS  S 
Sbjct  248   ANRTVINLKGIIIGNAVIDDEADLRGMYDYLVTHALIPDETWSKIQKYCNFSANASAQSS  307

Query  917   TCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPE  1096
              C +  DDAD  + ++  YNIYAP C S S L+S   + S   FDPCS DY++ Y+N  E
Sbjct  308   RCISAADDADDDVSSLDMYNIYAPLC-SSSNLTSIPKKASIMKFDPCSEDYVHAYMNRAE  366

Query  1097  VQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVA  1276
             VQ+ LHANVT +   W+ CS DV   W D P T+LP + EL+  G+ VW++SGD DG V 
Sbjct  367   VQERLHANVTKLKFDWEPCS-DVIQKWGDSPHTILPLLHELLSHGLRVWVFSGDTDGVVP  425

Query  1277  VTTTTYAINKLNTSVKTPWYPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERAL  1453
             VT+T  +++K+    K PW PWY      G   V   DL+FVT+RGAGH VPSYQP RAL
Sbjct  426   VTSTKKSLHKMGLPTKRPWRPWYVGGEVGGYVQVYEGDLTFVTVRGAGHQVPSYQPRRAL  485

Query  1454  TFFSAFVEGKLPPKSAE  1504
             +  S F+ G   P   +
Sbjct  486   SLVSHFLSGSSLPSQQQ  502



>ref|XP_007224867.1| hypothetical protein PRUPE_ppa022742mg [Prunus persica]
 gb|EMJ26066.1| hypothetical protein PRUPE_ppa022742mg [Prunus persica]
Length=480

 Score =   434 bits (1117),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 251/465 (54%), Positives = 309/465 (66%), Gaps = 27/465 (6%)
 Frame = +2

Query  146   RQNNNAQTIIMSAQDLGS----------VYIGAQDGLKDADKISALPGQPEG-VKFAQFS  292
             + NN  + +I S +  G+          VY+G+Q+GL +ADKI ALPGQP G V F Q++
Sbjct  24    QTNNLIKKLIKSRKSAGNPKSWDGLYSPVYVGSQEGLMEADKIEALPGQPAGEVNFNQYA  83

Query  293   GYVTVDPQAGRALFYYFAESETPSDKPLVLWLngg-pgcssfgnggMMENGPFRVNSDSK  469
             GYVTVDP AGRALFYYF E+   S  PLVL L+GG  GCS+FG G + E GPFRV +D+K
Sbjct  84    GYVTVDPTAGRALFYYFVEANNSSSNPLVLSLHGGPEGCSAFGYGALQELGPFRVGNDNK  143

Query  470   TLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVT-GDKKTAADNYIFLLNWLERFPE  646
             TL  N YAWNN ANV+FLE+P G GFSYSN+SSDY T GD+ TA D+Y FL+NWLERFP+
Sbjct  144   TLIPNDYAWNNAANVLFLETPLGTGFSYSNKSSDYHTVGDEITAQDSYAFLVNWLERFPQ  203

Query  647   YKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDSGTYD  826
             YK  D FITGESYAGHY P+LA +IL NN ITNQT INLKG+AIGN +ID  T     +D
Sbjct  204   YKDSDFFITGESYAGHYAPELAYIILSNNNITNQTKINLKGVAIGNPWIDLNTALLALFD  263

Query  827   FYWTHALISDETHRGIIANCNFSS-AASPSDTCDTFVDDADRSMG-NIYSYNIYAPFCss  1000
              +WTHAL SDET+ GI   CN +      S  C  ++      +G +I   NIYAP C  
Sbjct  264   NFWTHALNSDETNAGIHKYCNLTDFGGKQSKVCGEYLQQGFEEVGEDIDLSNIYAPIC--  321

Query  1001  gsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWE  1180
                 S  S   S   FDPCS  Y+  YLN PEVQ ALH      P  W +CS   + +W 
Sbjct  322   --KTSQDSQPKSVDDFDPCSDIYVEAYLNLPEVQAALHVK----PTTWSACS---DTDWT  372

Query  1181  DMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgev  1360
             D PDT+LPTI++++ SGIS W+YSGD DG  +VT++ YA++ LN  +KTPW PWYS    
Sbjct  373   DSPDTMLPTIQQIIQSGISFWIYSGDTDGFFSVTSSRYALHILNLPIKTPWRPWYSNSRE  432

Query  1361  ggyvvgyeD-LSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
              G  V   + L+F T+RGAG  VPS QP+RALT  S+F+EGKLPP
Sbjct  433   VGGYVVGYEGLTFATVRGAGIMVPSNQPQRALTLISSFLEGKLPP  477



>ref|XP_009392029.1| PREDICTED: putative serine carboxypeptidase-like 23 [Musa acuminata 
subsp. malaccensis]
Length=515

 Score =   436 bits (1120),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 253/465 (54%), Positives = 309/465 (66%), Gaps = 24/465 (5%)
 Frame = +2

Query  122   LLKTQKQK----RQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQPEGVKFAQF  289
             LL+  + K     Q ++   +  S+++L +VY+  Q GLKD DKI  LPGQPEG    Q+
Sbjct  62    LLRMMRSKWSPAAQQDSLFRLSNSSKELPAVYVAPQHGLKDLDKIDRLPGQPEGQSINQY  121

Query  290   SGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMENGPFRVNSDS  466
             +GYVTVD   GRALFYYF ES E  + KPLVLWLNGGPGCSS G G M E GPFRVNSD 
Sbjct  122   AGYVTVDHHNGRALFYYFVESPEDQAKKPLVLWLNGGPGCSSLGYGAMEELGPFRVNSDG  181

Query  467   KTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVT-GDKKTAADNYIFLLNWLERFP  643
             KTL  N ++W +VAN+IFLESPAGVGFSYSN +SDY + GD++TA D+Y FL+NWLERF 
Sbjct  182   KTLRENDHSWIDVANIIFLESPAGVGFSYSNTTSDYRSNGDRRTAEDSYTFLVNWLERFQ  241

Query  644   EYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDSGTY  823
             EYK+ D FITGESY GHYVPQLA LILRNN   NQ+ INLKGIAIGNAYID    +   Y
Sbjct  242   EYKSHDFFITGESYGGHYVPQLASLILRNNMKMNQSTINLKGIAIGNAYIDRNINEIEMY  301

Query  824   DFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFCssg  1003
             +F W HA+ SD+TH+ I   CN S   S    C   +  A R  G I  YN+YAP C   
Sbjct  302   EFLWAHAMFSDDTHKLIQKQCNGSDTFSLE--CQDAMFQARRETGEINLYNVYAPRC---  356

Query  1004  sglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWED  1183
                  S+    +  +DPC  DY+  YLN  +VQKALHA    +P  W  CS  V   W D
Sbjct  357   -----SAWARENEEYDPCDDDYVRSYLNDEKVQKALHA----VPTGWGHCSSMV---WTD  404

Query  1184  MPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevg  1363
                ++L  IK+L   G+ VWLYSGDID  V VT+T  ++N L+  ++  W PWY   EVG
Sbjct  405   TTVSMLAMIKKLSTRGLRVWLYSGDIDAVVPVTSTKASLNMLDLPIRRAWLPWYIDHEVG  464

Query  1364  gyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEG-KLPPK  1495
             GYVV Y+ ++FVT+RGAGH VPSYQPER+L   +AF++G  LPPK
Sbjct  465   GYVVEYKGITFVTVRGAGHEVPSYQPERSLAMITAFLQGTSLPPK  509



>ref|XP_002272961.1| PREDICTED: serine carboxypeptidase-like 40 isoform X1 [Vitis 
vinifera]
Length=504

 Score =   435 bits (1118),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 244/482 (51%), Positives = 320/482 (66%), Gaps = 16/482 (3%)
 Frame = +2

Query  95    GRKFDPLESLLKTQKQKRQNNNAQTI-------IMSAQDLGSVYIGAQDGLKDADKISAL  253
             G+    +E+L   QK K   N+           + +  +  S  I  Q+GLK+ D+I  L
Sbjct  26    GKTMKQIEALDILQKAKLHGNSGIDTNLFEVNEVENGAETESHKIHPQEGLKEKDRIDML  85

Query  254   PGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDKPLVL-WLnggpgcssfgnggM  430
             PGQP  V F+Q+ GYVT+D   G+AL+YYFAE+        +L WLNGGPGCSS   G M
Sbjct  86    PGQPH-VGFSQYGGYVTIDESKGKALYYYFAEAPLSKKSLPLLLWLNGGPGCSSLAYGAM  144

Query  431   MENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVTG-DKKTAADN  607
              E GPFRV+S+ KTL+ N+YAWN VANV+FLESPAGVGFSYSN +SDY  G D+KTA DN
Sbjct  145   QELGPFRVHSEGKTLYRNQYAWNKVANVLFLESPAGVGFSYSNTTSDYRNGGDRKTAKDN  204

Query  608   YIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNA  787
             Y FL+NWLERFPEYK RD +I+GESYAGHYVPQLA  IL +NK  +  IINLKGI IGNA
Sbjct  205   YAFLVNWLERFPEYKKRDFYISGESYAGHYVPQLAHTILHHNKKADGPIINLKGIIIGNA  264

Query  788   YIDEETQDSGTYDFYWTHALISDETHRGIIANCNFS-SAASPSDTCDTFVDDADRSMGNI  964
              I++ET + G Y ++ +HAL+S++T R +  +CNFS  AAS S  C    D+ D ++  I
Sbjct  265   VINDETDELGMYQYFGSHALVSEKTIRQMEKHCNFSPGAASQSKECTKASDEVDDNIDVI  324

Query  965   YSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPW  1144
               YNIYAP C   +   +   +  +  FDPCS  Y+Y YLN  +VQKALHANVT +   W
Sbjct  325   DIYNIYAPLC--FNTNLTVKPKKVTPEFDPCSDYYVYAYLNRADVQKALHANVTKLKYDW  382

Query  1145  DSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVK  1324
             + CS DV  NW D P T++P + E M +G+ VW++SGD DG+V VT+T  +I+ +  SVK
Sbjct  383   EPCS-DVIQNWTDSPSTIIPLLHEFMENGLRVWVFSGDTDGRVPVTSTMASIDTMKLSVK  441

Query  1325  TPWYPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGK-LPPKS  1498
             TPW+PW+ +    G   V   DL+F T+RGAGH VPS++P+RAL+  S F+ G  LP +S
Sbjct  442   TPWHPWFVAGEVGGYTEVYKGDLTFATVRGAGHQVPSFRPKRALSLISHFLSGTPLPRRS  501

Query  1499  AE  1504
             ++
Sbjct  502   SK  503



>dbj|BAC16131.1| putative serine carboxypeptidase II-3 precursor [Oryza sativa 
Japonica Group]
Length=524

 Score =   436 bits (1120),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 242/439 (55%), Positives = 296/439 (67%), Gaps = 16/439 (4%)
 Frame = +2

Query  221   GLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESE----TPSDKPLVLWL  388
             G K+AD+++ LPGQP GV FAQ++GYVTVD  AGRALFYY AE++      S  PL+LWL
Sbjct  79    GSKEADRVAGLPGQPAGVGFAQYAGYVTVDAAAGRALFYYLAEADGGAAASSKAPLLLWL  138

Query  389   nggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSS  568
             NGGPGCSS G G M E GPFRV SD  +L+ N Y+WNNVANV+FLESP GVGFSYSN ++
Sbjct  139   NGGPGCSSLGYGAMEELGPFRVKSDGVSLYRNPYSWNNVANVMFLESPIGVGFSYSNTTA  198

Query  569   DYV-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKIT-  742
             DY   GD  TA D Y FL+NW+ERFPEYK RD ++ GESYAGHYVPQLA  ILR++    
Sbjct  199   DYSRMGDNSTAEDAYKFLVNWMERFPEYKGRDFYLAGESYAGHYVPQLAHAILRHSSAAA  258

Query  743   ----NQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASP  910
                 + + INLKGI IGNA I++ T   G YDF+WTHALISDE + GI  +CNF+  A  
Sbjct  259   GGKPSSSPINLKGIMIGNAVINDWTDTKGMYDFFWTHALISDEANDGITKHCNFTDGADA  318

Query  911   SDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNT  1090
             +  CD     AD  + +I  YNIYAP C S   + S  V  S   FDPC+  Y+  YLN 
Sbjct  319   NSLCDDATSLADDCLQDIDIYNIYAPNCQSPGLVVSPPVTPSIESFDPCTDYYVEAYLNN  378

Query  1091  PEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGK  1270
             P+VQKALHAN+T +  PW +CS  V   W D   TVLP IKEL+ + I VW+YSGD DG+
Sbjct  379   PDVQKALHANITRLDHPWSACS-GVLRRWVDSASTVLPIIKELLKNNIRVWVYSGDTDGR  437

Query  1271  VAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvg-----yeDLSFVTIRGAGHFVPSY  1435
             V VT++ Y++N+LN  V   W PW+S  +  G V G       +LS VT+RGAGH VPSY
Sbjct  438   VPVTSSRYSVNQLNLPVAAKWRPWFSNTQGVGDVGGYIVQYKGNLSLVTVRGAGHEVPSY  497

Query  1436  QPERALTFFSAFVEGKLPP  1492
             QP+RAL     F+EGK  P
Sbjct  498   QPQRALVLVQYFLEGKTLP  516



>dbj|BAK01526.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=510

 Score =   435 bits (1119),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 242/438 (55%), Positives = 296/438 (68%), Gaps = 17/438 (4%)
 Frame = +2

Query  212   AQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSD-----KPL  376
             A+ G K+AD++ ALPGQP GV FAQ++GYVTVD  AGRALFYY AE+   +      KP 
Sbjct  74    AEAGSKEADRVDALPGQPRGVDFAQYAGYVTVDAAAGRALFYYLAEAAGGNGNGNKPKPF  133

Query  377   VLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYS  556
             +LWLNGGPGCSS G G M E GPFRV SD KTL+ N Y+WN  ANV+FLESPAGVG+SYS
Sbjct  134   LLWLNGGPGCSSLGYGAMEELGPFRVMSDGKTLYRNPYSWNRAANVLFLESPAGVGYSYS  193

Query  557   NRSSDY-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNN  733
             N ++DY  +GD +TA D YIFL++WL+RFPEYK R+ +I GESYAGH+ PQLA  ILR+ 
Sbjct  194   NTTADYDRSGDNRTAEDAYIFLVSWLQRFPEYKGREFYIAGESYAGHFAPQLAHAILRHA  253

Query  734   KITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPS  913
                    INLKG+ IGNA I++ T   GT+DFYWTHALISDET  G+  NCNF++ A  +
Sbjct  254   S----PAINLKGVMIGNAVINDGTDKKGTFDFYWTHALISDETADGVSRNCNFTNGAESN  309

Query  914   DTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTP  1093
             D CD   DD   ++ NI +YNIYAP C    GL +  +  S   FD C+S+Y+  YLN P
Sbjct  310   DLCDEANDDVVENLRNIDNYNIYAPNC-QTEGLVTPPITPSVESFDTCTSNYVEAYLNKP  368

Query  1094  EVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKV  1273
             +VQKALHANVT +  PW +CS+ V   W D   TVLP I+ELM + I VW+YSGD DG V
Sbjct  369   DVQKALHANVTRLDRPWLACSE-VFTRWVDSAATVLPIIRELMENNIRVWVYSGDTDGNV  427

Query  1274  AVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvg-----yeDLSFVTIRGAGHFVPSYQ  1438
              VT T Y+IN+L   V   W  W+S  +  G V G        LS VT+RGAGH VPSYQ
Sbjct  428   PVTATRYSINQLQLPVAVKWRRWFSSTKGAGEVGGYVVQYKGGLSLVTVRGAGHEVPSYQ  487

Query  1439  PERALTFFSAFVEGKLPP  1492
             P+RAL     F+ G   P
Sbjct  488   PQRALQLLQGFLAGTTLP  505



>ref|NP_001050257.1| Os03g0386800 [Oryza sativa Japonica Group]
 dbj|BAF12171.1| Os03g0386800, partial [Oryza sativa Japonica Group]
Length=460

 Score =   433 bits (1114),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 233/429 (54%), Positives = 303/429 (71%), Gaps = 4/429 (1%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLn  391
             QD L++ D++ A+PGQ E  +F Q++GYVTVD +AGRALFYYF E+   P  KPLVLWLN
Sbjct  34    QDDLREKDRVRAMPGQMEEAEFNQYAGYVTVDAKAGRALFYYFVEAPHDPLKKPLVLWLN  93

Query  392   ggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSD  571
             GGPGCSSFG G M+E GPF V SD+KTL+  ++AWN VAN++F++ PAGVG+SYSN +SD
Sbjct  94    GGPGCSSFGAGAMLELGPFSVRSDNKTLYNKQHAWNTVANMLFVDVPAGVGYSYSNTTSD  153

Query  572   YVT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQ  748
             Y   GDKKT  D YIFL+NW+++FPEY+  D FITGESYAGHY+P+LA LI+ NN+  N 
Sbjct  154   YYNIGDKKTTDDAYIFLINWMKKFPEYQGHDFFITGESYAGHYIPELANLIVSNNRAINS  213

Query  749   TIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDT  928
             T I LKG+AIGNA + +      ++D+YW HA+ISD  +R I  +C F+   + ++ C  
Sbjct  214   TNIKLKGVAIGNADLHDNVTLRASFDYYWRHAMISDRVYRAIQTSCGFNE--TYTNDCQN  271

Query  929   FVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKA  1108
              ++ A++  GN+  YNIYAP C   S  S S    S    DPC++ Y+  YLN PEVQ+A
Sbjct  272   AMNLANKEKGNVDDYNIYAPQCHDASNPSPSGSSDSVAFGDPCTNHYVSSYLNNPEVQRA  331

Query  1109  LHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTT  1288
             LHAN TG+  PW  CS  +  NW+D P+T+LP+IK L+ SG  +WLYSGD+D   +VT+T
Sbjct  332   LHANTTGLNYPWMDCSGLIFDNWKDSPETMLPSIKTLISSGTRIWLYSGDMDAVCSVTST  391

Query  1289  TYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSA  1468
              YA++ L   V+T W PW    EV GYVVGY  L F T+RGAGH VP YQP RAL   S+
Sbjct  392   QYALDILGLPVETSWRPWRIDNEVAGYVVGYRGLVFATVRGAGHMVPYYQPRRALALLSS  451

Query  1469  FVEGKLPPK  1495
             F+EGKLPP+
Sbjct  452   FLEGKLPPE  460



>gb|AAT78817.1| putative serine carboxypeptidase [Oryza sativa Japonica Group]
 gb|ABF96316.1| Serine carboxypeptidase family protein, expressed [Oryza sativa 
Japonica Group]
Length=478

 Score =   434 bits (1115),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 233/429 (54%), Positives = 303/429 (71%), Gaps = 4/429 (1%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLn  391
             QD L++ D++ A+PGQ E  +F Q++GYVTVD +AGRALFYYF E+   P  KPLVLWLN
Sbjct  52    QDDLREKDRVRAMPGQMEEAEFNQYAGYVTVDAKAGRALFYYFVEAPHDPLKKPLVLWLN  111

Query  392   ggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSD  571
             GGPGCSSFG G M+E GPF V SD+KTL+  ++AWN VAN++F++ PAGVG+SYSN +SD
Sbjct  112   GGPGCSSFGAGAMLELGPFSVRSDNKTLYNKQHAWNTVANMLFVDVPAGVGYSYSNTTSD  171

Query  572   YVT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQ  748
             Y   GDKKT  D YIFL+NW+++FPEY+  D FITGESYAGHY+P+LA LI+ NN+  N 
Sbjct  172   YYNIGDKKTTDDAYIFLINWMKKFPEYQGHDFFITGESYAGHYIPELANLIVSNNRAINS  231

Query  749   TIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDT  928
             T I LKG+AIGNA + +      ++D+YW HA+ISD  +R I  +C F+   + ++ C  
Sbjct  232   TNIKLKGVAIGNADLHDNVTLRASFDYYWRHAMISDRVYRAIQTSCGFNE--TYTNDCQN  289

Query  929   FVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKA  1108
              ++ A++  GN+  YNIYAP C   S  S S    S    DPC++ Y+  YLN PEVQ+A
Sbjct  290   AMNLANKEKGNVDDYNIYAPQCHDASNPSPSGSSDSVAFGDPCTNHYVSSYLNNPEVQRA  349

Query  1109  LHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTT  1288
             LHAN TG+  PW  CS  +  NW+D P+T+LP+IK L+ SG  +WLYSGD+D   +VT+T
Sbjct  350   LHANTTGLNYPWMDCSGLIFDNWKDSPETMLPSIKTLISSGTRIWLYSGDMDAVCSVTST  409

Query  1289  TYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSA  1468
              YA++ L   V+T W PW    EV GYVVGY  L F T+RGAGH VP YQP RAL   S+
Sbjct  410   QYALDILGLPVETSWRPWRIDNEVAGYVVGYRGLVFATVRGAGHMVPYYQPRRALALLSS  469

Query  1469  FVEGKLPPK  1495
             F+EGKLPP+
Sbjct  470   FLEGKLPPE  478



>ref|XP_009592799.1| PREDICTED: serine carboxypeptidase-like 40 [Nicotiana tomentosiformis]
Length=616

 Score =   438 bits (1126),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 240/431 (56%), Positives = 292/431 (68%), Gaps = 7/431 (2%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLng  394
             Q+GLKD D+I  LPGQP  VKF Q+ GYVTV+  AGRALFYYF E+E     PL+LWLNG
Sbjct  67    QEGLKDKDQIKRLPGQPP-VKFKQYGGYVTVNESAGRALFYYFVEAENSKSLPLLLWLNG  125

Query  395   gpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY  574
             GPGCSS   G M E GPFRV+S+ KTL+ N YAWN+ ANV+FLESPAGVGFSYSN SSD 
Sbjct  126   GPGCSSIAYGAMEELGPFRVHSNGKTLYRNHYAWNHEANVLFLESPAGVGFSYSNTSSDV  185

Query  575   VT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQT  751
              + GD+ TA DN IFLLNW++RFPEYK RD +I GESYAGH+VPQLAQ IL +NK+  +T
Sbjct  186   KSNGDRTTAVDNVIFLLNWIQRFPEYKNRDFYIAGESYAGHFVPQLAQGILHHNKLPKKT  245

Query  752   IINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASP-SDTCDT  928
              INLKGI IGNA I+ ET   G Y+++ +HALI DE    I   CNFS  A P S  CD 
Sbjct  246   FINLKGIMIGNAVINYETDRKGMYEYHASHALIPDEILEQIERYCNFSDKALPQSQECDN  305

Query  929   FVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKA  1108
              +D A      I  YNIYAP C   +   +   + +S+  DPCS DY+  Y+N P+VQK 
Sbjct  306   AIDIAIADTEPIDVYNIYAPLC--SNSELTLQPKKTSQVIDPCSDDYVIAYMNRPDVQKL  363

Query  1109  LHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTT  1288
             LHANVT I   W  CS DV  +W D P T++P +KELM +G+ VW++SGD DG V VT+T
Sbjct  364   LHANVTKIKYNWQPCS-DVIESWTDSPLTIIPLLKELMENGVRVWIFSGDTDGIVPVTST  422

Query  1289  TYAINKLNTSVKTPWYPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFS  1465
               +I K+    KTPWYPW+ +    G   V   +L+F T+RGAGH VPSYQP RAL+   
Sbjct  423   KKSIKKMKLLTKTPWYPWFHNDEVGGYAQVYIGNLTFATVRGAGHQVPSYQPARALSLVK  482

Query  1466  AFVEGKLPPKS  1498
              F+ G   P S
Sbjct  483   HFLAGTELPNS  493



>gb|AES59495.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=491

 Score =   434 bits (1115),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 247/442 (56%), Positives = 311/442 (70%), Gaps = 15/442 (3%)
 Frame = +2

Query  185   QDLGSVYIGAQDGLKD--ADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESET  358
             + +  V++  +  L+   +DK+ +LPGQP+GV F Q++GY+TVD +A R LFYYF ES +
Sbjct  57    EHVSKVHVNVEQHLRSRKSDKVKSLPGQPKGVNFDQYAGYITVDAKARRKLFYYFVESPS  116

Query  359   -PSDKPLVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPA  535
               S KPLVLWLNGGPGCSSFG G M E GPFRVNSD  TL   K AWN VANVIFLESP 
Sbjct  117   NSSTKPLVLWLNGGPGCSSFGYGAMQELGPFRVNSDGTTLSFIKDAWNVVANVIFLESPV  176

Query  536   GVGFSYSNRSSDYVT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLA  712
             GVGFSYS +  +    GDK TA D+YIFLLNWLERFP+YK RD FITGESYAGHYVPQLA
Sbjct  177   GVGFSYSKKPLNQTNIGDKNTARDSYIFLLNWLERFPQYKIRDFFITGESYAGHYVPQLA  236

Query  713   QLILRNNKI-TNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCN  889
              LIL NNK   N  +INLKGIA+GN +ID+     G YD++W HAL SD+TH+GI  +C+
Sbjct  237   HLILSNNKKRKNHKMINLKGIAVGNGWIDDNFCTKGMYDYFWMHALNSDQTHKGIEKHCD  296

Query  890   FSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDY  1069
             F    + ++ C  + + AD  +GNI  YNIYAP C+S +    +S   S+   DPC+ DY
Sbjct  297   FRKF-NVTNECVGYENIADDELGNIDVYNIYAPVCNSSATKYGASYSVSN--VDPCAEDY  353

Query  1070  IYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLY  1249
                YLN PEVQKALH   T     W  CS   +++W D P ++LPTI  L+ SGIS+W+Y
Sbjct  354   TTTYLNLPEVQKALHVKRT----KWSPCS---DLSWTDSPASILPTINGLISSGISIWMY  406

Query  1250  SGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVP  1429
             SGDIDG+V + +T Y+IN L   V+T W PWY+  EVGGYV+GY+ L+ +T+RGAGH VP
Sbjct  407   SGDIDGRVPIISTKYSINSLKLHVRTAWRPWYTGKEVGGYVIGYKGLTLITVRGAGHMVP  466

Query  1430  SYQPERALTFFSAFVEGKLPPK  1495
             + QP RALT  S+F+ G+LPP+
Sbjct  467   TDQPYRALTVISSFLLGQLPPQ  488



>ref|XP_008783276.1| PREDICTED: serine carboxypeptidase II-3-like [Phoenix dactylifera]
Length=485

 Score =   433 bits (1114),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 238/430 (55%), Positives = 298/430 (69%), Gaps = 11/430 (3%)
 Frame = +2

Query  212   AQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWL  388
             +Q GLK+ D+I  LPGQP GV F +++GYVTVD +AGRALFYYF  +    S KPL+LWL
Sbjct  63    SQQGLKENDRIEYLPGQPGGVDFDEYAGYVTVDQKAGRALFYYFVLAVGDSSSKPLLLWL  122

Query  389   nggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSS  568
             NGGPGCSS G G M E GPFRV SD KTL+ N +AWN VANV+FLESPAGVGFSYSN +S
Sbjct  123   NGGPGCSSLGYGAMQELGPFRVMSDGKTLFRNPFAWNRVANVLFLESPAGVGFSYSNTTS  182

Query  569   DYVT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITN  745
             DY   GD++TA DNY+FL+NW+ERFPEYK RD +I GESYAGH+VPQLA +IL+      
Sbjct  183   DYSKGGDRRTAEDNYVFLVNWMERFPEYKGRDFYIAGESYAGHFVPQLATIILQQKN---  239

Query  746   QTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSD-TC  922
               +INLKGI +GNA I++ T   G +D+ WTHALISDET   I   CNFS   +  +  C
Sbjct  240   -AVINLKGIMVGNAVINDATDSRGMFDYLWTHALISDETIDAIHKYCNFSPNTTNQEYRC  298

Query  923   DTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQ  1102
                +  A      +  YNIYAP C    G++++  + S R FDPCS +Y+YVYLN+ EVQ
Sbjct  299   GHAMSVAREVSRTLNIYNIYAPLC--SGGITNTPKRLSIRNFDPCSENYVYVYLNSAEVQ  356

Query  1103  KALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVT  1282
             + LHANVT +   W  CSQ +   W D P T+LP IKEL+   I VW+YSGDIDG+V VT
Sbjct  357   QKLHANVTKLNYTWSGCSQVIQ-QWSDSPSTILPLIKELIDRNIRVWIYSGDIDGRVPVT  415

Query  1283  TTTYAINKLNTSVKTPWYPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTF  1459
             +T Y+IN+L   VKT WYPWY      G  V  + +L+F T+RGAGH VPSYQ ++AL  
Sbjct  416   STRYSINQLMLLVKTQWYPWYIGSKAGGYSVSYHGNLTFATVRGAGHEVPSYQAQQALQL  475

Query  1460  FSAFVEGKLP  1489
              + F++G +P
Sbjct  476   VTFFLKGHIP  485



>dbj|BAJ94105.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=516

 Score =   434 bits (1116),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 244/440 (55%), Positives = 292/440 (66%), Gaps = 18/440 (4%)
 Frame = +2

Query  221   GLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES---ETPSDKPLVLWLn  391
             G K+AD++ ALPGQP GV FAQ++GYVTVD  AGRALFYY AE+        KPL+LWLN
Sbjct  79    GRKEADRVEALPGQPRGVDFAQYAGYVTVDAAAGRALFYYLAEAVGGNGDKPKPLLLWLN  138

Query  392   ggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSD  571
             GGPGCSS G G M E GPFRV SD KTL+ N Y+WN+ ANV+FLESPAGVG+SYSN ++D
Sbjct  139   GGPGCSSLGYGAMEELGPFRVMSDGKTLYSNPYSWNHAANVLFLESPAGVGYSYSNTTAD  198

Query  572   Y-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQ  748
             Y  +GD  TA D Y FL NWLERFPEYK R+ +ITGESYAGHYVPQLA  ILR+      
Sbjct  199   YGRSGDNGTAEDAYQFLANWLERFPEYKGREFYITGESYAGHYVPQLAHAILRH----AS  254

Query  749   TIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFS---SAASPSDT  919
               INLKGI IGNA I++ T   G YDF+WTHALISDET  GI  NCNF+   +  + +  
Sbjct  255   PAINLKGIMIGNAVINDWTDSKGMYDFFWTHALISDETADGISKNCNFTAYGAGVASNAL  314

Query  920   CDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEV  1099
             CD   D+   S+ +I  YNIYAP C     L +  +  S   FDPC+  Y+  YLN P+V
Sbjct  315   CDAASDEVGESLADIDIYNIYAPNC-QSEKLVTPPIAPSIDNFDPCTDYYVEAYLNRPDV  373

Query  1100  QKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAV  1279
             QKALHANVT +  PW +CS DV   W D   TVLP I+ELM + I VW+YSGD DG+V V
Sbjct  374   QKALHANVTRLDHPWSACS-DVLTRWVDSAKTVLPIIQELMKNSIRVWVYSGDTDGRVPV  432

Query  1280  TTTTYAINKLNTSVKTPWYPWYSKgevggy-----vvgyeDLSFVTIRGAGHFVPSYQPE  1444
             T++  ++N+L   V   W PW+S  +  G      V    DLS VT+RGAGH VPSYQP 
Sbjct  433   TSSRLSVNQLQLPVAAKWRPWFSSTKGAGEVGGYIVQYKGDLSLVTVRGAGHEVPSYQPR  492

Query  1445  RALTFFSAFVEGKLPPKSAE  1504
             RAL     F+ GK  P   E
Sbjct  493   RALVLVQNFLAGKALPDCKE  512



>ref|XP_011025637.1| PREDICTED: serine carboxypeptidase-like 40 [Populus euphratica]
Length=506

 Score =   432 bits (1111),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 236/431 (55%), Positives = 294/431 (68%), Gaps = 11/431 (3%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK---PLVLW  385
             Q G K+ D+I  LPGQP+ V F+Q+ GYVTV+  AG AL+YYF E++  S +   PL+LW
Sbjct  75    QKGSKEKDRIKMLPGQPQ-VNFSQYGGYVTVNESAGSALYYYFVEADQHSKEAALPLLLW  133

Query  386   LnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRS  565
             LNGGPGCSS G G M E GPFRV+S+ KTL+ NKY+WN VANV+FLESPAGVGFSYSN +
Sbjct  134   LNGGPGCSSLGYGAMEELGPFRVHSNGKTLYRNKYSWNKVANVLFLESPAGVGFSYSNAT  193

Query  566   SD--YVTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKI  739
             SD  Y +GD+ TAA NY+FL+NWLERFPEYK RD +I GESYAGHYVPQLA  IL  NK 
Sbjct  194   SDNTYTSGDRDTAAQNYMFLVNWLERFPEYKDRDFYIAGESYAGHYVPQLADNILHYNKK  253

Query  740   TNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDT  919
               ++++NLKGI IGN+ I++ T   G YDF+ THA+ S+E  R I   CNFSSA S    
Sbjct  254   AKRSVVNLKGIMIGNSVINDHTDMQGMYDFFGTHAITSNENLRKIQHYCNFSSAGSLYKE  313

Query  920   CDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEV  1099
             C   +D AD  +  I  YNIY P C   S L+S   + S   FDPCS  Y+  YLN P+V
Sbjct  314   CQEAMDKADTDVNVIDIYNIYGPLC-FNSNLTSKPKKTSPMNFDPCSDSYVLAYLNRPDV  372

Query  1100  QKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAV  1279
             Q+A+HANVT +   W  C      NW D   TVLP +KE M SG+ VW++SGD DG+V V
Sbjct  373   QEAMHANVTKLAYDWQPCG---GFNWVDSASTVLPLLKEFMASGLRVWVFSGDTDGRVPV  429

Query  1280  TTTTYAINKLNTSVKTPWYPWYS-KgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALT  1456
             T++ Y+IN++N  +KT W+PW+S K   G   V   DL+  T+RGAGH VPS QP RAL+
Sbjct  430   TSSQYSINEMNLPIKTQWHPWFSDKEVGGYVQVYKGDLTLATVRGAGHMVPSIQPVRALS  489

Query  1457  FFSAFVEGKLP  1489
               S F+ G  P
Sbjct  490   LISHFLAGTSP  500



>emb|CDP18508.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   429 bits (1103),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 248/474 (52%), Positives = 306/474 (65%), Gaps = 55/474 (12%)
 Frame = +2

Query  77    ECYSIGGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALP  256
             +CY   G K++ L   L  +   R NN   T   SA     VYIG Q+G K A+KI ALP
Sbjct  19    KCYK--GEKYETLRKFLHAESLNRSNNYI-TDEDSAHQYSPVYIGPQEGFKAANKIIALP  75

Query  257   GQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLnggpgcssfgnggMME  436
             G+ +GVKF Q+SGYVTVDP AGRALFYYF+ESE PS KPLVLWLN G GCSS G G M  
Sbjct  76    GEAKGVKFDQYSGYVTVDPTAGRALFYYFSESENPSSKPLVLWLNQGRGCSSLGVGAMSG  135

Query  437   NGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVTGDKKTAADNYIF  616
              GPFRV+ D+KTLW N+YAWN VAN+++LESPAG GFSY N                   
Sbjct  136   QGPFRVSKDNKTLWHNEYAWNKVANILYLESPAGAGFSYLNT------------------  177

Query  617   LLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYID  796
                           D +I  E+YAG +VP+LAQLI  NNKITNQT+INLKGIA+GN+ +D
Sbjct  178   --------------DFYIAEEAYAGFFVPELAQLIPHNNKITNQTVINLKGIAMGNSIVD  223

Query  797   EETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYN  976
              ETQ  G YDF W+H+LISDE + G+++NC          TC+ + + A +++GNI  Y+
Sbjct  224   TETQSKGLYDFLWSHSLISDEIYHGLVSNC----------TCNKYAEQAVKAIGNINRYS  273

Query  977   IYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCS  1156
             IYAP CSS S       +      DP + DY   +LN PEVQK+LHAN TGI G    C 
Sbjct  274   IYAPVCSSTSNAPWIYGE------DPRADDYALSHLNNPEVQKSLHANATGI-GLMGYCR  326

Query  1157  QDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWY  1336
                 +NW D P TVLPTI+ELM  GI+VW+YSGD +  + VT T YAI KL  ++  PW 
Sbjct  327   F---INWTDSPATVLPTIRELMAGGINVWMYSGDTNSFIPVTATRYAIKKLGIAMNAPWQ  383

Query  1337  PWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
             PWYS+GEV GYVV YE+L+FVT++GAG F PSY+P R+L  FS+F+EGKLP  S
Sbjct  384   PWYSQGEVAGYVVEYENLTFVTLKGAGLFAPSYKPARSLAMFSSFLEGKLPSSS  437



>ref|XP_008658699.1| PREDICTED: lysosomal protective protein isoform X1 [Zea mays]
Length=493

 Score =   431 bits (1108),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 231/435 (53%), Positives = 308/435 (71%), Gaps = 6/435 (1%)
 Frame = +2

Query  197   SVYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKP  373
             SV+ G+    ++ DKI  +PGQ    +F Q++GYVTVD +AGRALFYYF E+ + PS+KP
Sbjct  63    SVHRGSTSNQREQDKIVCMPGQTGVAEFDQYAGYVTVDAKAGRALFYYFVEAPQDPSNKP  122

Query  374   LVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSY  553
             LVLWLNGGPGCSSFG+G M+E GPF V+SD+KTL+  ++AWN +AN++F+E PAGVG+SY
Sbjct  123   LVLWLNGGPGCSSFGSGAMVELGPFSVHSDNKTLYKKRHAWNRMANMLFIEIPAGVGYSY  182

Query  554   SNRSSDYV-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRN  730
             SN +SDY  TGD++T  D Y FL+ WLE+FPEY+ RD FITGESYAGHY+P+LA LIL  
Sbjct  183   SNTTSDYYNTGDQRTTDDAYTFLITWLEKFPEYQDRDFFITGESYAGHYIPELANLILSK  242

Query  731   NKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASP  910
             N+ TN T I LKG+AIGNA +D+      +YD+YW HA+IS + ++ +   C F+   + 
Sbjct  243   NRATNVTSIKLKGVAIGNADLDDNLTLRASYDYYWMHAMISGKAYKAVKDKCGFN--GTY  300

Query  911   SDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNT  1090
             ++ C   +D A +  GNI  Y+IYAP C   S  S SS        DPC++ Y+  YLN 
Sbjct  301   TEDCQNAMDLATQEKGNIDDYDIYAPICQDASNPSKSSDSLVFG--DPCTNHYVSSYLNR  358

Query  1091  PEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGK  1270
             PEVQ+ALHAN TG+  PW  CSQ +  NW+D P+T+LP+IK+L+ SG  +WLYSGD+D  
Sbjct  359   PEVQRALHANTTGLGYPWMDCSQQIFDNWKDSPETMLPSIKKLISSGTRIWLYSGDMDAV  418

Query  1271  VAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERA  1450
              +  +T Y ++ L   ++  W PW    EV GYV+GY+ L FVT+RGAGH VP YQP RA
Sbjct  419   CSFISTQYVLDNLGLPIEAAWRPWRVDNEVAGYVIGYKGLVFVTVRGAGHMVPYYQPRRA  478

Query  1451  LTFFSAFVEGKLPPK  1495
             L  FS+F+EG+LPP+
Sbjct  479   LALFSSFLEGELPPR  493



>ref|XP_008231545.1| PREDICTED: serine carboxypeptidase-like 40 [Prunus mume]
Length=500

 Score =   431 bits (1108),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 240/435 (55%), Positives = 299/435 (69%), Gaps = 7/435 (2%)
 Frame = +2

Query  206   IGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK-PLVL  382
             I  Q+GLK+ D+I +LPGQP  V F+Q+ GYVTVD +AGRALFYYFAE+E   D  PL+L
Sbjct  65    IHPQEGLKEKDRIDSLPGQPH-VNFSQYGGYVTVDKEAGRALFYYFAEAEKAKDSSPLLL  123

Query  383   WLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNR  562
             WLNGGPGCSS   G M+E GPFR++SD KTL+ NK++WN  ANV+FLESPAGVGFSYSN+
Sbjct  124   WLNGGPGCSSLAYGAMLELGPFRIHSDGKTLYQNKFSWNYAANVLFLESPAGVGFSYSNK  183

Query  563   SSDY-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKI  739
             +SDY   GD++TAADNY+FL+NWLERFPE+K R+ +I+GESYAGHYVPQLA  IL +NK 
Sbjct  184   TSDYDANGDRRTAADNYVFLVNWLERFPEHKDREFYISGESYAGHYVPQLAHAILYHNKR  243

Query  740   TNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFS-SAASPSD  916
              N+TIINLKGI IGNA I+ ET   G YD+  +HALISD+T   I   C+FS +A     
Sbjct  244   ANKTIINLKGIMIGNAVINYETDSRGMYDYLASHALISDQTANKINKYCDFSPNATKQPK  303

Query  917   TCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPE  1096
              C    D A +    I  YNIYA  C   S L++   + S   FDPCS  Y Y Y N P 
Sbjct  304   ECIDAADAAAKDTYYIDIYNIYASSC-VSSNLTAKPKKASIFEFDPCSEYYAYAYFNRPY  362

Query  1097  VQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVA  1276
             VQ+ALHANVT +   W+ CS DV  NW D   TV+P +KE + + + VW++SGDIDG V 
Sbjct  363   VQQALHANVTKLTHDWEPCS-DVITNWADSASTVVPLLKEFLANDVRVWIFSGDIDGVVP  421

Query  1277  VTTTTYAINKLNTSVKTPWYPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERAL  1453
             VT+T Y+I KLN  VKT W+ W+      G   V   +L+F T+RGAGH VPSYQP R L
Sbjct  422   VTSTKYSIEKLNLPVKTEWHAWFIGGEVGGYTQVYEGELTFATVRGAGHQVPSYQPARGL  481

Query  1454  TFFSAFVEGKLPPKS  1498
             +    F++G   P +
Sbjct  482   SLIKHFLDGTPLPNT  496



>emb|CDP16358.1| unnamed protein product [Coffea canephora]
Length=491

 Score =   430 bits (1106),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 244/433 (56%), Positives = 296/433 (68%), Gaps = 9/433 (2%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPS---DKPLVLW  385
             QDGLK+ D I  LPGQP  V F Q+ GY+T++  AGRA +YYF E++ P+   D PL+LW
Sbjct  62    QDGLKEKDIIQKLPGQPP-VSFKQYGGYITINATAGRAFYYYFTEADDPNKAQDLPLLLW  120

Query  386   LnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRS  565
             LNGGPGCSS   G M E GPFRV SD KTL+ N+YAWN VANV+FLESPAGVGFSYSN +
Sbjct  121   LNGGPGCSSLAYGAMQELGPFRVASDGKTLFKNQYAWNYVANVLFLESPAGVGFSYSNTT  180

Query  566   SDYVTG-DKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKIT  742
             SD+V G D KTAADNYIF+LNWLERFPEYK RD +I GESYAGHYVPQLA  I+ +NK  
Sbjct  181   SDFVEGGDTKTAADNYIFILNWLERFPEYKNRDFYIAGESYAGHYVPQLAHNIVYHNKKA  240

Query  743   NQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTC  922
             NQTIINLKGI IGNA I++ET   G  D++ +HALIS E+ R +  +C FSS A  SD C
Sbjct  241   NQTIINLKGILIGNAVINDETDTKGLIDYFASHALISPESSRKLHEDCKFSSDAETSDGC  300

Query  923   DTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQ  1102
             +  V       GNI  Y+IY P C     L+S     S    DPCS  Y+  Y N PEVQ
Sbjct  301   NDIVTKLRTIAGNIDIYSIYYPLC-LDGNLTSIPKMFSIMEIDPCSEYYVQSYFNLPEVQ  359

Query  1103  KALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVT  1282
             +A+HANVT +   W+ CS  + V WED   TVLP I+ELM +GI VW++SGD+DG+V VT
Sbjct  360   EAIHANVTKLHYDWEPCSDVLKV-WEDSSSTVLPFIEELMENGIRVWIFSGDVDGRVPVT  418

Query  1283  TTTYAINKLNTSVKTPWYPWYSKgevgg-yvvgyeDLSFVTIRGAGHFVPSYQPERALTF  1459
              T Y++  +N +    W PWY  G VGG       +L+F T+RGAGH VPSY+P+R L+ 
Sbjct  419   GTQYSLEVMNITTLNAWRPWYRDGAVGGYVQEYKNNLTFATVRGAGHQVPSYRPDRGLSL  478

Query  1460  FSAFVEGK-LPPK  1495
              S FV G  LP K
Sbjct  479   VSNFVTGTPLPVK  491



>emb|CDP16356.1| unnamed protein product [Coffea canephora]
Length=491

 Score =   430 bits (1106),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 248/433 (57%), Positives = 299/433 (69%), Gaps = 9/433 (2%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETP---SDKPLVLW  385
             QDGLK+ D I  LPGQP  V F Q+ GYVT++  AG A +YYF E++ P    D PL+LW
Sbjct  62    QDGLKEKDIIQELPGQPP-VIFKQYGGYVTINATAGSAFYYYFTEAQDPKKAQDLPLLLW  120

Query  386   LnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRS  565
             LNGGPGCSS G G M E GPFRV SD KTL+ N+YAWN+VANV+FLESPAGVGFSYSN +
Sbjct  121   LNGGPGCSSLGYGAMQELGPFRVGSDGKTLYKNQYAWNHVANVLFLESPAGVGFSYSNTT  180

Query  566   SDYVT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKIT  742
             SD+   GD KTAADNYIFLLNWLERFPEYK RD +I GESYAGHYVPQLA  I+ +NK  
Sbjct  181   SDFENCGDTKTAADNYIFLLNWLERFPEYKNRDFYIAGESYAGHYVPQLAHNIVYHNKKA  240

Query  743   NQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTC  922
             N+TIINL+GI IGNA I++ET ++G  DF+ +HALIS E+ R I   CNFS+ A  SD C
Sbjct  241   NKTIINLRGILIGNAAINDETDNNGMIDFFASHALISLESSRDIHKYCNFSADAETSDEC  300

Query  923   DTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQ  1102
                V +A   +G I  YNIY P C   S L+S     S    DPCS  Y+  Y N PEVQ
Sbjct  301   IKSVQEAGNMVGTIDIYNIYYPMC-LHSNLTSIPKPFSIMEIDPCSEYYVQSYFNLPEVQ  359

Query  1103  KALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVT  1282
             +A+HAN T +   W+SCS DV  +W D   TVLP IK+LM +GI VW +SGD+DG+V VT
Sbjct  360   EAMHANFTKLHYNWESCS-DVIQHWGDSSSTVLPLIKDLMENGIRVWTFSGDVDGRVPVT  418

Query  1283  TTTYAINKLNTSVKTPWYPWYSKgevgg-yvvgyeDLSFVTIRGAGHFVPSYQPERALTF  1459
              T Y++  +N +    W PWY  GEVGG       +L+F T+RGAGH VPSY+P+R L+ 
Sbjct  419   GTQYSLETMNITALNSWRPWYRDGEVGGYVQDYKNNLTFATVRGAGHQVPSYKPDRGLSL  478

Query  1460  FSAFVEGK-LPPK  1495
              S FV G  LP K
Sbjct  479   VSNFVTGTPLPEK  491



>ref|XP_002271490.3| PREDICTED: serine carboxypeptidase-like 40 isoform X3 [Vitis 
vinifera]
Length=501

 Score =   430 bits (1106),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 241/476 (51%), Positives = 311/476 (65%), Gaps = 13/476 (3%)
 Frame = +2

Query  95    GRKFDPLESLLKTQKQKRQNNNA-QTIIMSAQDLGS----VYIGAQDGLKDADKISALPG  259
             GR     E L   QK K Q N+   T +    ++ S      I  Q G+K+ D+I  LPG
Sbjct  25    GRVRKQTELLKLLQKAKMQGNSGIDTSLFEVNEIKSEAESYKILPQKGMKEKDRIERLPG  84

Query  260   QPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK-PLVLWLnggpgcssfgnggMME  436
             QP  V F+Q+ GYVT+D   G A +YYF E+ T  +  PL+LW NGGPGCSS   G M E
Sbjct  85    QPH-VGFSQYGGYVTIDESKGEAFYYYFVEAPTSRESLPLLLWFNGGPGCSSLAYGAMQE  143

Query  437   NGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVTG-DKKTAADNYI  613
              GPFRV+SD KTL+ N+YAWN VANV+FLESPAGVGFSYSN +SD  +G D+KTA +NY 
Sbjct  144   LGPFRVHSDGKTLYRNQYAWNKVANVLFLESPAGVGFSYSNTTSDNQSGGDRKTANENYA  203

Query  614   FLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYI  793
             FL+NWLERFPEYK RD +I+GESYAGHYVPQLA  IL +NK  N  IINLKGI IGNA I
Sbjct  204   FLVNWLERFPEYKKRDFYISGESYAGHYVPQLAHTILHHNKKANGPIINLKGIIIGNAVI  263

Query  794   DEETQDSGTYDFYWTHALISDETHRGIIANCNFS-SAASPSDTCDTFVDDADRSMGNIYS  970
             D+E  D G Y +  +HAL+S++T   +  +CNFS  A S S  C   VD+   ++  I  
Sbjct  264   DDEADDIGRYQYLGSHALVSEKTIHQMEKHCNFSPGATSQSKECTEAVDEVHSNIDVIDI  323

Query  971   YNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDS  1150
             YNIY+P C   + + ++  +  +  FDPCS  Y+  YLN  +VQKALHANVT +   W  
Sbjct  324   YNIYSPLC--FNTILTAKPKKVTPEFDPCSDYYVSAYLNRADVQKALHANVTKLKYEWRP  381

Query  1151  CSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTP  1330
             CS D++ NW D P T++P ++E M +G+ VW++SGD DG V VT+T  +I K+  SVKTP
Sbjct  382   CS-DIDKNWTDSPLTIIPLLREFMANGLRVWVFSGDTDGDVPVTSTMASIGKMRLSVKTP  440

Query  1331  WYPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPK  1495
             W+PW+ +    G   V   DL+F T+RGAGH VPS++P+RAL+    F+ G   PK
Sbjct  441   WHPWFVAGEVGGYTEVYKGDLTFATVRGAGHQVPSFRPKRALSLIVHFLSGTPLPK  496



>ref|XP_008231546.1| PREDICTED: serine carboxypeptidase-like 40 [Prunus mume]
Length=500

 Score =   429 bits (1104),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 237/433 (55%), Positives = 300/433 (69%), Gaps = 7/433 (2%)
 Frame = +2

Query  206   IGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDKP-LVL  382
             I  Q+GLK+ D+I +LPGQP  V F+Q+ GYVTVD +AGRALFYYF E+E   D   L+L
Sbjct  65    IHPQEGLKEKDRIGSLPGQPH-VNFSQYGGYVTVDKEAGRALFYYFVEAEKTKDSSRLLL  123

Query  383   WLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNR  562
             WLNGGPGCSS G G M+E GPFR++SD KTL+ N+++WN+ ANV+FLESPAGVGFSYSN+
Sbjct  124   WLNGGPGCSSLGYGAMLELGPFRIHSDGKTLYRNRFSWNHAANVLFLESPAGVGFSYSNK  183

Query  563   SSDY-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKI  739
             +SDY  +GD+ TAADNY+FL+NWLERFPEYK R+ +I+GESYAGHYVPQLA  IL +NK 
Sbjct  184   TSDYDASGDRITAADNYVFLVNWLERFPEYKDREFYISGESYAGHYVPQLAHTILYHNKR  243

Query  740   TNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFS-SAASPSD  916
              N+TIINLKGI IGNA I++ET   G YD+  +HALISD+T   I   C+FS +A     
Sbjct  244   ANKTIINLKGIVIGNAVINDETDSRGMYDYLASHALISDQTANKINKYCDFSPNATKQPK  303

Query  917   TCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPE  1096
              C    D A +    I  YNIYA  C   S L++   + S   FDPCS  Y Y Y N P+
Sbjct  304   ACSDAADAAAKDTYYIDIYNIYASSC-VSSNLTAKPKKASIFEFDPCSEYYAYAYFNRPD  362

Query  1097  VQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVA  1276
             VQ+ALHANVT +   W+ CS DV  NW D   TVLP +KE + + + +W++SGDID +V 
Sbjct  363   VQQALHANVTKLTHDWEPCS-DVIANWADGASTVLPLLKEFLANDVRLWIFSGDIDARVP  421

Query  1277  VTTTTYAINKLNTSVKTPWYPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERAL  1453
             VT+T Y+I KLN  +KT W+ W+      G   V   +L+F T+RGAGH VPSYQP R L
Sbjct  422   VTSTKYSIEKLNLPIKTEWHAWFLGGEVGGYTQVYEGELTFATVRGAGHQVPSYQPARGL  481

Query  1454  TFFSAFVEGKLPP  1492
             +    F++G   P
Sbjct  482   SLVKHFLDGTPLP  494



>sp|P52711.1|CBP23_HORVU RecName: Full=Serine carboxypeptidase II-3; AltName: Full=CP-MII.3; 
Contains: RecName: Full=Serine carboxypeptidase II-3 
chain A; Contains: RecName: Full=Serine carboxypeptidase II-3 
chain B; Flags: Precursor [Hordeum vulgare]
 emb|CAA55478.1| serine carboxylase II-3 [Hordeum vulgare subsp. vulgare]
 gb|AAB31589.1| CP-MII.3=serine carboxypeptidase [Hordeum vulgare=barley, cv. 
Alexis, aleurone, Peptide, 516 aa]
Length=516

 Score =   430 bits (1106),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 243/440 (55%), Positives = 291/440 (66%), Gaps = 18/440 (4%)
 Frame = +2

Query  221   GLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES---ETPSDKPLVLWLn  391
             G K+AD++ ALPG P GV FAQ++GYVTVD  AGRALFYY AE+        KPL+LWLN
Sbjct  79    GRKEADRVEALPGHPRGVDFAQYAGYVTVDAAAGRALFYYLAEAVGGNGDKTKPLLLWLN  138

Query  392   ggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSD  571
             GGPGCSS G G M E GPFRV SD KTL+ N Y+WN+ ANV+FLESPAGVG+SYSN ++D
Sbjct  139   GGPGCSSLGYGAMEELGPFRVMSDGKTLYSNPYSWNHAANVLFLESPAGVGYSYSNTTAD  198

Query  572   Y-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQ  748
             Y  +GD  TA D Y FL NWLERFPEYK R+ +ITGESYAGHYVPQLA  ILR+      
Sbjct  199   YGRSGDNGTAEDAYQFLDNWLERFPEYKGREFYITGESYAGHYVPQLAHAILRHASPD--  256

Query  749   TIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFS---SAASPSDT  919
               INLKGI IGNA I++ T   G YDF+WTHALISDET  GI  NCNF+   +  + +  
Sbjct  257   --INLKGIMIGNAVINDWTDSKGMYDFFWTHALISDETADGISKNCNFTAYGAGVASNAL  314

Query  920   CDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEV  1099
             CD   D+   S+ +I  YNIYAP C     L +  +  S   FDPC+  Y+  YLN P+V
Sbjct  315   CDAASDEVGESLADIDIYNIYAPNC-QSEKLVTPPIAPSIDNFDPCTDYYVEAYLNRPDV  373

Query  1100  QKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAV  1279
             QKALHANVT +  PW +CS DV   W D   TVLP I+ELM + I VW+YSGD DG+V V
Sbjct  374   QKALHANVTRLDHPWSACS-DVLTRWVDSAKTVLPIIQELMKNSIRVWVYSGDTDGRVPV  432

Query  1280  TTTTYAINKLNTSVKTPWYPWYSKgevggy-----vvgyeDLSFVTIRGAGHFVPSYQPE  1444
             T++  ++N+L   V   W PW+S  +  G      V    DLS VT+RGAGH VPSYQP 
Sbjct  433   TSSRLSVNQLQLPVAAKWRPWFSSTKGAGEVGGYIVQYKGDLSLVTVRGAGHEVPSYQPR  492

Query  1445  RALTFFSAFVEGKLPPKSAE  1504
             RAL     F+ GK  P   E
Sbjct  493   RALVLVQNFLAGKALPDCKE  512



>ref|XP_008220189.1| PREDICTED: serine carboxypeptidase II-3-like [Prunus mume]
Length=487

 Score =   429 bits (1102),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 256/469 (55%), Positives = 318/469 (68%), Gaps = 20/469 (4%)
 Frame = +2

Query  113   LESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQPEG-VKFAQF  289
             ++ L+K++K  R   +   +         VY+G+Q+G  +ADKI ALPGQP G V F Q+
Sbjct  31    IKKLIKSRKSARNPKSWDGL------YSPVYVGSQEGSMEADKIEALPGQPAGEVNFNQY  84

Query  290   SGYVTVDPQAGRALFYYFAESETPSDKPLVLWLngg-pgcssfgnggMMENGPFRVNSDS  466
             +GYVTVDP+AGRALFYYF E+   S  PLVL L+GG  GCS+FG G + E GPFRV +D+
Sbjct  85    AGYVTVDPKAGRALFYYFVEANNSSSNPLVLSLHGGPGGCSAFGYGALQELGPFRVGNDN  144

Query  467   KTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVT-GDKKTAADNYIFLLNWLERFP  643
             KTL  N YAWNN ANV+FLE+P G GFSYSN SSDY T GD+ TA D++ FL+NWLERFP
Sbjct  145   KTLIPNDYAWNNAANVLFLETPLGTGFSYSNTSSDYDTVGDEITAQDSHAFLVNWLERFP  204

Query  644   EYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDSGTY  823
             +YK  D FITGESYAGHY P+LA  IL NN ITNQT INLKG+AIGN +ID  T     Y
Sbjct  205   QYKDSDFFITGESYAGHYAPELAYTILSNNNITNQTKINLKGVAIGNPWIDLNTALLALY  264

Query  824   DFYWTHALISDETHRGIIANCNFSS-AASPSDTCDTFVDDADRSMG-NIYSYNIYAPFCs  997
             D  WTHAL SDET+ GI   CN +      S+ C  +V  A  ++G +I   NIYAP C 
Sbjct  265   DNLWTHALNSDETNAGIHKYCNVTDLGGKQSNVCVEYVQQAIEALGEDIDISNIYAPICK  324

Query  998   sgsgls-sssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVN  1174
             +       S    S   FDPCS  Y+  YLN PEVQ ALH      P  W +CS   + +
Sbjct  325   TSQDSQPKSVSTASVDDFDPCSDIYVESYLNLPEVQAALHVK----PTKWSACS---DTD  377

Query  1175  WEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYS-K  1351
             W D PD++LPTI++++ SGIS W+YSGD DG  +VT++ YA++ LN  +KT W PWYS +
Sbjct  378   WTDSPDSMLPTIQQIIQSGISFWIYSGDADGFFSVTSSRYALHILNLPIKTTWRPWYSNR  437

Query  1352  gevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
              EVGGYVVGYE L+F T+RGAG  VPS QP+RALT  S+F+EGKLPP +
Sbjct  438   EEVGGYVVGYEGLTFATVRGAGIMVPSNQPQRALTLISSFLEGKLPPSA  486



>ref|XP_004984181.1| PREDICTED: serine carboxypeptidase-like 26-like isoform X1 [Setaria 
italica]
Length=494

 Score =   429 bits (1103),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 230/428 (54%), Positives = 307/428 (72%), Gaps = 7/428 (2%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLn  391
             ++ L++ DKI ++PGQ   V+F Q++GYVTVD +AGRALFYYF E+ + P DKPLVLWLN
Sbjct  71    KNNLQEQDKIVSMPGQTGVVEFGQYAGYVTVDAKAGRALFYYFVEAPQDPLDKPLVLWLN  130

Query  392   ggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSD  571
             GGPGCSSFG+G M+E GPF V +D+KTL+  ++AWN VAN++F+E PAGVG+SYSN +SD
Sbjct  131   GGPGCSSFGSGAMLELGPFSVRNDNKTLYRKRHAWNRVANMLFVEIPAGVGYSYSNTTSD  190

Query  572   YV-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQ  748
             Y  TGD++T  D Y F++NWLE+FPEY+ RD FITGESYAGHY+P+LA LI+  N+ +N 
Sbjct  191   YYNTGDQRTTDDAYTFIVNWLEKFPEYRDRDFFITGESYAGHYIPELANLIVSKNRASNA  250

Query  749   TIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDT  928
             T + LKG+AIGNA +D+      ++D+YW HA+IS + +R I   C+F+   + +  C  
Sbjct  251   TNVKLKGVAIGNADLDDNLTLRASFDYYWMHAMISRKAYRAIKDKCDFN--GTYTKDCQN  308

Query  929   FVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKA  1108
              ++ A +  GN+  Y+IYAP C   S  S SS        DPC++ Y+  YLN PEVQKA
Sbjct  309   AMNLATQEKGNVDDYDIYAPTCHDASNPSKSSDSLVG---DPCTNHYVSSYLNRPEVQKA  365

Query  1109  LHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTT  1288
             LHAN TG+  PW  CSQ V  NW+D P+T+LP+IK+L+ SGI +WLYSGD+D   +  +T
Sbjct  366   LHANTTGLHYPWMDCSQHVFDNWKDSPETMLPSIKKLISSGIRIWLYSGDMDAVCSFIST  425

Query  1289  TYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSA  1468
              Y ++ L   ++T W PW    EV GYV+GY+ L F T+RGAGH VP YQP RAL  FS+
Sbjct  426   QYVLDILGLPIETSWRPWSIDNEVAGYVIGYKGLVFATVRGAGHMVPYYQPRRALALFSS  485

Query  1469  FVEGKLPP  1492
             F+EGKLPP
Sbjct  486   FLEGKLPP  493



>ref|XP_004499088.1| PREDICTED: serine carboxypeptidase II-3-like isoform X4 [Cicer 
arietinum]
Length=489

 Score =   429 bits (1102),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 254/429 (59%), Positives = 307/429 (72%), Gaps = 12/429 (3%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESE-TPSDKPLVLWLn  391
             Q  L + DK+ +LPGQP+GV F Q++GYVTVD ++GR LFYYF ES    S KPLVLWLN
Sbjct  66    QSKLMEDDKVMSLPGQPKGVNFDQYAGYVTVDAKSGRELFYYFVESPLNSSSKPLVLWLN  125

Query  392   ggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSD  571
             GGPGCSSFG G M E GPFRVNSD  TL LN+ AWN VANVIFLESPAGVGFSYSN SSD
Sbjct  126   GGPGCSSFGYGAMQELGPFRVNSDGTTLSLNQDAWNIVANVIFLESPAGVGFSYSNNSSD  185

Query  572   YV-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNK-ITN  745
             Y   GD  TA D+Y FLLNW ERFP+YKTR+ FI GESY GHYVPQLA LIL NNK + N
Sbjct  186   YSHIGDNSTALDSYTFLLNWFERFPQYKTREFFIAGESYGGHYVPQLAHLILSNNKQMKN  245

Query  746   QTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCD  925
              T+INLKGIAIGN +ID+     G YD++W HAL S ETH GI  NC+F +    S+ C 
Sbjct  246   HTVINLKGIAIGNGWIDDNLCTKGMYDYFWMHALNSVETHEGIEKNCDFGNFNFTSE-CV  304

Query  926   TFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQK  1105
              + + AD  +GNI  YNIYAP C+S +  +++S    S  FDPCS DY   YLN PEVQ+
Sbjct  305   KYQNIADDELGNIDIYNIYAPLCNSSATKTAASPTTYSG-FDPCSEDYTVAYLNHPEVQQ  363

Query  1106  ALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTT  1285
             ALHA     P  W SCS+   V W D P ++LPTI  L+ + IS+ +YSGD+D +V +T+
Sbjct  364   ALHAK----PTKWSSCSE---VGWTDSPASILPTINHLISNAISILIYSGDVDARVPITS  416

Query  1286  TTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFS  1465
             T Y+IN L  +  T W PWY+  EVGGYV+GY+ L+ VT+RGAGH VPS+QP+ ALT  S
Sbjct  417   TLYSINALKLAPDTAWRPWYTGKEVGGYVIGYKGLTLVTVRGAGHMVPSHQPQSALTMIS  476

Query  1466  AFVEGKLPP  1492
             +F+ G+LPP
Sbjct  477   SFLLGELPP  485



>ref|XP_004514571.1| PREDICTED: serine carboxypeptidase-like 40-like [Cicer arietinum]
Length=498

 Score =   429 bits (1103),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 229/434 (53%), Positives = 294/434 (68%), Gaps = 7/434 (2%)
 Frame = +2

Query  206   IGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK-PLVL  382
             + +QDG+K+ D I  LPGQP  VKF+Q+ GYVTVD   GRA +YYF E+    +  PL+L
Sbjct  64    VHSQDGMKEKDMIVKLPGQPN-VKFSQYGGYVTVDKLVGRAFYYYFVEAHHSKETLPLLL  122

Query  383   WLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNR  562
             WLNGGPGCSS   G M E GPFRVNSD KTL  N Y+WN  ANV+FLESPAGVGFSYSN+
Sbjct  123   WLNGGPGCSSLAYGAMEELGPFRVNSDGKTLHKNNYSWNYAANVLFLESPAGVGFSYSNK  182

Query  563   SSDYVT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKI  739
             + DY T GD++TA DNY+FLLNWLERFPEYK RD +I GESYAGHYVPQLA  IL  NK 
Sbjct  183   TFDYDTNGDRRTARDNYVFLLNWLERFPEYKNRDFYIAGESYAGHYVPQLAHNILYYNKK  242

Query  740   TNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDT  919
              N+TI+NLKGI IGNA I++ET + G YD+  +HA+ISD+T   I   CNFSS ++ S  
Sbjct  243   ANRTIVNLKGIMIGNAVINDETDNQGMYDYLASHAIISDQTAHNINTFCNFSSTSNQSTE  302

Query  920   CDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEV  1099
             C+    +  R+   +  YNIYAP C   +   ++  +  S   DPCS DY+  YLN  +V
Sbjct  303   CNEAASEVYRNTLFLDVYNIYAPIC--TNHNLTTLSKKISVALDPCSDDYVQAYLNRDDV  360

Query  1100  QKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAV  1279
             Q+ALHANVT +   W+ CS  ++  W D P T++P + E + +G+ VW++SGDIDG+V V
Sbjct  361   QEALHANVTKLKYDWEPCSSIIS-KWGDSPSTIIPLLHEFLNNGLRVWVFSGDIDGRVPV  419

Query  1280  TTTTYAINKLNTSVKTPWYPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALT  1456
             T+T Y+I K+   ++T WYPW+ +    G   V    L+F T+R AGH VPSYQP RAL+
Sbjct  420   TSTKYSIKKMKLPIETTWYPWFLNGQVGGYAEVYKGGLTFATVREAGHQVPSYQPARALS  479

Query  1457  FFSAFVEGKLPPKS  1498
                 F+ G   P +
Sbjct  480   LIKHFLNGTPLPNT  493



>ref|XP_004984182.1| PREDICTED: serine carboxypeptidase-like 26-like isoform X2 [Setaria 
italica]
Length=495

 Score =   429 bits (1102),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 230/428 (54%), Positives = 307/428 (72%), Gaps = 6/428 (1%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLn  391
             ++ L++ DKI ++PGQ   V+F Q++GYVTVD +AGRALFYYF E+ + P DKPLVLWLN
Sbjct  71    KNNLQEQDKIVSMPGQTGVVEFGQYAGYVTVDAKAGRALFYYFVEAPQDPLDKPLVLWLN  130

Query  392   ggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSD  571
             GGPGCSSFG+G M+E GPF V +D+KTL+  ++AWN VAN++F+E PAGVG+SYSN +SD
Sbjct  131   GGPGCSSFGSGAMLELGPFSVRNDNKTLYRKRHAWNRVANMLFVEIPAGVGYSYSNTTSD  190

Query  572   YV-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQ  748
             Y  TGD++T  D Y F++NWLE+FPEY+ RD FITGESYAGHY+P+LA LI+  N+ +N 
Sbjct  191   YYNTGDQRTTDDAYTFIVNWLEKFPEYRDRDFFITGESYAGHYIPELANLIVSKNRASNA  250

Query  749   TIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDT  928
             T + LKG+AIGNA +D+      ++D+YW HA+IS + +R I   C+F+   + +  C  
Sbjct  251   TNVKLKGVAIGNADLDDNLTLRASFDYYWMHAMISRKAYRAIKDKCDFN--GTYTKDCQN  308

Query  929   FVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKA  1108
              ++ A +  GN+  Y+IYAP C   S  S SS        DPC++ Y+  YLN PEVQKA
Sbjct  309   AMNLATQEKGNVDDYDIYAPTCHDASNPSKSSDSVYMG--DPCTNHYVSSYLNRPEVQKA  366

Query  1109  LHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTT  1288
             LHAN TG+  PW  CSQ V  NW+D P+T+LP+IK+L+ SGI +WLYSGD+D   +  +T
Sbjct  367   LHANTTGLHYPWMDCSQHVFDNWKDSPETMLPSIKKLISSGIRIWLYSGDMDAVCSFIST  426

Query  1289  TYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSA  1468
              Y ++ L   ++T W PW    EV GYV+GY+ L F T+RGAGH VP YQP RAL  FS+
Sbjct  427   QYVLDILGLPIETSWRPWSIDNEVAGYVIGYKGLVFATVRGAGHMVPYYQPRRALALFSS  486

Query  1469  FVEGKLPP  1492
             F+EGKLPP
Sbjct  487   FLEGKLPP  494



>ref|XP_009777002.1| PREDICTED: serine carboxypeptidase-like 40 [Nicotiana sylvestris]
Length=492

 Score =   428 bits (1101),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 240/476 (50%), Positives = 312/476 (66%), Gaps = 9/476 (2%)
 Frame = +2

Query  86    SIGGRKFDPLESLLKTQKQKRQNNNAQTI--IMSAQDLGSVYIGAQDGLKDADKISALPG  259
             S+G R+ D L    K +++K  + +      +++  +L  V I +Q+G K+ D I  LPG
Sbjct  22    SLGKRQSDVLGKFYKAKQKKHSSIDKSPFKAVLNHVNLDKV-ILSQEGQKEKDWIKKLPG  80

Query  260   QPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLnggpgcssfgnggMMEN  439
             QP  VKF Q+ GYVTV+  AGRAL+YYF E+E     PL+LWLNGGPGCSS   G M E 
Sbjct  81    QPP-VKFQQYGGYVTVNESAGRALYYYFTEAENSKSLPLLLWLNGGPGCSSIAFGAMEEL  139

Query  440   GPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIF  616
             GPFRV+SD KTL+ N+YAWN VANV+FLESPAGVGFSY+N SSD+  TGDK+TA DN +F
Sbjct  140   GPFRVHSDGKTLYRNRYAWNLVANVLFLESPAGVGFSYTNTSSDFNSTGDKRTANDNVVF  199

Query  617   LLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYID  796
             LLNWLERFPEYK RD +I+GESYAGHYVPQLA +IL  NK  N+T+INLKG  IGNA I+
Sbjct  200   LLNWLERFPEYKNRDFYISGESYAGHYVPQLAHVILHLNKRANKTLINLKGFIIGNAVIN  259

Query  797   EETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYN  976
             E+T + G Y+++ +HALISD+T   I   C   S       C+     +D +  N+  YN
Sbjct  260   EDTDNLGMYEYFASHALISDQTFLDIHKYC--YSDFYNEKKCNKAGAVSDSNTDNLDIYN  317

Query  977   IYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCS  1156
             IY P C     L+      S+  FDPCS +YIY YLN  +VQ+ALHANVT I   W++CS
Sbjct  318   IYFPLC-HDDNLTKHPKFPSTLQFDPCSDNYIYAYLNRRDVQEALHANVTNISYDWEACS  376

Query  1157  QDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWY  1336
               +  NW+D P T++P ++E + +G+ VW++SGD DG+V VT++  +I  +  +V  PW 
Sbjct  377   DPLFYNWKDSPLTIIPLLQESLANGVRVWIFSGDTDGRVPVTSSKRSIKAMELTVDKPWR  436

Query  1337  PW-YSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKSA  1501
              W Y     G        L+F T+RGAGH VPSYQP RAL+  S F+ G  PP  A
Sbjct  437   SWLYGGEVGGYIETYKGGLTFATVRGAGHEVPSYQPARALSLISHFLSGTAPPGDA  492



>ref|XP_004231125.1| PREDICTED: serine carboxypeptidase-like 40 isoform X1 [Solanum 
lycopersicum]
Length=492

 Score =   428 bits (1100),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 240/428 (56%), Positives = 294/428 (69%), Gaps = 5/428 (1%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLng  394
             Q+GLKD D I  LPGQP  VKF Q+ GYVTVD  AGRAL+YYF E+E     PL+LWLNG
Sbjct  65    QEGLKDKDWIKKLPGQPP-VKFQQYGGYVTVDGSAGRALYYYFTEAENSKSLPLLLWLNG  123

Query  395   gpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY  574
             GPGCSS   G M E GPFRVNSD KTL  N YAWN VANV+FLESPAGVGFSY+N SSD+
Sbjct  124   GPGCSSIAYGAMEELGPFRVNSDGKTLHRNHYAWNLVANVLFLESPAGVGFSYTNTSSDF  183

Query  575   -VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQT  751
               TGD +TA DN +FLLNWLERFPEYK RD +I+GESYAGHYVPQLA  IL++NK  N+T
Sbjct  184   NTTGDSRTANDNVVFLLNWLERFPEYKKRDFYISGESYAGHYVPQLAHEILKHNKQANKT  243

Query  752   IINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTF  931
             +INLKGI IGNA I+++T   GTY++Y +HALISDET   I   C F +  + S+ C+  
Sbjct  244   LINLKGIIIGNAVINDDTDIIGTYEYYASHALISDETFLNIKKYC-FDNHYNKSN-CNEA  301

Query  932   VDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKAL  1111
             V  ++ ++ +I  YNIY P C  G+      V      F+PCS  Y+Y YLN  +VQ AL
Sbjct  302   VAVSNNNLYDIDIYNIYFPLCKDGNLTKYPRVPSQPLVFEPCSDQYVYAYLNRRDVQDAL  361

Query  1112  HANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTT  1291
             HANVT I   W+SCS  +  NW+D P T++P + E + +G+ VW++SGD DG V VT+T 
Sbjct  362   HANVTNIKYDWESCSDPLFYNWKDSPATIIPLLTESLENGVRVWIFSGDTDGSVPVTSTK  421

Query  1292  YAINKLNTSVKTPWYPWYSKgevgg-yvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSA  1468
              +I  +N  V  PW  W S GE+GG        L+F T+RGAGH VPSYQP RAL+  S 
Sbjct  422   KSIKAMNLIVDQPWRSWLSGGEIGGYVETYKGGLTFATVRGAGHEVPSYQPARALSLISH  481

Query  1469  FVEGKLPP  1492
             F+ G L P
Sbjct  482   FLSGTLLP  489



>gb|KHG24370.1| Serine carboxypeptidase II-3 [Gossypium arboreum]
Length=472

 Score =   427 bits (1098),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 260/483 (54%), Positives = 307/483 (64%), Gaps = 52/483 (11%)
 Frame = +2

Query  86    SIGGRKFDPLESLLKTQKQK---RQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALP  256
             S  G + D L  L+ +++     R  + AQ           V++G+Q GL  ADKI  LP
Sbjct  23    SCMGNQIDYLNRLVASRRSSNPPRPESWAQLDDQGNSHSSPVFVGSQKGLMQADKIDKLP  82

Query  257   GQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPS-DKPLVLWLnggpgcssfgnggMM  433
             GQPEGV F Q++GYVTVDP A RALFYYF ES   S +KPLVLWLNGGPGCSS G G M 
Sbjct  83    GQPEGVDFDQYAGYVTVDPVADRALFYYFVESPVTSPNKPLVLWLNGGPGCSSLGYGAMQ  142

Query  434   ENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYV-TGDKKTAADNY  610
             E GPFRVNSD KTL+ N+YAWNNVANVIFLESPAGVGFSYS  SSDY   GDK+TA D+Y
Sbjct  143   ELGPFRVNSDGKTLYRNEYAWNNVANVIFLESPAGVGFSYSKNSSDYTQVGDKRTAEDSY  202

Query  611   IFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAY  790
             +FLLNWLERFP+YKTRDLFITGESYAGHYVPQLA  IL  NK TNQ++INLKGIAIGNA+
Sbjct  203   VFLLNWLERFPQYKTRDLFITGESYAGHYVPQLASYILSRNKNTNQSVINLKGIAIGNAW  262

Query  791   IDEETQDSGTYDFYWTHALISDETHRGIIANCNFSS---------AASPSDTCDTFVDDA  943
             ID+     G +D+ WTHAL SDET+ G+   CNF+S         A + +D CD +   A
Sbjct  263   IDDNICTKGRFDYLWTHALNSDETNEGVNKYCNFASQDLVTNKAVAKNATDQCDQYQSRA  322

Query  944   DRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANV  1123
                MG+I  Y IY+P C   S        G+   FDPCS  ++  YLN  +VQ ALHA  
Sbjct  323   LTEMGDIDLYGIYSPLC--NSSAIKPGSDGNVLNFDPCSDVHVKSYLNLAKVQAALHAKA  380

Query  1124  TGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAIN  1303
             T     W +C                                SGD DG V VT++ YAI 
Sbjct  381   T----KWSAC--------------------------------SGDTDGLVPVTSSRYAIK  404

Query  1304  KLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGK  1483
              L   V+T W PWYS  EVGGYVVGY+ + F T+RGAGH VPSYQP RALT  ++F++ K
Sbjct  405   TLQLPVETAWRPWYSDSEVGGYVVGYKGVVFTTVRGAGHTVPSYQPARALTMIASFLQEK  464

Query  1484  LPP  1492
             LPP
Sbjct  465   LPP  467



>ref|XP_003559864.1| PREDICTED: serine carboxypeptidase II-3-like [Brachypodium distachyon]
Length=518

 Score =   428 bits (1101),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 245/443 (55%), Positives = 298/443 (67%), Gaps = 25/443 (6%)
 Frame = +2

Query  221   GLKDADKISALPGQPE-----GVKFAQFSGYVTVDPQAGRALFYYFAES-----ETPSDK  370
             G K+AD++  LPGQP      G +FAQ++GYVTVD  AGRALFYY AE+      + + K
Sbjct  74    GSKEADRVEKLPGQPAAAGDGGSEFAQYAGYVTVDAAAGRALFYYLAEAIGTGNGSSNSK  133

Query  371   PLVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFS  550
             PL+LWLNGGPGCSS G G M E GPFRV SD KTL+ N Y+WN+ ANV+FLESPAGVG+S
Sbjct  134   PLLLWLNGGPGCSSLGYGAMEELGPFRVMSDGKTLYRNPYSWNHAANVLFLESPAGVGYS  193

Query  551   YSNRSSDYVT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILR  727
             YSN ++DY   GD KTA D Y+FL NW+ERFPEYK RD +ITGESYAGHYVPQLA  ILR
Sbjct  194   YSNTTADYSRFGDNKTAEDAYLFLANWMERFPEYKGRDFYITGESYAGHYVPQLAHQILR  253

Query  728   NNKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFS---S  898
             +   +    INLKGI IGNA I++ T   G YDF+WTHALISD+T   I  NCNF+   +
Sbjct  254   HKSPS----INLKGIMIGNAVINDWTDSKGMYDFFWTHALISDDTADAINKNCNFTAAGA  309

Query  899   AASPSDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYV  1078
              A+ SD CD    +A+ S+ +I  YNIYAP C     L S     S   FDPC+  Y+  
Sbjct  310   GAASSDLCDEASGEANESLRDIDIYNIYAPVC-QSDKLVSPPNTPSIESFDPCTDYYVEA  368

Query  1079  YLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGD  1258
             YLN P+VQKALHANVT +  PW +CS DV   W D   TVLP I+ELM + I VW+YSGD
Sbjct  369   YLNNPDVQKALHANVTRLDHPWSACS-DVLRRWVDSASTVLPIIRELMKNNIKVWVYSGD  427

Query  1259  IDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggy-----vvgyeDLSFVTIRGAGHF  1423
              DG+V VT++ Y++N+L   V   W PW+S  +  G      V    DLS VT+RGAGH 
Sbjct  428   TDGRVPVTSSRYSVNQLQLPVAEKWRPWFSSTKGTGEVGGYVVQYKGDLSLVTVRGAGHE  487

Query  1424  VPSYQPERALTFFSAFVEGKLPP  1492
             VPSYQP+RAL    +F+ GK  P
Sbjct  488   VPSYQPQRALVLVQSFLAGKTLP  510



>ref|XP_002314060.2| hypothetical protein POPTR_0009s06090g [Populus trichocarpa]
 gb|EEE88015.2| hypothetical protein POPTR_0009s06090g [Populus trichocarpa]
Length=501

 Score =   427 bits (1099),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 234/432 (54%), Positives = 294/432 (68%), Gaps = 11/432 (3%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK---PLVLW  385
             Q G K+ D+I  LPGQP  V F+Q+ GYVTV+  AG AL+YYF E++  S +   PL+LW
Sbjct  75    QKGSKEKDRIKMLPGQPR-VNFSQYGGYVTVNESAGSALYYYFVEADQHSKESALPLLLW  133

Query  386   LnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRS  565
             LNGGPGCSS G G M E GPFRV+S+ KTL+ NKY+WN VANV+FLESPAGVGFSYSN +
Sbjct  134   LNGGPGCSSLGYGAMEELGPFRVHSNGKTLYRNKYSWNKVANVLFLESPAGVGFSYSNAT  193

Query  566   SDYV--TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKI  739
             SDY   +GD++TAA NY+FL+NWLERFPEYK RD +I GESYAGHYVPQLA  IL  NK 
Sbjct  194   SDYTYTSGDRETAAQNYMFLVNWLERFPEYKDRDFYIAGESYAGHYVPQLADTILHYNKK  253

Query  740   TNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDT  919
               ++++NLKGI IGN+ I++ T   G YDF+ THA+ S+E  R I   CNFSSA S    
Sbjct  254   AKRSVVNLKGIMIGNSVINDHTDMQGMYDFFGTHAITSNENFRKIQHYCNFSSAGSLYKE  313

Query  920   CDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEV  1099
             C   +  AD  +  I  YNIY P C   S L+S   + S   FDPCS  Y+  YLN P+V
Sbjct  314   CQEAMGKADTDVSVIDIYNIYGPSC-FNSNLTSKPKKTSPMNFDPCSDSYVLAYLNRPDV  372

Query  1100  QKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAV  1279
             Q+A+HANVT +   W  C      NW D   TVLP +KE M +G+ VW++SGD DG+V V
Sbjct  373   QEAMHANVTKLAYDWQPCG---GFNWVDSASTVLPLLKEFMANGLRVWVFSGDTDGRVPV  429

Query  1280  TTTTYAINKLNTSVKTPWYPWYS-KgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALT  1456
             T++ Y+IN++N  +KT W+PW+S +   G   V   DL+F T+RGAGH VPS QP RAL+
Sbjct  430   TSSQYSINEMNLPIKTQWHPWFSDQEVGGYVQVYKGDLTFATVRGAGHMVPSIQPVRALS  489

Query  1457  FFSAFVEGKLPP  1492
               S F+ G   P
Sbjct  490   LISHFLSGTPLP  501



>ref|XP_002463311.1| hypothetical protein SORBIDRAFT_02g041610 [Sorghum bicolor]
 gb|EER99832.1| hypothetical protein SORBIDRAFT_02g041610 [Sorghum bicolor]
Length=526

 Score =   427 bits (1099),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 250/486 (51%), Positives = 307/486 (63%), Gaps = 23/486 (5%)
 Frame = +2

Query  98    RKFDPLESLLKTQKQKR-QNNNAQTIIMSAQDLGSVYIGAQD-GLKDADKISALPGQPEG  271
             R+ D L  L  + +Q      +A   + SA D  + +  +   G K+ D++  LPGQP G
Sbjct  35    RQGDYLARLRGSPRQSPWPAESASLAVASATDRAARHAASPPVGRKEDDRVDKLPGQPSG  94

Query  272   VKFAQFSGYVTVDPQAGRALFYYFAES--ETPSDKPLVLWLnggpgcssfgnggMMENGP  445
             V F Q+SGYVTVD  AGRALFYY AE+     + KPL+LWLNGGPGCSS G G M E GP
Sbjct  95    VDFEQYSGYVTVDAAAGRALFYYLAEAVGGGSAAKPLLLWLNGGPGCSSLGYGAMEELGP  154

Query  446   FRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVT-GDKKTAADNYIFLL  622
             FRV SD KTL+ N YAWNN ANV+FLESPAGVGFSYSN ++DY   GD KTA D   FLL
Sbjct  155   FRVKSDGKTLYRNPYAWNNAANVLFLESPAGVGFSYSNTTADYGRFGDNKTAEDALQFLL  214

Query  623   NWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRN-------NKITNQTIINLKGIAIG  781
             NW+++FPEYK RD ++ GESYAGHYVPQLA  ILR+        K ++ + INLKGI IG
Sbjct  215   NWMDKFPEYKGRDFYLAGESYAGHYVPQLAHAILRHAAATAGGGKPSSSSPINLKGIMIG  274

Query  782   NAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGN  961
             NA I++ T   G YDF+WTHALISD T   I   CNFS+AA+ SD CD    +AD ++ +
Sbjct  275   NAVINDWTDSKGMYDFFWTHALISDTTADAIGRYCNFSAAAAGSDKCDEATSEADEALED  334

Query  962   IYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGP  1141
             I  YNIYAP C     L S  +  S   FDPCS  Y+  YLN P VQ ALHANVT +  P
Sbjct  335   IDIYNIYAPNC-QSDDLVSPPITPSMDNFDPCSDYYVNAYLNDPAVQSALHANVTRLDHP  393

Query  1142  WDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSV  1321
             W +CS DV   W D   TVLP + EL+ + + VW+YSGD DG+V VT++ Y++N+L   V
Sbjct  394   WSACS-DVLRRWTDSATTVLPILTELLKNDVRVWVYSGDTDGRVPVTSSRYSVNQLQLPV  452

Query  1322  KTPWYPWYSKgevggyv---------vgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFV  1474
                W  W+S  +  G V              LS VT+RGAGH VPSYQP+RAL     F+
Sbjct  453   AAKWRAWFSSTQGAGEVGGYVVQYKGKEKGSLSLVTVRGAGHEVPSYQPKRALVLVQNFL  512

Query  1475  EGKLPP  1492
              GK  P
Sbjct  513   AGKTLP  518



>ref|XP_010261659.1| PREDICTED: serine carboxypeptidase-like 40 [Nelumbo nucifera]
Length=484

 Score =   426 bits (1095),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 230/430 (53%), Positives = 294/430 (68%), Gaps = 11/430 (3%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLng  394
             Q G K++D+IS LPGQP  V F Q+ GYVTVD  AGRALFYYF E+     +PLVLWLNG
Sbjct  62    QSGSKESDRISMLPGQPS-VNFNQYGGYVTVDGSAGRALFYYFVEAPDAMSRPLVLWLNG  120

Query  395   gpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY  574
             GPGCSS G+G M E GPFRV SD +TL+ N YAWN VANV+FLESPAGVGFSYSN SSDY
Sbjct  121   GPGCSSLGDGAMTELGPFRVQSDGRTLYRNPYAWNQVANVLFLESPAGVGFSYSNTSSDY  180

Query  575   VT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQT  751
              T GD+ TA DNY+FL+NWLERFPEYKTRD +I GESYAGHYVPQLA  IL+ NK     
Sbjct  181   STRGDQSTAEDNYVFLVNWLERFPEYKTRDFYIVGESYAGHYVPQLANAILQ-NKNAGMN  239

Query  752   IINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTF  931
              INL+GI IGN  I+ ET   G YD+ WTHAL+SD+ +  I + C    A+  S+ C+  
Sbjct  240   SINLRGIMIGNPLINGETDMRGMYDYRWTHALVSDQINNAINSYC---YASYQSEQCNYA  296

Query  932   VDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKAL  1111
             ++ A+ ++ +I  YNIYAP C       ++    +S  +DPC   Y+  Y+N PEVQ+AL
Sbjct  297   MNQANAAVNSIDIYNIYAPLC----ASGANPTIAASLNWDPCGETYVRNYMNLPEVQRAL  352

Query  1112  HANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTT  1291
             HANV      W+ CS  +N NW D   T+LP +++ M +GI VW++SGD+DG + VT+T 
Sbjct  353   HANVIRPGFYWEHCSNMINSNWRDSASTILPLLRQFMANGIRVWVFSGDVDGLIPVTSTR  412

Query  1292  YAINKLNTSVKTPWYPWYS-KgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSA  1468
             Y++N L  +   PWYPW++ +   G  VV    L+F T+RGAGH VP +QP R+LT  + 
Sbjct  413   YSLNTLQLAESIPWYPWFANREVGGYSVVYQGGLTFATVRGAGHEVPKHQPSRSLTLVNY  472

Query  1469  FVEGKLPPKS  1498
             F+ G+  P+S
Sbjct  473   FLAGQPLPRS  482



>emb|CAC19488.1| putative serine carboxypeptidase [Pisum sativum]
Length=494

 Score =   426 bits (1096),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 232/433 (54%), Positives = 295/433 (68%), Gaps = 13/433 (3%)
 Frame = +2

Query  212   AQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES----ETPSDKPLV  379
             +Q G+K+ D+I  LPGQP  VKF+QF GYVT+D  +G A +YYF E+    ETP   PL+
Sbjct  63    SQKGVKENDRIKKLPGQP-FVKFSQFGGYVTLDKLSGSAFYYYFVEAHQSKETP---PLL  118

Query  380   LWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSN  559
             LWLNGGPGCSS   G M E GPFRVNSD KTL  N+Y+WN  ANV+FLESP GVGFSYSN
Sbjct  119   LWLNGGPGCSSLAYGAMQELGPFRVNSDGKTLHQNRYSWNYAANVLFLESPVGVGFSYSN  178

Query  560   RSSDYVT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNK  736
             +S++Y + GDKKTA DNY+FL+NWLERFPEYK RD +I+GESYAGHYVPQLA  IL +NK
Sbjct  179   KSTEYSSNGDKKTAIDNYLFLVNWLERFPEYKNRDFYISGESYAGHYVPQLAHTILYHNK  238

Query  737   ITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSD  916
               N+TIINLKGI IGNA I + T  +G YDF  THA+ISD+    +   C+FSS+ + + 
Sbjct  239   KANKTIINLKGILIGNAVIHDTTDSTGMYDFLATHAIISDKAAYDVNKVCDFSSSDNLTA  298

Query  917   TCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPE  1096
              C++  D+ +  +  I  YNIYAP C + +  S           DPCS +Y+Y YLN  +
Sbjct  299   ECNSAADEVNEDIAFIDLYNIYAPLCKNENLTSKPKKNTIVT--DPCSKNYVYAYLNRQD  356

Query  1097  VQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVA  1276
             VQ+A+HANVT +   W  CS  +   W D   TVLP + E + +G+ VW++SGD DG+V 
Sbjct  357   VQEAIHANVTKLKYEWSPCSGVIR-KWVDSSPTVLPLLHEFLNNGLRVWIFSGDTDGRVP  415

Query  1277  VTTTTYAINKLNTSVKTPWYPWYS-KgevggyvvgyeDLSFVTIRGAGHFVPSYQPERAL  1453
             VT+T Y+I K+N  VKT W+PW++     G   V   DL+FVT+R AGH VPSYQP RAL
Sbjct  416   VTSTKYSIKKMNLPVKTVWHPWFAYGEVGGYTEVYKGDLTFVTVREAGHQVPSYQPARAL  475

Query  1454  TFFSAFVEGKLPP  1492
             T    F++G   P
Sbjct  476   TLIKHFLDGTPLP  488



>gb|AES71591.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=504

 Score =   426 bits (1096),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 254/438 (58%), Positives = 301/438 (69%), Gaps = 22/438 (5%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESE-TPSDKPLVLWLn  391
             Q+ L+ ADKI  LPGQP GV F Q+SGYVTVDP+ GR LFYYF ES    S KPLVLWLN
Sbjct  69    QEELRLADKIVTLPGQPYGVNFDQYSGYVTVDPETGRELFYYFVESPCNSSTKPLVLWLN  128

Query  392   ggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSD  571
             GGPGCSS G G   E GPFRVNSD KTL+ N YAWN VANV+FLESPAG+GFSYSN +SD
Sbjct  129   GGPGCSSLGYGAFQELGPFRVNSDGKTLYRNPYAWNEVANVLFLESPAGIGFSYSNTTSD  188

Query  572   Y-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQ  748
             Y  +GDK TA D+Y+FL+NWLERFP+YKTRD +I+GESYAGHYVPQLA  IL NNK+   
Sbjct  189   YDKSGDKSTAKDSYVFLINWLERFPQYKTRDFYISGESYAGHYVPQLASTILHNNKLYKN  248

Query  749   TIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDT  928
             TIINLKGI++ NA+ID+ T   G YD  WTHAL SD+TH  I   C+F+   + S  C  
Sbjct  249   TIINLKGISVWNAWIDDATSLKGLYDNLWTHALNSDQTHELIEKYCDFTK-QNYSAICTN  307

Query  929   FVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKA  1108
              ++ +    G I S+NIYAP C   S L + S    S   DPCS  Y   YLN PEVQKA
Sbjct  308   AMNMSMIEKGKIDSFNIYAPLC-HDSTLKNGSTGYVSNDLDPCSDYYGTAYLNRPEVQKA  366

Query  1109  LHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYS-----------G  1255
             LHA     P  W  CS  +N+NW+D P T+LPTIK L+ +GI +W+Y            G
Sbjct  367   LHAK----PTNWSHCS--INLNWKDSPITILPTIKYLIDNGIKLWIYRQAQFHITCRIFG  420

Query  1256  DIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSY  1435
             D D  V VT + Y IN L   + + W PWYS  E+GGYVVGY+ L+FVT+RGAGH VPS+
Sbjct  421   DTDA-VGVTISRYPINTLKLPIDSTWRPWYSGKEIGGYVVGYKGLTFVTVRGAGHLVPSW  479

Query  1436  QPERALTFFSAFVEGKLP  1489
             QPERALT  S+F+ G LP
Sbjct  480   QPERALTLISSFLYGILP  497



>emb|CDP01379.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   425 bits (1093),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 243/439 (55%), Positives = 303/439 (69%), Gaps = 16/439 (4%)
 Frame = +2

Query  197   SVYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKP  373
             +V++  QDGLK+ DKI  LPGQP+GV F QFSGYV VD   GR L+YYF ES +  S KP
Sbjct  60    AVHVSPQDGLKEKDKIDRLPGQPDGVDFNQFSGYVKVD--CGRVLYYYFVESPQDSSSKP  117

Query  374   LVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSY  553
             L++W  G PGCSSFG G   E GPFRVN D KTL+ N YAWN+ AN+IF+E+PAGVGFSY
Sbjct  118   LLMWFAGVPGCSSFGVGAWTEIGPFRVNKDGKTLYRNPYAWNSEANLIFVEAPAGVGFSY  177

Query  554   SNRSSDY-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRN  730
             SN S+ Y   GD  TA D Y FL+NWLERFPEYK R LF+ GE YAGHY  QLAQLILR 
Sbjct  178   SNTSAYYERIGDTLTAYDTYTFLVNWLERFPEYKNRGLFLAGEGYAGHYATQLAQLILRQ  237

Query  731   NKITNQTI-INLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAAS  907
             NK +NQT  INLKGIA+GN+YID E+   G+ D+ W HALISDE + G+ +NCN S    
Sbjct  238   NKYSNQTTAINLKGIALGNSYIDYESSFYGSLDYAWRHALISDEIYNGVNSNCNLSLVIQ  297

Query  908   PSDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLN  1087
              SD+C  +++ ++     I  Y+IYA  C+S  G +  S         PCS+DY+  Y+ 
Sbjct  298   -SDSCSEYLNLSNNVTEGINPYDIYASLCNSTPGAAPYSY------VGPCSTDYVSDYME  350

Query  1088  TPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVW--LYSGDI  1261
              PEVQ ALHAN++ +P PW  C+ D+  NW D P TVLP I ELM  GI  +  ++SGD 
Sbjct  351   NPEVQIALHANISTVPYPWKICN-DLK-NWTDAPRTVLPIITELMEGGIQSFQMMFSGDT  408

Query  1262  DGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQP  1441
             D  + VT+  YA+NKL  S KT WYPWY + EVGGYVV Y++L+FVT+RGAG FVP +QP
Sbjct  409   DSAIPVTSAKYAVNKLKLSAKTAWYPWYLQNEVGGYVVEYQNLTFVTVRGAGLFVPDHQP  468

Query  1442  ERALTFFSAFVEGKLPPKS  1498
              RAL  F++F+  +LPP +
Sbjct  469   ARALALFTSFINAQLPPST  487



>ref|NP_001151412.1| lysosomal protective protein precursor [Zea mays]
 gb|ACG42765.1| lysosomal protective protein precursor [Zea mays]
Length=493

 Score =   425 bits (1093),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 228/435 (52%), Positives = 306/435 (70%), Gaps = 6/435 (1%)
 Frame = +2

Query  197   SVYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKP  373
             SV+ G+    ++ DKI  +PGQ    +F Q++ YVTVD +AGRALFYYF E+ + PS+KP
Sbjct  63    SVHRGSTSNQREQDKIICMPGQTGVAEFDQYAXYVTVDAKAGRALFYYFVEAPQDPSNKP  122

Query  374   LVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSY  553
             LVLWLNGGPGCSSFG+G M+E GPF V+SD+KTL+  ++AWN +AN++F+E PAGVG+SY
Sbjct  123   LVLWLNGGPGCSSFGSGAMVELGPFSVHSDNKTLYKKRHAWNRMANMLFIEIPAGVGYSY  182

Query  554   SNRSSDYV-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRN  730
             SN +SDY  TGD++T  D Y FL+ WLE+FPEY+ RD FITGESYAGHY+P+LA LIL  
Sbjct  183   SNTTSDYYNTGDQRTTDDAYTFLITWLEKFPEYQDRDFFITGESYAGHYIPELANLILSK  242

Query  731   NKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASP  910
             N+ TN T I LKG+AIGNA +D+      +YD+YW HA+IS + ++ +   C F+   + 
Sbjct  243   NRATNVTSIKLKGVAIGNABLDDNLTLRASYDYYWMHAMISGKAYKAVKDKCGFN--GTY  300

Query  911   SDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNT  1090
             ++ C   +D A +  GNI  Y+IYAP C   S  S SS        DPC++ Y+  YLN 
Sbjct  301   TEDCQNAMDLATQEKGNIDDYDIYAPICQDASNPSKSSDSLVFG--DPCTNHYVXSYLNR  358

Query  1091  PEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGK  1270
             PEVQ+ALHAN TG+  PW  CSQ +  NW+D P+T+LP+IK+L+ SG  +WLYSGD+D  
Sbjct  359   PEVQRALHANTTGLGXPWMDCSQQIFDNWKDSPETMLPSIKKLISSGTRIWLYSGDMDAV  418

Query  1271  VAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERA  1450
              +  +T Y ++ L   ++  W PW+   EV GYV+GY+ L F T+RGA H VP YQP RA
Sbjct  419   CSFISTQYVLDNLGLPIEAAWRPWHVDNEVAGYVIGYKGLVFATVRGAVHMVPYYQPRRA  478

Query  1451  LTFFSAFVEGKLPPK  1495
             L  FS+F+EG+LPP+
Sbjct  479   LALFSSFLEGELPPR  493



>ref|XP_002467770.1| hypothetical protein SORBIDRAFT_01g033770 [Sorghum bicolor]
 gb|EER94768.1| hypothetical protein SORBIDRAFT_01g033770 [Sorghum bicolor]
Length=495

 Score =   425 bits (1093),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 234/436 (54%), Positives = 307/436 (70%), Gaps = 8/436 (2%)
 Frame = +2

Query  197   SVYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKP  373
             SV+ G+ +  ++ DKI  +PGQ    +F Q++GYVTVD +AGRALFYYF E+ + PSDKP
Sbjct  63    SVHRGSTNNQREQDKIVYMPGQTGVAEFDQYAGYVTVDAKAGRALFYYFVEAPQDPSDKP  122

Query  374   LVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSY  553
             LVLWLNGGPGCSSFG+G M+E GPF V+SD+KTL+  K+AWN VAN++F+E PAGVG+SY
Sbjct  123   LVLWLNGGPGCSSFGSGAMLELGPFSVHSDNKTLYKKKHAWNRVANMLFIEIPAGVGYSY  182

Query  554   SNRSSDYV-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRN  730
             SN +SDY  TGD++T  D Y FL+ WLE+FPEY+ RD FITGESYAGHY+P+LA LIL  
Sbjct  183   SNTTSDYYNTGDQRTTDDAYTFLVTWLEKFPEYRDRDFFITGESYAGHYIPELANLILSK  242

Query  731   NKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASP  910
             N+ TN T + LKG+AIGNA +D+      +YD+YW HA+IS + +  I   C+F+   + 
Sbjct  243   NRATNVTSVKLKGVAIGNADLDDNLTLRASYDYYWMHAMISGKAYTAIKDKCSFN--GTY  300

Query  911   SDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNT  1090
             +  C   ++ A +  GN+  Y+IYAP C   S  S SS        DPC++ Y+  YLN 
Sbjct  301   TKDCLNAMNLAIQEKGNVDDYDIYAPICHDASNPSKSSDSLVFG--DPCTNHYVSSYLNR  358

Query  1091  PEVQKALHANVTGIPGPWDSCSQDV--NVNWEDMPDTVLPTIKELMGSGISVWLYSGDID  1264
             PEVQ+ALHAN TG+  PW  CSQ V  N NW+D P+T+LP+IK+L+ SG  +WLYSGD+D
Sbjct  359   PEVQRALHANTTGLGYPWMDCSQHVYDNWNWKDSPETMLPSIKKLISSGTRIWLYSGDMD  418

Query  1265  GKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPE  1444
                +  +T Y ++ L   ++  W PW    EV GYV+GY+ L F T+RGAGH VP YQP 
Sbjct  419   AVCSFISTQYVLDNLGLPIEASWRPWRIDNEVAGYVIGYKGLVFATVRGAGHMVPYYQPR  478

Query  1445  RALTFFSAFVEGKLPP  1492
             RAL  FS+F+EGKLPP
Sbjct  479   RALALFSSFLEGKLPP  494



>emb|CDP16350.1| unnamed protein product [Coffea canephora]
Length=497

 Score =   425 bits (1092),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 251/431 (58%), Positives = 300/431 (70%), Gaps = 12/431 (3%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESE---TPSDKPLVLW  385
             Q+GLK+ D+I  LPGQP  V F Q+ GY+TV+  AGRA FYYF E++    P D PLVLW
Sbjct  64    QEGLKEKDRIDRLPGQPP-VGFKQYGGYITVNETAGRAFFYYFVEAQGRRKPEDVPLVLW  122

Query  386   LnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRS  565
             LNGGPGCSS   G   E GPFRV SD KTL+ N++AWN VANV+F+ESPAGVGFSYSN +
Sbjct  123   LNGGPGCSSLAYGAFQELGPFRVGSDGKTLFKNRFAWNYVANVLFVESPAGVGFSYSNTT  182

Query  566   SDYVTG-DKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKIT  742
              D+V G DKKTAADNYIFLLN LERFPEYK RD +ITGESYAGHYVPQLA  I+ +NK  
Sbjct  183   EDFVKGGDKKTAADNYIFLLNLLERFPEYKNRDFYITGESYAGHYVPQLAHNIVYHNKKA  242

Query  743   NQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFS----SAASP  910
             N+TIINLKGI IGNA I++ T   G YDF+ THALIS ET + I   C+ S    S +  
Sbjct  243   NRTIINLKGILIGNAVINDPTDSIGMYDFFATHALISPETLQKINKLCDLSHPDASISVE  302

Query  911   SDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNT  1090
             S  C+  +  AD ++  I  YNIY P C    GL+S   + +   FD CS  Y Y Y N 
Sbjct  303   SLECNQTLAVADNAVDQIDIYNIYYPRC-FHGGLTSFPKRFNILKFDKCSDYYGYAYFNH  361

Query  1091  PEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGK  1270
             P VQ+ALHANVT IP  W  CS DV  +W D   TVLP +KE M +GI VW++SGD+DG+
Sbjct  362   PNVQEALHANVTKIPYDWQPCS-DVLNDWVDWQSTVLPYLKEFMVNGIQVWIFSGDVDGR  420

Query  1271  VAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeD-LSFVTIRGAGHFVPSYQPER  1447
             V VT + YAI  L  SV TPW PW+   EVGGYV  Y+D L+FVT+RGAGH VPSY+P+R
Sbjct  421   VPVTASQYAIEALKVSVVTPWQPWFRDWEVGGYVQIYQDNLTFVTVRGAGHQVPSYRPDR  480

Query  1448  ALTFFSAFVEG  1480
             AL+  S F+ G
Sbjct  481   ALSLISHFISG  491



>ref|XP_006345489.1| PREDICTED: serine carboxypeptidase-like 40-like [Solanum tuberosum]
Length=460

 Score =   424 bits (1089),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 231/440 (53%), Positives = 297/440 (68%), Gaps = 9/440 (2%)
 Frame = +2

Query  200   VYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPL  376
             +++ +Q GLKD D+I  LPGQP  VKF Q+ GYVTV+  AGRALFYYF E+ E     PL
Sbjct  6     IFVLSQKGLKDKDQIKKLPGQP-FVKFKQYGGYVTVNKSAGRALFYYFVEAHENFKSLPL  64

Query  377   VLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYS  556
             +LWLNGGPGCSS   G M E GPFR++ D KTL+ N Y+WN  AN++FLESPAGVGFSYS
Sbjct  65    LLWLNGGPGCSSLAYGAMEEIGPFRIHKDGKTLYRNNYSWNQAANLLFLESPAGVGFSYS  124

Query  557   NRSSDYVT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNN  733
             N SS+  + GD+ TA DN IFLLNW++RFPEYK RD +I GESYAGH+VPQLA++IL++N
Sbjct  125   NISSEVKSNGDRNTAIDNIIFLLNWIQRFPEYKNRDFYIAGESYAGHFVPQLAEIILQHN  184

Query  734   KITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPS  913
             K+  + +INLKGI IGNA I+ ET + G Y+++ +H LI DE    I   CNFS  A P 
Sbjct  185   KLAKKNLINLKGIMIGNAVINFETDEKGMYEYHASHGLIPDEIFEQIDRYCNFSDKALPQ  244

Query  914   -DTCDTFVDDADRSMGNIYSYNIYAPFCssgsglsss--svqgssrgFDPCSSDYIYVYL  1084
                CD  +D A      I  YNIYAP C     LS++  +   +S+  DPCS DY+  Y+
Sbjct  245   PHQCDNAIDIAIADTDPIDLYNIYAPLCPKSDDLSTTYYTSNKNSQEIDPCSDDYLIAYM  304

Query  1085  NTPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDID  1264
             N P+VQKALHANVT I   W  CS+ +  +W+D P +++P IK++M +GI VW++SGD D
Sbjct  305   NRPDVQKALHANVTKIKYNWQPCSEVIE-SWKDSPLSIVPVIKKVMANGIRVWIFSGDTD  363

Query  1265  GKVAVTTTTYAINKLNTSVKTPWYPWYSKgevg--gyvvgyeDLSFVTIRGAGHFVPSYQ  1438
             G V VT+T  +I K+   V+TPWYPW+ K         V   +L+F T+RGAGH VPSY+
Sbjct  364   GIVPVTSTKKSIKKMKLRVETPWYPWFHKDYEVGGYAQVYRGNLTFATVRGAGHQVPSYE  423

Query  1439  PERALTFFSAFVEGKLPPKS  1498
             P RA T    F+ G   P S
Sbjct  424   PARAFTLAKHFLAGTQLPNS  443



>ref|XP_010659210.1| PREDICTED: serine carboxypeptidase-like 40 isoform X2 [Vitis 
vinifera]
Length=504

 Score =   425 bits (1092),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 239/478 (50%), Positives = 312/478 (65%), Gaps = 15/478 (3%)
 Frame = +2

Query  95    GRKFDPLESLLKTQKQKRQNNNAQTI-------IMSAQDLGSVYIGAQDGLKDADKISAL  253
             G+    +E+L   QK K   N+           + +  +  S  I  Q+GLK+ D+I  L
Sbjct  26    GKTMKQIEALDILQKAKLHGNSGIDTNLFEVNEVENGAETESHKIHPQEGLKEKDRIDML  85

Query  254   PGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDKPLVL-WLnggpgcssfgnggM  430
             PGQP  V F+Q+ GYVT+D   G+AL+YYFAE+        +L WLNGGPGCSS   G M
Sbjct  86    PGQPH-VGFSQYGGYVTIDESKGKALYYYFAEAPLSKKSLPLLLWLNGGPGCSSLAYGAM  144

Query  431   MENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVTG-DKKTAADN  607
              E GPFRV+SD KTL+ N+YAWN VANV+FLESPAGVGFSYSN +SD  +G D+KTA +N
Sbjct  145   QELGPFRVHSDGKTLYRNQYAWNKVANVLFLESPAGVGFSYSNTTSDNQSGGDRKTANEN  204

Query  608   YIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNA  787
             Y FL+NWLERFPEYK RD +I+GESYAGHYVPQLA  IL +NK  N  IINLKGI IGNA
Sbjct  205   YAFLVNWLERFPEYKKRDFYISGESYAGHYVPQLAHTILHHNKKANGPIINLKGIIIGNA  264

Query  788   YIDEETQDSGTYDFYWTHALISDETHRGIIANCNFS-SAASPSDTCDTFVDDADRSMGNI  964
              ID+E  D G Y +  +HAL+S++T   +  +CNFS  A S S  C   VD+   ++  I
Sbjct  265   VIDDEADDIGRYQYLGSHALVSEKTIHQMEKHCNFSPGATSQSKECTEAVDEVHSNIDVI  324

Query  965   YSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPW  1144
               YNIY+P C   + + ++  +  +  FDPCS  Y+  YLN  +VQKALHANVT +   W
Sbjct  325   DIYNIYSPLC--FNTILTAKPKKVTPEFDPCSDYYVSAYLNRADVQKALHANVTKLKYEW  382

Query  1145  DSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVK  1324
               CS D++ NW D P T++P ++E M +G+ VW++SGD DG V VT+T  +I K+  SVK
Sbjct  383   RPCS-DIDKNWTDSPLTIIPLLREFMANGLRVWVFSGDTDGDVPVTSTMASIGKMRLSVK  441

Query  1325  TPWYPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPK  1495
             TPW+PW+ +    G   V   DL+F T+RGAGH VPS++P+RAL+    F+ G   PK
Sbjct  442   TPWHPWFVAGEVGGYTEVYKGDLTFATVRGAGHQVPSFRPKRALSLIVHFLSGTPLPK  499



>ref|XP_006658912.1| PREDICTED: serine carboxypeptidase II-3-like [Oryza brachyantha]
Length=466

 Score =   423 bits (1088),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 242/438 (55%), Positives = 297/438 (68%), Gaps = 17/438 (4%)
 Frame = +2

Query  224   LKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSD----KPLVLWLn  391
             L   ++++ LPGQP GV FAQ++GYVTV+  AGRALFYY AE+   +     KPL+LWLN
Sbjct  23    LLSGNRVAGLPGQPSGVDFAQYAGYVTVNATAGRALFYYLAEANGSAAAASSKPLLLWLN  82

Query  392   ggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSD  571
             GGPGCSS G G M E GPFRV SD K L+ N Y+WNNVANV+FLESP GVGFSYSN ++D
Sbjct  83    GGPGCSSLGYGAMEELGPFRVMSDGKKLYRNPYSWNNVANVLFLESPVGVGFSYSNTTAD  142

Query  572   Y-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKIT--  742
             Y + GD  TA D Y FL+NW+ERFPEYK RD ++ GESYAGHYVPQLA  ILR++     
Sbjct  143   YSLMGDTSTAEDAYRFLVNWMERFPEYKGRDFYLAGESYAGHYVPQLAHAILRHSSAAGT  202

Query  743   ---NQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPS  913
                + + INLKGI IGNA I++ T   G YDF+WTHALISDE + GI  +CNFS AA  +
Sbjct  203   GKPSSSPINLKGIMIGNAVINDWTDTKGMYDFFWTHALISDEANDGIAKHCNFSDAAPDN  262

Query  914   DTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTP  1093
               CD     A  ++ NI  YNIYAP C   +GL S  V  S   FDPC+  Y+  YLN P
Sbjct  263   ALCDNATTLAGEALQNIDIYNIYAPNC-QSAGLVSPPVAPSVDRFDPCTDYYVDAYLNNP  321

Query  1094  EVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKV  1273
             +VQKALHANVT +  PW +CS DV  +W D   TVLP I+EL+ + I VW+YSGD DG+V
Sbjct  322   DVQKALHANVTKLDHPWSACS-DVLRSWVDSASTVLPIIRELLKNNIRVWVYSGDTDGRV  380

Query  1274  AVTTTTYAINKLNTSVKTPWYPWYSKgevgg-----yvvgyeDLSFVTIRGAGHFVPSYQ  1438
              VT++ Y++N+LN +V   W PW+S  E  G      V    +LS VT+RGAGH VPSYQ
Sbjct  381   PVTSSRYSVNQLNLAVTDKWRPWFSNTEGAGDVGGYVVQYKGNLSLVTVRGAGHEVPSYQ  440

Query  1439  PERALTFFSAFVEGKLPP  1492
             P+RAL     F+ GK  P
Sbjct  441   PQRALVLVQNFLAGKTLP  458



>ref|XP_010067794.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
40 [Eucalyptus grandis]
Length=435

 Score =   422 bits (1085),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 234/432 (54%), Positives = 294/432 (68%), Gaps = 8/432 (2%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLn  391
             Q+GL++ D I  LPGQP  VKF  + GYVT+D  AGRA +YYF E        PL+LWLN
Sbjct  4     QEGLREKDMIKRLPGQPP-VKFDHYGGYVTIDELAGRAFYYYFVEGVRNKESMPLLLWLN  62

Query  392   ggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSD  571
             GGPGCSS G G M E GPFRV+SD KTL+ NK+AWNN ANV+FLESPAGVGFSYSN ++D
Sbjct  63    GGPGCSSLGYGAMQELGPFRVHSDGKTLYKNKFAWNNAANVLFLESPAGVGFSYSNTTAD  122

Query  572   YVT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQ  748
             Y + GD KTAADNY+FLLNWLERFPEYK RD +I+GESYAGHYVPQLA  IL NNK  N+
Sbjct  123   YSSSGDSKTAADNYVFLLNWLERFPEYKDRDFYISGESYAGHYVPQLAHNILSNNKRANK  182

Query  749   TIINLKGI--AIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFS-SAASPSDT  919
             T+INLKGI   IGNA I++ET   G  +++ THALISDET   I   C+FS +A S    
Sbjct  183   TLINLKGIXXVIGNAVINDETDQRGILEYFATHALISDETGFAIQKYCDFSPNATSQVSQ  242

Query  920   CDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEV  1099
             C +   DA   +  +  YNIYAP C   S L+S   + +   FDP    Y++  +N  +V
Sbjct  243   CLSAAQDASNDVSPLQIYNIYAPLC-FSSNLTSHPKKTNIMDFDPSVDTYVHACMNREDV  301

Query  1100  QKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAV  1279
             Q+ALHANVT +   W++CS  V   W D P TVLP ++E M SG+ VW++SGD DG+V V
Sbjct  302   QEALHANVTKLDHDWENCSDVVLQTWGDSPSTVLPLLREFMSSGLRVWVFSGDTDGRVPV  361

Query  1280  TTTTYAINKLNTSVKTPWYPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALT  1456
             T+T  +++K+    ++PW PW+      G   V   DL+F T+RG+GH VPSYQP+RAL+
Sbjct  362   TSTKRSLSKMKLPTESPWRPWFLGGEVGGYVQVYKGDLTFATVRGSGHQVPSYQPKRALS  421

Query  1457  FFSAFVEGKLPP  1492
               S F+ G L P
Sbjct  422   LISHFLAGSLLP  433



>ref|XP_009792171.1| PREDICTED: serine carboxypeptidase-like 40 [Nicotiana sylvestris]
Length=505

 Score =   424 bits (1091),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 234/433 (54%), Positives = 291/433 (67%), Gaps = 9/433 (2%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLng  394
             Q+GLK  D+I  L GQP  VKF Q+ GYVTV+  AGRALFYYF E+E     PL+LWLNG
Sbjct  67    QEGLKHKDRIKRLSGQPP-VKFKQYGGYVTVNEFAGRALFYYFVEAENSRSLPLLLWLNG  125

Query  395   gpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY  574
             GPGCSS   G M E GPFRV+S+ KTL+ N YAWN+ ANV+FLESPAGVGFSYSN SSD 
Sbjct  126   GPGCSSIAYGAMEELGPFRVHSNGKTLYRNHYAWNHEANVLFLESPAGVGFSYSNTSSDV  185

Query  575   VT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQT  751
              + GD+ TA DN IFLLNW++RFPEYK RD +I GESYAGH+VPQLAQ IL +NK+  +T
Sbjct  186   KSNGDRNTAIDNVIFLLNWIQRFPEYKNRDFYIAGESYAGHFVPQLAQTILHHNKLAKKT  245

Query  752   IINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASP-SDTCDT  928
             ++NLKGI IGNA I+ ET   G Y+++ +HALI DE    I   CNFS  A P S  CD 
Sbjct  246   LLNLKGIMIGNAVINYETDRKGMYEYHASHALIPDEILEQIERYCNFSDKALPQSQECDN  305

Query  929   FVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKA  1108
              +D A      I  YNIYAP C   +   +   + +S+  DPCS DY+  Y+N P+VQK 
Sbjct  306   AIDIAIADTEPIDVYNIYAPLC--SNSELTLQPKKTSQVIDPCSDDYVIAYMNRPDVQKL  363

Query  1109  LHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLY--SGDIDGKVAVT  1282
             LHANVT I   W  CS DV  +W D P T++P +KELM +G+ +W++  SGD DG V VT
Sbjct  364   LHANVTKIKYNWQPCS-DVIESWTDSPLTIIPLLKELMANGVRLWMFRCSGDTDGIVPVT  422

Query  1283  TTTYAINKLNTSVKTPWYPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTF  1459
             +T  +I K+   +KT WYPW+ +    G   +   +L+F T+RGAGH VPSYQP RAL+ 
Sbjct  423   STKKSIKKMKLPIKTAWYPWFHNDEVGGYAQIYVGNLTFATVRGAGHQVPSYQPARALSL  482

Query  1460  FSAFVEGKLPPKS  1498
                F+ G   P S
Sbjct  483   VKHFLAGTELPNS  495



>ref|XP_010324807.1| PREDICTED: serine carboxypeptidase-like 40 isoform X2 [Solanum 
lycopersicum]
Length=491

 Score =   424 bits (1089),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 240/428 (56%), Positives = 294/428 (69%), Gaps = 6/428 (1%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLng  394
             Q+GLKD D I  LPGQP  VKF Q+ GYVTVD  AGRAL+YYF E+E     PL+LWLNG
Sbjct  65    QEGLKDKDWIKKLPGQPP-VKFQQYGGYVTVDGSAGRALYYYFTEAENSKSLPLLLWLNG  123

Query  395   gpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY  574
             GPGCSS   G M E GPFRVNSD KTL  N YAWN VANV+FLESPAGVGFSY+N SSD+
Sbjct  124   GPGCSSIAYGAMEELGPFRVNSDGKTLHRNHYAWNLVANVLFLESPAGVGFSYTNTSSDF  183

Query  575   -VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQT  751
               TGD +TA DN +FLLNWLERFPEYK RD +I+GESYAGHYVPQLA  IL++NK  N+T
Sbjct  184   NTTGDSRTANDNVVFLLNWLERFPEYKKRDFYISGESYAGHYVPQLAHEILKHNKQANKT  243

Query  752   IINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTF  931
             +INLKGI IGNA I+++T   GTY++Y +HALISDET   I   C F +  + S+ C+  
Sbjct  244   LINLKGIIIGNAVINDDTDIIGTYEYYASHALISDETFLNIKKYC-FDNHYNKSN-CNEA  301

Query  932   VDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKAL  1111
             V  ++ ++ +I  YNIY P C     L+      S   F+PCS  Y+Y YLN  +VQ AL
Sbjct  302   VAVSNNNLYDIDIYNIYFPLC-KDGNLTKYPRVPSPLVFEPCSDQYVYAYLNRRDVQDAL  360

Query  1112  HANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTT  1291
             HANVT I   W+SCS  +  NW+D P T++P + E + +G+ VW++SGD DG V VT+T 
Sbjct  361   HANVTNIKYDWESCSDPLFYNWKDSPATIIPLLTESLENGVRVWIFSGDTDGSVPVTSTK  420

Query  1292  YAINKLNTSVKTPWYPWYSKgevgg-yvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSA  1468
              +I  +N  V  PW  W S GE+GG        L+F T+RGAGH VPSYQP RAL+  S 
Sbjct  421   KSIKAMNLIVDQPWRSWLSGGEIGGYVETYKGGLTFATVRGAGHEVPSYQPARALSLISH  480

Query  1469  FVEGKLPP  1492
             F+ G L P
Sbjct  481   FLSGTLLP  488



>ref|XP_010279512.1| PREDICTED: serine carboxypeptidase-like 40 isoform X2 [Nelumbo 
nucifera]
Length=480

 Score =   423 bits (1088),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 248/474 (52%), Positives = 307/474 (65%), Gaps = 21/474 (4%)
 Frame = +2

Query  95    GRKFDPLESLLKTQKQKRQNNNAQTI--IMSAQDLGSVYIGAQDGLKDADKISALPGQPE  268
             GR+ D L  L + + Q +   +  +   +   Q +    +  Q+GLK+ D I  LPGQP 
Sbjct  23    GRQADALARLYQAKLQNKAGIDLTSSYEMKMTQIINEAEVLPQEGLKEKDMIERLPGQPP  82

Query  269   GVKFAQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLnggpgcssfgnggMMENGPF  448
              V F Q+ GYVTVD  AGRALFYYF E++ P  KPL+LWLNGGPGCSS G G M E GPF
Sbjct  83    -VGFKQYGGYVTVDESAGRALFYYFVEAQDPKSKPLLLWLNGGPGCSSLGYGAMEELGPF  141

Query  449   RVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVT-GDKKTAADNYIFLLN  625
             RV+SD KTL+ N+Y+WN              GFSYSNR+SDY T GD+ TA DNY+FL+N
Sbjct  142   RVHSDGKTLYENRYSWNR-------------GFSYSNRTSDYATRGDQSTAEDNYVFLVN  188

Query  626   WLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEET  805
             WLERFPEYKTRD +I GESYAGHYVPQ A  IL++NKI    IINLKGI IGNA I++ET
Sbjct  189   WLERFPEYKTRDFYIAGESYAGHYVPQFAHTILQHNKIEQNNIINLKGIMIGNAVINDET  248

Query  806   QDSGTYDFYWTHALISDETHRGIIANCNFS-SAASPSDTCDTFVDDADRSMGNIYSYNIY  982
                G YD+ WTHAL SDET+  I   CNFS S    SD C    ++A  +   I  YNIY
Sbjct  249   DQKGMYDYAWTHALSSDETNIAINKYCNFSESELEWSDECINSTNEAFMNEVLIDIYNIY  308

Query  983   APFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQD  1162
                C   S L+    + S   FDPCS +Y+  YLN P+VQ+ALHAN+T +   W  CS D
Sbjct  309   GSQC-FSSNLTEKPKKASLMNFDPCSDNYVVAYLNQPDVQEALHANITKLKYDWQPCS-D  366

Query  1163  VNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPW  1342
             V   W D P TV+  ++E M +GI V ++SGD+DG+V VT+T Y++NKL   V T WYPW
Sbjct  367   VLTKWNDSPSTVVYLLQEFMDNGIRVLVFSGDVDGRVPVTSTRYSLNKLQLQVNTSWYPW  426

Query  1343  YSKgev-ggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKSA  1501
             Y+K EV G  VV    L+F T+RGAGH VPSYQP RALT  + F+ GK  P++A
Sbjct  427   YTKREVGGYTVVYKGGLTFATVRGAGHEVPSYQPLRALTLVNYFLHGKPLPRNA  480



>ref|XP_010932886.1| PREDICTED: serine carboxypeptidase-like 40 isoform X3 [Elaeis 
guineensis]
Length=390

 Score =   420 bits (1079),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 236/398 (59%), Positives = 278/398 (70%), Gaps = 12/398 (3%)
 Frame = +2

Query  305   VDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWL  481
             V+PQ GR LFYYF ES   P  KPL+LWLNGGPGCSS G G M E GPFRV SD KTL  
Sbjct  2     VEPQHGRTLFYYFVESPRDPERKPLLLWLNGGPGCSSLGGGAMQELGPFRVQSDGKTLHR  61

Query  482   NKYAWNNVANVIFLESPAGVGFSYSNRSSDYVT-GDKKTAADNYIFLLNWLERFPEYKTR  658
             NK+AWNNVANV+FLESPAGVGFSY+  SSDY   GDK+TA D Y FL+NWLERFPEYKTR
Sbjct  62    NKHAWNNVANVVFLESPAGVGFSYTKTSSDYENRGDKRTAEDTYTFLVNWLERFPEYKTR  121

Query  659   DLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWT  838
             D F+TGESYAGHYVPQLA LI+ NNK  N+  INL+GIAIGNAYID  T   G Y+F W 
Sbjct  122   DFFVTGESYAGHYVPQLASLIVLNNKKPNKPTINLRGIAIGNAYIDTNTTLMGMYEFLWM  181

Query  839   HALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglss  1018
             HA+ SD T+R I   C  S     S  C+   + AD  +G+I  +N+Y P C +      
Sbjct  182   HAMYSDRTYRLIRRKCKISDMY--SSECENATNLADFEIGSIDRFNVYVPLC-TKKLHQP  238

Query  1019  ssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTV  1198
             +SV  S+  FDPC+ +Y+Y YLN PEVQK+LHA    IP  W  CS+     W D P T+
Sbjct  239   TSVTSSNVEFDPCAGNYVYAYLNLPEVQKSLHA----IPFLWTYCSRG---GWRDSPYTM  291

Query  1199  LPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvg  1378
             LP IK+L  SGI +WLYSGD+D  V+VT+T Y +  L   +K+PW PW +  EV GYVV 
Sbjct  292   LPMIKQLATSGIRMWLYSGDMDSVVSVTSTKYFLRMLGLPIKSPWRPWQANSEVAGYVVA  351

Query  1379  yeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
             Y  L+FVT+RGAGH VPSYQPER+L   SAF+EGKLPP
Sbjct  352   YNGLTFVTVRGAGHEVPSYQPERSLIMISAFLEGKLPP  389



>ref|XP_004135951.1| PREDICTED: serine carboxypeptidase-like 40-like [Cucumis sativus]
 ref|XP_004158177.1| PREDICTED: serine carboxypeptidase-like 40-like [Cucumis sativus]
 gb|KGN45090.1| hypothetical protein Csa_7G420830 [Cucumis sativus]
Length=512

 Score =   424 bits (1090),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 234/444 (53%), Positives = 296/444 (67%), Gaps = 10/444 (2%)
 Frame = +2

Query  185   QDLGSVYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPS  364
             Q+  +V I  Q G+K  DKI  LPGQP  V+F+Q+ GYVTV+  AGRA +YYF E+  P 
Sbjct  68    QNAENVEIYDQTGMKKQDKIERLPGQPPNVRFSQYGGYVTVNKSAGRAFYYYFVEA--PH  125

Query  365   DK---PLVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPA  535
             +K   PL+LWLNGGPGCSS   G M E GPFRV SD KTL+ NK++WN+ ANV+FLESP 
Sbjct  126   NKKSLPLLLWLNGGPGCSSLAYGAMAELGPFRVRSDGKTLFQNKFSWNHAANVLFLESPT  185

Query  536   GVGFSYSNRSSDYVT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLA  712
             GVGFSYSN +SDY T GDK TA +NY FL+NWLERFPEYKTRD +I GESYAGHYVPQLA
Sbjct  186   GVGFSYSNTTSDYNTNGDKSTAKNNYAFLVNWLERFPEYKTRDFYIAGESYAGHYVPQLA  245

Query  713   QLILRNNKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNF  892
               IL +NK   + I+NLKGI IGNA I++ET   G YDF+ +HALI+D T   I   CNF
Sbjct  246   HTILSHNKKAGKKIVNLKGIIIGNAVINDETDQIGMYDFFASHALIADRTANDIRKYCNF  305

Query  893   SS-AASPSDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDY  1069
             +S  A  +  C    +  + ++G I  YNIY P C   S L++   + S   +DPC+  Y
Sbjct  306   TSEEAVQNRQCLDASNMVELNIGVIDIYNIYYPLC-QNSTLTNVPKKASVLNYDPCTDYY  364

Query  1070  IYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLY  1249
              Y YLN  +VQKA+HANVT +   W+ CS DV   W D   TV+P ++E M SG+ VW++
Sbjct  365   TYAYLNRADVQKAMHANVTKLSYDWEPCS-DVMQGWSDSASTVVPLLREFMASGLRVWVF  423

Query  1250  SGDIDGKVAVTTTTYAINKLNTSVKTPWYPWY-SKgevggyvvgyeDLSFVTIRGAGHFV  1426
             SGD DG+V +T+T Y+I+ +   VK  WYPW+ +    G   V   +L+  T+RGAGH V
Sbjct  424   SGDFDGRVPITSTKYSIDSMKLPVKKSWYPWFNANEVGGYAEVYEGELTLATVRGAGHEV  483

Query  1427  PSYQPERALTFFSAFVEGKLPPKS  1498
             PSYQP RAL+    F+ G   P S
Sbjct  484   PSYQPRRALSLIKHFLHGTPLPSS  507



>ref|XP_009601275.1| PREDICTED: serine carboxypeptidase-like 40 [Nicotiana tomentosiformis]
Length=492

 Score =   423 bits (1088),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 239/476 (50%), Positives = 309/476 (65%), Gaps = 9/476 (2%)
 Frame = +2

Query  86    SIGGRKFDPLESLLKTQKQKRQNNNAQTI--IMSAQDLGSVYIGAQDGLKDADKISALPG  259
             S+G R+ D L    K +++K  + +       ++  DL  V I  Q+G K+ D I  LPG
Sbjct  22    SLGKRQSDVLGKFYKAKQKKDSSIDKSQFKAALNHVDLDKV-ILPQEGQKEKDWIKKLPG  80

Query  260   QPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLnggpgcssfgnggMMEN  439
             QP  VKF Q+ GYVTV+  AGRAL+YYF E+E     PL+LWLNGGPGCSS   G M E 
Sbjct  81    QPP-VKFHQYGGYVTVNESAGRALYYYFTEAENSKSLPLLLWLNGGPGCSSIAFGAMEEL  139

Query  440   GPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIF  616
             GPFRV+SD KTL+ N YAWN  ANV+FLESPAGVGFSY+N SSD+  TGDK+TA DN +F
Sbjct  140   GPFRVHSDGKTLYRNHYAWNLAANVLFLESPAGVGFSYTNTSSDFNSTGDKRTANDNVVF  199

Query  617   LLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYID  796
             LLNWLERFPEYK RD +I+GESYAGHYVPQLA  IL  NK +N+T+INLKGI IGNA I+
Sbjct  200   LLNWLERFPEYKNRDFYISGESYAGHYVPQLAHAILHLNKRSNKTLINLKGIIIGNAVIN  259

Query  797   EETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYN  976
             E+T + G Y+++ +HALISD+T   I   C   S     + C+     +D +  N+  YN
Sbjct  260   EDTDNVGMYEYFASHALISDQTFLDIQKYC--YSDFYNEEKCNKAGAVSDNNTDNLDIYN  317

Query  977   IYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCS  1156
             IY P C     L+       +  FDPCS +YIY YLN  +VQ+ALHANVT I   W++CS
Sbjct  318   IYFPLC-HDGNLTKHPKLPFTLQFDPCSDNYIYAYLNRRDVQEALHANVTNISYDWEACS  376

Query  1157  QDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWY  1336
               +  NW+D P T++P ++E + +G+ VW++SGD DG+V VT++  +I  ++ +V  PW 
Sbjct  377   DPLFYNWKDSPLTIIPLLEESLANGVRVWIFSGDTDGRVPVTSSKRSIKAMDLTVDKPWR  436

Query  1337  PW-YSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKSA  1501
              W Y     G        L+  T+RGAGH VPSYQP RAL+  S F+ G  PP  A
Sbjct  437   SWLYGGEVGGYIETYKGGLTLATVRGAGHEVPSYQPARALSLISHFLSGTPPPGDA  492



>ref|NP_191906.1| serine carboxypeptidase-like 40 [Arabidopsis thaliana]
 sp|Q0WRX3.2|SCP40_ARATH RecName: Full=Serine carboxypeptidase-like 40; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB87800.1| serin carboxypeptidase-like protein [Arabidopsis thaliana]
 gb|AAM65131.1| serin carboxypeptidase-like protein [Arabidopsis thaliana]
 gb|AEE80489.1| serine carboxypeptidase-like 40 [Arabidopsis thaliana]
Length=502

 Score =   423 bits (1088),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 225/425 (53%), Positives = 285/425 (67%), Gaps = 11/425 (3%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK-PLVLWLn  391
             Q+GL+  D I  LPGQP  V F Q+ GYVTV+  AGR+ FYYF E+    D  PL+LWLN
Sbjct  73    QEGLRKRDLIRRLPGQPP-VSFDQYGGYVTVNESAGRSFFYYFVEASKSKDSSPLLLWLN  131

Query  392   ggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSD  571
             GGPGCSS   G + E GPFRV+SD KTL+ N+YAWNN ANV+FLESPAGVGFSY+N +SD
Sbjct  132   GGPGCSSLAYGALQELGPFRVHSDGKTLFRNRYAWNNAANVLFLESPAGVGFSYTNTTSD  191

Query  572   YVT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQ  748
                 GD+ TAADNYIFL+NWLERFPEYK RDL+I GESYAGHYVPQLA  IL    + ++
Sbjct  192   LEKHGDRNTAADNYIFLVNWLERFPEYKGRDLYIAGESYAGHYVPQLAHTIL----LHHR  247

Query  749   TIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNF--SSAASPSDTC  922
             +  NLKGI IGNA I++ET   G YDF+ +HALIS+++   + +NC+    SA+  ++ C
Sbjct  248   SFFNLKGILIGNAVINDETDLMGMYDFFESHALISEDSLARLKSNCDLKTESASVMTEEC  307

Query  923   DTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQ  1102
                 D  D     +  YNIYAP C + +         + R FDPCS  Y+  YLN PEVQ
Sbjct  308   AVVSDQIDMDTYYLDIYNIYAPLCLNSTLTRRPKRGTTIREFDPCSDHYVQAYLNRPEVQ  367

Query  1103  KALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVT  1282
              ALHAN T +P  W  CS  +   W D P TV+P IKELMG G+ VW++SGD DG++ VT
Sbjct  368   AALHANATKLPYEWQPCSSVIK-KWNDSPTTVIPLIKELMGQGVRVWVFSGDTDGRIPVT  426

Query  1283  TTTYAINKLNTSVKTPWYPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTF  1459
             +T Y++ K+N + KT W+PWY      G        L+F T+RGAGH VPS+QP+R+L+ 
Sbjct  427   STKYSLKKMNLTAKTAWHPWYLGGEVGGYTEEYKGKLTFATVRGAGHQVPSFQPKRSLSL  486

Query  1460  FSAFV  1474
             F  F+
Sbjct  487   FIHFL  491



>gb|EEC75383.1| hypothetical protein OsI_11849 [Oryza sativa Indica Group]
Length=415

 Score =   420 bits (1079),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 228/417 (55%), Positives = 293/417 (70%), Gaps = 4/417 (1%)
 Frame = +2

Query  251   LPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgngg  427
             +PGQ E  +F Q++GYVTVD +AGRALFYYF E+   P  KPLVLWLNGGPGCSSFG G 
Sbjct  1     MPGQMEEAEFNQYAGYVTVDAKAGRALFYYFVEAPHDPLKKPLVLWLNGGPGCSSFGAGA  60

Query  428   MMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVT-GDKKTAAD  604
             M+E GPF V SD+KTL+  ++AWN VAN++F++ PAGVG+SYSN +SDY   GDKKT  D
Sbjct  61    MLELGPFSVRSDNKTLYKKQHAWNTVANMLFVDVPAGVGYSYSNTTSDYYNIGDKKTTDD  120

Query  605   NYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGN  784
              YIFL+NW+++FPEY+  D FITGESYAGHY+P+LA LI+ NN+  N T I LKG+AIGN
Sbjct  121   AYIFLINWMKKFPEYQGHDFFITGESYAGHYIPELANLIVSNNRAINSTNIKLKGVAIGN  180

Query  785   AYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNI  964
             A + +      ++D+YW HA+ISD  +R I  +C F+     ++ C   ++ A++  GN+
Sbjct  181   ADLHDNVTLRASFDYYWRHAMISDRVYRAIQTSCGFNETY--TNDCQNAMNLANKEKGNV  238

Query  965   YSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPW  1144
               YNIYAP C   S  S S    S    DPC++ Y+  YLN PEVQ+ALHAN TG+  PW
Sbjct  239   DDYNIYAPQCHDASNPSPSGSSDSVAFGDPCTNHYVSSYLNNPEVQRALHANTTGLNYPW  298

Query  1145  DSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVK  1324
               CS  +  NW+D P+T+LP+IK L+ SG  +WLYSGD+D   +VT+T YA++ L   V+
Sbjct  299   MDCSGLIFDNWKDSPETMLPSIKTLISSGTRIWLYSGDMDAVCSVTSTQYALDILGLPVE  358

Query  1325  TPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPK  1495
             T W PW    EV GYVVGY  L F T+RGAGH VP YQP RAL   S+F+EGKLPP+
Sbjct  359   TSWRPWRIDNEVAGYVVGYRGLVFATVRGAGHMVPYYQPRRALALLSSFLEGKLPPE  415



>gb|EEE59170.1| hypothetical protein OsJ_11093 [Oryza sativa Japonica Group]
Length=415

 Score =   420 bits (1079),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 228/417 (55%), Positives = 293/417 (70%), Gaps = 4/417 (1%)
 Frame = +2

Query  251   LPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgngg  427
             +PGQ E  +F Q++GYVTVD +AGRALFYYF E+   P  KPLVLWLNGGPGCSSFG G 
Sbjct  1     MPGQMEEAEFNQYAGYVTVDAKAGRALFYYFVEAPHDPLKKPLVLWLNGGPGCSSFGAGA  60

Query  428   MMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVT-GDKKTAAD  604
             M+E GPF V SD+KTL+  ++AWN VAN++F++ PAGVG+SYSN +SDY   GDKKT  D
Sbjct  61    MLELGPFSVRSDNKTLYNKQHAWNTVANMLFVDVPAGVGYSYSNTTSDYYNIGDKKTTDD  120

Query  605   NYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGN  784
              YIFL+NW+++FPEY+  D FITGESYAGHY+P+LA LI+ NN+  N T I LKG+AIGN
Sbjct  121   AYIFLINWMKKFPEYQGHDFFITGESYAGHYIPELANLIVSNNRAINSTNIKLKGVAIGN  180

Query  785   AYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNI  964
             A + +      ++D+YW HA+ISD  +R I  +C F+     ++ C   ++ A++  GN+
Sbjct  181   ADLHDNVTLRASFDYYWRHAMISDRVYRAIQTSCGFNETY--TNDCQNAMNLANKEKGNV  238

Query  965   YSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPW  1144
               YNIYAP C   S  S S    S    DPC++ Y+  YLN PEVQ+ALHAN TG+  PW
Sbjct  239   DDYNIYAPQCHDASNPSPSGSSDSVAFGDPCTNHYVSSYLNNPEVQRALHANTTGLNYPW  298

Query  1145  DSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVK  1324
               CS  +  NW+D P+T+LP+IK L+ SG  +WLYSGD+D   +VT+T YA++ L   V+
Sbjct  299   MDCSGLIFDNWKDSPETMLPSIKTLISSGTRIWLYSGDMDAVCSVTSTQYALDILGLPVE  358

Query  1325  TPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPK  1495
             T W PW    EV GYVVGY  L F T+RGAGH VP YQP RAL   S+F+EGKLPP+
Sbjct  359   TSWRPWRIDNEVAGYVVGYRGLVFATVRGAGHMVPYYQPRRALALLSSFLEGKLPPE  415



>ref|XP_008461353.1| PREDICTED: serine carboxypeptidase-like 40 [Cucumis melo]
Length=517

 Score =   423 bits (1088),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 232/439 (53%), Positives = 294/439 (67%), Gaps = 10/439 (2%)
 Frame = +2

Query  200   VYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK---  370
             V I  Q G+K  DKI  LPGQP  V+ +Q+ GYVTV+  AGRA +YYF E+  P +K   
Sbjct  78    VEIYDQTGMKKQDKIVRLPGQPPNVRLSQYGGYVTVNKSAGRAFYYYFVEA--PHNKKSL  135

Query  371   PLVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFS  550
             PL+LWLNGGPGCSS   G M E GPFRV SD KTL+ NK++WN+ ANV+FLESP GVGFS
Sbjct  136   PLLLWLNGGPGCSSLAYGAMAELGPFRVRSDGKTLFQNKFSWNHAANVLFLESPTGVGFS  195

Query  551   YSNRSSDYVT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILR  727
             YSN +SDY T GDK TA +NY FL+NWLERFPEYKTRD +I GESYAGHYVPQLA  IL 
Sbjct  196   YSNTTSDYDTNGDKSTAENNYAFLVNWLERFPEYKTRDFYIAGESYAGHYVPQLAHTILS  255

Query  728   NNKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSS-AA  904
             +NK   + I+NLKGI IGNA I++ET   G YDF+ +HALI+D T + I   CNF+S  A
Sbjct  256   HNKKAGKNIVNLKGIIIGNAVINDETDQIGMYDFFASHALIADRTAKDIRKYCNFTSDEA  315

Query  905   SPSDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYL  1084
               +  C    +  + ++G I  YNIY P C   + L++   + S   +DPC+  Y Y YL
Sbjct  316   VQNRQCIDASNMVESNIGVIDIYNIYYPLC-QNTTLTNVPKRASVLNYDPCTDYYTYAYL  374

Query  1085  NTPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDID  1264
             N  +VQKA+HANVT +   W+ CS DV   W D   TV+P ++E M SG+ VW++SGD D
Sbjct  375   NRADVQKAMHANVTKLSYDWEPCS-DVMQGWSDSASTVVPLLREFMASGLRVWVFSGDFD  433

Query  1265  GKVAVTTTTYAINKLNTSVKTPWYPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQP  1441
             G+V +T+T Y+I+ +   VK  WYPW+ +K   G   V   +L+  T+RGAGH VPSYQP
Sbjct  434   GRVPITSTKYSIDSMKLPVKKSWYPWFNAKEVGGYAEVYEGELTLATVRGAGHEVPSYQP  493

Query  1442  ERALTFFSAFVEGKLPPKS  1498
              RAL+    F+ G   P S
Sbjct  494   RRALSLIKHFLRGTPLPSS  512



>ref|XP_006345490.1| PREDICTED: serine carboxypeptidase-like 40-like [Solanum tuberosum]
Length=486

 Score =   422 bits (1085),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 230/431 (53%), Positives = 295/431 (68%), Gaps = 15/431 (3%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLng  394
             Q+GLK  D I+ LPGQP  VKF Q+ GYVTV+  AGRAL+YYF E+E  +  PL+LWLNG
Sbjct  63    QEGLKAKDWINKLPGQPP-VKFQQYGGYVTVNQSAGRALYYYFTEAENSNALPLLLWLNG  121

Query  395   gpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY  574
             GPGCSS   G M E GPFRVNSD KTL  N+YAWN+ ANV+FLESPAGVGFSY+N SSD 
Sbjct  122   GPGCSSIAYGAMEELGPFRVNSDGKTLHRNRYAWNHAANVLFLESPAGVGFSYTNTSSDL  181

Query  575   -VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQT  751
               TGD +TA DN +FLLNWLERFPEYK RD +I+GESYAGHYVPQLA  IL+ NK+  +T
Sbjct  182   NTTGDSRTANDNVVFLLNWLERFPEYKNRDFYISGESYAGHYVPQLAHAILQLNKLEKKT  241

Query  752   IINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANC---NFSSAASPSDTC  922
             +INLKGI IGNA I+++T   G Y+++ +HALISDET+  I+ +C   N++        C
Sbjct  242   LINLKGIIIGNAVINDDTDTIGMYEYFASHALISDETYHDILNSCYDDNYNQRK-----C  296

Query  923   DTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQ  1102
             D   +  ++++ N+  YNIY P C       + +    +   DPCS  YIY Y+N   VQ
Sbjct  297   DEAAEITNKNLNNLDIYNIYYPLC----KDGNLTKYPKTPTIDPCSDKYIYAYMNRRNVQ  352

Query  1103  KALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVT  1282
              ALHANVT +   W SCS  +  +W+D P T++P +KE + +G+ VW++SGD DG+V VT
Sbjct  353   DALHANVTNLKYDWTSCSDSLFYDWKDSPVTIIPLLKESLANGVRVWIFSGDTDGRVPVT  412

Query  1283  TTTYAINKLNTSVKTPWYPWYSKgevgg-yvvgyeDLSFVTIRGAGHFVPSYQPERALTF  1459
             ++  +I  +N +V  PW  W + GEVGG        L+F T+RGAGH VPSYQP RAL+ 
Sbjct  413   SSKRSIQAMNLTVDQPWRSWLNGGEVGGYVETYKGGLTFATVRGAGHEVPSYQPTRALSL  472

Query  1460  FSAFVEGKLPP  1492
              S F+ G LPP
Sbjct  473   ISHFLSGTLPP  483



>gb|KHN11708.1| Serine carboxypeptidase-like 40 [Glycine soja]
Length=496

 Score =   422 bits (1084),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 240/480 (50%), Positives = 308/480 (64%), Gaps = 17/480 (4%)
 Frame = +2

Query  92    GGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVY---IGAQDGLKDADKISALPGQ  262
             G R+   L  L K+ K  R N+         ++L  VY   + +Q+GLK+ D+I +LPGQ
Sbjct  25    GNRQVQALNKLHKSTKF-RGNSQIDRSEFEVEEL--VYDDIVHSQEGLKEKDRIESLPGQ  81

Query  263   PEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK-PLVLWLnggpgcssfgnggMMEN  439
             P  V F+ + GYVTVD +AGRA +YYF E++      PL+LWLNGGPGCSS G G M E 
Sbjct  82    PP-VSFSHYGGYVTVDKEAGRAFYYYFVEAQRSKQTLPLLLWLNGGPGCSSLGYGAMQEL  140

Query  440   GPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVT-GDKKTAADNYIF  616
             GPFRVNSD KTL  N ++WN VANV+FLESPAGVGFSYSN+S DY T GDKKTAADNY+F
Sbjct  141   GPFRVNSDGKTLHRNIFSWNKVANVLFLESPAGVGFSYSNKSKDYDTNGDKKTAADNYLF  200

Query  617   LLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYID  796
             L+NWLER+PEYK RD +I GESYAGHYVPQ A  IL +NK  N+ IINLKGI IGNA I+
Sbjct  201   LVNWLERYPEYKERDFYIAGESYAGHYVPQFAHTILYHNKKANKKIINLKGILIGNAVIN  260

Query  797   EETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYN  976
             EET   G YD+  +HA+ISD+    +   C+ SS+      CD   D+    +  I  YN
Sbjct  261   EETDSDGLYDYLASHAIISDKAAY-LNKACDSSSSKIQESVCDAAGDELGEDIEYIDLYN  319

Query  977   IYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCS  1156
             IYAP C + +  +           DPCS +Y+Y YLN  +VQ+ALHANVT +   W+ CS
Sbjct  320   IYAPLCKNANLTALPKRNTIVT--DPCSENYVYAYLNRKDVQEALHANVTNLKHDWEPCS  377

Query  1157  QDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWY  1336
              DV   W D   TVLP + E + + + VW++SGD DG+V +T+T Y++ K+N  +K+ W+
Sbjct  378   -DVITKWVDQASTVLPLLHEFLNNSLRVWIFSGDTDGRVPITSTKYSVKKMNLPIKSVWH  436

Query  1337  PWYS-KgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKL---PPKSAE  1504
             PW+S     G   V    L+  T+R AGH VPSYQP RALT    F++G     PPK  +
Sbjct  437   PWFSYGEVGGYVEVYKGGLTLATVREAGHQVPSYQPARALTLIKYFLDGTPLPGPPKRKD  496



>ref|XP_004499087.1| PREDICTED: serine carboxypeptidase II-3-like isoform X3 [Cicer 
arietinum]
Length=496

 Score =   422 bits (1084),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 247/436 (57%), Positives = 300/436 (69%), Gaps = 19/436 (4%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESE-TPSDKPLVLWLn  391
             Q  L + DK+ +LPGQP+GV F Q++GYVTVD ++GR LFYYF ES    S KPLVLWLN
Sbjct  66    QSKLMEDDKVMSLPGQPKGVNFDQYAGYVTVDAKSGRELFYYFVESPLNSSSKPLVLWLN  125

Query  392   ggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSD  571
             GGPGCSSFG G M E GPFRVNSD  TL LN+ AWN VANVIFLESPAGVGFSYSN SSD
Sbjct  126   GGPGCSSFGYGAMQELGPFRVNSDGTTLSLNQDAWNIVANVIFLESPAGVGFSYSNNSSD  185

Query  572   YV-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNK-ITN  745
             Y   GD  TA D+Y FLLNW ERFP+YKTR+ FI GESY GHYVPQLA LIL NNK + N
Sbjct  186   YSHIGDNSTALDSYTFLLNWFERFPQYKTREFFIAGESYGGHYVPQLAHLILSNNKQMKN  245

Query  746   QTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCD  925
              T+INLKGIAIGN +ID+     G YD++W HAL S ETH GI  NC+F +    S+ C 
Sbjct  246   HTVINLKGIAIGNGWIDDNLCTKGMYDYFWMHALNSVETHEGIEKNCDFGNFNFTSE-CV  304

Query  926   TFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQK  1105
              + + AD  +GNI  YNIYAP C + S   +++   +  GFDPCS DY   YLN PEVQ+
Sbjct  305   KYQNIADDELGNIDIYNIYAPLC-NSSATKTAASPTTYSGFDPCSEDYTVAYLNHPEVQQ  363

Query  1106  ALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTT  1285
             ALHA     P  W SCS+   V W D P ++LPTI  L+ + IS+ +YSGD+D +V +T+
Sbjct  364   ALHAK----PTKWSSCSE---VGWTDSPASILPTINHLISNAISILIYSGDVDARVPITS  416

Query  1286  TTYAINKLNTSVKTPWYPWYSKgevggyvvgy-------eDLSFVTIRGAGHFVPSYQPE  1444
             T Y+IN L  +  T W PWY+  E   Y +         + L+ VT+RGAGH VPS+QP+
Sbjct  417   TLYSINALKLAPDTAWRPWYTGKEYYAYNMQVGGYVIGYKGLTLVTVRGAGHMVPSHQPQ  476

Query  1445  RALTFFSAFVEGKLPP  1492
              ALT  S+F+ G+LPP
Sbjct  477   SALTMISSFLLGELPP  492



>ref|XP_003534383.1| PREDICTED: serine carboxypeptidase-like 40-like isoform 1 [Glycine 
max]
Length=496

 Score =   421 bits (1083),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 238/478 (50%), Positives = 306/478 (64%), Gaps = 13/478 (3%)
 Frame = +2

Query  92    GGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLG-SVYIGAQDGLKDADKISALPGQPE  268
             G R+   L  L K+ K  R N+         ++L     + +Q+GLK+ D+I +LPGQP 
Sbjct  25    GNRQVQALNKLHKSTKF-RGNSQIDRSEFEVEELAYDGIVHSQEGLKEKDRIESLPGQPP  83

Query  269   GVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK-PLVLWLnggpgcssfgnggMMENGP  445
              V F+ + GYVTVD +AGRA +YYF E++      PL+LWLNGGPGCSS G G M E GP
Sbjct  84    -VSFSHYGGYVTVDKEAGRAFYYYFVEAQRSKQTLPLLLWLNGGPGCSSLGYGAMQELGP  142

Query  446   FRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVT-GDKKTAADNYIFLL  622
             FRVNSD KTL  N ++WN VANV+FLESPAGVGFSYSN+S DY T GDKKTAADNY+FL+
Sbjct  143   FRVNSDGKTLHRNIFSWNKVANVLFLESPAGVGFSYSNKSKDYDTNGDKKTAADNYLFLV  202

Query  623   NWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEE  802
             NWLER+PEYK RD +I GESYAGHYVPQ A  IL +NK  N+ IINLKGI IGNA I+EE
Sbjct  203   NWLERYPEYKERDFYIAGESYAGHYVPQFAHTILYHNKKANKKIINLKGILIGNAVINEE  262

Query  803   TQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIY  982
             T   G YD+  +HA+ISD+    +   C+ SS+      CD   D+    +  I  YNIY
Sbjct  263   TDSDGLYDYLASHAIISDKAAY-LNKACDSSSSKIQESVCDAAGDELGEDIEYIDLYNIY  321

Query  983   APFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQD  1162
             AP C + +  +           DPCS +Y+Y YLN  +VQ+ALHANVT +   W+ CS D
Sbjct  322   APLCKNANLTALPKRNTIVT--DPCSENYVYAYLNRKDVQEALHANVTNLKHDWEPCS-D  378

Query  1163  VNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPW  1342
             V   W D   TVLP + E + + + VW++SGD DG+V +T+T Y++ K+N  +K+ W+PW
Sbjct  379   VITKWVDQASTVLPLLHEFLNNSLRVWIFSGDTDGRVPITSTKYSVKKMNLPIKSVWHPW  438

Query  1343  YS-KgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKL---PPKSAE  1504
             +S     G   V    L+  T+R AGH VPSYQP RALT    F++G     PPK  +
Sbjct  439   FSYGEVGGYVEVYKGGLTLATVREAGHQVPSYQPARALTLIKYFLDGTPLPGPPKRKD  496



>ref|XP_006345491.1| PREDICTED: serine carboxypeptidase-like 40-like [Solanum tuberosum]
Length=491

 Score =   421 bits (1081),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 240/472 (51%), Positives = 310/472 (66%), Gaps = 8/472 (2%)
 Frame = +2

Query  86    SIGGRKFDPLESLLKTQKQKRQNNNA-QTIIMSAQDLGSVYIGAQDGLKDADKISALPGQ  262
             S+G ++ + L +  K ++     N+  +   +   +L  V I  Q+GLK+ D I  LPGQ
Sbjct  22    SLGKKQSEVLGNFYKAKQDSAFGNSYYEAAAVENVELDKV-ILPQEGLKEKDWIKKLPGQ  80

Query  263   PEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLnggpgcssfgnggMMENG  442
             P  VKF Q+ GYVTVD  AGRAL+YYF E+E     PL+LWLNGGPGCSS   G M E G
Sbjct  81    PP-VKFQQYGGYVTVDESAGRALYYYFTEAENSKSLPLLLWLNGGPGCSSIAYGAMEELG  139

Query  443   PFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFL  619
             PFR NSD KTL  N YAWN VANV+FLE+PAGVGFSY+N SSD   TGD +T  DN +FL
Sbjct  140   PFRANSDGKTLHRNHYAWNLVANVLFLETPAGVGFSYTNTSSDLNKTGDSRTVNDNVVFL  199

Query  620   LNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDE  799
             LNWLERFPEYK RD +I+GESYAGHYVPQLA  IL++NK++N+T+INLKGI IGNA I++
Sbjct  200   LNWLERFPEYKNRDFYISGESYAGHYVPQLAHTILQHNKLSNKTLINLKGIIIGNAVIND  259

Query  800   ETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNI  979
             +T   GTY++Y +HALISDET   I   C F +  + S+ C+  V  ++ ++ +I+ YNI
Sbjct  260   DTDIIGTYEYYASHALISDETFLDIKKYC-FDNHYNKSN-CNEAVAVSNNNLNHIHIYNI  317

Query  980   YAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQ  1159
             Y+P C     L+      S   F+PCS  Y++ YLN  +VQ ALHANVT I   W+SCS 
Sbjct  318   YSPLC-KDGNLTKYPKVPSPLVFEPCSDQYVHAYLNRRDVQDALHANVTNIKYDWESCSD  376

Query  1160  DVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYP  1339
              +  NW+D P T +P + E + +G+ VW++SGDIDG V VT+T  +I  +N  V  PW  
Sbjct  377   PLFYNWKDSPATTIPLLTESLENGVRVWIFSGDIDGSVPVTSTKKSIKVMNLIVDQPWRS  436

Query  1340  WYS-KgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
             W S     G        L+F T+RGAGH VPS+QP RAL+  S F+ G L P
Sbjct  437   WLSGGEIGGYVETYKGGLTFATVRGAGHEVPSFQPARALSLISHFLSGTLLP  488



>ref|XP_004229672.1| PREDICTED: serine carboxypeptidase-like 40 [Solanum lycopersicum]
Length=492

 Score =   420 bits (1080),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 231/431 (54%), Positives = 294/431 (68%), Gaps = 12/431 (3%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLng  394
             Q+GLK  D I+ LPGQP  VKF Q+ GYVTV+  AGRALFYYF E+E     PL+LWLNG
Sbjct  66    QEGLKAKDWINKLPGQPP-VKFQQYGGYVTVNQSAGRALFYYFTEAENSEALPLLLWLNG  124

Query  395   gpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY  574
             GPGCSS   G M E GPFRVNSD KTL  N YAWN  ANV+FLESPAGVGFSY+N SSD+
Sbjct  125   GPGCSSIAYGSMEELGPFRVNSDGKTLHRNHYAWNRAANVLFLESPAGVGFSYTNTSSDF  184

Query  575   -VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQT  751
               TGD  TA DN +FLLNWLERFPEYK RD +I+GESYAGHYVPQLA  IL++NK  N+T
Sbjct  185   NTTGDSTTANDNVVFLLNWLERFPEYKKRDFYISGESYAGHYVPQLAHEILKHNKQANKT  244

Query  752   IINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANC---NFSSAASPSDTC  922
             +INLKGI IGNA I+++T   G Y+++ +HALISDET+  I+ +C   N++ +      C
Sbjct  245   LINLKGIIIGNAVINDDTDTIGMYEYFASHALISDETYHDILNSCYDDNYNQS-----KC  299

Query  923   DTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQ  1102
             +   +  ++++ N+  YNIY P C     L+      +    DPCS  YIY Y+N  +VQ
Sbjct  300   EKAAEVTNKNLNNLDIYNIYYPLC-KDENLTKYPKTPTPLQIDPCSDKYIYAYMNRRDVQ  358

Query  1103  KALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVT  1282
              ALHANVT +   W SCS  +  +W+D P T++P +KE + +G+ VW++SGD DG+V VT
Sbjct  359   DALHANVTNLKYEWTSCSDSLFYDWKDSPVTIIPLLKESLANGVRVWIFSGDTDGRVPVT  418

Query  1283  TTTYAINKLNTSVKTPWYPWYSKgevgg-yvvgyeDLSFVTIRGAGHFVPSYQPERALTF  1459
             ++  +I  +N +V  PW    + GEVGG        L+F T+RGAGH VPSYQP RAL+ 
Sbjct  419   SSKRSIQAMNLTVDLPWRSLLNGGEVGGYVETYKGGLAFATVRGAGHEVPSYQPARALSI  478

Query  1460  FSAFVEGKLPP  1492
              S F+ G LPP
Sbjct  479   ISHFLSGTLPP  489



>ref|XP_003539875.1| PREDICTED: serine carboxypeptidase-like 40-like [Glycine max]
Length=496

 Score =   419 bits (1076),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 242/480 (50%), Positives = 304/480 (63%), Gaps = 17/480 (4%)
 Frame = +2

Query  92    GGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVY---IGAQDGLKDADKISALPGQ  262
             G R+   L  L K+ K  R N+         ++L  VY     +Q+GLK+ D+I +LPGQ
Sbjct  25    GNRQVQALNKLHKSTKF-RGNSQIDRSEFEVEEL--VYDDIAHSQEGLKEKDRIESLPGQ  81

Query  263   PEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK-PLVLWLnggpgcssfgnggMMEN  439
             P  V F+Q+ GYVTVD  AGRA +YYF E++      PL+LWLNGGPGCSS G G M E 
Sbjct  82    PP-VSFSQYGGYVTVDKVAGRAFYYYFVEAQRSKQTLPLLLWLNGGPGCSSLGYGAMQEL  140

Query  440   GPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIF  616
             GPFRVNSD KTL  N ++WN VANV+FLESPAGVGFSYSN+S DY   GDKKTAADNY+F
Sbjct  141   GPFRVNSDGKTLHRNIFSWNKVANVLFLESPAGVGFSYSNKSKDYDNNGDKKTAADNYLF  200

Query  617   LLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYID  796
             L+NWLER+PEYK RD +I GESYAGHYVPQLA  IL +NK  N+ IINLKGI IGNA I+
Sbjct  201   LVNWLERYPEYKDRDFYIAGESYAGHYVPQLAHTILYHNKKANKKIINLKGILIGNAVIN  260

Query  797   EETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYN  976
             EET   G YD+  +HA+ISD+    +   C  SS+      CD   D+    +  I  YN
Sbjct  261   EETDSDGLYDYLASHAIISDKAAY-LNKACQSSSSKIQESVCDAAGDEVGDDIEYIDLYN  319

Query  977   IYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCS  1156
             IYAP C + +  S           DPCS  Y+Y YLN  +VQ+ALHANVT +   W+ CS
Sbjct  320   IYAPLCKNANLTSLPKRNSIVT--DPCSEYYVYAYLNRKDVQEALHANVTNLKHDWEPCS  377

Query  1157  QDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWY  1336
              DV   W D   TVLP + E + + + VW++SGD DG+V +T+T Y++ K+N  +KT W+
Sbjct  378   -DVITKWVDQASTVLPLLHEFLNNSLRVWIFSGDTDGRVPITSTKYSVKKMNLPIKTAWH  436

Query  1337  PWYS-KgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKL---PPKSAE  1504
             PW+S     G   +    L   T+R AGH VPSYQP RALT    F++G     PPK  +
Sbjct  437   PWFSYGEVGGYVEIYKGGLRLATVREAGHQVPSYQPARALTLIKYFLDGTPLPGPPKRKD  496



>gb|KHN32398.1| Serine carboxypeptidase-like 40 [Glycine soja]
Length=496

 Score =   418 bits (1075),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 241/480 (50%), Positives = 305/480 (64%), Gaps = 17/480 (4%)
 Frame = +2

Query  92    GGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVY---IGAQDGLKDADKISALPGQ  262
             G R+   L  L K+ K  R N+         ++L  VY   + +Q+GLK+ D+I +LPGQ
Sbjct  25    GNRQVQALNKLHKSTKF-RGNSQIDRSEFEVEEL--VYDDIVHSQEGLKEKDRIESLPGQ  81

Query  263   PEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK-PLVLWLnggpgcssfgnggMMEN  439
             P  V F+ + GYVTVD  AGRA +YYF E++      PL+LWLNGGPGCSS G G M E 
Sbjct  82    PP-VSFSHYGGYVTVDKVAGRAFYYYFVEAQRSKQTLPLLLWLNGGPGCSSLGYGAMQEL  140

Query  440   GPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIF  616
             GPFRVNSD KTL  N ++WN VANV+FLESPAGVGFSYSN+S DY   GDKKTAADNY+F
Sbjct  141   GPFRVNSDGKTLHRNIFSWNKVANVLFLESPAGVGFSYSNKSKDYDNNGDKKTAADNYLF  200

Query  617   LLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYID  796
             L+NWLER+PEYK RD +I GESYAGHYVPQLA  IL +NK  N+ IINLKGI IGNA I+
Sbjct  201   LVNWLERYPEYKERDFYIAGESYAGHYVPQLAHNILYHNKKANKKIINLKGILIGNAVIN  260

Query  797   EETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYN  976
             EET   G YD+  +HA+ISD+    +   C+ SS+      CD   D+    +  I  YN
Sbjct  261   EETDSDGLYDYLASHAIISDKAAY-LNKACHSSSSKIQESVCDAAGDEVGDDIEYIDLYN  319

Query  977   IYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCS  1156
             IYAP C + +  S           DPCS  Y+Y YLN  +VQ+ALHANVT +   W+ CS
Sbjct  320   IYAPLCKNANLTSLPKRNSIVT--DPCSEYYVYAYLNRKDVQEALHANVTNLKHDWEPCS  377

Query  1157  QDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWY  1336
              DV   W D   TVLP + E + + + VW++SGD DG+V +T+T Y++ K+N  +KT W+
Sbjct  378   -DVITKWVDQASTVLPLLHEFLNNSLRVWIFSGDTDGRVPITSTKYSVKKMNLPIKTAWH  436

Query  1337  PWYS-KgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKL---PPKSAE  1504
             PW+S     G   +    L   T+R AGH VPSYQP RALT    F++G     PPK  +
Sbjct  437   PWFSYGEVGGYVEIYKGGLRLATVREAGHQVPSYQPARALTLIKYFLDGTPLPGPPKRKD  496



>ref|XP_010694765.1| PREDICTED: serine carboxypeptidase-like 40 [Beta vulgaris subsp. 
vulgaris]
Length=523

 Score =   419 bits (1077),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 234/432 (54%), Positives = 298/432 (69%), Gaps = 12/432 (3%)
 Frame = +2

Query  227   KDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK---PLVLWLngg  397
             K+ D+I  LPGQP  V F Q+ GYVTVD +AG+A +YYF E+  P +K   PL+LWLNGG
Sbjct  93    KERDRIVKLPGQPP-VNFTQYGGYVTVDSKAGKAFYYYFVEA--PKNKNSLPLLLWLNGG  149

Query  398   pgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-  574
             PGCSS   G M E GPFRV SD KTL+ NK+AWN+ ANV+FLESPAGVGFSYSN +SDY 
Sbjct  150   PGCSSLAYGAMEELGPFRVKSDGKTLFRNKFAWNHAANVLFLESPAGVGFSYSNSTSDYD  209

Query  575   VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTI  754
               GD KTAA+NYIFLLNW ERFPEYK RD +I+GESYAGHYVPQLA  IL++N  TN +I
Sbjct  210   SNGDSKTAAENYIFLLNWFERFPEYKGRDFYISGESYAGHYVPQLAHAILQHNTNTNNSI  269

Query  755   INLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFS-SAASPSDTCDTF  931
             INLKGI IGNA I++ET   G Y+++WTHALISDE    +  +C+F+ +A + S  C   
Sbjct  270   INLKGIIIGNAVINDETDLKGMYEYFWTHALISDEVKDDLTKHCDFTPNAINQSVECSLA  329

Query  932   VDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKAL  1111
              D  +     +  YNIYAP C   S   +   +  +   DPCS  Y++ YLN+PEVQKAL
Sbjct  330   ADQVEVDTQYLDIYNIYAPVC--HSSNLTVKPKKLTPDLDPCSDHYVHAYLNSPEVQKAL  387

Query  1112  HANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTT  1291
             HANVT +   W+ CS  ++  W D P TV+P +KELM  G+ VW++SGD DG++ VT+T 
Sbjct  388   HANVTKLSHDWEPCSSIIS-KWSDSPSTVIPLLKELMTKGLRVWIFSGDTDGRIPVTSTR  446

Query  1292  YAINKLNTSVKTPWYPWYSK-gevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSA  1468
              ++NK+  S+KT W+PW+ K    G   V   +L+F T+RGAGH VPS+QP RALT  S 
Sbjct  447   QSLNKMGLSIKTKWHPWFIKGEVGGYTQVYEGNLTFATVRGAGHQVPSFQPLRALTLISH  506

Query  1469  FVEGKLPPKSAE  1504
             F+ G   P ++ 
Sbjct  507   FLAGTPLPNTSR  518



>ref|XP_007204505.1| hypothetical protein PRUPE_ppa019210mg [Prunus persica]
 gb|EMJ05704.1| hypothetical protein PRUPE_ppa019210mg [Prunus persica]
Length=440

 Score =   416 bits (1068),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 226/434 (52%), Positives = 301/434 (69%), Gaps = 13/434 (3%)
 Frame = +2

Query  227   KDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESET--PSDKPLVLWLnggp  400
             ++ D+ISALPGQP  V F+QFSGYVTV+   GRALFY+  E+ T  P +KPLVLWLNGGP
Sbjct  7     QELDRISALPGQPP-VSFSQFSGYVTVNEHHGRALFYWLTEAATVSPHNKPLVLWLNGGP  65

Query  401   gcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYV-  577
             GCSS   G   E GPFR+N+   +L+LNKY+WN  AN++FLESPAGVGFSY+N SSD   
Sbjct  66    GCSSVAYGASEELGPFRINTTGSSLYLNKYSWNREANILFLESPAGVGFSYTNTSSDLED  125

Query  578   TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTII  757
             +GDK+TA D  IFLL WL RFP+YK R+ +I GESYAGHYVPQLA+ I+  N+  + +II
Sbjct  126   SGDKRTAQDALIFLLKWLSRFPQYKYREFYIAGESYAGHYVPQLAREIVTYNQGNSHSII  185

Query  758   NLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVD  937
             NLKG  +GNA  D      GT  F+W+HA+ISD+T+R I+ +CNF+ A   S  CD  V+
Sbjct  186   NLKGFIVGNAVTDNYYDSLGTVTFWWSHAMISDQTYRSILNHCNFT-AERASQQCDAAVN  244

Query  938   DA-DRSMGNIYSYNIYAPFCssgs-------glssssvqgssrgFDPCSSDYIYVYLNTP  1093
              A +   G+I  Y+IY PFC +          L ++ ++    G+DPC+ +Y   Y N P
Sbjct  245   YAMNHDFGDIDQYSIYTPFCLTMLNNTNRHLRLKNTLLRRRVSGYDPCTENYAEKYYNRP  304

Query  1094  EVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKV  1273
             +VQKA+HAN+T IP  W +CS  +  NW+D  D++LPT K+L+ +G+ +W++SGD D  V
Sbjct  305   DVQKAMHANITRIPYKWTACSDVLIKNWKDSEDSMLPTYKQLIKAGLKIWVFSGDTDSVV  364

Query  1274  AVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERAL  1453
              VT T +A+N LN ++KTPWYPWY+ G+VGG+   Y+ L+F T+RGAGH VP +QP RA 
Sbjct  365   PVTATRFALNHLNLTIKTPWYPWYTGGQVGGWTEAYDGLTFATVRGAGHEVPLFQPNRAF  424

Query  1454  TFFSAFVEGKLPPK  1495
               F +F+ GK  PK
Sbjct  425   IIFKSFLAGKKLPK  438



>ref|XP_003589244.1| Serine carboxypeptidase II-3 [Medicago truncatula]
Length=515

 Score =   418 bits (1075),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 245/464 (53%), Positives = 310/464 (67%), Gaps = 35/464 (8%)
 Frame = +2

Query  185   QDLGSVYIGAQDGLKD--ADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESET  358
             + +  V++  +  L+   +DK+ +LPGQP+GV F Q++GY+TVD +A R LFYYF ES +
Sbjct  57    EHVSKVHVNVEQHLRSRKSDKVKSLPGQPKGVNFDQYAGYITVDAKARRKLFYYFVESPS  116

Query  359   -PSDKPLVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPA  535
               S KPLVLWLNGGPGCSSFG G M E GPFRVNSD  TL   K AWN VANVIFLESP 
Sbjct  117   NSSTKPLVLWLNGGPGCSSFGYGAMQELGPFRVNSDGTTLSFIKDAWNVVANVIFLESPV  176

Query  536   GVGFSYSNRSSDYVT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLA  712
             GVGFSYS +  +    GDK TA D+YIFLLNWLERFP+YK RD FITGESYAGHYVPQLA
Sbjct  177   GVGFSYSKKPLNQTNIGDKNTARDSYIFLLNWLERFPQYKIRDFFITGESYAGHYVPQLA  236

Query  713   QLILRNNKI-TNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCN  889
              LIL NNK   N  +INLKGI +GN +ID+     G YD++W HAL SD+TH+GI  +C+
Sbjct  237   HLILSNNKKRKNHKMINLKGI-VGNGWIDDNFCTKGMYDYFWMHALNSDQTHKGIEKHCD  295

Query  890   FSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDY  1069
             F    + ++ C  + + AD  +GNI  YNIYAP C+S +    +S   S+   DPC+ DY
Sbjct  296   FRKF-NVTNECVGYENIADDELGNIDVYNIYAPVCNSSATKYGASYSVSN--VDPCAEDY  352

Query  1070  IYVYLNTPEVQKALHANVTGIPGPWDSCSQDV----------------------NVNWED  1183
                YLN PEVQKALH   T     W  C   +                      +++W D
Sbjct  353   TTTYLNLPEVQKALHVKRT----KWSPCRYTILYYTTNYVIVFPELMCLMVFFSDLSWTD  408

Query  1184  MPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevg  1363
              P ++LPTI  L+ SGIS+W+YSGDIDG+V + +T Y+IN L   V+T W PWY+  EVG
Sbjct  409   SPASILPTINGLISSGISIWMYSGDIDGRVPIISTKYSINSLKLHVRTAWRPWYTGKEVG  468

Query  1364  gyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPK  1495
             GYV+GY+ L+ +T+RGAGH VP+ QP RALT  S+F+ G+LPP+
Sbjct  469   GYVIGYKGLTLITVRGAGHMVPTDQPYRALTVISSFLLGQLPPQ  512



>ref|XP_002876724.1| hypothetical protein ARALYDRAFT_486857 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52983.1| hypothetical protein ARALYDRAFT_486857 [Arabidopsis lyrata subsp. 
lyrata]
Length=504

 Score =   418 bits (1074),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 223/430 (52%), Positives = 285/430 (66%), Gaps = 13/430 (3%)
 Frame = +2

Query  206   IGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK---PL  376
             +  Q+ L++ D I  LPGQP  V F Q+ GYVTV+  AGR+ FYYF E+     K   PL
Sbjct  70    VANQEELRERDLIRRLPGQPP-VSFDQYGGYVTVNESAGRSFFYYFVEASNSKSKDSSPL  128

Query  377   VLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYS  556
             +LWLNGGPGCSS   G + E GPFRV+SD KTL+ N+YAWNN ANV+FLESPAGVGFSY+
Sbjct  129   LLWLNGGPGCSSLAYGALQELGPFRVHSDGKTLFRNRYAWNNAANVLFLESPAGVGFSYT  188

Query  557   NRSSDYVT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNN  733
             N +SD    GD+ TAADNYIFL+ WLERFPEYK RDL+I GESYAGHYVPQLA  IL   
Sbjct  189   NTTSDLEKHGDRNTAADNYIFLVKWLERFPEYKGRDLYIAGESYAGHYVPQLAHTIL---  245

Query  734   KITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNF--SSAAS  907
              + +++ +NLKGI IGNA I++ET   G YDF+ +HALIS+++   +  NC+    SA+ 
Sbjct  246   -LHHRSSLNLKGILIGNAVINDETDLMGMYDFFESHALISEDSLARLKNNCDLKTESASV  304

Query  908   PSDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLN  1087
              ++ C    D  D     +  YNIYAP C + +         + R FDPCS  Y+  YLN
Sbjct  305   MTEECAVVSDQIDMDTYYLDIYNIYAPLCLNSTLTHRPKRGTTIREFDPCSDHYVQAYLN  364

Query  1088  TPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDG  1267
              PEVQ ALHAN T +P  W  CS  +   W D P TV+P IKELMG G+ VW++SGD DG
Sbjct  365   RPEVQAALHANATKLPYEWQPCSSVIK-KWNDSPTTVIPLIKELMGQGVRVWVFSGDTDG  423

Query  1268  KVAVTTTTYAINKLNTSVKTPWYPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPE  1444
             ++ VT+T Y++ K+N + KT W+PWY      G        L+F T+RGAGH VPS+QP+
Sbjct  424   RIPVTSTKYSLKKMNLTAKTAWHPWYLGGEVGGYTEEYKGKLTFATVRGAGHQVPSFQPK  483

Query  1445  RALTFFSAFV  1474
             R+L+ F  F+
Sbjct  484   RSLSLFIHFL  493



>gb|KCW66001.1| hypothetical protein EUGRSUZ_G03291, partial [Eucalyptus grandis]
Length=445

 Score =   416 bits (1068),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 228/445 (51%), Positives = 299/445 (67%), Gaps = 6/445 (1%)
 Frame = +2

Query  98    RKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQPEGVK  277
             ++ D L+SL K +    + + +   + +  +  +  I  Q+GLK+ D+I  LPGQP  VK
Sbjct  2     KQGDALDSLYKAKYDNSRIDMSPFQVSNHDENFNFRIYHQEGLKEKDRIKRLPGQPP-VK  60

Query  278   FAQFSGYVTVDPQAGRALFYYFAESETPSDK-PLVLWLnggpgcssfgnggMMENGPFRV  454
             F  + GYVTVD  A RA +YYFAE+    D  PL+LWLNGGPGCSS   G M E GPFRV
Sbjct  61    FDHYGGYVTVDESASRAFYYYFAEAGQNKDSMPLLLWLNGGPGCSSLNYGAMQELGPFRV  120

Query  455   NSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFLLNWL  631
             +SD KTL+ NK+AWN  ANV+FLESPAGVGFSYSN++SDY  +GD KTA DNY+FLLNWL
Sbjct  121   HSDGKTLYRNKFAWNIAANVLFLESPAGVGFSYSNKTSDYSASGDSKTATDNYVFLLNWL  180

Query  632   ERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQD  811
             ERFPEYK RD +I GESYAGHYVPQLA  IL NNK  N+T+INLKGI IGNA I++ET +
Sbjct  181   ERFPEYKNRDFYIAGESYAGHYVPQLAHNILYNNKKANKTLINLKGIIIGNAVINDETDN  240

Query  812   SGTYDFYWTHALISDETHRGIIANCNFSSAASP-SDTCDTFVDDADRSMGNIYSYNIYAP  988
              G Y++Y THALISDET   I   CNF+   +  +  C + +  AD  +  I +YNIYAP
Sbjct  241   KGMYEYYATHALISDETWYAIQKYCNFAPTGTDLASQCTSALIKADDDVSPIDNYNIYAP  300

Query  989   FCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVN  1168
              C   S L+S   + +   FDPC   Y++ YLN  +VQ+ALHANV  +   W SC+ D+ 
Sbjct  301   LC-FSSNLTSHPKKTNIMNFDPCGGHYVHAYLNREDVQEALHANVAKLHHEWQSCNDDIQ  359

Query  1169  VNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWY-  1345
              NW D P T++P ++E+M +G+ +W+YSGD D  V VT+T  +++K++   K+PW PW+ 
Sbjct  360   KNWRDSPSTIIPLLQEVMSTGLRLWVYSGDTDAVVPVTSTQRSLSKMSLRTKSPWSPWFL  419

Query  1346  SKgevggyvvgyeDLSFVTIRGAGH  1420
                  G   V   +L+F T+RGAGH
Sbjct  420   GGEVGGYVQVYEGELTFATVRGAGH  444



>ref|XP_006345492.1| PREDICTED: serine carboxypeptidase-like 40-like [Solanum tuberosum]
Length=632

 Score =   422 bits (1085),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 233/428 (54%), Positives = 295/428 (69%), Gaps = 6/428 (1%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLng  394
             Q+G K  D I+ LPGQP  VKF Q+ GYVTV+  AGRA +YYF E+E     PL+LWLNG
Sbjct  206   QEGSKAKDWINKLPGQPP-VKFQQYGGYVTVNQSAGRAFYYYFTEAENSEALPLLLWLNG  264

Query  395   gpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY  574
             GPGCSS   G M E GPFRVNSD KTL  N YAWN  ANV+FLESPAGVGFSY+N SSD 
Sbjct  265   GPGCSSMAYGAMEELGPFRVNSDGKTLHRNSYAWNRAANVLFLESPAGVGFSYTNTSSDL  324

Query  575   -VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQT  751
               TGD +TA DN +FLLNWLERFPEYK RD +I+GESYAGHYVPQLA  IL++NK+ N+T
Sbjct  325   NTTGDSRTANDNVVFLLNWLERFPEYKNRDFYISGESYAGHYVPQLAHEILKHNKLANKT  384

Query  752   IINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTF  931
             +INLKGI IGNA I+++T   G Y+++ +HALISDET+  I  +C F    + S  C++ 
Sbjct  385   LINLKGIIIGNAVINDDTDIIGMYEYFASHALISDETYHDIQNSC-FVQNYNESK-CNSA  442

Query  932   VDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKAL  1111
             +  +D ++ ++  YNIY P C     L+           DPCS+DYIY YLN  +VQ AL
Sbjct  443   IAISDNNINHLDIYNIYFPLC-KNGNLTKYPKIPPPLQIDPCSADYIYAYLNRRDVQDAL  501

Query  1112  HANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTT  1291
             HANVT I   W+SCS  +  NW+D P T++P ++E + +G+ VW++SGD DG+V VT++ 
Sbjct  502   HANVTNIKYEWESCSNSLFYNWKDSPVTIVPLLRESLENGVRVWIFSGDTDGRVPVTSSK  561

Query  1292  YAINKLNTSVKTPWYPWYSKgevgg-yvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSA  1468
              +I  +N +V  PW  W + GEVGG        L+F T+RGAGH VPSYQP RAL+  S 
Sbjct  562   RSIQAMNLTVDQPWRSWLNGGEVGGYVETYKGGLTFATVRGAGHEVPSYQPARALSLISH  621

Query  1469  FVEGKLPP  1492
             F+ G LPP
Sbjct  622   FLSGTLPP  629



>ref|XP_007015558.1| Serine carboxypeptidase-like 40, putative isoform 3, partial 
[Theobroma cacao]
 gb|EOY33177.1| Serine carboxypeptidase-like 40, putative isoform 3, partial 
[Theobroma cacao]
Length=437

 Score =   415 bits (1067),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 243/416 (58%), Positives = 280/416 (67%), Gaps = 15/416 (4%)
 Frame = +2

Query  107   DPLESLLKTQKQKRQNNNAQTIIMSAQDLGSV--YIGAQDGLKDADKISALPGQPEGVKF  280
             + L S LK+ +  R+   A ++       G    Y+  QDG  +ADKI ALPGQP  V F
Sbjct  28    ETLRSFLKS-RLSRKPAAAHSLAWFHNKTGYSPNYVQPQDGSMEADKIGALPGQPNAVDF  86

Query  281   AQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgnggMMENGPFRVN  457
               ++GYVTVD QAGRALFYYFAES E  S  PLVLWLNGGPGCSS     M E GPFRVN
Sbjct  87    DHYAGYVTVDSQAGRALFYYFAESPENSSTNPLVLWLNGGPGCSSLTGA-MTELGPFRVN  145

Query  458   SDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFLLNWLE  634
             SD KTL+ N YAWNNVANVIFLESPAGVGFSYSN SSDY  TGDK TA D Y FL+NWLE
Sbjct  146   SDGKTLFRNIYAWNNVANVIFLESPAGVGFSYSNTSSDYDRTGDKSTAEDAYTFLVNWLE  205

Query  635   RFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDS  814
             RFP+YKTRD +ITGESYAGHYVPQLA  IL NNK +NQT INLKGIA+GN  I++ T   
Sbjct  206   RFPQYKTRDFYITGESYAGHYVPQLAYTILLNNKNSNQTAINLKGIAVGNGLIEDITFYL  265

Query  815   GTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFC  994
             G +DF WTHAL SDET++GI   C++ +   P   CD F + A    G+I  YNIYAP C
Sbjct  266   GRFDFLWTHALNSDETNKGIHTYCHYFNGKDPKQ-CDDFQNRAYDEAGDIDGYNIYAPLC  324

Query  995   ssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVN  1174
                  +S+   QGS   FDPCS  Y+  YLN PEVQ ALHA ++     W  CS   + +
Sbjct  325   -QEYSVSNKGSQGSVNSFDPCSGAYMISYLNRPEVQTALHAKLS----EWHQCS---SFD  376

Query  1175  WEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPW  1342
             W D P TVLP IK LM SG+ VWLYSGD+D  V +TTT Y IN LN  +KT W  W
Sbjct  377   WADSPATVLPIIKSLMASGLRVWLYSGDVDAVVPITTTRYGINILNPPIKTAWRSW  432



>emb|CBI28593.3| unnamed protein product [Vitis vinifera]
Length=963

 Score =   432 bits (1110),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 241/472 (51%), Positives = 314/472 (67%), Gaps = 15/472 (3%)
 Frame = +2

Query  113   LESLLKTQKQKRQNNNAQTI-------IMSAQDLGSVYIGAQDGLKDADKISALPGQPEG  271
             +E+L   QK K   N+           + +  +  S  I  Q+GLK+ D+I  LPGQP  
Sbjct  4     IEALDILQKAKLHGNSGIDTNLFEVNEVENGAETESHKIHPQEGLKEKDRIDMLPGQPH-  62

Query  272   VKFAQFSGYVTVDPQAGRALFYYFAESETPSDKPLVL-WLnggpgcssfgnggMMENGPF  448
             V F+Q+ GYVT+D   G+AL+YYFAE+        +L WLNGGPGCSS   G M E GPF
Sbjct  63    VGFSQYGGYVTIDESKGKALYYYFAEAPLSKKSLPLLLWLNGGPGCSSLAYGAMQELGPF  122

Query  449   RVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVTG-DKKTAADNYIFLLN  625
             RV+S+ KTL+ N+YAWN VANV+FLESPAGVGFSYSN +SDY  G D+KTA DNY FL+N
Sbjct  123   RVHSEGKTLYRNQYAWNKVANVLFLESPAGVGFSYSNTTSDYRNGGDRKTAKDNYAFLVN  182

Query  626   WLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEET  805
             WLERFPEYK RD +I+GESYAGHYVPQLA  IL +NK  +  IINLKGI IGNA I++ET
Sbjct  183   WLERFPEYKKRDFYISGESYAGHYVPQLAHTILHHNKKADGPIINLKGIIIGNAVINDET  242

Query  806   QDSGTYDFYWTHALISDETHRGIIANCNFS-SAASPSDTCDTFVDDADRSMGNIYSYNIY  982
              + G Y ++ +HAL+S++T R +  +CNFS  AAS S  C    D+ D ++  I  YNIY
Sbjct  243   DELGMYQYFGSHALVSEKTIRQMEKHCNFSPGAASQSKECTKASDEVDDNIDVIDIYNIY  302

Query  983   APFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQD  1162
             AP C   +   +   +  +  FDPCS  Y+Y YLN  +VQKALHANVT +   W+ CS D
Sbjct  303   APLC--FNTNLTVKPKKVTPEFDPCSDYYVYAYLNRADVQKALHANVTKLKYDWEPCS-D  359

Query  1163  VNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPW  1342
             V  NW D P T++P + E M +G+ VW++SGD DG+V VT+T  +I+ +  SVKTPW+PW
Sbjct  360   VIQNWTDSPSTIIPLLHEFMENGLRVWVFSGDTDGRVPVTSTMASIDTMKLSVKTPWHPW  419

Query  1343  Y-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPK  1495
             + +    G   V   DL+F T+RGAGH VPS++P+RAL+  S F+ G   P+
Sbjct  420   FVAGEVGGYTEVYKGDLTFATVRGAGHQVPSFRPKRALSLISHFLSGTPLPR  471


 Score =   430 bits (1105),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 241/476 (51%), Positives = 311/476 (65%), Gaps = 13/476 (3%)
 Frame = +2

Query  95    GRKFDPLESLLKTQKQKRQNNNA-QTIIMSAQDLGS----VYIGAQDGLKDADKISALPG  259
             GR     E L   QK K Q N+   T +    ++ S      I  Q G+K+ D+I  LPG
Sbjct  487   GRVRKQTELLKLLQKAKMQGNSGIDTSLFEVNEIKSEAESYKILPQKGMKEKDRIERLPG  546

Query  260   QPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK-PLVLWLnggpgcssfgnggMME  436
             QP  V F+Q+ GYVT+D   G A +YYF E+ T  +  PL+LW NGGPGCSS   G M E
Sbjct  547   QPH-VGFSQYGGYVTIDESKGEAFYYYFVEAPTSRESLPLLLWFNGGPGCSSLAYGAMQE  605

Query  437   NGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVTG-DKKTAADNYI  613
              GPFRV+SD KTL+ N+YAWN VANV+FLESPAGVGFSYSN +SD  +G D+KTA +NY 
Sbjct  606   LGPFRVHSDGKTLYRNQYAWNKVANVLFLESPAGVGFSYSNTTSDNQSGGDRKTANENYA  665

Query  614   FLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYI  793
             FL+NWLERFPEYK RD +I+GESYAGHYVPQLA  IL +NK  N  IINLKGI IGNA I
Sbjct  666   FLVNWLERFPEYKKRDFYISGESYAGHYVPQLAHTILHHNKKANGPIINLKGIIIGNAVI  725

Query  794   DEETQDSGTYDFYWTHALISDETHRGIIANCNFS-SAASPSDTCDTFVDDADRSMGNIYS  970
             D+E  D G Y +  +HAL+S++T   +  +CNFS  A S S  C   VD+   ++  I  
Sbjct  726   DDEADDIGRYQYLGSHALVSEKTIHQMEKHCNFSPGATSQSKECTEAVDEVHSNIDVIDI  785

Query  971   YNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDS  1150
             YNIY+P C   + + ++  +  +  FDPCS  Y+  YLN  +VQKALHANVT +   W  
Sbjct  786   YNIYSPLC--FNTILTAKPKKVTPEFDPCSDYYVSAYLNRADVQKALHANVTKLKYEWRP  843

Query  1151  CSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTP  1330
             CS D++ NW D P T++P ++E M +G+ VW++SGD DG V VT+T  +I K+  SVKTP
Sbjct  844   CS-DIDKNWTDSPLTIIPLLREFMANGLRVWVFSGDTDGDVPVTSTMASIGKMRLSVKTP  902

Query  1331  WYPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPK  1495
             W+PW+ +    G   V   DL+F T+RGAGH VPS++P+RAL+    F+ G   PK
Sbjct  903   WHPWFVAGEVGGYTEVYKGDLTFATVRGAGHQVPSFRPKRALSLIVHFLSGTPLPK  958



>gb|ACN29008.1| unknown [Zea mays]
 tpg|DAA63952.1| TPA: serine carboxypeptidase 1 [Zea mays]
Length=524

 Score =   418 bits (1074),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 242/465 (52%), Positives = 302/465 (65%), Gaps = 25/465 (5%)
 Frame = +2

Query  167   TIIMSAQDLGSVYIGAQD-GLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYF  343
             ++ ++A D  S +  +   G K+ D++  LPGQP GV F Q++GYVTVD  AGRALFYY 
Sbjct  54    SLAVAATDRASRHAASPGVGRKEDDRVDRLPGQPSGVDFEQYAGYVTVDAAAGRALFYYL  113

Query  344   AES----ETPSDKPLVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVAN  511
             AE+       + KPL+LWLNGGPGCSS G G M E GPFRV SD KTL+ N YAWNN AN
Sbjct  114   AEAVGGGSASAAKPLLLWLNGGPGCSSLGYGAMEELGPFRVKSDGKTLYRNPYAWNNAAN  173

Query  512   VIFLESPAGVGFSYSNRSSDYV-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYA  688
             V+FLESPAGVGFSYSN ++DY  +GD KTA D   FLLNW+E+FPEYK RDL++ GESYA
Sbjct  174   VLFLESPAGVGFSYSNTTADYSRSGDNKTAEDALRFLLNWMEKFPEYKGRDLYLAGESYA  233

Query  689   GHYVPQLAQLILRN---NKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDE  859
             GHYVPQLA  IL +    K ++ + +NL+GI IGNA I++ T   G YDF+WTHALISD 
Sbjct  234   GHYVPQLAHAILGHAAAGKPSSSSPLNLRGIMIGNAVINDWTDTKGMYDFFWTHALISDA  293

Query  860   THRGIIANCNFS-----SAASPSDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssss  1024
             T   I  +CNFS      AA+ +D C+    +AD ++ +I  YNIYAP C    GL S  
Sbjct  294   TADAIGRHCNFSAAADADAAASNDKCNEATSEADEALQDIDIYNIYAPNC-QSPGLVSPP  352

Query  1025  vqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLP  1204
             +  S   FDPCS  Y+  YLN P+VQ+ALHANVT +  PW +CS DV   W D   TVLP
Sbjct  353   ITPSMDRFDPCSDYYVNAYLNDPDVQRALHANVTRLDHPWSACS-DVLRRWTDSATTVLP  411

Query  1205  TIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggyv----  1372
              + EL+ + I VW+YSGD DG+V VT++ Y++N+L   V   W  W+S  +  G V    
Sbjct  412   ILTELLNNDIRVWVYSGDTDGRVPVTSSRYSVNQLQLPVAAKWRAWFSSTQGAGEVGGYT  471

Query  1373  -----vgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
                       LS VT+RGAGH VPSYQP RAL     F+ GK  P
Sbjct  472   VQYKGKEKGSLSLVTVRGAGHEVPSYQPRRALVLVQGFLAGKTLP  516



>ref|XP_007015557.1| Serine carboxypeptidase-like 40, putative isoform 2 [Theobroma 
cacao]
 gb|EOY33176.1| Serine carboxypeptidase-like 40, putative isoform 2 [Theobroma 
cacao]
Length=442

 Score =   415 bits (1066),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 236/382 (62%), Positives = 267/382 (70%), Gaps = 12/382 (3%)
 Frame = +2

Query  203   YIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLV  379
             Y+  QDG  +ADKI ALPGQP  V F  ++GYVTVD QAGRALFYYFAES E  S  PLV
Sbjct  61    YVQPQDGSMEADKIGALPGQPNAVDFDHYAGYVTVDSQAGRALFYYFAESPENSSTNPLV  120

Query  380   LWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSN  559
             LWLNGGPGCSS     M E GPFRVNSD KTL+ N YAWNNVANVIFLESPAGVGFSYSN
Sbjct  121   LWLNGGPGCSSLTGA-MTELGPFRVNSDGKTLFRNIYAWNNVANVIFLESPAGVGFSYSN  179

Query  560   RSSDY-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNK  736
              SSDY  TGDK TA D Y FL+NWLERFP+YKTRD +ITGESYAGHYVPQLA  IL NNK
Sbjct  180   TSSDYDRTGDKSTAEDAYTFLVNWLERFPQYKTRDFYITGESYAGHYVPQLAYTILLNNK  239

Query  737   ITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSD  916
              +NQT INLKGIA+GN  I++ T   G +DF WTHAL SDET++GI   C++ +   P  
Sbjct  240   NSNQTAINLKGIAVGNGLIEDITFYLGRFDFLWTHALNSDETNKGIHTYCHYFNGKDPKQ  299

Query  917   TCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPE  1096
              CD F + A    G+I  YNIYAP C     +S+   QGS   FDPCS  Y+  YLN PE
Sbjct  300   -CDDFQNRAYDEAGDIDGYNIYAPLC-QEYSVSNKGSQGSVNSFDPCSGAYMISYLNRPE  357

Query  1097  VQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVA  1276
             VQ ALHA ++     W  CS   + +W D P TVLP IK LM SG+ VWLYSGD+D  V 
Sbjct  358   VQTALHAKLS----EWHQCS---SFDWADSPATVLPIIKSLMASGLRVWLYSGDVDAVVP  410

Query  1277  VTTTTYAINKLNTSVKTPWYPW  1342
             +TTT Y IN LN  +KT W  W
Sbjct  411   ITTTRYGINILNPPIKTAWRSW  432



>ref|NP_001132061.1| uncharacterized protein LOC100193473 [Zea mays]
 gb|ACF80746.1| unknown [Zea mays]
Length=413

 Score =   414 bits (1063),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 227/416 (55%), Positives = 293/416 (70%), Gaps = 6/416 (1%)
 Frame = +2

Query  251   LPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLnggpgcssfgngg  427
             +PGQ    +F Q++GYVTVD +AGRALFYYF E+ + PSDKPLVLWLNGGPGCSSFG+G 
Sbjct  1     MPGQTVVAEFDQYAGYVTVDAKAGRALFYYFVEALQDPSDKPLVLWLNGGPGCSSFGSGA  60

Query  428   MMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYV-TGDKKTAAD  604
             M+E GPF V+SD+KTL+  ++AWN VAN++F+E PAGVG+SYSN +SDY  TGD++T  D
Sbjct  61    MLELGPFSVHSDNKTLYKRRHAWNRVANMLFIEIPAGVGYSYSNTTSDYYNTGDQRTTDD  120

Query  605   NYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGN  784
              Y FL+ WLE+FPEY+ RD FITGESYAGHY+P+LA LI+  N+ TN T I LKG+AIGN
Sbjct  121   AYTFLVTWLEKFPEYRNRDFFITGESYAGHYIPELANLIVSKNRATNVTNIKLKGVAIGN  180

Query  785   AYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNI  964
             A +D+      +YD+YW HA+IS + +  I   C+F+   + +  C   ++ A R  GN+
Sbjct  181   ADLDDNLTLRASYDYYWMHAMISGKAYTAIKDKCSFN--GTYTKDCLNAMNLATREKGNV  238

Query  965   YSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPW  1144
               Y+IYAP C   S  S SS        DPC++ Y+  YLN PEVQ+ALHAN TG+  PW
Sbjct  239   DDYDIYAPICHDASNASKSSDSLLFG--DPCTNHYVSSYLNNPEVQRALHANTTGLGYPW  296

Query  1145  DSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVK  1324
               CSQ V  NW+D P T+LP+IK+L+ SG  +WLYSGD+D   +  +T Y ++ L   V+
Sbjct  297   MDCSQRVFDNWKDSPVTMLPSIKKLISSGTRIWLYSGDMDAVCSFISTQYVLDNLGLPVE  356

Query  1325  TPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
               W PW    EV GYV+GY+ L F T+RGAGH VP YQP  AL  FS+F+EGKLPP
Sbjct  357   ASWRPWRIDNEVAGYVIGYKGLVFATVRGAGHMVPYYQPRSALALFSSFLEGKLPP  412



>ref|XP_002273192.3| PREDICTED: serine carboxypeptidase-like 40 [Vitis vinifera]
Length=497

 Score =   416 bits (1070),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 232/472 (49%), Positives = 312/472 (66%), Gaps = 12/472 (3%)
 Frame = +2

Query  98    RKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGS----VYIGAQDGLKDADKISALPGQP  265
             RK   L +LL+  K +  N+   T +    ++ S      I  Q G+K+ D+I  LPGQP
Sbjct  30    RKQTELLNLLRKAKMQ-GNSGIDTSLFEVNEIESEAESYKILPQKGMKEKDRIERLPGQP  88

Query  266   EGVKFAQFSGYVTVDPQAGRALFYYFAESETPSD-KPLVLWLnggpgcssfgnggMMENG  442
               V F+Q+ GYVT+D   G AL+YYF E+ T  +  PL+LWLNGGPGCSS G G M E G
Sbjct  89    H-VGFSQYGGYVTIDESKGEALYYYFVEAPTSKEYLPLLLWLNGGPGCSSLGAGAMAELG  147

Query  443   PFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVTGDKKTAADNYIFLL  622
             PFRV+SD KTL+ N++AWN  ANV+FLE+P+GVGFSYSN S +Y  GD+KTA  NY FL+
Sbjct  148   PFRVHSDGKTLYRNRFAWNKAANVLFLETPSGVGFSYSNISYNY-RGDRKTAGANYAFLV  206

Query  623   NWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEE  802
             NWLERFPEYK RD +I GESYAGH+VPQLA +IL +NK  N+TIINLKGI IGNA I +E
Sbjct  207   NWLERFPEYKKRDFYIAGESYAGHFVPQLAHVILHHNKKANRTIINLKGITIGNAAIHDE  266

Query  803   TQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDT-CDTFVDDADRSMGNIYSYNI  979
             T   G Y ++ +HAL+S  T R I  +C+FS   +  +  C+   ++ D ++ NI  YNI
Sbjct  267   TDWLGMYQYFGSHALVSPRTTRQIEKHCDFSPGVTNQNKECNAAFEEVDPNIANIGIYNI  326

Query  980   YAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQ  1159
             Y P C   + L++   + +   FDPCS DY++ YLN P+VQ+A HANVT +   W+ C+ 
Sbjct  327   YGPVC-LDTNLTAKPKKVTPLQFDPCSYDYVHAYLNRPDVQEAFHANVTKLKYDWEICN-  384

Query  1160  DVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYP  1339
             +V  NW D   +++  + E M +G+ VW+YSGD+DG+V VT+T  ++ K+  +VKTPW+P
Sbjct  385   NVVYNWTDSAWSIITLLHEFMENGLRVWVYSGDVDGRVPVTSTLASLAKMRLTVKTPWHP  444

Query  1340  WY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
             W+      G   V   DL+F T+RGAGH VPS+QP RAL+F   F+ G   P
Sbjct  445   WFLHGEVGGYTEVYKGDLTFATVRGAGHQVPSFQPRRALSFIIHFLAGTPLP  496



>ref|NP_001147904.1| serine carboxypeptidase 1 precursor [Zea mays]
 gb|ACG29071.1| serine carboxypeptidase 1 precursor [Zea mays]
Length=524

 Score =   417 bits (1072),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 242/465 (52%), Positives = 301/465 (65%), Gaps = 25/465 (5%)
 Frame = +2

Query  167   TIIMSAQDLGSVYIGAQD-GLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYF  343
             ++ ++A D  S +  +   G K+ D++  LPGQP GV F Q++GYVTVD  AGRALFYY 
Sbjct  54    SLAVAATDRASRHAASPGVGRKEDDRVDRLPGQPSGVDFEQYAGYVTVDAAAGRALFYYL  113

Query  344   AES----ETPSDKPLVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVAN  511
             AE+       + KPL+LWLNGGPGCSS G G M E GPFRV SD KTL+ N YAWNN AN
Sbjct  114   AEAVGGGSASAAKPLLLWLNGGPGCSSLGYGAMEELGPFRVKSDGKTLYRNPYAWNNAAN  173

Query  512   VIFLESPAGVGFSYSNRSSDYV-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYA  688
             V+FLESPAGVGFSYSN + DY  +GD KTA D   FLLNW+E+FPEYK RDL++ GESYA
Sbjct  174   VLFLESPAGVGFSYSNTTEDYSRSGDNKTAEDALRFLLNWMEKFPEYKGRDLYLAGESYA  233

Query  689   GHYVPQLAQLILRN---NKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDE  859
             GHYVPQLA  IL +    K ++ + +NL+GI IGNA I++ T   G YDF+WTHALISD 
Sbjct  234   GHYVPQLAHAILGHAAAGKPSSSSPLNLRGIMIGNAVINDWTDTKGMYDFFWTHALISDA  293

Query  860   THRGIIANCNFS-----SAASPSDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssss  1024
             T   I  +CNFS      AA+ +D C+    +AD ++ +I  YNIYAP C    GL S  
Sbjct  294   TADAIGRHCNFSAAADADAAASNDKCNEATSEADEALQDIDIYNIYAPNC-QSPGLVSPP  352

Query  1025  vqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLP  1204
             +  S   FDPCS  Y+  YLN P+VQ+ALHANVT +  PW +CS DV   W D   TVLP
Sbjct  353   ITPSMDRFDPCSDYYVNAYLNDPDVQRALHANVTRLDHPWSACS-DVLRRWTDSATTVLP  411

Query  1205  TIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggyv----  1372
              + EL+ + I VW+YSGD DG+V VT++ Y++N+L   V   W  W+S  +  G V    
Sbjct  412   ILTELLNNDIRVWVYSGDTDGRVPVTSSRYSVNQLQLPVAAKWRAWFSSTQGAGEVGGYV  471

Query  1373  -----vgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
                       LS VT+RGAGH VPSYQP RAL     F+ GK  P
Sbjct  472   VQYKGKEKGSLSLVTVRGAGHEVPSYQPRRALVLVQGFLAGKTLP  516



>ref|XP_004499086.1| PREDICTED: serine carboxypeptidase II-3-like isoform X2 [Cicer 
arietinum]
Length=519

 Score =   417 bits (1072),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 253/456 (55%), Positives = 306/456 (67%), Gaps = 36/456 (8%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESE-TPSDKPLVLWLn  391
             Q  L + DK+ +LPGQP+GV F Q++GYVTVD ++GR LFYYF ES    S KPLVLWLN
Sbjct  66    QSKLMEDDKVMSLPGQPKGVNFDQYAGYVTVDAKSGRELFYYFVESPLNSSSKPLVLWLN  125

Query  392   ggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSD  571
             GGPGCSSFG G M E GPFRVNSD  TL LN+ AWN VANVIFLESPAGVGFSYSN SSD
Sbjct  126   GGPGCSSFGYGAMQELGPFRVNSDGTTLSLNQDAWNIVANVIFLESPAGVGFSYSNNSSD  185

Query  572   YV-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNK-ITN  745
             Y   GD  TA D+Y FLLNW ERFP+YKTR+ FI GESY GHYVPQLA LIL NNK + N
Sbjct  186   YSHIGDNSTALDSYTFLLNWFERFPQYKTREFFIAGESYGGHYVPQLAHLILSNNKQMKN  245

Query  746   QTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCD  925
              T+INLKGIAIGN +ID+     G YD++W HAL S ETH GI  NC+F +    S+ C 
Sbjct  246   HTVINLKGIAIGNGWIDDNLCTKGMYDYFWMHALNSVETHEGIEKNCDFGNFNFTSE-CV  304

Query  926   TFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQK  1105
              + + AD  +GNI  YNIYAP C+S +  +++S    S  FDPCS DY   YLN PEVQ+
Sbjct  305   KYQNIADDELGNIDIYNIYAPLCNSSATKTAASPTTYSG-FDPCSEDYTVAYLNHPEVQQ  363

Query  1106  ALHANVTGIPGPWDSCSQDV---------------------------NVNWEDMPDTVLP  1204
             ALHA     P  W SC   +                            V W D P ++LP
Sbjct  364   ALHAK----PTKWSSCRYTIMFSFLKFQNSLIVNVVVLLTFPLMLFSEVGWTDSPASILP  419

Query  1205  TIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgye  1384
             TI  L+ + IS+ +YSGD+D +V +T+T Y+IN L  +  T W PWY+  EVGGYV+GY+
Sbjct  420   TINHLISNAISILIYSGDVDARVPITSTLYSINALKLAPDTAWRPWYTGKEVGGYVIGYK  479

Query  1385  DLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
              L+ VT+RGAGH VPS+QP+ ALT  S+F+ G+LPP
Sbjct  480   GLTLVTVRGAGHMVPSHQPQSALTMISSFLLGELPP  515



>gb|KEH17668.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=493

 Score =   416 bits (1069),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 230/432 (53%), Positives = 286/432 (66%), Gaps = 9/432 (2%)
 Frame = +2

Query  206   IGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK-PLVL  382
             I +Q+GLK+ D+I +LPGQP  VKF+QF GYV +D   GRA +YYF E++   +  PL+L
Sbjct  62    IHSQEGLKEKDRIKSLPGQPL-VKFSQFGGYVKLDKLGGRAFYYYFVEAQHSKETLPLLL  120

Query  383   WLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNR  562
             WLNGGPGCSS   G M E GPFRVNSD KTL  N+Y+WN  ANV+FLESP GVGFSYSN+
Sbjct  121   WLNGGPGCSSLAYGAMQELGPFRVNSDGKTLHHNRYSWNYAANVLFLESPVGVGFSYSNK  180

Query  563   SSDYVT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKI  739
             SSDY T GDKKTA DNY+FL+NWLERFPEYK RD +I+GESYAGHYVPQL   IL +NK 
Sbjct  181   SSDYSTNGDKKTATDNYLFLVNWLERFPEYKNRDFYISGESYAGHYVPQLGHTILYHNK-  239

Query  740   TNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDT  919
               +TIINLKGI IGNA I ++T     YD+  +HA+ISDE    I + C+FSS    S  
Sbjct  240   KAKTIINLKGILIGNAVIHDQTDSPAMYDYLASHAIISDEAAYDIKSVCDFSS-DKLSKE  298

Query  920   CDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEV  1099
             C+   D+ +  +  I  YNIYAP C + +  +           DPC   Y+  YLN  +V
Sbjct  299   CNAVADEVNEDLAFINLYNIYAPVCKNDNLTAKPKKYSIVN--DPCGESYVSAYLNRKDV  356

Query  1100  QKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAV  1279
             Q+ALHANVT +   W  CS DV  +W D   TVLP + E + SG+ VW++SGD DG+V V
Sbjct  357   QEALHANVTKLKYEWSPCS-DVIGHWVDSSSTVLPILHEFLNSGLRVWIFSGDTDGRVPV  415

Query  1280  TTTTYAINKLNTSVKTPWYPWYS-KgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALT  1456
             T+T  +I K+N  +KT WYPW +     G   V   DL+F T+R AGH VPSYQP RAL 
Sbjct  416   TSTKNSIKKMNLPIKTRWYPWLAYGEVGGYTQVYKGDLTFATVREAGHQVPSYQPGRALA  475

Query  1457  FFSAFVEGKLPP  1492
                 F++G   P
Sbjct  476   LIKHFLDGTPLP  487



>ref|XP_004231124.2| PREDICTED: serine carboxypeptidase-like 40 [Solanum lycopersicum]
Length=527

 Score =   417 bits (1072),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 243/470 (52%), Positives = 307/470 (65%), Gaps = 8/470 (2%)
 Frame = +2

Query  89    IGGRKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGSVYIGAQDGLKDADKISALPGQPE  268
             +G ++ D L    K  KQK        +     +L  V I  Q+G K  D I+ LPGQP 
Sbjct  61    LGKKQGDVLSKFYKA-KQKNSAFRKSYLNDENVELDKV-ILPQEGSKAKDWINKLPGQPP  118

Query  269   GVKFAQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLnggpgcssfgnggMMENGPF  448
              VKF Q+ GYVTV+  AGRAL+YYF E+E     PL+LWLNGGPGCSS   G M E GPF
Sbjct  119   -VKFQQYGGYVTVNQSAGRALYYYFTEAENSEALPLLLWLNGGPGCSSMAYGAMEELGPF  177

Query  449   RVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFLLN  625
             RVNSD KTL  N YAWN  ANV+FLESPAGVGFSY+N SSD+  TGD  TA DN +FLLN
Sbjct  178   RVNSDGKTLHRNSYAWNRAANVLFLESPAGVGFSYTNTSSDFNTTGDSTTANDNVVFLLN  237

Query  626   WLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEET  805
             WLERFPEYK RD +I+GESYAGHYVPQLA  IL++NK  N+T+INLKGI IGNA I+++T
Sbjct  238   WLERFPEYKKRDFYISGESYAGHYVPQLAHEILKHNKQANRTLINLKGIIIGNAVINDDT  297

Query  806   QDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNIYSYNIYA  985
                G Y+++ +HALISDET+  I  +C F    + S  C++ +  +D ++  +  YNIY 
Sbjct  298   DIIGMYEYFASHALISDETYHDIQNSC-FVENYNESK-CNSAIAISDNNINYLDIYNIYF  355

Query  986   PFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDV  1165
             P C     L+           DPCS+DYIY YLN  +VQ ALHANVT I   W+SCS  +
Sbjct  356   PLC-KNGNLTKHPKIPPPLQIDPCSADYIYAYLNRRDVQDALHANVTNIKYEWESCSNTL  414

Query  1166  NVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWY  1345
               NW+D   T++P + E + +G+ VW++SGD DG+V VT++  +I  +N +V  PW  W 
Sbjct  415   FYNWKDSSVTIVPLLIESLENGVRVWIFSGDTDGRVPVTSSKRSIQAMNLTVDQPWRSWL  474

Query  1346  SKgevgg-yvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
             + GEVGG        L+F T+RGAGH VPSYQP RAL+  S F+ G LPP
Sbjct  475   NGGEVGGYVETYKGGLTFATVRGAGHEVPSYQPARALSLISHFLSGTLPP  524



>gb|KFK35499.1| hypothetical protein AALP_AA5G292700 [Arabis alpina]
Length=494

 Score =   416 bits (1068),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 237/471 (50%), Positives = 305/471 (65%), Gaps = 13/471 (3%)
 Frame = +2

Query  113   LESLLKTQKQKRQNNNAQTIIMSA-QDLG-SVYIGAQDGLKDADKISALPGQPEGVKFAQ  286
             + +L +    KR+  +  T    A +DL  S+  G Q  L+  D I  LPGQP  V F Q
Sbjct  29    VHALSRLYLSKREVGSMDTSHFKAVKDLKPSLLGGNQKELRKRDLIGRLPGQPP-VDFDQ  87

Query  287   FSGYVTVDPQAGRALFYYFAESETPS--DKPLVLWLnggpgcssfgnggMMENGPFRVNS  460
             + GYVTV+  AGR+ FYYF E+ + S    PL+LWLNGGPGCSS   G + E GPFRV+S
Sbjct  88    YGGYVTVNESAGRSFFYYFVEASSVSKDSSPLLLWLNGGPGCSSLAYGALQEIGPFRVHS  147

Query  461   DSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVT-GDKKTAADNYIFLLNWLER  637
             D KTL+ N+YAWNN ANV+FLESPAGVGFSY+N +SD    GD+ TAADNYIFL+ WLER
Sbjct  148   DGKTLFRNRYAWNNAANVLFLESPAGVGFSYTNTTSDLEKHGDRNTAADNYIFLVKWLER  207

Query  638   FPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDSG  817
             FPEYK RDL+I GESYAGHYVPQLA  IL    + +Q  +NLKGI IGNA I++ET   G
Sbjct  208   FPEYKGRDLYIAGESYAGHYVPQLAHTIL----LHHQNFLNLKGILIGNAVINDETDLMG  263

Query  818   TYDFYWTHALISDETHRGIIANCNFSSAASP-SDTCDTFVDDADRSMGNIYSYNIYAPFC  994
              YDF+ +HALIS++T   +  NC+  + +S  +  C       + ++  +  YNIYAP C
Sbjct  264   MYDFFESHALISEDTLVSLKKNCDLKTESSVMTGECAMASQQIEMNIYYLDIYNIYAPMC  323

Query  995   ssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVN  1174
              + +         + R FDPCS  Y+  YLN  EVQ ALHAN T +P  W+ CS  +   
Sbjct  324   LNSTLTRRPKRGTTIREFDPCSDHYVKAYLNRAEVQAALHANATKLPYEWEPCSSVIK-K  382

Query  1175  WEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKg  1354
             W D P TV+P IKELMG GI VW++SGD DG++ VT+T Y++ K+N + K  W+PWY  G
Sbjct  383   WNDSPTTVIPLIKELMGKGIRVWVFSGDTDGRIPVTSTKYSLKKMNLTAKMVWHPWYQGG  442

Query  1355  evgg-yvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKSAE  1504
             EVGG        L+F T+RGAGH VPS+QP RAL+ F  F++  L P ++ 
Sbjct  443   EVGGYTEEYKGKLTFATVRGAGHQVPSFQPRRALSLFIHFLKDTLLPDTSR  493



>emb|CBI28591.3| unnamed protein product [Vitis vinifera]
Length=516

 Score =   416 bits (1069),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 232/472 (49%), Positives = 312/472 (66%), Gaps = 12/472 (3%)
 Frame = +2

Query  98    RKFDPLESLLKTQKQKRQNNNAQTIIMSAQDLGS----VYIGAQDGLKDADKISALPGQP  265
             RK   L +LL+  K +  N+   T +    ++ S      I  Q G+K+ D+I  LPGQP
Sbjct  49    RKQTELLNLLRKAKMQ-GNSGIDTSLFEVNEIESEAESYKILPQKGMKEKDRIERLPGQP  107

Query  266   EGVKFAQFSGYVTVDPQAGRALFYYFAESETPSD-KPLVLWLnggpgcssfgnggMMENG  442
               V F+Q+ GYVT+D   G AL+YYF E+ T  +  PL+LWLNGGPGCSS G G M E G
Sbjct  108   H-VGFSQYGGYVTIDESKGEALYYYFVEAPTSKEYLPLLLWLNGGPGCSSLGAGAMAELG  166

Query  443   PFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVTGDKKTAADNYIFLL  622
             PFRV+SD KTL+ N++AWN  ANV+FLE+P+GVGFSYSN S +Y  GD+KTA  NY FL+
Sbjct  167   PFRVHSDGKTLYRNRFAWNKAANVLFLETPSGVGFSYSNISYNY-RGDRKTAGANYAFLV  225

Query  623   NWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEE  802
             NWLERFPEYK RD +I GESYAGH+VPQLA +IL +NK  N+TIINLKGI IGNA I +E
Sbjct  226   NWLERFPEYKKRDFYIAGESYAGHFVPQLAHVILHHNKKANRTIINLKGITIGNAAIHDE  285

Query  803   TQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDT-CDTFVDDADRSMGNIYSYNI  979
             T   G Y ++ +HAL+S  T R I  +C+FS   +  +  C+   ++ D ++ NI  YNI
Sbjct  286   TDWLGMYQYFGSHALVSPRTTRQIEKHCDFSPGVTNQNKECNAAFEEVDPNIANIGIYNI  345

Query  980   YAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQ  1159
             Y P C   + L++   + +   FDPCS DY++ YLN P+VQ+A HANVT +   W+ C+ 
Sbjct  346   YGPVC-LDTNLTAKPKKVTPLQFDPCSYDYVHAYLNRPDVQEAFHANVTKLKYDWEICN-  403

Query  1160  DVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYP  1339
             +V  NW D   +++  + E M +G+ VW+YSGD+DG+V VT+T  ++ K+  +VKTPW+P
Sbjct  404   NVVYNWTDSAWSIITLLHEFMENGLRVWVYSGDVDGRVPVTSTLASLAKMRLTVKTPWHP  463

Query  1340  WY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPP  1492
             W+      G   V   DL+F T+RGAGH VPS+QP RAL+F   F+ G   P
Sbjct  464   WFLHGEVGGYTEVYKGDLTFATVRGAGHQVPSFQPRRALSFIIHFLAGTPLP  515



>ref|XP_010920885.1| PREDICTED: serine carboxypeptidase-like 27 [Elaeis guineensis]
Length=506

 Score =   416 bits (1068),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 225/438 (51%), Positives = 295/438 (67%), Gaps = 6/438 (1%)
 Frame = +2

Query  206   IGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSD-KPLVL  382
             +G     + +D+I  LPGQP  V F+Q+SGYVTV+ +AGRALFY+F E+   +   PLVL
Sbjct  44    VGGLAASRASDRIYRLPGQPP-VGFSQYSGYVTVNARAGRALFYWFIEAPPATQPAPLVL  102

Query  383   WLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNR  562
             WLNGGPGCSS   G   E GPFR++ D KTL+LN YAWN+ AN++FL+SPAGVGFSYSN 
Sbjct  103   WLNGGPGCSSIAYGASEEIGPFRIHPDGKTLFLNPYAWNSEANLLFLDSPAGVGFSYSNT  162

Query  563   SSD-YVTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKI  739
             SSD Y  GD++TA D Y FLLNW ERFP+YK RD +I+GESYAGHYVPQL+Q++ R NK 
Sbjct  163   SSDLYTAGDQRTAIDAYKFLLNWFERFPQYKYRDFYISGESYAGHYVPQLSQIVYRKNKG  222

Query  740   TNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDT  919
                 IIN KG  +GN  I++     GT++++WTH LISD+T+  ++  C+  S+  PS  
Sbjct  223   NKNPIINFKGFMVGNGVIEDYHDFVGTFEYWWTHGLISDDTYHDLMVTCDLQSSTHPSAE  282

Query  920   CDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqg---ssrgFDPCSSDYIYVYLNT  1090
             C   +D A    G+I  Y+IY   C+  + L           SR +DPC+ +Y  VY N 
Sbjct  283   CVKVLDAATIEQGHIDPYSIYTSPCTDATSLKRKIRGHYPWMSRAYDPCTENYARVYYNH  342

Query  1091  PEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGK  1270
             PEVQKALHANVTGIP PWD+CS  V + W D P ++LP  +EL+ +G+ +W++SGD D  
Sbjct  343   PEVQKALHANVTGIPYPWDTCSNIVGIYWADSPRSMLPIYRELIAAGLRIWVFSGDTDSV  402

Query  1271  VAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERA  1450
             V +T T Y+I+ LN S    WYPWY  G+VGG+   YE L+FVT+RGAGH VP ++P +A
Sbjct  403   VPLTATRYSIDALNLSTVISWYPWYDHGKVGGWTQVYEGLTFVTVRGAGHEVPLHRPRQA  462

Query  1451  LTFFSAFVEGKLPPKSAE  1504
             L  F  F++ KL P   E
Sbjct  463   LILFRHFLQDKLMPADTE  480



>gb|KHG25905.1| Serine carboxypeptidase-like 27 [Gossypium arboreum]
Length=470

 Score =   414 bits (1065),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 222/431 (52%), Positives = 288/431 (67%), Gaps = 7/431 (2%)
 Frame = +2

Query  221   GLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES---ETPSDKPLVLWLn  391
             G ++ DKI+ LPGQP+ V F Q+SGYVTV+ +AGRALFY+F ES     P  +PL+LWLN
Sbjct  25    GDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYWFIESPLNRRPETRPLILWLN  84

Query  392   ggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSD  571
             GGPGCSS   G   E GPFR+  D KTL+ N YAWN +AN +FLESPAGVGFSY+N +SD
Sbjct  85    GGPGCSSVAYGAAEEIGPFRIRPDGKTLYFNPYAWNKLANTLFLESPAGVGFSYTNTTSD  144

Query  572   -YVTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQ  748
              Y +GDK+TA D Y+FL+NWLERFP+YK RD +I GESYAGHYVPQLAQ++   NK    
Sbjct  145   LYTSGDKRTAEDAYVFLVNWLERFPQYKYRDFYIAGESYAGHYVPQLAQIVYERNKGVQI  204

Query  749   TIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDT  928
              +IN KG  +GNA  D+     GT++++WTH LISD T+R +   C+  SA  PS  C T
Sbjct  205   PVINFKGFMVGNAVTDDYHDFVGTFEYWWTHGLISDSTYRNLQVACDMGSATHPSSECTT  264

Query  929   FVDDADRSMGNIYSYNIYAPFCssgsglssssvqg---ssrgFDPCSSDYIYVYLNTPEV  1099
              ++ A+   GNI  Y+I+   C+  + L  +        SR FDPC+  Y   Y N PEV
Sbjct  265   ALEVAEAEQGNIDPYSIFTQPCADTTSLRRNLRGHYPWMSRAFDPCTERYSKEYFNRPEV  324

Query  1100  QKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAV  1279
             QKALHANVTGIP  W++CS  +  NW D P ++LP  +EL+ +GI +W+YSGD D  V V
Sbjct  325   QKALHANVTGIPYQWETCSDVIGYNWTDSPLSMLPIYQELIAAGIRIWVYSGDTDAVVPV  384

Query  1280  TTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTF  1459
             T T Y+I+ L       W+PWY  G+VGG+   Y+ L+FVT+ GAGH VP ++P +A   
Sbjct  385   TATRYSIDALKLPTINKWHPWYENGKVGGWSQEYKGLTFVTVTGAGHEVPLHRPRQAFIL  444

Query  1460  FSAFVEGKLPP  1492
             F +F+E K  P
Sbjct  445   FRSFLENKSMP  455



>ref|XP_004288721.1| PREDICTED: serine carboxypeptidase 24-like [Fragaria vesca subsp. 
vesca]
Length=448

 Score =   413 bits (1062),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 221/441 (50%), Positives = 304/441 (69%), Gaps = 10/441 (2%)
 Frame = +2

Query  197   SVYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAE-SETPSDKP  373
             ++ + A    ++ D+I+ALPGQP  V F+Q+SGYVTV+ + GRALFY+F E + +P +KP
Sbjct  8     TINVAATAKEQELDRITALPGQPP-VSFSQYSGYVTVNKKHGRALFYWFTEATASPHNKP  66

Query  374   LVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSY  553
             LVLW NGGPGCSS   G   E GPFR+N    +L+LNKY+WN  AN++FLESPAGVGFSY
Sbjct  67    LVLWFNGGPGCSSVAYGASEEIGPFRINRTGSSLYLNKYSWNREANILFLESPAGVGFSY  126

Query  554   SNRSSDYV-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRN  730
             +N S+D + +GDK+TA D   FLL WL RFP+YK R+ +I+GESYAGHYVPQLA+ I+  
Sbjct  127   TNTSADLIDSGDKRTAQDALTFLLQWLSRFPQYKYREFYISGESYAGHYVPQLAKEIVNY  186

Query  731   NKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASP  910
             NK  +  IINLKG  +GNA  D      GT  ++WTH++ISD T+R I+ +CNF++  S 
Sbjct  187   NKAHSHPIINLKGFIVGNAVTDNYYDSIGTVAYWWTHSMISDHTYRSILDHCNFTADKST  246

Query  911   SDTCDTFVDDA-DRSMGNIYSYNIYAPFCssgsglssssvqgssrg-----FDPCSSDYI  1072
             +  CD  V+ A +   G+I  Y+IY PFC +    S+ +++  +       +DPCS +Y 
Sbjct  247   TQ-CDDAVNYAMNYEFGDIDQYSIYTPFCLTQITNSARNLRLKNTLLCRRGYDPCSENYA  305

Query  1073  YVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYS  1252
               Y N P+VQKA+HAN+T IP  W +CS  +  NW D  D++LPT KELM +G+ +W++S
Sbjct  306   EKYYNRPDVQKAMHANITKIPYKWTACSDTLIKNWNDSEDSMLPTYKELMAAGLKIWVFS  365

Query  1253  GDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPS  1432
             GD D  V VT T ++++ LN ++KTPWYPWY+ G+VGG+   Y  L+F TIRGAGH VP 
Sbjct  366   GDTDSVVPVTATRFSLSHLNLTIKTPWYPWYTGGQVGGWTEVYHGLTFATIRGAGHEVPL  425

Query  1433  YQPERALTFFSAFVEGKLPPK  1495
             +QP+RA   F +F+ GK  P+
Sbjct  426   FQPKRAFVLFQSFLAGKQLPR  446



>ref|XP_008337089.1| PREDICTED: serine carboxypeptidase II-3-like [Malus domestica]
Length=377

 Score =   410 bits (1055),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 219/358 (61%), Positives = 261/358 (73%), Gaps = 10/358 (3%)
 Frame = +2

Query  428   MMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYV-TGDKKTAAD  604
             M E GPFRVN+D KTL+ N YAWNNVANVIFLESPAGVGFSYSN +SDY   GDK+TA D
Sbjct  29    MEELGPFRVNNDRKTLFRNDYAWNNVANVIFLESPAGVGFSYSNTTSDYGDVGDKRTAED  88

Query  605   NYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGN  784
             +Y FL+NWLERFP+YKTRD FITGESYAGHYVPQLA  IL NNK+TNQT INLKGIAIGN
Sbjct  89    SYKFLVNWLERFPQYKTRDFFITGESYAGHYVPQLASTILLNNKVTNQTKINLKGIAIGN  148

Query  785   AYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADRSMGNI  964
             A+ID+ T + G YD+ WTH++ SDET+ GI   C+FSS  + S  CD +       +GN+
Sbjct  149   AWIDDSTGELGIYDYVWTHSMNSDETNAGIHKYCDFSS-GNFSSACDKYRSQXGEELGNV  207

Query  965   YSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPW  1144
               YNIYAP C   S  + S  + S   FDPCS  Y+  YLN  EVQ ALHA     P  W
Sbjct  208   XIYNIYAPLC-KTSEPTKSLSKSSIDDFDPCSDXYVGTYLNLKEVQAALHAK----PTEW  262

Query  1145  DSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVK  1324
              +C     V W D P T+LPTIK+L+ SGIS+W+YSGD DG+V VT++ YAI      ++
Sbjct  263   SACG---GVGWTDSPTTILPTIKQLIASGISLWIYSGDTDGRVPVTSSRYAIKTFKLPLQ  319

Query  1325  TPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
             TPW  WYS G+VGGYV GY+ L+F TIRGAGH VPSYQP+R+LTF S+F++GKLPP S
Sbjct  320   TPWRAWYSNGQVGGYVAGYKGLTFTTIRGAGHMVPSYQPKRSLTFISSFLQGKLPPSS  377



>gb|ABR16997.1| unknown [Picea sitchensis]
Length=536

 Score =   416 bits (1069),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 227/431 (53%), Positives = 293/431 (68%), Gaps = 7/431 (2%)
 Frame = +2

Query  212   AQDGLKDADKI-SALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLW  385
             A+   ++AD +   LPGQP G+KF Q+SGYVTVD +AGRALFYYF E+   PS +PLVLW
Sbjct  108   AEGHTQEADYLPHGLPGQPMGIKFRQYSGYVTVDAKAGRALFYYFTEAVRDPSKQPLVLW  167

Query  386   LnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRS  565
             LNGGPGCSS G G M E GPFRVN D KT+  N+Y WN VAN++FLESPAGVGFSYSN S
Sbjct  168   LNGGPGCSSLGFGAMAEVGPFRVNPDGKTVHFNRYTWNQVANILFLESPAGVGFSYSNTS  227

Query  566   SDYV--TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKI  739
             SDY   +GD++TA D Y FL+ W  RFP+YK RD +I GESYAG+Y+P+LA  IL + ++
Sbjct  228   SDYSKHSGDRRTAKDAYTFLMKWFIRFPQYKFRDFYIAGESYAGNYIPELAATILHHQRL  287

Query  740   TNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDT  919
             +  + IN KGI +GN  ++ +T + G   + WTHALISDET+ G+I NC  S+       
Sbjct  288   SQASFINFKGIMVGNGIMNSDTDNIGQITYPWTHALISDETYEGLINNCIKSNV--DEIL  345

Query  920   CDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEV  1099
             C+         MGNI  Y+IYAP C + S   +   +    G+DPCS DY++ Y NTP+V
Sbjct  346   CEVLELKMSLEMGNIDPYSIYAPLCLTNSSELAKQEEAEIPGYDPCSDDYVFTYFNTPDV  405

Query  1100  QKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAV  1279
             QKA+HANVT +   W+ CS +V  NW D   TVLP  + L+ +G+ + L SGD D  V V
Sbjct  406   QKAIHANVTNLNYTWNQCS-NVISNWTDYASTVLPIYRHLIATGLRILLLSGDTDTVVPV  464

Query  1280  TTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTF  1459
             T+T  +IN+L   + TPWYPW +  EVGGY V Y+ L+F T+RGAGH VP++QP RALT 
Sbjct  465   TSTRLSINELKLPIATPWYPWLNGDEVGGYTVIYKGLTFATVRGAGHEVPAFQPSRALTL  524

Query  1460  FSAFVEGKLPP  1492
             F +F+ GK  P
Sbjct  525   FKSFLAGKPLP  535



>ref|XP_003552566.1| PREDICTED: serine carboxypeptidase-like 25-like isoform 1 [Glycine 
max]
Length=467

 Score =   413 bits (1061),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 233/451 (52%), Positives = 307/451 (68%), Gaps = 19/451 (4%)
 Frame = +2

Query  194   GSVYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDK  370
             G+ +  A+ G + AD+I  LPGQP+ V F QFSGYVTV+  AGRALFY+  E+ + P  K
Sbjct  20    GARFAKAEGGGEAADRILELPGQPK-VSFQQFSGYVTVNKVAGRALFYWLTEAAQNPLTK  78

Query  371   PLVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFS  550
             PLV+WLNGGPGCSS   G   E GPFR+N  +  L++NK++WN VAN++FLE+PAGVGFS
Sbjct  79    PLVIWLNGGPGCSSVAYGASEEIGPFRINKTASGLYINKFSWNTVANLLFLEAPAGVGFS  138

Query  551   YSNRSSDYV-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILR  727
             Y+NRSSD + TGD++TA D+  F++ WLERFP YK R+L+ITGESYAGHYVPQLA+ IL 
Sbjct  139   YANRSSDLLNTGDRRTAQDSLEFVIQWLERFPRYKNRELYITGESYAGHYVPQLAKEILT  198

Query  728   NNKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAAS  907
              N  T    INLKGI +GNA  D    + GT  ++W+HA+ISD+T+R +++ C+F     
Sbjct  199   YNAKTKHP-INLKGIMVGNAVTDNYYDNLGTVTYWWSHAMISDQTYRQLMSTCDFHRQKE  257

Query  908   PSDTCDTFVDDA-DRSMGNIYSYNIYAPFCssgsglssssvqgssrg-------------  1045
              SD C++    A D+  GNI  YNIYAP C++  G SSS+ + + R              
Sbjct  258   -SDECESVYSYAMDQEFGNIDQYNIYAPPCNNSDGSSSSANRRTMRLPHRPHVDFSHWSG  316

Query  1046  FDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMG  1225
             +DPC+  Y  +Y N P+VQKALHAN TGIP  W +CS+ +N NW D   +VLP  +EL+ 
Sbjct  317   YDPCTEKYAEIYYNRPDVQKALHANKTGIPYRWTACSEVLNRNWNDTDVSVLPIYRELIA  376

Query  1226  SGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTI  1405
              GI VW++SGD+D  V VT T YA+ +L  S K PWYPWY K +VGG+   YE ++F T+
Sbjct  377   HGIRVWVFSGDVDSVVPVTATRYALAQLKLSTKIPWYPWYVKNQVGGWTEVYEGVTFATV  436

Query  1406  RGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
             RGAGH VP ++P  AL  F +F+EGK  PKS
Sbjct  437   RGAGHEVPLFKPRAALQLFKSFLEGKPLPKS  467



>ref|XP_006292523.1| hypothetical protein CARUB_v10018754mg, partial [Capsella rubella]
 gb|EOA25421.1| hypothetical protein CARUB_v10018754mg, partial [Capsella rubella]
Length=450

 Score =   412 bits (1060),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 221/428 (52%), Positives = 282/428 (66%), Gaps = 11/428 (3%)
 Frame = +2

Query  206   IGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK-PLVL  382
             +   + L+  D I  LPGQP  V F Q+ GYVTV+  AGR+ FYYF E+    D  PL+L
Sbjct  20    VADHEELRKRDLIRRLPGQPP-VDFDQYGGYVTVNESAGRSFFYYFVEASKSKDSSPLLL  78

Query  383   WLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNR  562
             WLNGGPGCSS   G + E GPFRV+SD KTL+ N+YAWNN ANV+FLESPAGVGFSY+N 
Sbjct  79    WLNGGPGCSSLAYGALQELGPFRVHSDGKTLFRNRYAWNNAANVLFLESPAGVGFSYTNT  138

Query  563   SSDYVT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKI  739
             +SD    GD+ TAADNYIFL+ WLERFPEYK RDL+I GESYAGHYVPQLA  IL    +
Sbjct  139   TSDMEKHGDRNTAADNYIFLVKWLERFPEYKDRDLYIAGESYAGHYVPQLAHTIL----L  194

Query  740   TNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNF--SSAASPS  913
              +Q+ ++LKGI IGNA I++ET   G YDF+ +HALIS+++   +  NC+    SA+  +
Sbjct  195   HHQSFLDLKGILIGNAVINDETDLMGMYDFFESHALISEDSLASLKNNCDLKTESASVMT  254

Query  914   DTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTP  1093
             + C    D  D     +  YNIYAP C + +         + R FDPCS  Y+  YLN P
Sbjct  255   EECAVVSDQIDMDTYYLDIYNIYAPLCLNSTLTRRPKRGTTIREFDPCSDHYVQAYLNRP  314

Query  1094  EVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKV  1273
             EVQ ALHAN T +P  W  CS  +   W D P TV+P IK LMG G+ VW++SGD DG++
Sbjct  315   EVQAALHANATKLPYEWQPCSSVIK-KWNDSPTTVIPLIKGLMGRGVRVWVFSGDTDGRI  373

Query  1274  AVTTTTYAINKLNTSVKTPWYPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERA  1450
              VT+T Y++ K+N + KT W+PWY      G        L+F T+RGAGH VPS+QP+R+
Sbjct  374   PVTSTKYSLKKMNLTAKTAWHPWYIGGEVGGYTEEYKGKLTFATVRGAGHQVPSFQPKRS  433

Query  1451  LTFFSAFV  1474
             L+ F  F+
Sbjct  434   LSLFIHFL  441



>ref|XP_010906017.1| PREDICTED: serine carboxypeptidase II-3-like [Elaeis guineensis]
Length=485

 Score =   413 bits (1061),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 236/426 (55%), Positives = 290/426 (68%), Gaps = 11/426 (3%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLn  391
             Q GLK  D+I  LPGQPEGV F +++GYVTVD +AGRALFYYF ++    S KPL+LWLN
Sbjct  64    QQGLKKKDRIEYLPGQPEGVDFDEYAGYVTVDQKAGRALFYYFVQAVGDSSSKPLLLWLN  123

Query  392   ggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSD  571
             GGPGCSS G G M E GPFRV SD KTL+ N +AWN VANV+FLESPAGVGFSYSN +SD
Sbjct  124   GGPGCSSLGYGAMQEIGPFRVMSDGKTLFRNPFAWNGVANVLFLESPAGVGFSYSNTTSD  183

Query  572   YV-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQ  748
             Y  +GD +TA DNY+FL+NW+ERFPEYK RD +I GESYAGH VP LA  IL+       
Sbjct  184   YSKSGDSRTAEDNYVFLVNWMERFPEYKGRDFYIAGESYAGHLVPDLATTILQQ----KN  239

Query  749   TIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSD-TCD  925
             T INL GI IGNA I++ T + G +D+ WTHALISDET   I   C+FS  A+  +  C 
Sbjct  240   TNINLNGIMIGNAVINDATDNRGMFDYLWTHALISDETIDAIHKYCSFSPNATNQEYRCG  299

Query  926   TFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQK  1105
               +  A      +  YNIYAP C   SG++++  + S + FDPCS DY+  YLN  EVQ+
Sbjct  300   DAMSVAREVSTVLNIYNIYAPPC--SSGITNTPKRLSIKNFDPCSVDYVDTYLNRAEVQQ  357

Query  1106  ALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTT  1285
              LHANVT +   W  CSQ +   W D P TVLP IK LM S I VW+YSGD+DG+V VT+
Sbjct  358   KLHANVTKLNYTWSGCSQVIQ-QWLDSPSTVLPLIKNLMASNIQVWIYSGDVDGRVPVTS  416

Query  1286  TTYAINKLNTSVKTPWYPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFF  1462
             T Y+IN+L   VK  WYPWY      G  V  + +L+F T++GAGH VPSY+ ++AL   
Sbjct  417   TRYSINELLLPVKKQWYPWYIGNKACGYGVTYHGNLTFATVKGAGHEVPSYKAQQALQLV  476

Query  1463  SAFVEG  1480
               F+EG
Sbjct  477   KFFLEG  482



>ref|XP_010067795.1| PREDICTED: serine carboxypeptidase-like 40 [Eucalyptus grandis]
Length=494

 Score =   413 bits (1062),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 228/430 (53%), Positives = 292/430 (68%), Gaps = 9/430 (2%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPSDKPLVLWLn  391
             Q+GLK+ D+I  LPGQP  V+F  + GYVTVD  AGRA +YYFAE+ +     PL++W N
Sbjct  68    QEGLKEKDRIERLPGQPP-VEFDHYGGYVTVDESAGRAFYYYFAEAVQNKHLMPLLIWFN  126

Query  392   ggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSD  571
             GGPGCSS       E GPFR+ SD KTL+ NK+AWN  ANV+FLESP GVGFSYSN +SD
Sbjct  127   GGPGCSSLYGAKQ-ELGPFRIQSDGKTLYRNKFAWNRAANVLFLESPVGVGFSYSNTTSD  185

Query  572   YVT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQ  748
             Y T GD KTAADNY+FLLNWLERFPEYK RD +I+GESYAGH+V QLA  IL NNK  N+
Sbjct  186   YRTNGDSKTAADNYVFLLNWLERFPEYKNRDFYISGESYAGHFVTQLAHNILSNNKAANK  245

Query  749   TIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDT-CD  925
             T+INLKGI +GNA +++ET  S  Y+++ THALIS ET   I   CNFS  AS   + C+
Sbjct  246   TLINLKGIIVGNAVLNDETHRSEIYEYFATHALISQETWYAIQKYCNFSLDASKRGSQCN  305

Query  926   TFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQK  1105
             +   +ADR +  I +Y IYAP C   S L++   + +   FDPC   Y+  YLN  +VQ+
Sbjct  306   SATSEADRDVSYIDTYEIYAPPC--LSNLTAHPKKTNIMDFDPCGELYLQAYLNREDVQE  363

Query  1106  ALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTT  1285
             ALHANVT +   WD+CS  +   W+  P TVLP ++E M +G+ VW+YSGD D  V VT+
Sbjct  364   ALHANVTKLDYGWDTCSSVIE-GWQWGPSTVLPLLQEFMSNGLRVWVYSGDTDAVVPVTS  422

Query  1286  TTYAINKLNTSVKTPWYPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFF  1462
             T  ++++++   K+ W PW+      G   V   DL+F T+RGAGH VPSYQP+RAL+  
Sbjct  423   TQRSLSEMSLPTKSAWRPWFLGGEVGGYVQVYKGDLTFATVRGAGHMVPSYQPKRALSLI  482

Query  1463  SAFVEGKLPP  1492
             S F+ G L P
Sbjct  483   SRFLAGSLLP  492



>ref|XP_011008261.1| PREDICTED: serine carboxypeptidase-like 40 [Populus euphratica]
Length=498

 Score =   413 bits (1062),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 226/429 (53%), Positives = 288/429 (67%), Gaps = 9/429 (2%)
 Frame = +2

Query  215   QDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK--PLVLWL  388
             ++G K  D+I  LPGQP  V+F+Q+ GY+TV+  AG A +YYF E++  S +  PL+LWL
Sbjct  76    KEGSKKKDRIKRLPGQPH-VRFSQYGGYITVNKTAGAAFYYYFVEADKHSKEHLPLLLWL  134

Query  389   nggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSS  568
             NGGPGCSS   G M E GPFRV+S+ KTL+ N+Y+WNNVANV+F+ESPAGVGFSYSN S+
Sbjct  135   NGGPGCSSLAYGAMQELGPFRVHSNGKTLYRNRYSWNNVANVLFVESPAGVGFSYSN-ST  193

Query  569   DYVTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQ  748
                 GD++TAA+NY FL+NWL RFPEYK RD +I GESYAGHY PQLAQ +L +NK  N 
Sbjct  194   WRTNGDRQTAAENYRFLVNWLGRFPEYKNRDFYIAGESYAGHYAPQLAQTVLHHNKKANT  253

Query  749   TIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDT  928
             TI+NLKG+ IGNA ID+ET + G YDF+ THALIS +  R I   C+FS A   ++   +
Sbjct  254   TIVNLKGVLIGNAAIDDETDNQGMYDFFGTHALISYDNLRKIHRYCDFSRAHESAECRHS  313

Query  929   FVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTPEVQKA  1108
              +         I  YNIY P C     L+S   + S   FDPCS  Y+Y YLN P+VQ+A
Sbjct  314   LLKTDADVWNAIDVYNIYGPLC-LDGNLTSRPRKTSLMNFDPCSDYYVYAYLNRPDVQEA  372

Query  1109  LHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTT  1288
             +HANVT +   W+ CS   + +W D   T+LP +KELM +G+ VWL+SGD DG+V  T+T
Sbjct  373   MHANVTKLTYDWEPCS---DFDWVDSASTILPLVKELMENGLRVWLFSGDTDGRVPFTST  429

Query  1289  TYAINKLNTSVKTPWYPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFS  1465
              YAINK+   +KT WYPW+      G   V   DL+F T+RGAGH VPS QP RA    S
Sbjct  430   QYAINKMKLPIKTEWYPWFHGGEVGGYVQVYKGDLTFATVRGAGHMVPSIQPVRASALIS  489

Query  1466  AFVEGKLPP  1492
              F+ G   P
Sbjct  490   HFLAGTPLP  498



>ref|XP_002529402.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF32998.1| serine carboxypeptidase, putative [Ricinus communis]
Length=469

 Score =   412 bits (1059),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 227/454 (50%), Positives = 296/454 (65%), Gaps = 12/454 (3%)
 Frame = +2

Query  170   IIMSAQDLGSVYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAE  349
             ++ S  D  ++     +  ++ D+ISALPGQP  V F+QFSGYVTV+ + GRALFY+  E
Sbjct  17    VVFSGMDTTTIVDALANKEQELDRISALPGQPP-VTFSQFSGYVTVNEKHGRALFYWLTE  75

Query  350   -SETPSDKPLVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLE  526
              + +P  KPLVLWLNGGPGCSS   G   E GPFR+N    +L+LNKY+WN  AN++FLE
Sbjct  76    ATSSPHHKPLVLWLNGGPGCSSVAYGASEEIGPFRINRTGSSLYLNKYSWNTEANILFLE  135

Query  527   SPAGVGFSYSNRSSDYV-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVP  703
             SPAGVGFSY+N SSD   +GDK+TA D  +FLL W  RFP+YK RD FI GESYAGHYVP
Sbjct  136   SPAGVGFSYTNTSSDLKDSGDKRTAQDALVFLLRWFSRFPQYKYRDFFIAGESYAGHYVP  195

Query  704   QLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIAN  883
             QLA+ I   NK  +  IINLKG  +GNA  D      GT  F+W+H++ISD T+R II N
Sbjct  196   QLAKKIHDYNKGHSHPIINLKGFIVGNAVTDNFYDSIGTVTFWWSHSMISDRTYRSIIDN  255

Query  884   CNFSSAASPSDTCDTFVDDA-DRSMGNIYSYNIYAPFC--------ssgsglssssvqgs  1036
             CNF      S+ CD  V  A +   G+I  Y+IY P C             L ++ ++  
Sbjct  256   CNFKEDNKTSEKCDDAVTYAMNHEFGDIDQYSIYTPACIQLPNKTSVRSLRLKNTLLRRR  315

Query  1037  srgFDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKE  1216
               G+DPC+ +Y   Y N P+VQKA+HAN+TGIP  W +CS  +  NW+D   +VLP  KE
Sbjct  316   VSGYDPCTENYAEKYFNRPQVQKAMHANITGIPYKWTACSDVLIKNWKDSEYSVLPIYKE  375

Query  1217  LMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSF  1396
             L+ +G+ +W++SGD D  V VT T ++++ LN +VKT WYPWYS  +VGG+   Y  L+F
Sbjct  376   LIAAGLRIWVFSGDTDSVVPVTATRFSLSHLNLTVKTRWYPWYSGNQVGGWTEVYNGLNF  435

Query  1397  VTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
              T+RGAGH VP +QP RA   F +F+ GK  PKS
Sbjct  436   ATVRGAGHEVPLFQPRRAFILFRSFLAGKELPKS  469



>ref|XP_006402270.1| hypothetical protein EUTSA_v10005912mg [Eutrema salsugineum]
 gb|ESQ43723.1| hypothetical protein EUTSA_v10005912mg [Eutrema salsugineum]
Length=498

 Score =   413 bits (1061),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 225/439 (51%), Positives = 288/439 (66%), Gaps = 13/439 (3%)
 Frame = +2

Query  176   MSAQDLGSVYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESE  355
             +    LGSV   +Q  L+  D I  LPGQP  V F Q+ GYVTVD  AGR+ FYYF ++ 
Sbjct  56    LKPSSLGSVV--SQRELRKRDLIRRLPGQPP-VDFDQYGGYVTVDESAGRSFFYYFVQAS  112

Query  356   --TPSDKPLVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLES  529
               +    PL+LWLNGGPGCSS   G + E GPFRV+SD KTL+ N+YAWNN ANV+FLES
Sbjct  113   FNSSDSSPLLLWLNGGPGCSSLAYGALQELGPFRVHSDGKTLFRNRYAWNNAANVLFLES  172

Query  530   PAGVGFSYSNRSSDYVT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQ  706
             PAGVGFSY+N +SD+   GDK TAADNYIFL+ WLERFPE+K RDL+I GESYAGHYVPQ
Sbjct  173   PAGVGFSYTNTTSDHEKHGDKNTAADNYIFLVKWLERFPEFKGRDLYIAGESYAGHYVPQ  232

Query  707   LAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANC  886
             LA  IL ++     + +NLKGI IGNA I++ET   G YDF+ +HALIS ++   + ++C
Sbjct  233   LAHTILLHHPT---SFLNLKGILIGNAVINDETDLMGMYDFFESHALISKDSLVRLKSSC  289

Query  887   NF--SSAASPSDTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCS  1060
             +    SA+  +D C    D  D     +  YNIYAP C + +         + R FDPCS
Sbjct  290   DLKTESASVMTDECAVVSDQIDMDTYYLDIYNIYAPLCLNSTLTRRPKRGTTIRDFDPCS  349

Query  1061  SDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISV  1240
               Y+  YLN PEVQ ALHAN T +P  W  CS  +   W D P TV+P IKELMG G+ V
Sbjct  350   DHYVQAYLNRPEVQAALHANATKLPYEWQPCSSVIK-KWNDSPTTVIPLIKELMGQGVRV  408

Query  1241  WLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWY-SKgevggyvvgyeDLSFVTIRGAG  1417
             W++SGD DG++ VT+T Y++ K+N + +T W+PWY      G        L+F T+RGAG
Sbjct  409   WVFSGDTDGRIPVTSTKYSLKKMNLTTQTAWHPWYLGGEVGGYTEEYEGKLTFATVRGAG  468

Query  1418  HFVPSYQPERALTFFSAFV  1474
             H VPS+QP+R+L+ F  F+
Sbjct  469   HQVPSFQPKRSLSLFIHFL  487



>ref|XP_008243007.1| PREDICTED: serine carboxypeptidase 24 [Prunus mume]
Length=463

 Score =   411 bits (1057),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 224/435 (51%), Positives = 300/435 (69%), Gaps = 14/435 (3%)
 Frame = +2

Query  227   KDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESE---TPSDKPLVLWLngg  397
             ++ D+ISALPGQP  V F+QFSGYVTV+   GRALFY+  E+    +P +KPLVLWLNGG
Sbjct  29    QELDRISALPGQPP-VSFSQFSGYVTVNEHQGRALFYWLTEAAATVSPHNKPLVLWLNGG  87

Query  398   pgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYV  577
             PGCSS   G   E GPFR+N+   +L+LNKY+WN  AN++FLESPAGVGFSY+N SS+  
Sbjct  88    PGCSSVAYGASEELGPFRINTTGSSLYLNKYSWNREANILFLESPAGVGFSYTNTSSNLK  147

Query  578   -TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTI  754
              +GDK+TA D  IFLL WL RFP+YK R+ +I GESYAGHYVPQLA+ I+  N+  + + 
Sbjct  148   DSGDKRTAQDALIFLLKWLSRFPQYKYREFYIAGESYAGHYVPQLAREIVTYNQGNSHSS  207

Query  755   INLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFV  934
             INLKGI +GNA  D      GT  F+W+HA+ISD T+R I+ +CNF+ A   S  CD  V
Sbjct  208   INLKGIIVGNAVTDNYYDSMGTVTFWWSHAMISDHTYRSILNHCNFT-AERTSQQCDDAV  266

Query  935   DDA-DRSMGNIYSYNIYAPFCssgs-------glssssvqgssrgFDPCSSDYIYVYLNT  1090
             + A +   G+I  Y+IY PFC +          L ++ ++    G+DPC+ +Y   Y N 
Sbjct  267   NYAMNHDFGDIDQYSIYTPFCLTMLNNTNRHLRLKNTLLRRRVSGYDPCTENYAEKYYNR  326

Query  1091  PEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGK  1270
             P+VQKA+HAN+T IP  W +CS  +  NW+D  D++LPT K+L+ +G+ +W++SGD D  
Sbjct  327   PDVQKAMHANITRIPYKWTACSDVLIKNWKDSEDSMLPTYKQLIKAGLKIWVFSGDTDSV  386

Query  1271  VAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERA  1450
             V VT T +A+N LN ++KTPWYPWY+ G+VGG+   Y+ L+F T+RGAGH VP +QP RA
Sbjct  387   VPVTATRFALNHLNLTIKTPWYPWYTGGQVGGWTEVYDGLTFATVRGAGHEVPLFQPNRA  446

Query  1451  LTFFSAFVEGKLPPK  1495
                F +F+ GK  PK
Sbjct  447   FIIFKSFLAGKKLPK  461



>gb|KHN41581.1| Serine carboxypeptidase-like 25 [Glycine soja]
Length=453

 Score =   410 bits (1055),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 233/453 (51%), Positives = 311/453 (69%), Gaps = 20/453 (4%)
 Frame = +2

Query  191   LGSVYIGAQDGLKDA-DKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAES-ETPS  364
             +G+ +  A++G ++A D+I  LPGQP+ V F QFSGYVTV+  AGRALFY+ AE+ + P 
Sbjct  4     VGARFAKAKEGGEEAADRILKLPGQPK-VSFKQFSGYVTVNKVAGRALFYWLAEAAQNPL  62

Query  365   DKPLVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVG  544
              KPLV+WLNGGPGCSS   G   E GPFR+N  +  L+ NK++WN+VAN++FLE+PAGVG
Sbjct  63    TKPLVIWLNGGPGCSSVAYGASEEIGPFRINKTASGLYKNKFSWNSVANLLFLEAPAGVG  122

Query  545   FSYSNRSSDYV-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLI  721
             FSY+NRSSD + TGD++TA D+  F++ WLERFP YKTR+L+ITGESYAGHYVPQLA+ I
Sbjct  123   FSYTNRSSDLLDTGDRRTAQDSLEFVIQWLERFPRYKTRELYITGESYAGHYVPQLAKEI  182

Query  722   LRNNKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSA  901
             +  N  T    INLKGI +GNA  D    + GT  ++W+HA+ISD+T R +++ C+F   
Sbjct  183   MTYNAKTKHP-INLKGIMVGNAVTDNYYDNLGTVTYWWSHAMISDQTFRQLMSRCDFHRQ  241

Query  902   ASPSDTCDTFVDDA-DRSMGNIYSYNIYAPFCssgsglssssvqgssrg-----------  1045
                SD C++    A D+  GNI  YNIYAP C++  G SSS+ + + R            
Sbjct  242   KE-SDECESVYSYAMDQEFGNIDQYNIYAPPCNNSDGSSSSATRRTMRLPHRPHVAFRHW  300

Query  1046  --FDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKEL  1219
               +DPC+  Y  +Y N P+VQKALHAN TGIP  W +CS+ +N NW D   +VLP  +EL
Sbjct  301   SGYDPCTEKYAEIYYNRPDVQKALHANKTGIPYRWTACSEVLNRNWNDTDVSVLPIYREL  360

Query  1220  MGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFV  1399
             +  GI VW++SGD+D  V VT T YA+ +L  S K PWYPWY K +VGG+   YE ++F 
Sbjct  361   IAHGIRVWVFSGDVDSVVPVTATRYALAQLKLSTKIPWYPWYVKNQVGGWTEVYEGVTFA  420

Query  1400  TIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
             T+RGAGH VP ++P  AL  F++F+ GK  PKS
Sbjct  421   TVRGAGHEVPLFKPRAALQLFTSFLTGKPLPKS  453



>gb|KHN13554.1| Serine carboxypeptidase-like 25 [Glycine soja]
Length=467

 Score =   410 bits (1055),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 233/451 (52%), Positives = 306/451 (68%), Gaps = 19/451 (4%)
 Frame = +2

Query  194   GSVYIGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPS-DK  370
             G+ +  A+ G + AD+I  LPGQP+ V F QFSGYVTV+  AGRALFY+  E+   S  K
Sbjct  20    GARFAKAEGGGEAADRILELPGQPK-VSFQQFSGYVTVNKVAGRALFYWLTEAAQNSLTK  78

Query  371   PLVLWLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFS  550
             PLV+WLNGGPGCSS   G   E GPFR+N  +  L++NK++WN VAN++FLE+PAGVGFS
Sbjct  79    PLVIWLNGGPGCSSVAYGASEEIGPFRINKTASGLYINKFSWNTVANLLFLEAPAGVGFS  138

Query  551   YSNRSSDYV-TGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILR  727
             Y+NRSSD + TGD++TA D+  F++ WLERFP YK R+L+ITGESYAGHYVPQLA+ IL 
Sbjct  139   YANRSSDLLNTGDRRTAQDSLEFVIQWLERFPRYKNRELYITGESYAGHYVPQLAKEILT  198

Query  728   NNKITNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAAS  907
              N  T    INLKGI +GNA  D    + GT  ++W+HA+ISD+T+R +++ C+F     
Sbjct  199   YNAKTKHP-INLKGIMVGNAVTDNYYDNLGTVTYWWSHAMISDQTYRQLMSTCDFHRQKE  257

Query  908   PSDTCDTFVDDA-DRSMGNIYSYNIYAPFCssgsglssssvqgssrg-------------  1045
              SD C++    A D+  GNI  YNIYAP C++  G SSS+ + + R              
Sbjct  258   -SDECESVYSYAMDQEFGNIDQYNIYAPPCNNSDGSSSSATRRTMRLPHRPHVDFRHWSG  316

Query  1046  FDPCSSDYIYVYLNTPEVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMG  1225
             +DPC+  Y  +Y N P+VQKALHAN TGIP  W +CS+ +N NW D   +VLP  +EL+ 
Sbjct  317   YDPCTEKYAEIYYNRPDVQKALHANKTGIPYRWTACSEVLNRNWNDTDVSVLPIYRELIA  376

Query  1226  SGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTI  1405
              GI VW++SGD+D  V VT T YA+ +L  S K PWYPWY K +VGG+   YE ++F T+
Sbjct  377   HGIRVWVFSGDVDSVVPVTATRYALAQLKLSTKIPWYPWYVKNQVGGWTEVYEGVTFATV  436

Query  1406  RGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
             RGAGH VP ++P  AL  F +F+EGK  PKS
Sbjct  437   RGAGHEVPLFKPRAALQLFKSFLEGKPLPKS  467



>ref|XP_010512774.1| PREDICTED: serine carboxypeptidase-like 40 isoform X1 [Camelina 
sativa]
 ref|XP_010512775.1| PREDICTED: serine carboxypeptidase-like 40 isoform X2 [Camelina 
sativa]
Length=501

 Score =   412 bits (1058),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 220/428 (51%), Positives = 283/428 (66%), Gaps = 11/428 (3%)
 Frame = +2

Query  206   IGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDK-PLVL  382
             +   + L+  D I  LPGQP  V F Q+ GYVTV+  AGR+ FYYF E+    D  PL+L
Sbjct  69    VANHEKLRKRDLIRTLPGQPP-VDFDQYGGYVTVNESAGRSFFYYFVEASKSKDSSPLLL  127

Query  383   WLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNR  562
             WLNGGPGCSS   G + E GPFRV+SD KTL+ N+YAWNN ANV+FLESPAGVGFSY+N 
Sbjct  128   WLNGGPGCSSLAYGALQELGPFRVHSDGKTLFRNRYAWNNAANVLFLESPAGVGFSYTNT  187

Query  563   SSDYVT-GDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKI  739
             +SD    GD+ TAADNYIFL+ WLERFP YK RDL+I GESYAGHYVPQLA  IL    +
Sbjct  188   TSDMEKHGDRNTAADNYIFLVKWLERFPAYKGRDLYIAGESYAGHYVPQLAHTIL----L  243

Query  740   TNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNF--SSAASPS  913
              +++ +NLKGI IGNA I++ET   G YDF+ +HALIS+++   +  NC+    SA+  +
Sbjct  244   HHRSFLNLKGILIGNAVINDETDLMGMYDFFESHALISEDSLATLKNNCDLKTESASVMT  303

Query  914   DTCDTFVDDADRSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTP  1093
             + C    D  D     +  YNIYAP C + +         + R FDPCS  Y+  YLN P
Sbjct  304   EECAVVSDQIDMDTYYLDIYNIYAPLCLNSTLTRRPKRGTTIREFDPCSDHYVQAYLNRP  363

Query  1094  EVQKALHANVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKV  1273
             EVQ ALHAN T +P  W  CS  +   W D P T++P IK LMG G+ VW++SGD+DG++
Sbjct  364   EVQAALHANATKLPYEWQPCSSVIK-KWNDSPTTMIPLIKGLMGQGVRVWVFSGDMDGRI  422

Query  1274  AVTTTTYAINKLNTSVKTPWYPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERA  1450
              VT+T Y++ K+N + KT W+PWY      G      E L+F T+RGAGH VPS+QP+R+
Sbjct  423   PVTSTKYSLKKMNLTAKTAWHPWYLGGEVGGYTEEYKEKLTFATVRGAGHQVPSFQPKRS  482

Query  1451  LTFFSAFV  1474
             L+ F  F+
Sbjct  483   LSLFIHFL  490



>ref|XP_004229673.1| PREDICTED: serine carboxypeptidase-like 40 [Solanum lycopersicum]
Length=504

 Score =   411 bits (1057),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 230/437 (53%), Positives = 290/437 (66%), Gaps = 10/437 (2%)
 Frame = +2

Query  206   IGAQDGLKDADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESE-TPSDKPLVL  382
             I  Q+ LK  D+I  LPGQP  VKF Q+ GY+T+D  AGRA +YYF E++ +    PL+L
Sbjct  71    ISNQEDLKTNDRIHKLPGQPL-VKFEQYGGYITIDEFAGRAFYYYFVEAQHSKKSLPLLL  129

Query  383   WLnggpgcssfgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNR  562
             WLNGGPGCSS   G   E GPFRVNSD KTL +N +AWN+ ANV+F+ESPAGVGFSYSN 
Sbjct  130   WLNGGPGCSSLAYGAFQELGPFRVNSDGKTLHINNFAWNHAANVLFVESPAGVGFSYSNT  189

Query  563   SSDY-VTGDKKTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKI  739
             SSD  + GD+KTA DNY+F++NWLERFPEYK RD +I GESYAGHYVPQLA  IL +NK 
Sbjct  190   SSDVKIGGDRKTANDNYLFIINWLERFPEYKDRDFYIAGESYAGHYVPQLAHTILYHNKK  249

Query  740   TNQTIINLKGIAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAAS-PSD  916
              N+ IINLKGI IGNA I++ET   G Y+++ +HALISDE    I   C F+   S  +D
Sbjct  250   ANKNIINLKGILIGNAVINDETDTRGMYEYFASHALISDEVEAEIQKQCKFTIPESEETD  309

Query  917   TCDTFVDDAD-RSMGNIYSYNIYAPFCssgsglssssvqgssrgFDPCSSDYIYVYLNTP  1093
              C      AD  +  +I  Y IYAP C   +   +S  +  S   DPCS  Y   Y+N P
Sbjct  310   ECKMAGSIADYDAHSHIDIYAIYAPLC--HNTNLTSKPKRPSLVIDPCSDYYTTAYMNRP  367

Query  1094  EVQKALHANVTGIP-GPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGK  1270
             +VQKALHANVT I    W  CS DV  NW D   T++P +KE M + I VW++SGD DG+
Sbjct  368   DVQKALHANVTNIKYSTWQPCS-DVLTNWTDSASTIIPLLKEFMANDIRVWIFSGDTDGR  426

Query  1271  VAVTTTTYAINKLNTSVKTPWYPWY-SKgevggyvvgyeDLSFVTIRGAGHFVPSYQPER  1447
             V VT+T  +I K+N  +KTPW+PW+ +    G   V   D++F T+RGAGH VP Y+P R
Sbjct  427   VPVTSTKKSIKKMNLPIKTPWHPWFLNGELGGYSQVYKGDMTFATVRGAGHQVPGYEPAR  486

Query  1448  ALTFFSAFVEGKLPPKS  1498
             AL+    F++G   P+S
Sbjct  487   ALSLIMHFLDGTDLPES  503



>ref|XP_006345395.1| PREDICTED: serine carboxypeptidase-like 40-like [Solanum tuberosum]
Length=505

 Score =   411 bits (1057),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 235/466 (50%), Positives = 301/466 (65%), Gaps = 19/466 (4%)
 Frame = +2

Query  146   RQNNNAQTIIMSAQDLGSVYIGA--------QDGLKDA-DKISALPGQPEGVKFAQFSGY  298
             ++N+N    +  A +   ++I +        Q+ LK A D+I  LPGQP  VKF Q+ GY
Sbjct  43    KKNSNIDKSLFDASNFDDLHIASNKKNVISNQEDLKKANDRIQKLPGQPL-VKFEQYGGY  101

Query  299   VTVDPQAGRALFYYFAESETPSDK-PLVLWLnggpgcssfgnggMMENGPFRVNSDSKTL  475
             +T+D  AGRA +YYF E++  +   PL+LWLNGGPGCSS   G   E GPFRVNSD KTL
Sbjct  102   ITIDESAGRAFYYYFVEAQLSNKSLPLLLWLNGGPGCSSLAYGAFQELGPFRVNSDGKTL  161

Query  476   WLNKYAWNNVANVIFLESPAGVGFSYSNRSSDY-VTGDKKTAADNYIFLLNWLERFPEYK  652
              +N +AWN+ ANV+F+ESPAGVGFSYSN SSD  + GD+KTA DNY F++NWLERFPEYK
Sbjct  162   HINNFAWNHAANVLFVESPAGVGFSYSNTSSDVKIGGDRKTANDNYRFIINWLERFPEYK  221

Query  653   TRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKGIAIGNAYIDEETQDSGTYDFY  832
              RD +I GESYAGHYVPQLA  IL +NK  N+ IINLKGI IGNA I++ET   G Y+++
Sbjct  222   DRDFYIAGESYAGHYVPQLAHTILYHNKKANKNIINLKGILIGNAVINDETDTRGMYEYF  281

Query  833   WTHALISDETHRGIIANCNFSSAAS-PSDTCDTFVDDAD-RSMGNIYSYNIYAPFCssgs  1006
              +HALISDE    I   C F+   S  SD C      AD  + G+I  Y IYAP C   +
Sbjct  282   ASHALISDEVEAEIQKQCKFTIPESEESDECKMAGSIADYDTHGHIDIYAIYAPLC--HN  339

Query  1007  glssssvqgssrgFDPCSSDYIYVYLNTPEVQKALHANVTGIP-GPWDSCSQDVNVNWED  1183
                +S  +  S   DPCS  Y   Y+N P+VQKALHANVT I    W  CS DV  NW D
Sbjct  340   TNLTSKPKRPSLVIDPCSDYYTTAYMNRPDVQKALHANVTNIKYSTWQPCS-DVLTNWTD  398

Query  1184  MPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYAINKLNTSVKTPWYPWY-SKgev  1360
                T++P +KE M + I VW++SGD DG+V VT+T  +I  +N  +KTPW+PW+ +    
Sbjct  399   SASTIIPLLKEFMANDIRVWIFSGDTDGRVPVTSTKKSIKIMNLPIKTPWHPWFLNGELG  458

Query  1361  ggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVEGKLPPKS  1498
             G   V   D++F T+RGAGH VP Y+P RAL+    F++G   P+S
Sbjct  459   GSTQVYKGDMTFATVRGAGHQVPGYEPARALSLIMHFLDGTDLPES  504



>gb|EEC69980.1| hypothetical protein OsI_00486 [Oryza sativa Indica Group]
Length=474

 Score =   410 bits (1053),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 222/433 (51%), Positives = 296/433 (68%), Gaps = 6/433 (1%)
 Frame = +2

Query  233   ADKISALPGQPEGVKFAQFSGYVTVDPQAGRALFYYFAESETPSDKPLVLWLnggpgcss  412
             AD+I+ALPGQP  V F+ +SGYVTVD  AGRALFY+  E+  P+  PLVLWLNGGPGCSS
Sbjct  42    ADRITALPGQPR-VNFSMYSGYVTVDAAAGRALFYWLIEAADPASAPLVLWLNGGPGCSS  100

Query  413   fgnggMMENGPFRVNSDSKTLWLNKYAWNNVANVIFLESPAGVGFSYSNRSSDYVT-GDK  589
              G G   E G FR+N D ++L+LN Y WN VAN++FL+SPAGVG+SYSN +SD +T GD 
Sbjct  101   VGYGASEELGAFRINPDGRSLYLNPYPWNRVANMLFLDSPAGVGYSYSNTTSDLLTAGDN  160

Query  590   KTAADNYIFLLNWLERFPEYKTRDLFITGESYAGHYVPQLAQLILRNNKITNQTIINLKG  769
             KTA D+Y FL+NWLERFP+YK RD +I GESY GHYVPQL+QL+ RNNK   + I+N KG
Sbjct  161   KTAHDSYAFLVNWLERFPQYKYRDFYIAGESYGGHYVPQLSQLVYRNNKDVEKPILNFKG  220

Query  770   IAIGNAYIDEETQDSGTYDFYWTHALISDETHRGIIANCNFSSAASPSDTCDTFVDDADR  949
               +GNA ID+     GT++++WTH LISD+T++ +   C+F S+A  S+ C+   + A+ 
Sbjct  221   FMVGNAVIDDYHDYVGTFEYWWTHGLISDDTYQKLQVACDFESSAHASEACNKIYEVAEA  280

Query  950   SMGNIYSYNIYAPFCssgsglssssvqgss----rgFDPCSSDYIYVYLNTPEVQKALHA  1117
               GNI +Y+IY P C   S L    ++G+     RG+DPC+  Y   Y N PEVQKA HA
Sbjct  281   EQGNIDAYSIYTPTCKKTSFLKRRLIRGNLPWLPRGYDPCTEKYSMKYYNLPEVQKAFHA  340

Query  1118  NVTGIPGPWDSCSQDVNVNWEDMPDTVLPTIKELMGSGISVWLYSGDIDGKVAVTTTTYA  1297
             NVTGIP  W +CS D+   W+D P ++LP  +EL+ +G+ +W++SGD D  V +T T Y+
Sbjct  341   NVTGIPYAWTTCSDDLFYYWKDSPRSMLPIYRELIAAGLRIWVFSGDADSVVPLTATRYS  400

Query  1298  INKLNTSVKTPWYPWYSKgevggyvvgyeDLSFVTIRGAGHFVPSYQPERALTFFSAFVE  1477
             I+ L     T WYPWY   EV G+   Y+ L+ VTIRGAGH VP ++P +AL  F  F++
Sbjct  401   IDALYLPTVTNWYPWYDDEEVAGWCQVYQGLTLVTIRGAGHEVPLHRPRQALKLFEHFLQ  460

Query  1478  GKLPPKSAE*LKS  1516
              K  P+    ++S
Sbjct  461   DKPMPQPLHSIQS  473



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4916045724216