BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c129956_g1_i1 len=123 path=[1:0-122]

Length=123
                                                                      Score     E

ref|WP_002473882.1|  molybdopterin biosynthesis protein MoeB          86.7    4e-19   
ref|WP_038398638.1|  molybdopterin biosynthesis protein MoeB          86.3    5e-19   
ref|WP_001832429.1|  molybdopterin biosynthesis protein MoeB          86.3    5e-19   
ref|WP_026177657.1|  molybdopterin biosynthesis protein MoeB          86.3    5e-19   
ref|WP_002438506.1|  MULTISPECIES: molybdopterin biosynthesis pro...  86.3    5e-19   
ref|WP_002498561.1|  molybdopterin biosynthesis protein MoeB          86.3    5e-19   
ref|WP_032606556.1|  molybdopterin biosynthesis protein MoeB          86.3    5e-19   
ref|WP_002467748.1|  molybdopterin biosynthesis protein MoeB          86.3    5e-19   
ref|WP_002501977.1|  molybdopterin biosynthesis protein MoeB          86.3    5e-19   
ref|WP_002494138.1|  molybdopterin biosynthesis protein MoeB          85.5    1e-18   
ref|WP_002477657.1|  hypothetical protein                             85.1    2e-18   
ref|WP_017465120.1|  molybdopterin biosynthesis protein MoeB          84.7    2e-18   
ref|WP_002457956.1|  molybdopterin biosynthesis protein MoeB          82.0    2e-17   
ref|WP_002490202.1|  molybdopterin biosynthesis protein MoeB          82.0    2e-17   
gb|KEI47936.1|  molybdopterin biosynthesis protein MoeB               82.0    2e-17   
ref|WP_002500903.1|  molybdopterin biosynthesis protein MoeB          82.0    2e-17   
ref|WP_002487102.1|  molybdopterin biosynthesis protein MoeB          82.0    2e-17   
ref|WP_002475361.1|  molybdopterin biosynthesis protein MoeB          82.0    2e-17   
ref|WP_002447307.1|  molybdopterin biosynthesis protein MoeB          82.0    2e-17   
gb|EJD87923.1|  putative thiamine/molybdopterin biosynthesis ThiF...  82.0    2e-17   
ref|WP_002453805.1|  molybdopterin biosynthesis protein MoeB          67.0    9e-12   
ref|WP_037550015.1|  molybdopterin biosynthesis protein MoeB          63.9    1e-10   
ref|WP_023351298.1|  molybdopterin biosynthesis adenylyltransferase   63.9    1e-10   
ref|WP_002432929.1|  molybdopterin biosynthesis protein MoeB          63.5    1e-10   
ref|WP_037541595.1|  molybdopterin biosynthesis protein MoeB          62.4    4e-10   
gb|EES42032.1|  ThiF family protein                                   62.4    5e-10   Staphylococcus caprae M23864:W1
ref|WP_031793145.1|  molybdopterin biosynthesis protein MoeB          60.1    6e-10   
ref|WP_031889868.1|  molybdopterin biosynthesis protein MoeB          59.7    9e-10   
ref|WP_031897320.1|  molybdopterin biosynthesis protein MoeB          60.5    1e-09   
ref|WP_031877341.1|  molybdopterin biosynthesis protein MoeB          60.8    1e-09   
ref|WP_031834735.1|  molybdopterin biosynthesis protein MoeB          60.1    1e-09   
ref|WP_001623856.1|  adenylyltransferase and sulfurtransferase        60.8    2e-09   
ref|WP_031870840.1|  molybdopterin biosynthesis protein MoeB          60.8    2e-09   
ref|WP_033862155.1|  molybdopterin biosynthesis protein MoeB          60.5    2e-09   
gb|EWQ47093.1|  adenylyltransferase and sulfurtransferase             60.5    2e-09   
gb|EUK97737.1|  adenylyltransferase and sulfurtransferase             60.1    2e-09   
ref|WP_031881218.1|  molybdopterin biosynthesis protein MoeB          60.5    2e-09   
ref|WP_031928250.1|  molybdopterin biosynthesis protein MoeB          60.5    2e-09   
ref|WP_023604930.1|  molybdopterin biosynthesis protein MoeB          60.5    2e-09   
ref|WP_031909362.1|  molybdopterin biosynthesis protein MoeB          60.5    2e-09   
ref|WP_031837248.1|  molybdopterin biosynthesis protein MoeB          60.5    2e-09   
ref|WP_000076920.1|  molybdopterin biosynthesis protein MoeB          60.5    2e-09   
ref|WP_031891340.1|  molybdopterin biosynthesis protein MoeB          60.5    2e-09   
ref|WP_017431689.1|  molybdopterin biosynthesis protein MoeB          60.5    2e-09   
ref|WP_000076930.1|  molybdopterin biosynthesis protein MoeB          60.5    2e-09   
ref|WP_031893595.1|  molybdopterin biosynthesis protein MoeB          60.1    2e-09   
ref|WP_006190880.1|  adenylyltransferase and sulfurtransferase        60.1    2e-09   
ref|WP_000076923.1|  molybdopterin biosynthesis protein MoeB          60.1    2e-09   
ref|WP_000076912.1|  molybdopterin biosynthesis protein MoeB          60.1    2e-09   
ref|WP_000076929.1|  molybdopterin biosynthesis protein MoeB          60.1    2e-09   
ref|WP_033856370.1|  molybdopterin biosynthesis protein MoeB          60.1    2e-09   
ref|WP_023914062.1|  hypothetical protein                             60.1    2e-09   
ref|WP_001657011.1|  adenylyltransferase and sulfurtransferase        60.1    2e-09   
ref|WP_000076931.1|  molybdopterin biosynthesis protein MoeB          60.1    2e-09   
ref|WP_000076919.1|  molybdopterin biosynthesis protein MoeB          60.1    2e-09   
ref|WP_014532680.1|  molybdopterin biosynthesis protein MoeB          59.7    2e-09   
gb|EHT87650.1|  moeZ/MoeB domain protein                              60.1    2e-09   
ref|WP_031912451.1|  molybdopterin biosynthesis protein MoeB          60.1    3e-09   
ref|WP_000076916.1|  molybdopterin biosynthesis protein MoeB          60.1    3e-09   
ref|WP_000076925.1|  molybdopterin biosynthesis protein MoeB          60.1    3e-09   
ref|WP_000076927.1|  molybdopterin biosynthesis protein MoeB          60.1    3e-09   
ref|WP_000076913.1|  molybdopterin biosynthesis protein MoeB          60.1    3e-09   
ref|WP_000076926.1|  molybdopterin biosynthesis protein MoeB          60.1    3e-09   
ref|WP_000076915.1|  molybdopterin biosynthesis protein MoeB          60.1    3e-09   
ref|WP_031838281.1|  molybdopterin biosynthesis protein MoeB          60.1    3e-09   
ref|WP_000076917.1|  molybdopterin biosynthesis protein MoeB          60.1    3e-09   
ref|WP_000076924.1|  molybdopterin biosynthesis protein MoeB          60.1    3e-09   
ref|WP_000076928.1|  molybdopterin biosynthesis protein MoeB          60.1    3e-09   
ref|WP_031385318.1|  molybdopterin biosynthesis protein MoeB          60.1    3e-09   
ref|WP_031869558.1|  molybdopterin biosynthesis protein MoeB          60.1    3e-09   
ref|WP_031845249.1|  molybdopterin biosynthesis protein MoeB          58.2    3e-09   
ref|WP_000076914.1|  molybdopterin biosynthesis protein MoeB          60.1    3e-09   
ref|WP_000076922.1|  molybdopterin biosynthesis protein MoeB          60.1    3e-09   
ref|WP_031884683.1|  molybdopterin biosynthesis protein MoeB          57.0    3e-09   
gb|EFE26717.1|  molybdopterin biosynthesis protein MoeB               57.8    7e-09   
ref|WP_000076921.1|  molybdopterin biosynthesis protein MoeB          58.2    1e-08   
ref|WP_000076918.1|  molybdopterin biosynthesis protein MoeB          58.2    1e-08   
emb|CDR51275.1|  putative molybdopterin synthase sulfurylase          57.8    2e-08   
emb|CDR61909.1|  putative molybdopterin synthase sulfurylase          57.8    2e-08   
emb|CDR25605.1|  putative molybdopterin synthase sulfurylase          57.8    2e-08   
emb|CDR66989.1|  putative molybdopterin synthase sulfurylase          57.8    2e-08   
emb|CDR59100.1|  putative molybdopterin synthase sulfurylase          57.4    2e-08   
ref|WP_000085834.1|  molybdopterin biosynthesis protein MoeB          57.4    2e-08   
ref|WP_031787095.1|  molybdopterin biosynthesis protein MoeB          57.4    2e-08   
ref|WP_031871988.1|  molybdopterin biosynthesis protein MoeB          57.0    3e-08   
gb|EUR19944.1|  adenylyltransferase and sulfurtransferase             57.0    3e-08   
ref|WP_037535968.1|  molybdopterin biosynthesis protein MoeB          56.6    4e-08   
ref|WP_011275099.1|  MULTISPECIES: molybdopterin biosynthesis pro...  56.6    4e-08   
ref|WP_037549816.1|  molybdopterin biosynthesis protein MoeB          56.6    4e-08   
ref|WP_029055848.1|  molybdopterin biosynthesis protein MoeB          55.8    9e-08   
ref|WP_002461823.1|  molybdopterin biosynthesis protein MoeB          55.5    1e-07   
gb|EUK97870.1|  hypothetical protein O505_02772                       52.0    1e-07   
ref|WP_002479604.1|  hypothetical protein                             53.9    4e-07   
ref|WP_026083547.1|  molybdopterin biosynthesis protein MoeB          53.9    5e-07   
ref|WP_002465417.1|  molybdopterin biosynthesis protein MoeB          53.1    7e-07   
ref|WP_023373649.1|  molybdopterin biosynthesis protein MoeB          53.1    7e-07   
ref|WP_002450299.1|  molybdopterin biosynthesis protein MoeB          52.4    1e-06   
ref|WP_037567062.1|  molybdopterin biosynthesis protein MoeB          52.4    2e-06   
ref|WP_019468093.1|  molybdopterin biosynthesis protein MoeB          52.0    2e-06   
ref|WP_015901006.1|  molybdopterin biosynthesis protein MoeB          51.2    4e-06   
ref|WP_002460097.1|  molybdopterin biosynthesis protein MoeB          50.8    5e-06   
ref|WP_002492280.1|  molybdopterin biosynthesis protein MoeB          50.8    6e-06   
ref|WP_037545112.1|  molybdopterin biosynthesis protein MoeB          50.4    7e-06   
ref|WP_002478814.1|  molybdopterin biosynthesis protein MoeB          48.9    2e-05   
ref|WP_039647528.1|  molybdopterin biosynthesis protein MoeB          48.9    2e-05   
gb|AJC95410.1|  molybdopterin biosynthesis protein MoeB               48.9    3e-05   
ref|WP_019835261.1|  molybdopterin biosynthesis protein MoeB          48.9    3e-05   
ref|WP_017174868.1|  MULTISPECIES: molybdopterin biosynthesis pro...  48.9    3e-05   
gb|KDP12739.1|  Molybdopterin biosynthesis protein MoeB               48.5    4e-05   
ref|WP_002471317.1|  molybdopterin biosynthesis protein MoeB          48.1    4e-05   
ref|WP_037574840.1|  molybdopterin biosynthesis protein MoeB          48.1    4e-05   
ref|WP_002454995.1|  molybdopterin biosynthesis protein MoeB          48.1    6e-05   
ref|WP_002448508.1|  molybdopterin biosynthesis protein MoeB          48.1    6e-05   
ref|WP_002506940.1|  MULTISPECIES: molybdopterin biosynthesis pro...  47.8    6e-05   
ref|WP_009382828.1|  putative molybdopterin biosynthesis protein ...  47.4    9e-05   
ref|WP_002509301.1|  MULTISPECIES: molybdopterin biosynthesis pro...  46.2    2e-04   
ref|WP_021338414.1|  molybdopterin biosynthesis protein MoeB          45.8    3e-04   
ref|WP_026067065.1|  molybdopterin biosynthesis protein MoeB          45.4    4e-04   
ref|WP_016911490.1|  hypothetical protein                             44.3    0.001   



>ref|WP_002473882.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis]
 gb|EHM68450.1| ThiF family protein [Staphylococcus epidermidis VCU071]
Length=333

 Score = 86.7 bits (213),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE
Sbjct  281  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  320



>ref|WP_038398638.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis]
 gb|AIR82175.1| thiF family protein [Staphylococcus epidermidis]
Length=333

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE
Sbjct  281  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  320



>ref|WP_001832429.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis]
 gb|EGG71713.1| ThiF family protein [Staphylococcus epidermidis VCU028]
 gb|EHQ78980.1| ThiF family protein [Staphylococcus epidermidis VCU081]
 gb|EID34692.1| ThiF family protein [Staphylococcus epidermidis IS-250]
 gb|EID36848.1| ThiF family protein [Staphylococcus epidermidis IS-K]
Length=333

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE
Sbjct  281  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  320



>ref|WP_026177657.1| molybdopterin biosynthesis protein MoeB [Staphylococcus sp. JGI 
0001002-I23]
Length=334

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE
Sbjct  282  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  321



>ref|WP_002438506.1| MULTISPECIES: molybdopterin biosynthesis protein MoeB [Staphylococcus]
 ref|NP_765404.1| molybdopterin biosynthesis protein moeB [Staphylococcus epidermidis 
ATCC 12228]
 ref|YP_189420.1| molybdopterin biosynthesis MoeB protein [Staphylococcus epidermidis 
RP62A]
 gb|AAO05490.1|AE016750_95 molybdopterin biosynthesis protein moeB [Staphylococcus epidermidis 
ATCC 12228]
 gb|AAW55218.1| molybdopterin biosynthesis MoeB protein, putative [Staphylococcus 
epidermidis RP62A]
 gb|EES57128.1| ThiF family protein [Staphylococcus epidermidis BCM-HMP0060]
 gb|EFA88602.1| ThiF family protein [Staphylococcus epidermidis SK135]
 gb|EFE57902.1| ThiF family protein [Staphylococcus epidermidis M23864:W2(grey)]
 gb|EGG73233.1| ThiF family protein [Staphylococcus epidermidis VCU045]
 gb|EGS75618.1| ThiF family protein [Staphylococcus epidermidis VCU105]
 gb|EGS79958.1| ThiF family protein [Staphylococcus epidermidis VCU037]
 gb|EGS80108.1| ThiF family protein [Staphylococcus epidermidis VCU109]
 gb|EHQ72090.1| ThiF family protein [Staphylococcus epidermidis VCU041]
 gb|EHQ74158.1| ThiF family protein [Staphylococcus epidermidis VCU057]
 gb|EHR81729.1| ThiF family protein [Staphylococcus epidermidis VCU117]
 gb|EHR81838.1| ThiF family protein [Staphylococcus epidermidis VCU120]
 gb|EHR89535.1| ThiF family protein [Staphylococcus epidermidis VCU123]
 gb|EHR93027.1| ThiF family protein [Staphylococcus epidermidis VCU125]
 gb|EHR97358.1| ThiF family protein [Staphylococcus epidermidis VCU126]
 gb|EHS00111.1| ThiF family protein [Staphylococcus epidermidis VCU127]
 gb|EJD85245.1| putative thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein 
[Staphylococcus epidermidis NIHLM070]
 gb|EJD93975.1| putative thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein 
[Staphylococcus epidermidis NIHLM049]
 gb|EJD99869.1| putative thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein 
[Staphylococcus epidermidis NIHLM039]
 gb|EJE08853.1| putative thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein 
[Staphylococcus epidermidis NIHLM021]
 gb|EJE21754.1| putative thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein 
[Staphylococcus epidermidis NIHLM003]
 gb|EJE27315.1| putative thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein 
[Staphylococcus epidermidis NIH05005]
 gb|EJE28806.1| putative thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein 
[Staphylococcus epidermidis NIH04008]
 gb|EJE31387.1| ThiF family protein [Staphylococcus epidermidis NIH08001]
 gb|EJE34682.1| putative thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein 
[Staphylococcus epidermidis NIH05001]
 gb|EJE40429.1| ThiF family protein [Staphylococcus epidermidis NIH06004]
 gb|EJE42053.1| ThiF family protein [Staphylococcus epidermidis NIH04003]
 gb|EJE44662.1| ThiF family protein [Staphylococcus epidermidis NIH051668]
 gb|EJE46970.1| ThiF family protein [Staphylococcus epidermidis NIH051475]
 gb|EKC82818.1| molybdopterin biosynthesis MoeB protein [Staphylococcus epidermidis 
AU12-03]
 gb|ENL47706.1| adenylyltransferase and sulfurtransferase [Staphylococcus epidermidis 
M0881]
 gb|EON80274.1| molybdopterin biosynthesis MoeB protein [Staphylococcus epidermidis 
41tr]
 gb|EON80699.1| molybdopterin biosynthesis MoeB protein [Staphylococcus epidermidis 
528m]
 gb|EON86908.1| molybdopterin biosynthesis MoeB protein [Staphylococcus epidermidis 
36-1]
 gb|ETJ13226.1| Molybdopterin biosynthesis protein MoeB [Staphylococcus sp. DORA_6_22]
 gb|EUR97979.1| adenylyltransferase and sulfurtransferase [Staphylococcus epidermidis 
M0026]
 gb|EZI05722.1| ThiF family protein [Staphylococcus epidermidis VCU014]
 gb|EZI10517.1| ThiF family protein [Staphylococcus epidermidis VCU050]
 gb|KDP67191.1| ThiF family protein [Staphylococcus epidermidis VCU013]
 gb|KDP67954.1| ThiF family protein [Staphylococcus epidermidis VCU111]
 gb|KEA32869.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis]
 gb|KEA38759.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis]
 gb|KGJ23913.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis]
Length=333

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE
Sbjct  281  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  320



>ref|WP_002498561.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis]
 gb|EJD98186.1| putative thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein 
[Staphylococcus epidermidis NIHLM040]
Length=333

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE
Sbjct  281  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  320



>ref|WP_032606556.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis]
 gb|KEA34697.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis]
Length=333

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE
Sbjct  281  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  320



>ref|WP_002467748.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis]
 gb|EGG67575.1| ThiF family protein [Staphylococcus epidermidis VCU144]
 gb|EHQ74653.1| ThiF family protein [Staphylococcus epidermidis VCU065]
 gb|EJD79298.1| putative thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein 
[Staphylococcus epidermidis NIHLM088]
 gb|EJD85288.1| putative thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein 
[Staphylococcus epidermidis NIHLM067]
 gb|EJE08959.1| putative thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein 
[Staphylococcus epidermidis NIHLM020]
 gb|EJE20019.1| putative thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein 
[Staphylococcus epidermidis NIHLM008]
 gb|EJE22750.1| putative thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein 
[Staphylococcus epidermidis NIHLM001]
 gb|EJE38574.1| ThiF family protein [Staphylococcus epidermidis NIH05003]
 gb|EPZ41994.1| ThiF family protein [Staphylococcus epidermidis E13A]
 gb|EST93274.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis 
Scl31]
 gb|EST99784.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis 
Scl25]
 gb|KDP67343.1| ThiF family protein [Staphylococcus epidermidis VCU036]
 emb|CDM14398.1| Molybdopterin biosynthesis MoeB protein [Staphylococcus epidermidis 
PM221]
 gb|KGY37091.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis]
Length=333

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE
Sbjct  281  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  320



>ref|WP_002501977.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis]
 gb|EJE12608.1| putative thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein 
[Staphylococcus epidermidis NIHLM018]
Length=333

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE
Sbjct  281  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  320



>ref|WP_002494138.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis]
 gb|EJD77504.1| putative thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein 
[Staphylococcus epidermidis NIHLM095]
 gb|EJD77685.1| putative thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein 
[Staphylococcus epidermidis NIHLM087]
Length=333

 Score = 85.5 bits (210),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FLERNHIQYRTNLYMTMF+FREHRIVAFSGGRFLIHGTTE
Sbjct  281  FLERNHIQYRTNLYMTMFKFREHRIVAFSGGRFLIHGTTE  320



>ref|WP_002477657.1| hypothetical protein [Staphylococcus epidermidis]
 gb|EKS27184.1| hypothetical protein HMPREF9281_02093 [Staphylococcus epidermidis 
BVS058A4]
Length=333

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FLE+NHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE
Sbjct  281  FLEQNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  320



>ref|WP_017465120.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis]
Length=333

 Score = 84.7 bits (208),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FLERNHIQYRTNLYMTMFRFREHRIVA SGGRFLIHGTTE
Sbjct  281  FLERNHIQYRTNLYMTMFRFREHRIVALSGGRFLIHGTTE  320



>ref|WP_002457956.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis]
 gb|EFV88870.1| moeZ/MoeB domain protein [Staphylococcus epidermidis FRI909]
 gb|EJD92219.1| putative thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein 
[Staphylococcus epidermidis NIHLM053]
 gb|EJD97128.1| putative thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein 
[Staphylococcus epidermidis NIHLM057]
 gb|EPP69290.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis 
Scl22]
 gb|ESR05877.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis 
CIM28]
 gb|ESR22130.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis 
APO35]
 gb|ESU03399.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis 
CIM37]
 gb|ESV10228.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis 
MC28]
 gb|ESV15359.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis 
WI05]
 gb|ESV20474.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis 
WI09]
 gb|ESV24026.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis 
CIM40]
 gb|ESV29438.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis 
APO27]
 gb|ESV38349.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis 
MC16]
 gb|ESV42052.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis 
MC19]
 gb|ESV47608.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis 
Scl19]
Length=333

 Score = 82.0 bits (201),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FLERNHIQ+RTNLYMTMFRFRE+RIVAFSGGRFLIHGTTE
Sbjct  281  FLERNHIQHRTNLYMTMFRFREYRIVAFSGGRFLIHGTTE  320



>ref|WP_002490202.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis]
 gb|EHR99529.1| ThiF family protein [Staphylococcus epidermidis VCU128]
Length=333

 Score = 82.0 bits (201),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FLERNHIQ+RTNLYMTMFRFRE+RIVAFSGGRFLIHGTTE
Sbjct  281  FLERNHIQHRTNLYMTMFRFREYRIVAFSGGRFLIHGTTE  320



>gb|KEI47936.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis 
UC7032]
Length=334

 Score = 82.0 bits (201),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FLERNHIQ+RTNLYMTMFRFRE+RIVAFSGGRFLIHGTTE
Sbjct  282  FLERNHIQHRTNLYMTMFRFREYRIVAFSGGRFLIHGTTE  321



>ref|WP_002500903.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis]
 gb|EJE16856.1| putative thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein 
[Staphylococcus epidermidis NIHLM031]
Length=333

 Score = 82.0 bits (201),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FLERNHIQ+RTNLYMTMFRFRE+RIVAFSGGRFLIHGTTE
Sbjct  281  FLERNHIQHRTNLYMTMFRFREYRIVAFSGGRFLIHGTTE  320



>ref|WP_002487102.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis]
 gb|EHR82927.1| ThiF family protein [Staphylococcus epidermidis VCU118]
 gb|EHS00663.1| ThiF family protein [Staphylococcus epidermidis VCU129]
 gb|EJE02835.1| putative thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein 
[Staphylococcus epidermidis NIHLM037]
 gb|EJE15691.1| putative thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein 
[Staphylococcus epidermidis NIHLM015]
Length=333

 Score = 82.0 bits (201),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FLERNHIQ+RTNLYMTMFRFRE+RIVAFSGGRFLIHGTTE
Sbjct  281  FLERNHIQHRTNLYMTMFRFREYRIVAFSGGRFLIHGTTE  320



>ref|WP_002475361.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis]
 gb|EHM73202.1| ThiF family protein [Staphylococcus epidermidis 14.1.R1.SE]
Length=333

 Score = 82.0 bits (201),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FLERNHIQ+RTNLYMTMFRFRE+RIVAFSGGRFLIHGTTE
Sbjct  281  FLERNHIQHRTNLYMTMFRFREYRIVAFSGGRFLIHGTTE  320



>ref|WP_002447307.1| molybdopterin biosynthesis protein MoeB [Staphylococcus epidermidis]
 gb|EES34868.1| ThiF family protein [Staphylococcus epidermidis W23144]
 gb|EJE11197.1| putative thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein 
[Staphylococcus epidermidis NIHLM023]
Length=333

 Score = 82.0 bits (201),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FLERNHIQ+RTNLYMTMFRFRE+RIVAFSGGRFLIHGTTE
Sbjct  281  FLERNHIQHRTNLYMTMFRFREYRIVAFSGGRFLIHGTTE  320



>gb|EJD87923.1| putative thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein 
[Staphylococcus epidermidis NIHLM061]
Length=334

 Score = 82.0 bits (201),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FLERNHIQ+RTNLYMTMFRFRE+RIVAFSGGRFLIHGTTE
Sbjct  282  FLERNHIQHRTNLYMTMFRFREYRIVAFSGGRFLIHGTTE  321



>ref|WP_002453805.1| molybdopterin biosynthesis protein MoeB [Staphylococcus capitis]
 gb|EFS16016.1| putative molybdopterin biosynthesis MoeB protein [Staphylococcus 
capitis C87]
Length=334

 Score = 67.0 bits (162),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FLE++HI YRTNLYMT+F+FR HRIVAF+GGRFLIH  T+
Sbjct  282  FLEQHHIHYRTNLYMTIFKFRGHRIVAFNGGRFLIHNMTQ  321



>ref|WP_037550015.1| molybdopterin biosynthesis protein MoeB [Staphylococcus sp. TE8]
 gb|KDE94740.1| molybdopterin biosynthesis protein MoeB [Staphylococcus sp. TE8]
Length=334

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FLE++HI YRTN YMT+F+FR HRIVAF+GGRFLIH  T+
Sbjct  282  FLEQHHIHYRTNHYMTIFKFRGHRIVAFNGGRFLIHNMTQ  321



>ref|WP_023351298.1| molybdopterin biosynthesis adenylyltransferase [Staphylococcus 
capitis]
 emb|CDI73333.1| molybdopterin biosynthesis adenylyltransferase [Staphylococcus 
capitis CR01]
Length=334

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FLE++HI YRTN YMT+F+FR HRIVAF+GGRFLIH  T+
Sbjct  282  FLEQHHIHYRTNHYMTIFKFRGHRIVAFNGGRFLIHNMTQ  321



>ref|WP_002432929.1| molybdopterin biosynthesis protein MoeB [Staphylococcus capitis]
 gb|EEE50419.1| ThiF family protein [Staphylococcus capitis SK14]
 gb|EGS40640.1| ThiF family protein [Staphylococcus capitis VCU116]
Length=334

 Score = 63.5 bits (153),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FLE++HI YRTN YMT+F+FR HRIVAF+GGRFLIH  T+
Sbjct  282  FLEQHHIHYRTNHYMTIFKFRGHRIVAFNGGRFLIHNMTQ  321



>ref|WP_037541595.1| molybdopterin biosynthesis protein MoeB [Staphylococcus caprae]
Length=334

 Score = 62.4 bits (150),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FLE+N I YRTN YMT+F+FR HRIVAF+GGRFLIH  T
Sbjct  282  FLEQNQIHYRTNNYMTIFKFRGHRIVAFNGGRFLIHEMT  320



>gb|EES42032.1| ThiF family protein [Staphylococcus caprae M23864:W1]
Length=345

 Score = 62.4 bits (150),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FLE+N I YRTN YMT+F+FR HRIVAF+GGRFLIH  T
Sbjct  293  FLEQNQIHYRTNNYMTIFKFRGHRIVAFNGGRFLIHEMT  331



>ref|WP_031793145.1| molybdopterin biosynthesis protein MoeB, partial [Staphylococcus 
aureus]
 gb|EUW79481.1| hypothetical protein O432_02486, partial [Staphylococcus aureus 
M0301]
Length=177

 Score = 60.1 bits (144),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  125  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  163



>ref|WP_031889868.1| molybdopterin biosynthesis protein MoeB, partial [Staphylococcus 
aureus]
 gb|EVS41330.1| hypothetical protein Q528_01804, partial [Staphylococcus aureus 
M1361]
Length=181

 Score = 59.7 bits (143),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  129  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  167



>ref|WP_031897320.1| molybdopterin biosynthesis protein MoeB, partial [Staphylococcus 
aureus]
 gb|EYJ06631.1| adenylyltransferase and sulfurtransferase, partial [Staphylococcus 
aureus M32567]
Length=287

 Score = 60.5 bits (145),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  235  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  273



>ref|WP_031877341.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
Length=325

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  273  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  311



>ref|WP_031834735.1| molybdopterin biosynthesis protein MoeB, partial [Staphylococcus 
aureus]
Length=275

 Score = 60.1 bits (144),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  223  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  261



>ref|WP_001623856.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus]
 gb|ENM84000.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1322]
Length=334

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_031870840.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|EUF28184.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0716]
 gb|EUF77813.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0688]
Length=343

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_033862155.1| molybdopterin biosynthesis protein MoeB, partial [Staphylococcus 
aureus]
 gb|EVU89460.1| adenylyltransferase and sulfurtransferase, partial [Staphylococcus 
aureus M13316]
Length=323

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  271  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  309



>gb|EWQ47093.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1162]
Length=302

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  250  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  288



>gb|EUK97737.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0410]
Length=275

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  223  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  261



>ref|WP_031881218.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|EWV03280.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F50121]
Length=334

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_031928250.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|EZI00639.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21314]
Length=334

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_023604930.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
Length=334

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_031909362.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|EVW92648.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T62848]
Length=334

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_031837248.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|EUG68219.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0343]
 gb|EUZ86881.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0490]
Length=334

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_000076920.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 ref|YP_044278.1| molybdopterin synthase sulfurylase [Staphylococcus aureus subsp. 
aureus MSSA476]
 emb|CAG43977.1| putative molybdopterin synthase sulfurylase [Staphylococcus aureus 
subsp. aureus MSSA476]
Length=334

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_031891340.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|EUO67040.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1385]
 gb|EUO72649.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1384]
Length=334

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_017431689.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|AID40966.1| Molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
Length=334

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_000076930.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 ref|NP_372800.1| molybdopterin biosynthesis protein [Staphylococcus aureus subsp. 
aureus Mu50]
 ref|NP_375389.1| molybdopterin biosynthesis protein moeB [Staphylococcus aureus 
subsp. aureus N315]
 ref|YP_001247657.1| UBA/THIF-type NAD/FAD binding protein [Staphylococcus aureus 
subsp. aureus JH9]
 ref|YP_001317455.1| UBA/THIF-type NAD/FAD binding protein [Staphylococcus aureus 
subsp. aureus JH1]
 ref|YP_001442850.1| molybdopterin biosynthesis protein [Staphylococcus aureus subsp. 
aureus Mu3]
 ref|YP_003283176.1| molybdopterin biosynthesis protein [Staphylococcus aureus subsp. 
aureus ED98]
 ref|YP_005750816.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
ECT-R 2]
 ref|YP_005742963.1| Molybdopterin biosynthesis MoeB protein [Staphylococcus aureus 
04-02981]
 ref|YP_007578231.1| Molybdopterin biosynthesis protein [Staphylococcus aureus subsp. 
aureus ST228]
 ref|YP_007580239.1| Molybdopterin biosynthesis protein [Staphylococcus aureus subsp. 
aureus ST228]
 ref|YP_007582204.1| Molybdopterin biosynthesis protein [Staphylococcus aureus subsp. 
aureus ST228]
 ref|YP_007584218.1| Molybdopterin biosynthesis protein [Staphylococcus aureus subsp. 
aureus ST228]
 ref|YP_007586186.1| Molybdopterin biosynthesis protein [Staphylococcus aureus subsp. 
aureus ST228]
 ref|YP_007619947.1| Molybdopterin biosynthesis protein [Staphylococcus aureus subsp. 
aureus ST228]
 ref|YP_007621932.1| Molybdopterin biosynthesis protein [Staphylococcus aureus subsp. 
aureus ST228]
 ref|YP_007623921.1| Molybdopterin biosynthesis protein [Staphylococcus aureus subsp. 
aureus ST228]
 dbj|BAB43368.1| molybdopterin biosynthesis protein moeB [Staphylococcus aureus 
subsp. aureus N315]
 dbj|BAB58438.1| molybdopterin biosynthesis protein [Staphylococcus aureus subsp. 
aureus Mu50]
 gb|ABQ50081.1| UBA/THIF-type NAD/FAD binding protein [Staphylococcus aureus 
subsp. aureus JH9]
 gb|ABR53168.1| UBA/THIF-type NAD/FAD binding protein [Staphylococcus aureus 
subsp. aureus JH1]
 dbj|BAF79143.1| molybdopterin biosynthesis protein [Staphylococcus aureus subsp. 
aureus Mu3]
 gb|EEV26932.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
A9781]
 gb|EEV64920.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
A9763]
 gb|EEV66243.1| molybdopterin biosynthesis protein [Staphylococcus aureus A9719]
 gb|EEV71543.1| molybdopterin biosynthesis protein [Staphylococcus aureus A9299]
 gb|EEV75734.1| molybdopterin biosynthesis protein moeB [Staphylococcus aureus 
A8115]
 gb|EEV77638.1| molybdopterin biosynthesis protein moeB [Staphylococcus aureus 
A6300]
 gb|EEV79261.1| molybdopterin biosynthesis protein moeB [Staphylococcus aureus 
A6224]
 gb|EEV85346.1| molybdopterin biosynthesis protein moeB [Staphylococcus aureus 
A5937]
 gb|ACY12170.1| molybdopterin biosynthesis protein [Staphylococcus aureus subsp. 
aureus ED98]
 gb|EFB96347.1| molybdopterin biosynthesis protein moeB [Staphylococcus aureus 
A10102]
 gb|EFC03901.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
A8117]
 gb|ADC38425.1| Molybdopterin biosynthesis MoeB protein [Staphylococcus aureus 
04-02981]
 gb|EFG45920.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
A8819]
 gb|EFH38038.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
A8796]
 emb|CBX35466.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
ECT-R 2]
 gb|EFT85630.1| molybdopterin biosynthesis protein [Staphylococcus aureus subsp. 
aureus CGS03]
 gb|EGG60192.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21172]
 gb|EGL94416.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21318]
 gb|EGS96305.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21201]
 gb|EHO96819.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21272]
 gb|EHS09266.1| ThiF family protein [Staphylococcus aureus subsp. aureus IS-3]
 gb|EHS12322.1| ThiF family protein [Staphylococcus aureus subsp. aureus IS-99]
 gb|EHS28128.1| ThiF family protein [Staphylococcus aureus subsp. aureus IS-122]
 gb|EHT23147.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
CIG1165]
 gb|EHT25234.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
CIG1057]
 gb|EHT42318.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
CIG1769]
 gb|EHT42890.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
CIG1750]
 gb|EHT50044.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
CIG1096]
 gb|EHT52924.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
CIG1150]
 gb|EHT53680.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
CIG1213]
 gb|EHT82781.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
CIGC340D]
 gb|EHT92406.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
CIGC348]
 gb|EID40068.1| ThiF family protein [Staphylococcus aureus subsp. aureus IS-M]
 gb|EIK04029.1| hypothetical protein MQC_00338 [Staphylococcus aureus subsp. 
aureus VRS2]
 gb|EIK04513.1| hypothetical protein MQE_00707 [Staphylococcus aureus subsp. 
aureus VRS3a]
 gb|EIK04704.1| hypothetical protein MQA_01287 [Staphylococcus aureus subsp. 
aureus VRS1]
 gb|EIK11013.1| hypothetical protein MQG_00010 [Staphylococcus aureus subsp. 
aureus VRS4]
 gb|EIK12691.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus VRS5]
 gb|EIK15272.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus VRS6]
 gb|EIK20299.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus VRS8]
 gb|EIK21251.1| hypothetical protein MQM_00107 [Staphylococcus aureus subsp. 
aureus VRS7]
 gb|EIK21575.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus VRS9]
 gb|EIK28817.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus VRS10]
 gb|EIK29381.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus VRS11a]
 gb|EIK30560.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus VRS11b]
 gb|EJU82650.1| ThiF family protein [Staphylococcus aureus subsp. aureus CM05]
 emb|CCJ11589.1| Molybdopterin biosynthesis protein [Staphylococcus aureus subsp. 
aureus ST228]
 emb|CCJ13554.1| Molybdopterin biosynthesis protein [Staphylococcus aureus subsp. 
aureus ST228]
 emb|CCJ15518.1| Molybdopterin biosynthesis protein [Staphylococcus aureus subsp. 
aureus ST228]
 emb|CCJ27309.1| Molybdopterin biosynthesis protein [Staphylococcus aureus subsp. 
aureus ST228]
 emb|CCJ19446.1| Molybdopterin biosynthesis protein [Staphylococcus aureus subsp. 
aureus ST228]
 emb|CCJ21410.1| Molybdopterin biosynthesis protein [Staphylococcus aureus subsp. 
aureus ST228]
 emb|CCJ23378.1| Molybdopterin biosynthesis protein [Staphylococcus aureus subsp. 
aureus ST228]
 emb|CCJ25344.1| Molybdopterin biosynthesis protein [Staphylococcus aureus subsp. 
aureus ST228]
 gb|ELS65828.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21236]
 gb|EMY94199.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0075]
 gb|EMY97220.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1060]
 gb|EMY99043.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0294]
 gb|EMZ00385.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1078]
 gb|EMZ03517.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1193]
 gb|EMZ09066.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1407]
 gb|EMZ09725.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1466]
 gb|ENI14356.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
B40723]
 gb|ENI15035.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
B40950]
 gb|ENI16640.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
B147830]
 gb|ENI22770.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
B53639]
 gb|ENI54702.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0029]
 gb|ENI56751.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0001]
 gb|ENI58652.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0006]
 gb|ENI60752.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0035]
 gb|ENI65243.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0045]
 gb|ENI71464.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0060]
 gb|ENI73007.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0066]
 gb|ENI73858.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0102]
 gb|ENI79630.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0077]
 gb|ENI81176.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0103]
 gb|ENI82766.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0108]
 gb|ENI86265.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0104]
 gb|ENI88545.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0144]
 gb|ENI89864.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0154]
 gb|ENI94140.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0150]
 gb|ENI97463.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0171]
 gb|ENI98557.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0177]
 gb|ENJ00519.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0173]
 gb|ENJ02488.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0192]
 gb|ENJ06812.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0200]
 gb|ENJ09325.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0210]
 gb|ENJ11401.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0197]
 gb|ENJ14208.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0212]
 gb|ENJ17951.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0216]
 gb|ENJ21046.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0213]
 gb|ENJ23735.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0237]
 gb|ENJ29308.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0235]
 gb|ENJ30740.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0240]
 gb|ENJ34052.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0250]
 gb|ENJ38284.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0252]
 gb|ENJ42054.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0279]
 gb|ENJ46633.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0273]
 gb|ENJ46946.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0270]
 gb|ENJ49522.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0306]
 gb|ENJ50104.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0288]
 gb|ENJ51146.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0280]
 gb|ENJ56374.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0326]
 gb|ENJ61910.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0328]
 gb|ENJ64260.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0329]
 gb|ENJ69481.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0330]
 gb|ENJ71424.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0347]
 gb|ENJ77993.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0334]
 gb|ENJ78419.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0351]
 gb|ENJ82828.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0363]
 gb|ENJ86086.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0364]
 gb|ENJ86248.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0350]
 gb|ENJ91682.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0367]
 gb|ENJ92581.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0374]
 gb|ENJ98533.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0375]
 gb|ENK00403.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0391]
 gb|ENK01662.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0404]
 gb|ENK11515.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0415]
 gb|ENK14091.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0427]
 gb|ENK15541.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0438]
 gb|ENK16938.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0450]
 gb|ENK19495.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0455]
 gb|ENK23988.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0460]
 gb|ENK25631.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0467]
 gb|ENK30465.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0478]
 gb|ENK33949.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0489]
 gb|ENK37515.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0493]
 gb|ENK38941.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0494]
 gb|ENK40752.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0510]
 gb|ENK46525.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0528]
 gb|ENK52902.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0529]
 gb|ENK54770.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0536]
 gb|ENK62495.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0539]
 gb|ENK63156.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0562]
 gb|ENK64298.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0547]
 gb|ENK65739.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0565]
 gb|ENK70684.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0571]
 gb|ENK73685.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0580]
 gb|ENK74011.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0584]
 gb|ENK80038.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0622]
 gb|ENK80410.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0602]
 gb|ENK81970.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0586]
 gb|ENK86315.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0628]
 gb|ENK91634.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0646]
 gb|ENK97560.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0663]
 gb|ENK97875.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0648]
 gb|ENK99504.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0673]
 gb|ENL01953.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0660]
 gb|ENL04834.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0676]
 gb|ENL05157.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0687]
 gb|ENL11464.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0695]
 gb|ENL13138.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0692]
 gb|ENL16246.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0769]
 gb|ENL20502.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0719]
 gb|ENL22396.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0792]
 gb|ENL23006.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0780]
 gb|ENL24971.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0770]
 gb|ENL29522.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0822]
 gb|ENL32096.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0823]
 gb|ENL34600.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0799]
 gb|ENL39795.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0844]
 gb|ENL43406.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0871]
 gb|ENL48647.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0892]
 gb|ENL52934.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0900]
 gb|ENL54546.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0927]
 gb|ENL59500.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0953]
 gb|ENL61890.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0964]
 gb|ENL63642.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0934]
 gb|ENL66683.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0978]
 gb|ENL68608.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0994]
 gb|ENL71189.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0998]
 gb|ENL74512.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0999]
 gb|ENL79756.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1010]
 gb|ENL81095.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1015]
 gb|ENL83994.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1016]
 gb|ENL89330.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1037]
 gb|ENL90461.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1036]
 gb|ENL96332.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1044]
 gb|ENL96946.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1062]
 gb|ENM03004.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1061]
 gb|ENM04849.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1068]
 gb|ENM11301.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1076]
 gb|ENM12042.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1063]
 gb|ENM14703.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1083]
 gb|ENM17726.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1093]
 gb|ENM22263.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1092]
 gb|ENM23168.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1095]
 gb|ENM28244.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1103]
 gb|ENM31020.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1109]
 gb|ENM32064.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1126]
 gb|ENM34975.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1142]
 gb|ENM38825.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1167]
 gb|ENM40197.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1119]
 gb|ENM44449.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1188]
 gb|ENM44835.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1170]
 gb|ENM49301.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1224]
 gb|ENM52212.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1229]
 gb|ENM53809.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1244]
 gb|ENM58379.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1257]
 gb|ENM65522.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1275]
 gb|ENM66521.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1286]
 gb|ENM67194.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1277]
 gb|ENM71710.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1291]
 gb|ENM72612.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1309]
 gb|ENM79545.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1320]
 gb|ENM80593.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1321]
 gb|ENM88131.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1367]
 gb|ENM92006.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1359]
 gb|ENM93476.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1374]
 gb|ENM99643.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1373]
 gb|ENN00068.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1394]
 gb|ENN01110.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1450]
 gb|ENN02085.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1405]
 gb|ENN02773.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1451]
 gb|ENN08788.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1463]
 gb|ENN11196.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1481]
 gb|ENN16505.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1510]
 gb|ENN18854.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1521]
 gb|ENN22386.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1520]
 gb|ENN25315.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1531]
 gb|ENN26511.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1533]
 gb|ENN26885.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1544]
 gb|ENN32015.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1556]
 gb|ENN33114.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1563]
 gb|ENN39411.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1578]
 gb|ENN40684.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1565]
 gb|ENN43876.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0943]
 gb|ENN44674.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0944]
 gb|ENN53850.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1198]
 gb|ENN54757.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1199]
 gb|ENN57389.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1215]
 gb|ENN61362.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1248]
 gb|ENN65618.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1253]
 gb|ENN67527.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1255]
 gb|EOR32571.1| molybdopterin biosynthesis protein moeB [Staphylococcus aureus 
subsp. aureus 091751]
 gb|EOR92197.1| Molybdopterin biosynthesis protein [Staphylococcus aureus subsp. 
aureus CBD-635]
 gb|EPR24022.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
SA_ST125_MupR]
 gb|EPX91751.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
SA16]
 gb|EUD18683.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0662]
 gb|EUD20927.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0732]
 gb|EUD22679.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0741]
 gb|EUD28833.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0728]
 gb|EUD29341.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0725]
 gb|EUD31671.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0723]
 gb|EUD36594.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0710]
 gb|EUD38532.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0704]
 gb|EUD41100.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0696]
 gb|EUD42773.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0691]
 gb|EUD43902.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0626]
 gb|EUD48621.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0644]
 gb|EUD52282.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0651]
 gb|EUD52433.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0642]
 gb|EUD57331.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0655]
 gb|EUD58477.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0661]
 gb|EUD61231.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0667]
 gb|EUD77190.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0627]
 gb|EUD79421.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0631]
 gb|EUD84392.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0632]
 gb|EUD86145.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0634]
 gb|EUD89750.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0637]
 gb|EUD95825.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0638]
 gb|EUD98703.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0640]
 gb|EUD99398.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0643]
 gb|EUE04179.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0647]
 gb|EUE09900.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0649]
 gb|EUE13192.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0652]
 gb|EUE14005.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0654]
 gb|EUE15581.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0653]
 gb|EUE21163.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0656]
 gb|EUE21491.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0657]
 gb|EUE25842.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0659]
 gb|EUE29430.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0664]
 gb|EUE31040.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0666]
 gb|EUE42852.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0669]
 gb|EUE47070.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0670]
 gb|EUE48731.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0672]
 gb|EUE54798.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0674]
 gb|EUE55863.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0677]
 gb|EUE59271.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0678]
 gb|EUE61368.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0679]
 gb|EUE66016.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0680]
 gb|EUE67804.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0681]
 gb|EUE69070.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0682]
 gb|EUE73080.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0683]
 gb|EUE80594.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0685]
 gb|EUE81625.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0686]
 gb|EUE85528.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0689]
 gb|EUE87455.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0693]
 gb|EUE92772.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0698]
 gb|EUE93541.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0697]
 gb|EUE94864.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0699]
 gb|EUF00592.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0700]
 gb|EUF01629.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0701]
 gb|EUF03316.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0703]
 gb|EUF07169.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0706]
 gb|EUF11109.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0707]
 gb|EUF14544.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0708]
 gb|EUF20967.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0711]
 gb|EUF22642.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0713]
 gb|EUF31114.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0718]
 gb|EUF34093.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0720]
 gb|EUF34676.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0721]
 gb|EUF35629.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0722]
 gb|EUF39628.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0724]
 gb|EUF39839.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0727]
 gb|EUF50347.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0731]
 gb|EUF53300.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0733]
 gb|EUF55798.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0734]
 gb|EUF60525.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0736]
 gb|EUF62333.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0737]
 gb|EUF64876.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0739]
 gb|EUF71307.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0625]
 gb|EUF73272.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0635]
 gb|EUF74194.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0742]
 gb|EUF80565.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0675]
 gb|EUF81727.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0650]
 gb|EUF85479.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0702]
 gb|EUF86450.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0726]
 gb|EUF90151.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0714]
 gb|EUF91548.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0735]
 gb|EUF94317.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0498]
 gb|EUG04157.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0538]
 gb|EUG08191.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0551]
 gb|EUG08579.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0561]
 gb|EUG11881.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0570]
 gb|EUG15746.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0608]
 gb|EUG18585.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0620]
 gb|EUG21723.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0379]
 gb|EUG25814.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0395]
 gb|EUG26533.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0371]
 gb|EUG29849.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0407]
 gb|EUG33443.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0418]
 gb|EUG37050.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0432]
 gb|EUG37377.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0456]
 gb|EUG42248.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0473]
 gb|EUG47030.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0492]
 gb|EUG47581.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0243]
 gb|EUG50305.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0253]
 gb|EUG53218.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0268]
 gb|EUG61000.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0299]
 gb|EUG61229.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0311]
 gb|EUG65330.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0332]
 gb|EUG71008.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0365]
 gb|EUG75626.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0121]
 gb|EUG80655.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0130]
 gb|EUG83319.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0152]
 gb|EUG86414.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0167]
 gb|EUG90351.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0176]
 gb|EUG92151.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0190]
 gb|EUG95337.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0222]
 gb|EUG96423.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0238]
 gb|EUG99221.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0195]
 gb|EUH05202.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0023]
 gb|EUH08942.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0015]
 gb|EUH11984.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0032]
 gb|EUH17935.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0078]
 gb|EUH24375.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0105]
 gb|EUH30793.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0776]
 gb|EUH36365.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0787]
 gb|EUH38843.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0803]
 gb|EUH42289.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0816]
 gb|EUH45021.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0827]
 gb|EUH45851.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0849]
 gb|EUH47593.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0864]
 gb|EUH54438.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0860]
 gb|EUH55205.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0874]
 gb|EUH57016.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0884]
 gb|EUH61400.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0915]
 gb|EUH63206.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0908]
 gb|EUH68643.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0950]
 gb|EUH70858.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0938]
 gb|EUH74243.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0962]
 gb|EUH76568.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0973]
 gb|EUH77091.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0977]
 gb|EUH79387.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0986]
 gb|EUH83824.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1001]
 gb|EUH87931.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1020]
 gb|EUH91460.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1042]
 gb|EUH91910.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1052]
 gb|EUH94865.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1086]
 gb|EUH96476.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1072]
 gb|EUI00117.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1098]
 gb|EUI03131.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1104]
 gb|EUI10659.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1376]
 gb|EUI11282.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1389]
 gb|EUI12261.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1381]
 gb|EUI16524.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1399]
 gb|EUI19425.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1426]
 gb|EUI24082.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1439]
 gb|EUI30674.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1442]
 gb|EUI32375.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1114]
 gb|EUI33338.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1440]
 gb|EUI33914.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1131]
 gb|EUI38086.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1125]
 gb|EUI40887.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1134]
 gb|EUI43254.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1135]
 gb|EUI46491.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1155]
 gb|EUI50338.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1163]
 gb|EUI51990.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1175]
 gb|EUI54121.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1176]
 gb|EUI59204.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1177]
 gb|EUI59738.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1184]
 gb|EUI65165.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1196]
 gb|EUI68241.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1194]
 gb|EUI72527.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1240]
 gb|EUI74510.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1287]
 gb|EUI81447.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1300]
 gb|EUI81905.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1299]
 gb|EUI84170.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1342]
 gb|EUI86133.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1479]
 gb|EUI89997.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1475]
 gb|EUI97819.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1480]
 gb|EUI99027.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1485]
 gb|EUJ00246.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1486]
 gb|EUJ04259.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1499]
 gb|EUJ06228.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1492]
 gb|EUJ08133.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1502]
 gb|EUJ50666.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR948]
 gb|EUJ54743.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1280]
 gb|EUJ56547.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1199]
 gb|EUJ61722.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1366]
 gb|EUJ62403.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1503]
 gb|EUJ66505.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3170]
 gb|EUJ68599.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3172]
 gb|EUJ72560.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3165]
 gb|EUJ75617.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5898]
 gb|EUJ76246.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5897]
 gb|EUJ78685.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5896]
 gb|EUJ83570.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5894]
 gb|EUJ84091.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5895]
 gb|EUJ86718.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5893]
 gb|EUJ91088.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5892]
 gb|EUJ92663.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5891]
 gb|EUJ95409.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5882]
 gb|EUK00346.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5876]
 gb|EUK00746.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5883]
 gb|EUK04008.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5866]
 gb|EUK07706.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5860]
 gb|EUK10611.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5844]
 gb|EUK13860.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5842]
 gb|EUK14873.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5810]
 gb|EUK20908.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0018]
 gb|EUK24457.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0050]
 gb|EUK25663.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0039]
 gb|EUK28915.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0056]
 gb|EUK29739.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0062]
 gb|EUK36475.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0067]
 gb|EUK37293.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0068]
 gb|EUK40357.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0126]
 gb|EUK42889.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0114]
 gb|EUK45139.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0073]
 gb|EUK49256.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0133]
 gb|EUK49752.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0180]
 gb|EUK50522.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0158]
 gb|EUK54859.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0248]
 gb|EUK56993.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0267]
 gb|EUK62514.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0259]
 gb|EUK67026.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0269]
 gb|EUK67435.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0277]
 gb|EUK71323.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0304]
 gb|EUK71866.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0291]
 gb|EUK74603.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0298]
 gb|EUK76459.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0316]
 gb|EUK77081.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0324]
 gb|EUK81426.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0354]
 gb|EUK83338.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0358]
 gb|EUK86783.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0366]
 gb|EUK91216.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0370]
 gb|EUK95406.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0397]
 gb|EUK96197.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0389]
 gb|EUK98200.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0394]
 gb|EUL03938.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0434]
 gb|EUL06231.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0429]
 gb|EUL08591.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0459]
 gb|EUL13752.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0444]
 gb|EUL15123.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0495]
 gb|EUL16595.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0488]
 gb|EUL20373.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0499]
 gb|EUL23683.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0502]
 gb|EUL25337.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0535]
 gb|EUL27396.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0560]
 gb|EUN44161.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0832]
 gb|EUN47061.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0846]
 gb|EUN48995.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0743]
 gb|EUN50046.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0848]
 gb|EUN52819.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0854]
 gb|EUN56020.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0857]
 gb|EUN58721.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0867]
 gb|EUN60547.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0873]
 gb|EUN62165.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0870]
 gb|EUN62979.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0882]
 gb|EUN69519.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0886]
 gb|EUN71158.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0888]
 gb|EUN75676.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0904]
 gb|EUN77396.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0921]
 gb|EUN80905.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0906]
 gb|EUN82165.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0923]
 gb|EUN85010.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0939]
 gb|EUN90102.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0949]
 gb|EUN91995.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0980]
 gb|EUN93580.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0959]
 gb|EUN96151.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0991]
 gb|EUN98624.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0992]
 gb|EUN98785.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0981]
 gb|EUO02115.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0996]
 gb|EUO08005.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1008]
 gb|EUO09188.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1018]
 gb|EUO13454.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1024]
 gb|EUO14284.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1028]
 gb|EUO18134.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1029]
 gb|EUO19740.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1039]
 gb|EUO23167.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1047]
 gb|EUO25723.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1051]
 gb|EUO28754.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1055]
 gb|EUO29294.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1057]
 gb|EUO35046.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1065]
 gb|EUO35720.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1071]
 gb|EUO38755.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1073]
 gb|EUO42981.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1075]
 gb|EUO44112.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1097]
 gb|EUO46212.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1100]
 gb|EUO49715.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1099]
 gb|EUO53258.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1561]
 gb|EUO57956.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0755]
 gb|EUO58797.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1579]
 gb|EUO59694.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0765]
 gb|EUO60874.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1379]
 gb|EUO64979.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1368]
 gb|EUO74858.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1388]
 gb|EUO75740.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1404]
 gb|EUO77908.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1418]
 gb|EUO79116.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1468]
 gb|EUO84328.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1473]
 gb|EUO89126.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1343]
 gb|EUO90174.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1339]
 gb|EUO91729.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1357]
 gb|EUO94830.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1358]
 gb|EUO97694.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1362]
 gb|EUP02671.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1494]
 gb|EUP03765.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1488]
 gb|EUP07071.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1509]
 gb|EUP09483.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1522]
 gb|EUP12879.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1503]
 gb|EUP13762.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1527]
 gb|EUP16468.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1536]
 gb|EUP20677.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1543]
 gb|EUP24308.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1547]
 gb|EUP25589.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1539]
 gb|EUP27026.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1548]
 gb|EUP30666.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1549]
 gb|EUP31328.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1554]
 gb|EUP37903.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1558]
 gb|EUP40617.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1555]
 gb|EUP41844.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0805]
 gb|EUP49088.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
KINW6046]
 gb|EUP49656.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SCLE6100]
 gb|EUP74955.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
COAS6117]
 gb|EUP77884.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6125]
 gb|EUP80855.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
LAMC6117]
 gb|EUP83720.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6121]
 gb|EUP97798.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6110]
 gb|EUQ23955.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJUD6118]
 gb|EUQ36847.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJUD6104]
 gb|EUQ43655.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJOS6106]
 gb|EUQ45095.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
PLAC6024]
 gb|EUQ50704.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
HOAG6042]
 gb|EUQ52251.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
HOAG6034]
 gb|EUQ60153.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
AGEN6009]
 gb|EUQ66746.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
COAS6004]
 gb|EUQ69576.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WAMC6003]
 gb|EUQ72286.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
LAMC0016]
 gb|EUQ76632.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
FVRH6001]
 gb|EUQ77288.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SMMC6030]
 gb|EUQ80582.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
AMMC6073]
 gb|EUQ84015.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6047]
 gb|EUQ97244.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
PLAC6019]
 gb|EUR09136.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SMMC6051]
 gb|EUR24642.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
MISS6020]
 gb|EUR35949.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
AMMC6050]
 gb|EUR51209.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0004]
 gb|EUR53499.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0005]
 gb|EUR59728.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0009]
 gb|EUR61790.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0010]
 gb|EUR67050.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0012]
 gb|EUR68266.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0011]
 gb|EUR74404.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0013]
 gb|EUR79969.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0016]
 gb|EUR82743.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0014]
 gb|EUR85209.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0017]
 gb|EUR85686.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0021]
 gb|EUR86202.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0022]
 gb|EUR93099.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0024]
 gb|EUR95871.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0025]
 gb|EUS01841.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0028]
 gb|EUS03002.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0027]
 gb|EUS04141.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0031]
 gb|EUS08982.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0030]
 gb|EUS12597.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0034]
 gb|EUS13074.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0036]
 gb|EUS18679.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0038]
 gb|EUS23055.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0041]
 gb|EUS24227.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0040]
 gb|EUS27184.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0042]
 gb|EUS30244.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0043]
 gb|EUS33644.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0046]
 gb|EUS34737.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0044]
 gb|EUS38833.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0049]
 gb|EUS41372.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0048]
 gb|EUS42603.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0051]
 gb|EUS48214.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0054]
 gb|EUS50365.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0052]
 gb|EUS51867.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0057]
 gb|EUS55816.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0061]
 gb|EUS58602.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0058]
 gb|EUS62931.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0063]
 gb|EUS66063.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0064]
 gb|EUS66624.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0065]
 gb|EUS68519.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0069]
 gb|EUS71573.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0071]
 gb|EUS73578.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0070]
 gb|EUS73655.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0074]
 gb|EUS79352.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0079]
 gb|EUS81965.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0076]
 gb|EUS87260.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0081]
 gb|EUS90709.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0084]
 gb|EUS93094.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0082]
 gb|EUS96948.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0083]
 gb|EUT00524.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0089]
 gb|EUT00773.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0086]
 gb|EUT01999.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0087]
 gb|EUT07512.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0092]
 gb|EUT08432.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0093]
 gb|EUT13430.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0094]
 gb|EUT14794.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0095]
 gb|EUT17734.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0096]
 gb|EUT21111.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0098]
 gb|EUT26599.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0099]
 gb|EUT43173.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0110]
 gb|EUT51169.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0112]
 gb|EUT53506.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0115]
 gb|EUT57141.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0116]
 gb|EUT59010.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0117]
 gb|EUT59643.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0118]
 gb|EUT62158.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0119]
 gb|EUT67809.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0120]
 gb|EUT70268.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0122]
 gb|EUT73756.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0124]
 gb|EUT77898.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0125]
 gb|EUT81516.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0127]
 gb|EUT86338.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0128]
 gb|EUT90910.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0131]
 gb|EUT94874.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0132]
 gb|EUT99078.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0134]
 gb|EUU02187.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0135]
 gb|EUU02587.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0136]
 gb|EUU04229.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0137]
 gb|EUU08788.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0138]
 gb|EUU10420.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0141]
 gb|EUU11771.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0142]
 gb|EUU14376.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0143]
 gb|EUU18387.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0145]
 gb|EUU21885.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0147]
 gb|EUU23251.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0146]
 gb|EUU28209.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0148]
 gb|EUU29768.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0153]
 gb|EUU30720.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0149]
 gb|EUU32947.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0155]
 gb|EUU39756.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0156]
 gb|EUU40687.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0157]
 gb|EUU45237.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0159]
 gb|EUU47107.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0160]
 gb|EUU49918.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0161]
 gb|EUU51417.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0162]
 gb|EUU53814.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0163]
 gb|EUU55580.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0164]
 gb|EUU57563.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0166]
 gb|EUU63858.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0165]
 gb|EUU66060.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0168]
 gb|EUU68603.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0169]
 gb|EUU69911.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0172]
 gb|EUU72370.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0170]
 gb|EUU74119.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0174]
 gb|EUU78602.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0175]
 gb|EUU81477.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0178]
 gb|EUU83243.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0179]
 gb|EUU85493.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0181]
 gb|EUU88256.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0182]
 gb|EUU94034.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0184]
 gb|EUU96981.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0183]
 gb|EUU98872.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0185]
 gb|EUV01526.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0187]
 gb|EUV05403.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0191]
 gb|EUV08034.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0188]
 gb|EUV13318.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0194]
 gb|EUV15740.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0193]
 gb|EUV17034.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0199]
 gb|EUV19568.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0196]
 gb|EUV19921.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0198]
 gb|EUV23593.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0201]
 gb|EUV26685.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0203]
 gb|EUV31480.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0205]
 gb|EUV31639.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0202]
 gb|EUV37162.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0204]
 gb|EUV37634.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0207]
 gb|EUV39906.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0209]
 gb|EUV45099.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0208]
 gb|EUV46202.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0211]
 gb|EUV46436.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0214]
 gb|EUV53047.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0215]
 gb|EUV54329.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0218]
 gb|EUV54612.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0220]
 gb|EUV58612.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0224]
 gb|EUV61295.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0219]
 gb|EUV65231.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0226]
 gb|EUV65673.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0225]
 gb|EUV72519.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0227]
 gb|EUV73702.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0229]
 gb|EUV76355.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0228]
 gb|EUV78550.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0230]
 gb|EUV82555.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0231]
 gb|EUV83787.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0232]
 gb|EUV84027.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0234]
 gb|EUV92152.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0241]
 gb|EUV97241.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0244]
 gb|EUV98701.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0242]
 gb|EUV99568.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0245]
 gb|EUW03376.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0246]
 gb|EUW07082.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0247]
 gb|EUW10607.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0249]
 gb|EUW11680.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0254]
 gb|EUW11802.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0251]
 gb|EUW14380.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0255]
 gb|EUW19046.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0258]
 gb|EUW21851.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0262]
 gb|EUW22577.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0256]
 gb|EUW28288.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0264]
 gb|EUW31178.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0263]
 gb|EUW32905.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0265]
 gb|EUW36642.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0271]
 gb|EUW38350.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0272]
 gb|EUW39315.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0275]
 gb|EUW42446.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0278]
 gb|EUW45271.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0276]
 gb|EUW49725.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0281]
 gb|EUW52240.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0283]
 gb|EUW53437.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0286]
 gb|EUW57413.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0287]
 gb|EUW58501.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0285]
 gb|EUW63736.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0289]
 gb|EUW66240.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0292]
 gb|EUW67165.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0290]
 gb|EUW71233.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0295]
 gb|EUW72036.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0293]
 gb|EUW75372.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0297]
 gb|EUW79517.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0296]
 gb|EUW84320.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0300]
 gb|EUW85434.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0303]
 gb|EUW89000.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0302]
 gb|EUW91160.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0305]
 gb|EUW93330.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0307]
 gb|EUW97776.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0309]
 gb|EUW98284.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0310]
 gb|EUX02106.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0313]
 gb|EUX04898.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0314]
 gb|EUX04964.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0317]
 gb|EUX13882.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0319]
 gb|EUX19260.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0321]
 gb|EUX19733.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0320]
 gb|EUX20392.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0322]
 gb|EUX22482.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0323]
 gb|EUX23263.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0325]
 gb|EUX31001.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0327]
 gb|EUX32007.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0331]
 gb|EUX36002.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0335]
 gb|EUX36660.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0333]
 gb|EUX41535.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0336]
 gb|EUX42782.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0339]
 gb|EUX43751.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0338]
 gb|EUX50686.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0344]
 gb|EUX51881.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0341]
 gb|EUX55176.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0342]
 gb|EUX59435.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0345]
 gb|EUX60700.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0348]
 gb|EUX61767.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0346]
 gb|EUX68860.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0349]
 gb|EUX72728.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0355]
 gb|EUX76826.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0356]
 gb|EUX79010.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0357]
 gb|EUX81588.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0360]
 gb|EUX87568.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0361]
 gb|EUX91730.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0362]
 gb|EUX92664.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0368]
 gb|EUX95541.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0369]
 gb|EUX98469.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0373]
 gb|EUX99224.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0372]
 gb|EUY03389.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0376]
 gb|EUY07914.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0377]
 gb|EUY08821.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0378]
 gb|EUY09989.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0380]
 gb|EUY12158.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0383]
 gb|EUY17082.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0382]
 gb|EUY20875.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0384]
 gb|EUY22339.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0385]
 gb|EUY24295.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0386]
 gb|EUY26700.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0388]
 gb|EUY26987.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0390]
 gb|EUY30972.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0398]
 gb|EUY37326.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0399]
 gb|EUY38505.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0400]
 gb|EUY39930.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0402]
 gb|EUY43585.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0403]
 gb|EUY44796.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0405]
 gb|EUY48951.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0406]
 gb|EUY54863.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0409]
 gb|EUY56221.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0411]
 gb|EUY56699.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0412]
 gb|EUY60243.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0414]
 gb|EUY67166.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0416]
 gb|EUY69657.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0419]
 gb|EUY70144.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0417]
 gb|EUY72674.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0420]
 gb|EUY78419.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0423]
 gb|EUY79125.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0421]
 gb|EUY82123.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0425]
 gb|EUY84988.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0428]
 gb|EUY86287.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0430]
 gb|EUY92892.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0431]
 gb|EUY96712.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0433]
 gb|EUY97078.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0435]
 gb|EUZ01484.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0439]
 gb|EUZ05380.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0440]
 gb|EUZ11366.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0442]
 gb|EUZ11627.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0441]
 gb|EUZ15141.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0447]
 gb|EUZ17065.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0445]
 gb|EUZ20057.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0448]
 gb|EUZ25516.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0451]
 gb|EUZ25640.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0449]
 gb|EUZ26869.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0452]
 gb|EUZ36071.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0458]
 gb|EUZ39385.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0462]
 gb|EUZ44957.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0463]
 gb|EUZ49283.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0464]
 gb|EUZ51535.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0466]
 gb|EUZ55957.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0471]
 gb|EUZ59965.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0475]
 gb|EUZ62560.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0472]
 gb|EUZ63714.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0476]
 gb|EUZ68120.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0482]
 gb|EUZ74759.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0481]
 gb|EUZ80632.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0484]
 gb|EUZ82691.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0487]
 gb|EUZ90849.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0491]
 gb|EUZ91449.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0496]
 gb|EUZ92257.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0501]
 gb|EUZ97344.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0503]
 gb|EUZ99797.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0506]
 gb|EVA02267.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0505]
 gb|EVA05310.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0509]
 gb|EVA06174.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0508]
 gb|EVA10884.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0512]
 gb|EVA13282.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0514]
 gb|EVA14684.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0515]
 gb|EVA21070.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0516]
 gb|EVA21735.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0518]
 gb|EVA24318.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0519]
 gb|EVA29795.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0520]
 gb|EVA32172.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0523]
 gb|EVA36537.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0525]
 gb|EVA42089.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0532]
 gb|EVA42987.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0530]
 gb|EVA48829.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0534]
 gb|EVA50403.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0533]
 gb|EVA52229.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0540]
 gb|EVA53817.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0537]
 gb|EVA59935.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0543]
 gb|EVA61667.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0544]
 gb|EVA67433.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0546]
 gb|EVA68787.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0545]
 gb|EVA72748.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0548]
 gb|EVA78135.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0550]
 gb|EVA80597.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0549]
 gb|EVA83742.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0554]
 gb|EVA88907.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0555]
 gb|EVA89999.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0556]
 gb|EVA93332.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0557]
 gb|EVA96772.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0558]
 gb|EVA97946.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0559]
 gb|EVB07754.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0566]
 gb|EVB11967.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0568]
 gb|EVB14111.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0569]
 gb|EVB17149.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0572]
 gb|EVB22611.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0573]
 gb|EVB25491.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0581]
 gb|EVB26624.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0579]
 gb|EVB27020.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0582]
 gb|EVB33779.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0583]
 gb|EVB39522.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0587]
 gb|EVB40840.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0585]
 gb|EVB44091.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0588]
 gb|EVB44219.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0589]
 gb|EVB50167.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0591]
 gb|EVB51286.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0592]
 gb|EVB59541.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0595]
 gb|EVB63106.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0598]
 gb|EVB63352.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0601]
 gb|EVB64333.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0599]
 gb|EVB70750.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0603]
 gb|EVB74606.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0604]
 gb|EVB75905.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0607]
 gb|EVB76159.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0605]
 gb|EVB77712.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0610]
 gb|EVB81376.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0609]
 gb|EVB87565.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0611]
 gb|EVB88366.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0612]
 gb|EVB91178.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0613]
 gb|EVB93622.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0616]
 gb|EVB98253.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0617]
 gb|EVC03588.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0618]
 gb|EVC03886.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0619]
 gb|EVC06232.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0621]
 gb|EVC09041.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0624]
 gb|EVC09117.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0623]
 gb|EVC21439.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJOS6052]
 gb|EVC28999.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJOS6071]
 gb|EVC35813.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
CHAP6049]
 gb|EVC38244.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
GGMC6010]
 gb|EVC41337.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
PLAC6012]
 gb|EVC43875.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
AMMC6054]
 gb|EVC48737.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WMCS6011]
 gb|EVC63580.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
HBHO6042]
 gb|EVC68281.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
MISS6019]
 gb|EVC71660.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJUD6053]
 gb|EVC73980.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
MISS6012]
 gb|EVC78069.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
HOAG6054]
 gb|EVC79975.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
HOAG6057]
 gb|EVC97148.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WMCA6040]
 gb|EVC97397.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WMCS6016]
 gb|EVD03859.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
AMMC6068]
 gb|EVD09004.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
HOAG6068]
 gb|EVD09326.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6014]
 gb|EVD18997.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
CHOC6056]
 gb|EVD23074.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJOS6095]
 gb|EVD31665.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SMMC6067]
 gb|EVD33797.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJUD6074]
 gb|EVD34167.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJUD6072]
 gb|EVD39753.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WMCS6038]
 gb|EVD54538.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6046]
 gb|EVD61878.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6049]
 gb|EVD76523.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
AMMC6074]
 gb|EVD79220.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
LAMC0047]
 gb|EVD83768.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6055]
 gb|EVD84334.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6053]
 gb|EVD87528.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SMMC6097]
 gb|EVD92856.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
AGEN6033]
 gb|EVE02004.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6052]
 gb|EVE03826.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJOS6003]
 gb|EVE06140.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJOS6002]
 gb|EVE16131.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
HOAG6005]
 gb|EVE16973.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJOS6004]
 gb|EVE28364.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
AMMC6007]
 gb|EVE33234.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJOS6016]
 gb|EVE37079.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SMMC6034]
 gb|EVE40127.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SMMC6038]
 gb|EVE40705.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SMMC6037]
 gb|EVE44390.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SCLE6003]
 gb|EVE48170.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJUD6010]
 gb|EVE49193.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJUD6014]
 gb|EVE54474.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6003]
 gb|EVE56512.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJUD6018]
 gb|EVE64282.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6002]
 gb|EVE65610.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
LAMC0010]
 gb|EVE76681.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
AMMC6013]
 gb|EVE81427.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
AMMC6014]
 gb|EVE82454.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WMCS6001]
 gb|EVE90785.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
AMMC6012]
 gb|EVE91649.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
MISS6048]
 gb|EVE95924.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
MISS6042]
 gb|EVE98827.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJOS6022]
 gb|EVF01388.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJOS6027]
 gb|EVF06270.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6004]
 gb|EVF10496.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
KINW6001]
 gb|EVF12397.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
KINW6002]
 gb|EVF19165.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SCOA6008]
 gb|EVF20589.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
HOAG6025]
 gb|EVF22431.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
GGMC6003]
 gb|EVF30846.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6050]
 gb|EVF31906.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6015]
 gb|EVF36553.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WAMC6046]
 gb|EVF40299.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SMMC6022]
 gb|EVF40620.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6047]
 gb|EVF45457.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
KINW6010]
 gb|EVF54362.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJUD6028]
 gb|EVF64218.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJUD6021]
 gb|EVF66736.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SCLE6010]
 gb|EVF72158.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJUD6041]
 gb|EVF77984.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SMMC6011]
 gb|EVF80116.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6034]
 gb|EVF95540.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
KINW6016]
 gb|EVF98318.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
FVRH6011]
 gb|EVG02950.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
HOAG6092]
 gb|EVG06777.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJOS6124]
 gb|EVG11918.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJOS6105]
 gb|EVG14928.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJOS6118]
 gb|EVG17588.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJOS6125]
 gb|EVG20118.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
COAS6053]
 gb|EVG21984.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJUD6107]
 gb|EVG31698.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJOS6126]
 gb|EVG33119.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJUD6101]
 gb|EVG36853.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJUD6109]
 gb|EVG43352.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SMMC6076]
 gb|EVG49893.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SMMC6085]
 gb|EVG54742.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
HOAG6104]
 gb|EVG64991.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
MISS6052]
 gb|EVG71369.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6066]
 gb|EVG74631.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6069]
 gb|EVG78340.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJOS6144]
 gb|EVG80409.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
COAS6060]
 gb|EVG81254.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6070]
 gb|EVG86433.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
FVRH6026]
 gb|EVG91525.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
FVRH6022]
 gb|EVG94265.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
KINW6019]
 gb|EVH00055.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
MISS6134]
 gb|EVH03006.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6077]
 gb|EVH11199.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6076]
 gb|EVH11673.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJUD6120]
 gb|EVH16483.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJUD6124]
 gb|EVH19183.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WMCA6024]
 gb|EVH24785.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
AMMC6106]
 gb|EVH29076.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
KINW6023]
 gb|EVH29697.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
KINW6027]
 gb|EVH32797.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
KINB6024]
 gb|EVH33497.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
KINB6023]
 gb|EVH37133.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6084]
 gb|EVH40676.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SMMC6108]
 gb|EVH44508.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6075]
 gb|EVH44676.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
AMMC6111]
 gb|EVH49389.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
FVRH6035]
 gb|EVH52083.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WAMC6030]
 gb|EVH54563.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
KINW6033]
 gb|EVH58351.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
LAMC6078]
 gb|EVH59546.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6081]
 gb|EVH65174.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
AMMC6119]
 gb|EVH69534.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6085]
 gb|EVH70396.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6090]
 gb|EVH71603.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
LAMC6084]
 gb|EVH83310.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SMMC6121]
 gb|EVH88958.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SCLE6032]
 gb|EVH89215.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
KINW6036]
 gb|EVI05145.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6096]
 gb|EVI17689.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6104]
 gb|EVI18398.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
AGEN6042]
 gb|EVI21184.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WMCS6087]
 gb|EVI25273.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6105]
 gb|EVI26208.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
MISS6092]
 gb|EVI28717.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6106]
 gb|EVI32110.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
FVRH6065]
 gb|EVI38353.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
GGMC6024]
 gb|EVI41182.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6115]
 gb|EVI47254.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
KINW6040]
 gb|EVI51566.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
LAMC6106]
 gb|EVI60060.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6123]
 gb|EVI60382.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6114]
 gb|EVI63851.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6117]
 gb|EVI67262.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
GGMC6026]
 gb|EVI67653.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
MISS6078]
 gb|EVI75521.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6123]
 gb|EVI75943.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
MISS6080]
 gb|EVI83651.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SCLE6040]
 gb|EVJ01818.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
PLAC6044]
 gb|EVJ02410.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
FVRH6129]
 gb|EVJ27139.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WAMC6062]
 gb|EVJ28196.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
CHAP6102]
 gb|EVJ31597.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WAMC6071]
 gb|EVJ38021.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
KINW6058]
 gb|EVJ40742.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
HBHO6024]
 gb|EVJ52259.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
PLAC6055]
 gb|EVJ64276.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
GGMC6043]
 gb|EVJ65262.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WAMC6086]
 gb|EVJ65858.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
GGMC6053]
 gb|EVJ78492.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
KINW6047]
 gb|EVJ85011.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0746]
 gb|EVJ86002.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0744]
 gb|EVJ91807.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0752]
 gb|EVJ96645.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0774]
 gb|EVK01256.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0775]
 gb|EVK03257.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0779]
 gb|EVK08493.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0782]
 gb|EVK11903.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0783]
 gb|EVK13362.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0785]
 gb|EVK14902.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0784]
 gb|EVK21941.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0786]
 gb|EVK24470.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0788]
 gb|EVK26934.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0789]
 gb|EVK30365.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0791]
 gb|EVK35726.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0794]
 gb|EVK35836.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0793]
 gb|EVK40378.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0796]
 gb|EVK40667.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0798]
 gb|EVK49921.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0802]
 gb|EVK54411.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0804]
 gb|EVK57745.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0806]
 gb|EVK58768.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0808]
 gb|EVK59586.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0807]
 gb|EVK63986.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0809]
 gb|EVK66504.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0810]
 gb|EVK71068.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0812]
 gb|EVK72249.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0811]
 gb|EVK75513.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0817]
 gb|EVK75820.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0814]
 gb|EVK79949.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0818]
 gb|EVK83014.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0819]
 gb|EVK88846.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0824]
 gb|EVK96099.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0826]
 gb|EVK98450.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0830]
 gb|EVL02398.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0834]
 gb|EVL04565.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0836]
 gb|EVL06474.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0837]
 gb|EVL09511.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0838]
 gb|EVL14631.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0839]
 gb|EVL17058.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0840]
 gb|EVL20342.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0841]
 gb|EVL21508.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0842]
 gb|EVL24739.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0845]
 gb|EVL25299.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0843]
 gb|EVL27276.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0850]
 gb|EVL32463.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0851]
 gb|EVL36080.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0852]
 gb|EVL38162.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0855]
 gb|EVL45116.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0862]
 gb|EVL47670.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0861]
 gb|EVL49971.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0863]
 gb|EVL54347.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0865]
 gb|EVL58347.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0868]
 gb|EVL63194.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0869]
 gb|EVL63974.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0875]
 gb|EVL66848.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0872]
 gb|EVL69801.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0876]
 gb|EVL72408.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0879]
 gb|EVL75910.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0878]
 gb|EVL78286.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0880]
 gb|EVL82364.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0883]
 gb|EVL85536.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0885]
 gb|EVL87940.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0889]
 gb|EVL89572.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0887]
 gb|EVL94205.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0890]
 gb|EVL95151.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0891]
 gb|EVM01102.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0895]
 gb|EVM04115.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0898]
 gb|EVM09279.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0897]
 gb|EVM10214.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0899]
 gb|EVM12539.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0902]
 gb|EVM17798.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0903]
 gb|EVM18255.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0901]
 gb|EVM21906.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0905]
 gb|EVM22481.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0907]
 gb|EVM27538.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0909]
 gb|EVM29491.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0911]
 gb|EVM34217.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0913]
 gb|EVM35523.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0914]
 gb|EVM43171.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0917]
 gb|EVM45145.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0918]
 gb|EVM49439.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0920]
 gb|EVM51423.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0919]
 gb|EVM53121.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0922]
 gb|EVM55245.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0928]
 gb|EVM57232.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0924]
 gb|EVM62123.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0929]
 gb|EVM63464.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0931]
 gb|EVM64867.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0930]
 gb|EVM66408.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0932]
 gb|EVM70944.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0936]
 gb|EVM77268.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0935]
 gb|EVM79324.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0940]
 gb|EVM84190.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0941]
 gb|EVM86521.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0942]
 gb|EVM88676.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0947]
 gb|EVM93859.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0948]
 gb|EVM96087.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0954]
 gb|EVM97799.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0955]
 gb|EVM98887.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0951]
 gb|EVN03686.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0956]
 gb|EVN07746.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0957]
 gb|EVN10204.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0965]
 gb|EVN12274.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0960]
 gb|EVN14895.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0961]
 gb|EVN15102.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0966]
 gb|EVN23326.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0969]
 gb|EVN23590.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0967]
 gb|EVN25266.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0968]
 gb|EVN28549.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0971]
 gb|EVN28739.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0970]
 gb|EVN33059.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0972]
 gb|EVN36456.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0975]
 gb|EVN40029.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0979]
 gb|EVN40928.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0974]
 gb|EVN45407.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0983]
 gb|EVN50467.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0984]
 gb|EVN54094.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0988]
 gb|EVN55514.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0987]
 gb|EVN56080.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0985]
 gb|EVN63537.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0989]
 gb|EVN64179.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0993]
 gb|EVN64931.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0997]
 gb|EVN67670.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1002]
 gb|EVN72523.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1000]
 gb|EVN72747.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1006]
 gb|EVN74936.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1003]
 gb|EVN77767.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1009]
 gb|EVN78763.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1011]
 gb|EVN87294.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1013]
 gb|EVN87693.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1012]
 gb|EVN90863.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1019]
 gb|EVN91604.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1014]
 gb|EVN98671.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1021]
 gb|EVO01079.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1022]
 gb|EVO05039.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1023]
 gb|EVO06397.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1025]
 gb|EVO10411.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1027]
 gb|EVO13471.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1026]
 gb|EVO16222.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1030]
 gb|EVO17698.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1031]
 gb|EVO22211.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1033]
 gb|EVO26227.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1041]
 gb|EVO26404.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1043]
 gb|EVO31027.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1046]
 gb|EVO32934.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1045]
 gb|EVO36798.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1049]
 gb|EVO36972.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1048]
 gb|EVO41422.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1050]
 gb|EVO44496.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1053]
 gb|EVO47933.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1054]
 gb|EVO49254.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1058]
 gb|EVO54557.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1059]
 gb|EVO57051.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1066]
 gb|EVO60873.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1067]
 gb|EVO63104.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1069]
 gb|EVO67379.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1074]
 gb|EVO69498.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1077]
 gb|EVO71756.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1070]
 gb|EVO73925.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1079]
 gb|EVO75907.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1081]
 gb|EVO79892.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1080]
 gb|EVO85453.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1084]
 gb|EVO87586.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1082]
 gb|EVO88557.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1085]
 gb|EVO90576.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1087]
 gb|EVO91767.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1088]
 gb|EVO95317.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1089]
 gb|EVO95989.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1090]
 gb|EVP03059.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1091]
 gb|EVP04315.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1096]
 gb|EVP11458.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1102]
 gb|EVP17080.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1560]
 gb|EVP17208.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1562]
 gb|EVP18682.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1566]
 gb|EVP22639.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1567]
 gb|EVP27623.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1570]
 gb|EVP28781.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1569]
 gb|EVP32466.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1571]
 gb|EVP34329.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1572]
 gb|EVP37110.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1573]
 gb|EVP38583.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1574]
 gb|EVP43283.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1575]
 gb|EVP44427.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1576]
 gb|EVP48460.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1577]
 gb|EVP50192.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1580]
 gb|EVP52588.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0747]
 gb|EVP54617.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0749]
 gb|EVP58647.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0753]
 gb|EVP61973.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0754]
 gb|EVP63886.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0757]
 gb|EVP68954.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0759]
 gb|EVP73839.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0762]
 gb|EVP83348.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0764]
 gb|EVP83923.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0763]
 gb|EVP89813.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0767]
 gb|EVP93537.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1366]
 gb|EVP95135.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1369]
 gb|EVQ02997.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1370]
 gb|EVQ04784.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1372]
 gb|EVQ05892.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1371]
 gb|EVQ08645.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1378]
 gb|EVQ12123.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1380]
 gb|EVQ16350.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1377]
 gb|EVQ20555.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1383]
 gb|EVQ23215.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1386]
 gb|EVQ26516.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1387]
 gb|EVQ28032.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1390]
 gb|EVQ31303.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1391]
 gb|EVQ33128.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1392]
 gb|EVQ36027.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1396]
 gb|EVQ37753.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1395]
 gb|EVQ39122.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1398]
 gb|EVQ44635.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1397]
 gb|EVQ45594.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1401]
 gb|EVQ51566.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1402]
 gb|EVQ55871.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1406]
 gb|EVQ56072.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1403]
 gb|EVQ63379.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1409]
 gb|EVQ64315.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1410]
 gb|EVQ68333.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1412]
 gb|EVQ68712.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1411]
 gb|EVQ72247.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1413]
 gb|EVQ77316.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1414]
 gb|EVQ78122.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1415]
 gb|EVQ82021.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1417]
 gb|EVQ85909.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1416]
 gb|EVQ88709.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1420]
 gb|EVQ89482.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1421]
 gb|EVQ91683.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1423]
 gb|EVQ93474.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1424]
 gb|EVQ95818.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1422]
 gb|EVR01346.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1429]
 gb|EVR02422.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1425]
 gb|EVR05812.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1428]
 gb|EVR07784.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1430]
 gb|EVR09027.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1431]
 gb|EVR13429.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1433]
 gb|EVR13955.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1432]
 gb|EVR18047.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1434]
 gb|EVR21497.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1437]
 gb|EVR23994.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1435]
 gb|EVR29853.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1438]
 gb|EVR34727.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1443]
 gb|EVR35121.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1441]
 gb|EVR36815.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1444]
 gb|EVR39362.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1446]
 gb|EVR42032.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1445]
 gb|EVR50235.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1449]
 gb|EVR51738.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1448]
 gb|EVR55107.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1452]
 gb|EVR59120.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1454]
 gb|EVR63084.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1455]
 gb|EVR66413.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1456]
 gb|EVR68259.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1457]
 gb|EVR69981.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1458]
 gb|EVR71116.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1459]
 gb|EVR78275.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1464]
 gb|EVR79142.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1460]
 gb|EVR81079.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1461]
 gb|EVR85226.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1467]
 gb|EVR86453.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1465]
 gb|EVR87636.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1469]
 gb|EVR91789.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1470]
 gb|EVR92840.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1471]
 gb|EVR97545.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1472]
 gb|EVR98459.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1474]
 gb|EVS02856.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1344]
 gb|EVS05030.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1345]
 gb|EVS07755.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1338]
 gb|EVS10939.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1347]
 gb|EVS13608.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1349]
 gb|EVS17613.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1350]
 gb|EVS22486.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1352]
 gb|EVS26018.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1354]
 gb|EVS28899.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1353]
 gb|EVS33672.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1355]
 gb|EVS34801.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1356]
 gb|EVS35440.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1361]
 gb|EVS38055.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1360]
 gb|EVS40980.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1363]
 gb|EVS45056.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1365]
 gb|EVS46774.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1476]
 gb|EVS50558.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1477]
 gb|EVS53996.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1478]
 gb|EVS56800.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1482]
 gb|EVS58144.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1483]
 gb|EVS61575.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1484]
 gb|EVS64403.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1490]
 gb|EVS64981.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1487]
 gb|EVS67837.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1489]
 gb|EVS73485.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1491]
 gb|EVS74562.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1493]
 gb|EVS79529.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1496]
 gb|EVS81881.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1500]
 gb|EVS82045.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1497]
 gb|EVS87986.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1504]
 gb|EVS88148.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1501]
 gb|EVS90735.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1505]
 gb|EVS94190.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1507]
 gb|EVS98434.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1506]
 gb|EVS98972.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1508]
 gb|EVT02789.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1512]
 gb|EVT04585.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1513]
 gb|EVT07509.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1511]
 gb|EVT11805.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1514]
 gb|EVT12524.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1515]
 gb|EVT16989.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1516]
 gb|EVT18959.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1519]
 gb|EVT21474.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1518]
 gb|EVT23126.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1523]
 gb|EVT25672.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1524]
 gb|EVT30499.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1528]
 gb|EVT31950.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1525]
 gb|EVT33618.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1529]
 gb|EVT37410.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1530]
 gb|EVT39353.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1532]
 gb|EVT42045.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1534]
 gb|EVT43628.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1535]
 gb|EVT49495.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1538]
 gb|EVT51140.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1542]
 gb|EVT53249.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1541]
 gb|EVT55912.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1545]
 gb|EVT61531.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1552]
 gb|EVT61693.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1551]
 gb|EVT63471.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1550]
 gb|EVT67070.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1553]
 gb|EVT74688.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1557]
 gb|EVT75060.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1559]
 gb|EVU29486.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M81424]
 gb|EVU39139.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M81493]
 gb|EVU44060.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F41906]
 gb|EVU47060.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F41913]
 gb|EVU48425.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F41882]
 gb|EVU53706.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T49441]
 gb|EVU57940.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W31852]
 gb|EVU58516.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W31936]
 gb|EVU64967.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W31862]
 gb|EVU67194.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
S30087]
 gb|EVU70681.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H83536]
 gb|EVU71334.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F84093]
 gb|EVU73950.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F48584]
 gb|EVU80789.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M92071]
 gb|EVU88117.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W35325]
 gb|EVV01684.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T59607]
 gb|EVV04618.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W41914]
 gb|EVV11475.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W41918]
 gb|EVV12606.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M41648]
 gb|EVV17693.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F54452]
 gb|EVV19829.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F54467]
 gb|EVV23157.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F54494]
 gb|EVV25936.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F54471]
 gb|EVV31066.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H12818]
 gb|EVV40514.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F16077]
 gb|EVV43579.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F25913]
 gb|EVV64470.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H57070]
 gb|EVV66347.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F12874]
 gb|EVV68000.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T25611]
 gb|EVV76749.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H69239]
 gb|EVV84085.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W18443]
 gb|EVW01472.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M73849]
 gb|EVW09335.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T28847]
 gb|EVW09545.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H84489]
 gb|EVW09835.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T41081]
 gb|EVW20744.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F40814]
 gb|EVW24605.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T28854]
 gb|EVW28829.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M80333]
 gb|EVW38454.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W39902]
 gb|EVW41745.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H15665]
 gb|EVW43427.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F52748]
 gb|EVW46449.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M12703]
 gb|EVW48118.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M12714]
 gb|EVW53881.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H87658]
 gb|EVW54200.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M12717]
 gb|EVW63910.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H18808]
 gb|EVW64738.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H18813]
 gb|EVW67119.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H18809]
 gb|EVW72356.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
S72396]
 gb|EVW72673.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M16220]
 gb|EVW79682.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H18811]
 gb|EVW87979.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T62854]
 gb|EVW96678.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F62007]
 gb|EVX00827.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F62010]
 gb|EVX01869.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M20894]
 gb|EVX06122.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M20913]
 gb|EVX09511.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M20916]
 gb|EVX16207.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H27739]
 gb|EVX17488.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H27777]
 gb|EVX23943.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F65057]
 gb|EVX26575.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M27449]
 gb|EVX28805.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M24390]
 gb|EVX39501.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T71888]
 gb|EVX46534.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H33594]
 gb|EVX54229.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W60784]
 gb|EVX57754.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H30732]
 gb|EVX63761.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T78544]
 gb|EVX66612.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F77005]
 gb|EVX74194.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H30737]
 gb|EVX79377.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F68118]
 gb|EVX82583.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M36077]
 gb|EVX91334.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F80358]
 gb|EVX92741.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F80349]
 gb|EVX97137.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F80375]
 gb|EVX98933.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T84594]
 gb|EVY01187.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T84592]
 gb|EVY03577.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T84595]
 gb|EVY08812.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H45755]
 gb|EVY12733.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H45760]
 gb|EVY15949.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F83251]
 gb|EVY17560.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F83269]
 gb|EVY29980.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H48649]
 gb|EVY32208.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T87965]
 gb|EVY35522.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T81559]
 gb|EVY38415.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T87972]
 gb|EVY40138.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F89441]
 gb|EVY45534.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F89468]
 gb|EVY49280.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W79328]
 gb|EVY51666.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H54403]
 gb|EVY56372.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F92753]
 gb|EVY60448.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
S11444]
 gb|EVY61576.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T16281]
 gb|EVY64089.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W82303]
 gb|EVY69953.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W76127]
 gb|EVY72143.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H57815]
 gb|EVY81094.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W20433]
 gb|EVY84772.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T49833]
 gb|EVY94621.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T72838]
 gb|EVZ07306.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F74023]
 gb|EVZ35582.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T16117]
 gb|EVZ47623.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F35307]
 gb|EVZ51285.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F32119]
 gb|EVZ54329.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F63179]
 gb|EVZ57118.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F66300]
 gb|EVZ62145.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F66307]
 gb|EVZ65933.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F77930]
 gb|EVZ70113.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H24637]
 gb|EVZ70529.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H24662]
 gb|EVZ72654.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H27858]
 gb|EVZ78631.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H27862]
 gb|EVZ79473.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H27872]
 gb|EVZ82969.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H31276]
 gb|EVZ92273.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H34245]
 gb|EVZ93971.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H40569]
 gb|EVZ98671.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H57821]
 gb|EVZ99993.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H57822]
 gb|EWA02873.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H57823]
 gb|EWA05397.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H61003]
 gb|EWA07891.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H64299]
 gb|EWA16669.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H67656]
 gb|EWA20671.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H70834]
 gb|EWA21119.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H70826]
 gb|EWA27110.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H74056]
 gb|EWA29293.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H77098]
 gb|EWA31415.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H77102]
 gb|EWA33945.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M16438]
 gb|EWA40789.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M28112]
 gb|EWA44895.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M39841]
 gb|EWA51000.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M59498]
 gb|EWA55910.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M68475]
 gb|EWA72406.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T33139]
 gb|EWA76751.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T39363]
 gb|EWA81270.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T42722]
 gb|EWA83731.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T69703]
 gb|EWA83941.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T69686]
 gb|EWA91495.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T69721]
 gb|EWA95209.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T72889]
 gb|EWA96594.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T72876]
 gb|EWA98606.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T76010]
 gb|EWB03972.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T76018]
 gb|EWB07246.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T79159]
 gb|EWB09195.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T86006]
 gb|EWB11999.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T82627]
 gb|EWB14528.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T86045]
 gb|EWB19388.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T86048]
 gb|EWB24713.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T86055]
 gb|EWB30063.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W16001]
 gb|EWB30606.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W16013]
 gb|EWB35738.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W21940]
 gb|EWB38776.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W21945]
 gb|EWB41455.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W52104]
 gb|EWB43682.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W52117]
 gb|EWB46194.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W52120]
 gb|EWB49039.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W55442]
 gb|EWB51823.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W55446]
 gb|EWB54547.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W55451]
 gb|EWB57969.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W58473]
 gb|EWB59727.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W64953]
 gb|EWB65090.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W68479]
 gb|EWB68361.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W88551]
 gb|EWB73963.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W91963]
 gb|EWB86199.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H90284]
 gb|EWC07621.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F62013]
 gb|EWH60662.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M80992]
 gb|EWI02701.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M77202]
 gb|EWI12958.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M46058]
 gb|EWI37772.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W50101]
 gb|EWI52202.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W29651]
 gb|EWI60108.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W23214]
 gb|EWI65165.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T67327]
 gb|EWI72618.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T60805]
 gb|EWI80028.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T57397]
 gb|EWI90711.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T44830]
 gb|EWI92361.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T44461]
 gb|EWI99060.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T40867]
 gb|EWJ02675.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M91160]
 gb|EWJ07142.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M91155]
 gb|EWJ09974.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M87641]
 gb|EWJ12700.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M87665]
 gb|EWJ15896.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M80979]
 gb|EWJ22898.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M77238]
 gb|EWJ34335.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M13065]
 gb|EWJ36918.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M16586]
 gb|EWJ39507.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M13060]
 gb|EWJ45570.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H87668]
 gb|EWJ45876.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H85003]
 gb|EWJ49136.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H87628]
 gb|EWJ53449.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H84980]
 gb|EWJ56077.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H84973]
 gb|EWJ58763.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H25872]
 gb|EWJ64021.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F60346]
 gb|EWJ66089.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H12893]
 gb|EWJ69110.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F57036]
 gb|EWJ71597.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F57021]
 gb|EWJ73655.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F57033]
 gb|EWJ77094.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F53388]
 gb|EWJ79468.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F43252]
 gb|EWJ81356.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F43221]
 gb|EWJ87312.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F43199]
 gb|EWJ92505.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F43212]
 gb|EWJ98580.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F36683]
 gb|EWK00437.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W92106]
 gb|EWK05302.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W75539]
 gb|EWK11338.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W75113]
 gb|EWK14045.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W75098]
 gb|EWK21170.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W20096]
 gb|EWK22299.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W16028]
 gb|EWK26057.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T89467]
 gb|EWK26678.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T92876]
 gb|EWK33746.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T89463]
 gb|EWK35557.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T37840]
 gb|EWK45580.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T34011]
 gb|EWK46850.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T23868]
 gb|EWK49911.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T20118]
 gb|EWK53759.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T17141]
 gb|EWK54314.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T17131]
 gb|EWK60875.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T16676]
 gb|EWK77021.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M70099]
 gb|EWK81012.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M66673]
 gb|EWK90082.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M62699]
 gb|EWK97710.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M46066]
 gb|EWL00435.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M46070]
 gb|EWL08862.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H68256]
 gb|EWL11318.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H68252]
 gb|EWL13865.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H68244]
 gb|EWL17600.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H64967]
 gb|EWL25503.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H64941]
 gb|EWL32584.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H58191]
 gb|EWL39590.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F88375]
 gb|EWL40225.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F88405]
 gb|EWL43644.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F88369]
 gb|EWL47463.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F84763]
 gb|EWL49449.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F84732]
 gb|EWL56231.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F81389]
 gb|EWL56791.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F77974]
 gb|EWL60447.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F77967]
 gb|EWL63271.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F77919]
 gb|EWL63614.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F77960]
 gb|EWL69199.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F29997]
 gb|EWL76175.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F29982]
 gb|EWL78769.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F29993]
 gb|EWL82868.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F23368]
 gb|EWL87268.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F20115]
 gb|EWL90042.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F23353]
 gb|EWL93740.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F16470]
 gb|EWL97468.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F13027]
 gb|EWM02569.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F13022]
 gb|EWM81465.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1306]
 gb|EWM83803.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1316]
 gb|EWM87293.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1332]
 gb|EWM91703.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1281]
 gb|EWM91820.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1265]
 gb|EWM94651.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1259]
 gb|EWM95021.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1226]
 gb|EWM98023.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1251]
 gb|EWN05036.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1202]
 gb|EWN06248.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1212]
 gb|EWN08433.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1205]
 gb|EWN10948.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1190]
 gb|EWN11115.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1191]
 gb|EWN17503.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1179]
 gb|EWN18309.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1161]
 gb|EWN22037.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1157]
 gb|EWN24669.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1178]
 gb|EWN26865.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1154]
 gb|EWN28376.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1150]
 gb|EWN32331.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1123]
 gb|EWN34350.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1143]
 gb|EWN40868.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1111]
 gb|EWN41924.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1115]
 gb|EWN43001.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1106]
 gb|EWN47960.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1105]
 gb|EWN50753.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1337]
 gb|EWN55320.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1336]
 gb|EWN61543.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1330]
 gb|EWN65690.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1331]
 gb|EWN68980.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1328]
 gb|EWN73098.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1326]
 gb|EWN76767.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1324]
 gb|EWN79993.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1323]
 gb|EWN81332.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1325]
 gb|EWN81710.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1318]
 gb|EWN88327.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1317]
 gb|EWN90646.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1314]
 gb|EWN91115.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1315]
 gb|EWN99329.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1312]
 gb|EWO00169.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1313]
 gb|EWO03640.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1305]
 gb|EWO04385.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1310]
 gb|EWO07356.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1308]
 gb|EWO09383.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1303]
 gb|EWO11608.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1302]
 gb|EWO19545.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1301]
 gb|EWO22080.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1298]
 gb|EWO23368.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1296]
 gb|EWO30279.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1295]
 gb|EWO33227.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1293]
 gb|EWO43130.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1288]
 gb|EWO47261.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1285]
 gb|EWO47785.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1283]
 gb|EWO49815.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1282]
 gb|EWO52296.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1279]
 gb|EWO54669.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1280]
 gb|EWO61902.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1276]
 gb|EWO63842.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1274]
 gb|EWO66041.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1273]
 gb|EWO69733.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1271]
 gb|EWO80506.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1269]
 gb|EWO81087.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1268]
 gb|EWO84421.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1264]
 gb|EWO88073.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1267]
 gb|EWO93015.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1261]
 gb|EWO98987.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1258]
 gb|EWP03437.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1252]
 gb|EWP04962.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1254]
 gb|EWP07073.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1250]
 gb|EWP09503.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1249]
 gb|EWP12986.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1247]
 gb|EWP16638.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1246]
 gb|EWP17833.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1245]
 gb|EWP24132.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1243]
 gb|EWP25821.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1241]
 gb|EWP28461.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1239]
 gb|EWP32241.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1238]
 gb|EWP38662.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1236]
 gb|EWP40629.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1235]
 gb|EWP42729.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1234]
 gb|EWP46494.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1233]
 gb|EWP47912.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1232]
 gb|EWP49028.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1230]
 gb|EWP53538.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1231]
 gb|EWP54058.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1227]
 gb|EWP60919.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1222]
 gb|EWP62839.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1220]
 gb|EWP64982.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1219]
 gb|EWP67778.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1221]
 gb|EWP72315.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1218]
 gb|EWP79333.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1214]
 gb|EWP83743.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1209]
 gb|EWP84540.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1207]
 gb|EWP90804.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1206]
 gb|EWP93991.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1201]
 gb|EWP95515.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1204]
 gb|EWP98037.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1203]
 gb|EWQ01020.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1197]
 gb|EWQ01950.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1200]
 gb|EWQ08113.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1195]
 gb|EWQ10804.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1192]
 gb|EWQ13269.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1189]
 gb|EWQ16940.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1187]
 gb|EWQ17575.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1186]
 gb|EWQ22657.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1182]
 gb|EWQ24119.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1181]
 gb|EWQ24937.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1180]
 gb|EWQ28431.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1172]
 gb|EWQ30839.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1174]
 gb|EWQ34008.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1171]
 gb|EWQ40156.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1168]
 gb|EWQ40321.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1166]
 gb|EWQ43613.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1165]
 gb|EWQ48524.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1164]
 gb|EWQ54742.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1159]
 gb|EWQ55011.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1160]
 gb|EWQ58335.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1158]
 gb|EWQ60404.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1156]
 gb|EWQ67808.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1152]
 gb|EWQ71133.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1149]
 gb|EWQ75595.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1148]
 gb|EWQ78465.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1147]
 gb|EWQ80520.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1146]
 gb|EWQ82133.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1144]
 gb|EWQ84773.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1141]
 gb|EWQ87737.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1140]
 gb|EWQ90815.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1138]
 gb|EWQ93991.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1139]
 gb|EWQ96219.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1137]
 gb|EWQ99888.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1130]
 gb|EWR02589.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1136]
 gb|EWR08347.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1129]
 gb|EWR09839.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1128]
 gb|EWR13834.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1127]
 gb|EWR18098.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1122]
 gb|EWR21643.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1121]
 gb|EWR23641.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1116]
 gb|EWR26348.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1120]
 gb|EWR28060.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1117]
 gb|EWR32997.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1110]
 gb|EWR33970.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1113]
 gb|EWR35320.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1112]
 gb|EWR42205.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1108]
 gb|EWR42528.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1107]
 gb|EWR59805.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6109]
 gb|EWR61309.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6103]
 gb|EWR75639.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
MISS6176]
 gb|EWR81979.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
KINW6025]
 gb|EWR83940.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
MISS6132]
 gb|EWR91030.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJOS6123]
 gb|EWR93100.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJUD6098]
 gb|EWR95584.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
HOAG6047]
 gb|EWR99631.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SCLE6012]
 gb|EWS05222.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
HOAG6043]
 gb|EWS06223.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6017]
 gb|EWS16542.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
MISS6037]
 gb|EWS26587.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WMCA6006]
 gb|EWS31184.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
GGMC6004]
 gb|EWT15714.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F63704]
 gb|EWT19324.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T74005]
 gb|EWT41720.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F70051]
 gb|EWT50483.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T83715]
 gb|EWT52357.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M39260]
 gb|EWT54526.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M39274]
 gb|EWT79566.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H47224]
 gb|EWT81142.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T12849]
 gb|EWU17519.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H72129_090612]
 gb|EWU31085.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T28649]
 gb|EWU38734.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W79990_080112]
 gb|EWU42846.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W21479]
 gb|EWU49875.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M12709]
 gb|EWU60792.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W82310]
 gb|EWU63281.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H79484]
 gb|EWU69674.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W48969]
 gb|EWU75728.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W48973]
 gb|EWU87232.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H44713]
 gb|EWV08124.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F46798]
 gb|EWV13829.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F53404]
 gb|EWV17490.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F53399]
 gb|EWV18022.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H19476]
 gb|EWV24948.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M16552]
 gb|EWV29168.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T57402]
 gb|EWV30882.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W39821]
 gb|EWV46751.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F60349]
 gb|EWV57416.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W18442]
 gb|EWV60314.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F63787]
 gb|EWV68954.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M28485]
 gb|EWV71444.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T74091]
 gb|EWV74348.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W56912]
 gb|EWV84039.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H32135]
 gb|EWV94331.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T77565]
 gb|EWV97877.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F70077]
 gb|EWW01676.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M35933]
 gb|EWW01906.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M35938]
 gb|EWW08874.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M35955]
 gb|EWW12805.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M35965]
 gb|EWW14305.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H38226]
 gb|EWW17167.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H38239]
 gb|EWW23247.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F73187]
 gb|EWW27647.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H38215]
 gb|EWW34056.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T83705]
 gb|EWW41638.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F76218]
 gb|EWW42365.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W65885]
 gb|EWW46944.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M42507]
 gb|EWW55283.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M42485]
 gb|EWW66856.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M42496]
 gb|EWW71248.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W70599]
 gb|EWW72911.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W70568]
 gb|EWW78065.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H47171]
 gb|EWW83872.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H47183]
 gb|EWW86245.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M42518]
 gb|EWW92086.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F82573]
 gb|EWX01135.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W73676]
 gb|EWX03424.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W73592]
 gb|EWX09916.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H49917]
 gb|EWX14777.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F16106]
 gb|EWX15060.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F16107]
 gb|EWX23464.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F85414]
 gb|EWX23813.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F85691]
 gb|EWX25939.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F85660]
 gb|EWX38957.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F89075]
 gb|EWX47543.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F92089]
 gb|EWX53052.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H49864]
 gb|EWX57819.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H53188]
 gb|EWX79892.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M55890]
 gb|EWX91369.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M59255]
 gb|EWX92370.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M70013]
 gb|EWX95024.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T15889]
 gb|EWX97319.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T22051]
 gb|EWY02576.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T22071_080712]
 gb|EWY14320.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T32070]
 gb|EWY18326.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W73601]
 gb|EWY34287.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W83140]
 gb|EWY35024.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W86063]
 gb|EWY35405.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W83137]
 gb|EXM42981.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5852]
 gb|EXM45706.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5814]
 gb|EXM48507.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5855]
 gb|EXM52227.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR126]
 gb|EXM55026.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR116]
 gb|EXM56450.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR133]
 gb|EXM57909.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR104]
 gb|EXM61593.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR26]
 gb|EXM65165.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5789]
 gb|EXM67769.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5790]
 gb|EXM70768.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5791]
 gb|EXM74329.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5792]
 gb|EXM75933.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5793]
 gb|EXM78165.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5794]
 gb|EXM81991.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5795]
 gb|EXM84160.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5796]
 gb|EXM86599.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5797]
 gb|EXM91697.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5798]
 gb|EXM91894.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5799]
 gb|EXM95289.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5800]
 gb|EXM96932.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5801]
 gb|EXM99253.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5802]
 gb|EXN03787.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5803]
 gb|EXN06239.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5804]
 gb|EXN08857.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5805]
 gb|EXN10614.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5806]
 gb|EXN15061.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5807]
 gb|EXN17294.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5808]
 gb|EXN18387.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5809]
 gb|EXN22679.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5811]
 gb|EXN25065.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5812]
 gb|EXN27847.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5813]
 gb|EXN30910.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5816]
 gb|EXN31723.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5815]
 gb|EXN36617.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5817]
 gb|EXN39703.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5819]
 gb|EXN41325.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5820]
 gb|EXN44964.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5821]
 gb|EXN47651.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5822]
 gb|EXN49441.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5823]
 gb|EXN53060.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5824]
 gb|EXN54905.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5825]
 gb|EXN57545.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5826]
 gb|EXN61081.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5827]
 gb|EXN62131.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5828]
 gb|EXN65772.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5829]
 gb|EXN68342.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5830]
 gb|EXN71231.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5831]
 gb|EXN74262.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5832]
 gb|EXN75991.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5833]
 gb|EXN79128.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5834]
 gb|EXN81388.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5835]
 gb|EXN84885.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5836]
 gb|EXN87522.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5837]
 gb|EXN89956.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5838]
 gb|EXN93104.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5839]
 gb|EXN95615.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5840]
 gb|EXN96888.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5841]
 gb|EXO02598.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5843]
 gb|EXO03368.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5846]
 gb|EXO05776.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5845]
 gb|EXO08780.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5847]
 gb|EXO13329.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5848]
 gb|EXO14292.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5849]
 gb|EXO17437.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5850]
 gb|EXO20553.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5851]
 gb|EXO22356.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5853]
 gb|EXO25349.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5854]
 gb|EXO28952.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5856]
 gb|EXO30639.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5857]
 gb|EXO33569.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5858]
 gb|EXO36534.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5859]
 gb|EXO39321.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5861]
 gb|EXO41369.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5862]
 gb|EXO44445.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5863]
 gb|EXO46024.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5864]
 gb|EXO49471.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5865]
 gb|EXO50974.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3515]
 gb|EXO58053.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3508]
 gb|EXO59420.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3512]
 gb|EXO61843.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3505]
 gb|EXO65833.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3507]
 gb|EXO67216.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3504]
 gb|EXO75070.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W19276]
 gb|EXO76178.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W45757]
 gb|EXP30722.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W82239]
 gb|EXP44015.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W19270]
 gb|EXP46454.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W19256]
 gb|EXP49847.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W15995]
 gb|EXP52627.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W15990]
 gb|EXP54790.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W15976]
 gb|EXP62513.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W15974]
 gb|EXP71782.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T55959]
 gb|EXP73216.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T55960]
 gb|EXP94857.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M79671]
 gb|EXQ11651.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M17074]
 gb|EXQ15438.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H88185]
 gb|EXQ27375.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H72131]
 gb|EXQ43175.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H65863]
 gb|EXQ52336.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F64894]
 gb|EXQ54326.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F36099]
 gb|EXQ59798.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F36097]
 gb|EXQ72145.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F23613]
 gb|EXQ74196.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F23610]
 gb|EXQ76016.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F22648]
 gb|AHM70174.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|EXX98149.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3769]
 gb|EXY01464.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3907]
 gb|EXY02975.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR2070]
 gb|EYF14297.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F16104]
 gb|EYF19864.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F19470]
 gb|EYF25905.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F29447]
 gb|EYF27788.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H59303_080912]
 gb|EYF33991.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H59312_080912]
 gb|EYF46416.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T35594]
 gb|EYF51953.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T35604]
 gb|EYF53505.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W31983]
 gb|EYF57513.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F45749]
 gb|EYF61472.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F12749]
 gb|EYF62382.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W45755_111412]
 gb|EYF64981.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F12753]
 gb|EYF71004.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F19955]
 gb|EYF75443.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F87602]
 gb|EYF81584.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M72087]
 gb|EYF85553.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T16615]
 gb|EYF94028.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T16619]
 gb|EYF96289.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W75234]
 gb|EYG05521.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W89581]
 gb|EYG06825.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F32629]
 gb|EYG13752.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F42559]
 gb|EYG21294.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F52326]
 gb|EYG26680.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H15899]
 gb|EYG34624.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H19404]
 gb|EYG44273.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H81898]
 gb|EYG55316.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M90383]
 gb|EYG67768.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W42196]
 gb|EYG83818.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F34824]
 gb|EYH01876.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M66407]
 gb|EYH07928.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M79654]
 gb|EYH10203.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T22073]
 gb|EYH21208.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W80011]
 gb|EYH29242.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F64891]
 gb|EYH32325.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H47139]
 gb|EYH36409.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H65856]
 gb|EYH36545.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H88188]
 gb|EYH40951.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T39105]
 gb|EYH45093.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W45758]
 gb|EYH47489.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W82238]
 gb|EYJ02306.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W53395]
 gb|EYJ12508.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F12915]
 gb|EYJ12852.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M35954]
 gb|EYJ16985.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F12917]
 gb|EYJ22948.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F19466]
 gb|EYJ30809.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
S29036]
 gb|EYJ37518.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W86059]
 gb|EYJ41893.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F42568]
 gb|EYJ47005.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F42580]
 gb|EYJ47374.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F42579]
 gb|EYJ53795.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F42582]
 gb|EYJ54964.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F45759]
 gb|EYJ62500.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F59332]
 gb|EYJ63735.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F59335]
 gb|EYJ72303.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H19392]
 gb|EYJ72923.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H15911]
 gb|EYJ74602.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H22632]
 gb|EYJ81489.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H43690]
 gb|EYJ84040.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H81901]
 gb|EYJ87045.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H43700]
 gb|EYJ94979.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H88163]
 gb|EYJ95534.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H88149]
 gb|EYK02774.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M13074]
 gb|EYK05125.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M17027]
 gb|EYK14749.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M35158]
 gb|EYK18361.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M45726]
 gb|EYK20147.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M24419]
 gb|EYK23491.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M54162]
 gb|EYK26685.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M57746]
 gb|EYK28613.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M79664]
 gb|EYK30925.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M79673]
 gb|EYK35205.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M83332]
 gb|EYK37135.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M90396]
 gb|EYK42012.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T13096]
 gb|EYK49860.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T45836]
 gb|EYK52555.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T49198]
 gb|EYK57796.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T49201]
 gb|EYK69082.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T59618]
 gb|EYK87200.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W19220]
 gb|EYK90244.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W25787]
 gb|EYK92871.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W25814]
 gb|EYK95849.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W32014]
 gb|EYL00046.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W38532]
 gb|EYL08517.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W45747]
 gb|EYL17220.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W62344]
 gb|EYL21829.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W62354]
 gb|EYL27102.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F23585]
 gb|EYL35674.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F29214]
 gb|EYL47050.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F56969]
 gb|EYL56397.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H20321]
 gb|EYL57046.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H20322]
 gb|EYL71146.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H89939]
 gb|EYL73424.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H89941]
 gb|EYL75460.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H83025]
 gb|EYL76287.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M13559]
 gb|EYL82570.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M17299]
 gb|EYL83890.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M17301]
 gb|EYL89538.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M25139]
 gb|EYL98258.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M66410]
 gb|EYM04480.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M91652]
 gb|EYM05563.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T15928]
 gb|EYM09972.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T15898]
 gb|EYM15754.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T22074]
 gb|EYM30272.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W34837]
 gb|EYM32127.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W34839]
 gb|EYM35561.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W34841]
 gb|EYM37033.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W34848]
 gb|EYM39548.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W41757]
 gb|EYM46906.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W75242]
 gb|EYM55809.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W82228]
 gb|EYM56552.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W89577]
 gb|EYM59212.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W80013]
 gb|EYM61506.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W89579]
 gb|EYM65110.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3519]
 gb|EYM65650.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3525]
 gb|EYM65874.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3518]
 gb|EYM70835.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3529]
 gb|EYM71724.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3534]
 gb|EYM73323.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3548]
 gb|EYM78431.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3551]
 gb|EYM78976.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3555]
 gb|EYM85247.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3562]
 gb|EYM86620.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3565]
 gb|EYM88429.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3574]
 gb|EYM92418.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3567]
 gb|EYM94671.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3575]
 gb|EYM96918.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3576]
 gb|EYN01307.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3578]
 gb|EYN02449.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3583]
 gb|EYN04887.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3581]
 gb|EYN08605.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3584]
 gb|EYN13290.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3586]
 gb|EYN14622.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3590]
 gb|EYN15584.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3587]
 gb|EYN20405.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3596]
 gb|EYN20940.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3592]
 gb|EYN22481.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3591]
 gb|EYN26839.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3599]
 gb|EYN32058.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3609]
 gb|EYN32694.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3612]
 gb|EYN33888.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3608]
 gb|EYN41304.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3613]
 gb|EYN42765.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3616]
 gb|EYN44153.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3617]
 gb|EYN47076.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3624]
 gb|EYN47238.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3627]
 gb|EYN52291.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3628]
 gb|EYN54676.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3629]
 gb|EYN55663.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3632]
 gb|EYN59137.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3752]
 gb|EYN63616.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3758]
 gb|EYN64589.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3760]
 gb|EYN69103.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3761]
 gb|EYN69600.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3765]
 gb|EYN72051.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3762]
 gb|EYN76698.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3776]
 gb|EYN78996.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3767]
 gb|EYN79796.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3772]
 gb|EYN84537.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3781]
 gb|EYN85255.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3779]
 gb|EYN87813.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3782]
 gb|EYN90925.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3788]
 gb|EYN93934.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3790]
 gb|EYN97156.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3794]
 gb|EYN98498.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3796]
 gb|EYO03449.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3799]
 gb|EYO03988.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3842]
 gb|EYO05237.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3840]
 gb|EYO12059.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3845]
 gb|EYO14207.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3844]
 gb|EYO15181.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3847]
 gb|EYO18336.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3861]
 gb|EYO22019.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3859]
 gb|EYO23607.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3862]
 gb|EYO26615.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3868]
 gb|EYO27749.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3864]
 gb|EYO32325.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3870]
 gb|EYO34550.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3871]
 gb|EYO35755.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3886]
 gb|EYO39325.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3885]
 gb|EYO45148.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3892]
 gb|EYO46675.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3894]
 gb|EYO47999.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3891]
 gb|EYO52806.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3901]
 gb|EYO53417.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3897]
 gb|EYO56064.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3902]
 gb|EYO57796.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3911]
 gb|EYO60994.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3918]
 gb|EYO62822.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3913]
 gb|EYO67436.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3919]
 gb|EYO71379.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3928]
 gb|EYO72329.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3924]
 gb|EYO74683.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3930]
 gb|EYO79318.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5880]
 gb|EYO80272.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR22]
 gb|EYO80740.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3933]
 gb|EYO85734.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5878]
 gb|EYO86529.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5875]
 gb|EYO90868.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5874]
 gb|EYO94431.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5873]
 gb|EYO95285.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5877]
 gb|EYO99277.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1065]
 gb|EYP01705.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR966]
 gb|EYP05955.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1082]
 gb|EYP06496.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR951]
 gb|EYP10577.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1067]
 gb|EYP11902.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1083]
 gb|EYP14942.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1086]
 gb|EYP15819.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1084]
 gb|EYP19411.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1090]
 gb|EYP23162.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1161]
 gb|EYP23569.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1157]
 gb|EYP28100.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1158]
 gb|EYP30748.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1174]
 gb|EYP32133.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1176]
 gb|EYP35468.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1183]
 gb|EYP39097.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1275]
 gb|EYP39740.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1200]
 gb|EYP43687.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1291]
 gb|EYP47795.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1278]
 gb|EYP48215.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1276]
 gb|EYP53266.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1295]
 gb|EYP54841.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1293]
 gb|EYP55366.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1310]
 gb|EYP61620.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1311]
 gb|EYP63509.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1313]
 gb|EYP65640.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1370]
 gb|EYP66827.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1369]
 gb|EYP70562.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1490]
 gb|EYP73504.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1492]
 gb|EYP77596.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1692]
 gb|EYP78695.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1507]
 gb|EYP79166.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1698]
 gb|EYP84704.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1800]
 gb|EYP85245.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1810]
 gb|EYP89375.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1811]
 gb|EYP89931.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1813]
 gb|EYP94427.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1814]
 gb|EYP97605.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1815]
 gb|EYP98539.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1842]
 gb|EYQ02722.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1859]
 gb|EYQ03788.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1862]
 gb|EYQ04326.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1874]
 gb|EYQ09315.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1885]
 gb|EYQ09954.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1883]
 gb|EYQ15610.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1890]
 gb|EYQ16277.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1936]
 gb|EYQ20400.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1926]
 gb|EYQ22432.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1937]
 gb|EYQ27007.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1938]
 gb|EYQ29337.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1942]
 gb|EYQ30093.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1941]
 gb|EYQ32917.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1939]
 gb|EYQ36757.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1954]
 gb|EYQ40252.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1956]
 gb|EYQ41471.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1955]
 gb|EYQ44002.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1961]
 gb|EYQ47187.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1995]
 gb|EYQ47996.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR1980]
 gb|EYQ51900.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR2000]
 gb|EYQ54279.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR2002]
 gb|EYQ57503.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR2018]
 gb|EYQ60435.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR2019]
 gb|EYQ61098.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR2026]
 gb|EYQ65934.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR2067]
 gb|EYQ68650.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR2068]
 gb|EYQ68909.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR2072]
 gb|EYQ73543.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR2075]
 gb|EYQ75795.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3143]
 gb|EYQ80484.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3148]
 gb|EYQ82285.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3144]
 gb|EYQ87298.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3150]
 gb|EYQ88065.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3152]
 gb|EYQ90212.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3153]
 gb|EYQ93162.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3156]
 gb|EYQ94045.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3157]
 gb|EYQ98586.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3162]
 gb|EYR00203.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3163]
 gb|EYR01555.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3166]
 gb|EYR06648.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3177]
 gb|EYR07189.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3175]
 gb|EYR07497.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3176]
 gb|EYR13536.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3178]
 gb|EYR16744.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3183]
 gb|EYR17455.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3179]
 gb|EYR20832.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3198]
 gb|EYR25337.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR3236]
 gb|EYR25863.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5890]
 gb|EYR26994.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5889]
 gb|EYR32062.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5888]
 gb|EYR33402.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5886]
 gb|EYR34114.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5887]
 gb|EYR41378.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5885]
 gb|EYR42731.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5881]
 gb|EYR44242.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5884]
 gb|EYR48810.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5872]
 gb|EYR51527.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5870]
 gb|EYR54021.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5871]
 gb|EYR57485.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5868]
 gb|EYR59523.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5869]
 gb|EZI11433.1| ThiF family protein [Staphylococcus aureus subsp. aureus CO-30]
 gb|KDA08282.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|KDA08667.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
MM66]
 emb|CDP43353.1| Molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus]
 emb|CDP46334.1| Molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus]
 emb|CDP58300.1| Molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus]
 gb|KDP52261.1| ThiF family protein [Staphylococcus aureus subsp. aureus CO-99]
 emb|CDP39814.1| Molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus]
Length=334

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_031893595.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|EVD93497.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
LAMC6065]
Length=334

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_006190880.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus]
 gb|ENN60146.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1216]
 gb|EWP75213.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1217]
Length=334

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_000076923.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 ref|NP_647011.1| molybdopterin biosynthesis protein moeB [Staphylococcus aureus 
subsp. aureus MW2]
 dbj|BAB96059.1| molybdopterin biosynthesis protein moeB [Staphylococcus aureus 
subsp. aureus MW2]
 gb|EFH24520.1| ThiF family protein [Staphylococcus aureus subsp. aureus ATCC 
51811]
 gb|EFK83097.1| ThiF family protein [Staphylococcus aureus subsp. aureus TCH70]
 gb|EHM74805.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21334]
 gb|EHT39783.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
CIG1835]
 gb|EHT96500.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
CIGC128]
 gb|ELY16511.1| molybdopterin biosynthesis protein moeB [Staphylococcus aureus 
KT/314250]
 gb|ETO54148.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
MUF256]
 gb|ETO58066.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
MUM475]
 gb|EUZ77694.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0483]
 gb|EVC83750.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6035]
 gb|EVF80570.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
MISS6027]
 gb|EWS46321.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
MISS6103]
 gb|EZH97120.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21304]
 gb|EZI17183.1| ThiF family protein [Staphylococcus aureus subsp. aureus CO-41]
 gb|EZT87037.1| hypothetical protein U927_01648 [Staphylococcus aureus 12S00972]
 gb|EZT91065.1| hypothetical protein U922_01692 [Staphylococcus aureus 11S01420]
 gb|EZU13436.1| hypothetical protein U911_00623 [Staphylococcus aureus 07-03451]
 gb|EZU17758.1| hypothetical protein U910_01699 [Staphylococcus aureus 07-03450]
 gb|EZU28149.1| hypothetical protein U908_01150 [Staphylococcus aureus 08-02906]
 gb|EZU64848.1| hypothetical protein U985_01333 [Staphylococcus aureus 1110803248]
 gb|EZU70617.1| hypothetical protein U988_00578 [Staphylococcus aureus 1111000175]
 gb|EZU71791.1| hypothetical protein U989_01807 [Staphylococcus aureus 1111000177]
 gb|EZU76588.1| hypothetical protein U991_00308 [Staphylococcus aureus 1111100370]
 gb|EZV00581.1| hypothetical protein U919_00682 [Staphylococcus aureus 11S00605]
 gb|EZV05091.1| hypothetical protein U921_01071 [Staphylococcus aureus 11S01415]
 gb|EZV08625.1| hypothetical protein U914_00781 [Staphylococcus aureus 12-03481]
 gb|EZV15766.1| hypothetical protein U924_01140 [Staphylococcus aureus 12S00040]
 gb|EZV29767.1| hypothetical protein U930_00393 [Staphylococcus aureus 12-ST01564]
 gb|EZV32576.1| hypothetical protein U932_01861 [Staphylococcus aureus 13-ST00049]
 gb|EZW84110.1| hypothetical protein U887_00312 [Staphylococcus aureus 7-B-1]
Length=334

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_000076912.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 ref|YP_008129151.1| moeZ/MoeB domain protein [Staphylococcus aureus CA-347]
 gb|EEV71141.1| molybdopterin biosynthesis protein moeB [Staphylococcus aureus 
A9635]
 gb|EGS94637.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21200]
 gb|EHM62545.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21202]
 gb|EHM86173.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21194]
 gb|EHT80020.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
CIG1524]
 gb|ENM78116.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1311]
 gb|AGO30646.1| moeZ/MoeB domain protein [Staphylococcus aureus CA-347]
 gb|EUE75370.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0684]
 gb|EUE86262.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0690]
 gb|EUF23597.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0715]
 gb|EUH27242.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0745]
 gb|EUH60321.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0896]
 gb|EUN37616.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus 300-169]
 gb|EUN38290.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus 301-188]
 gb|EUV89122.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0236]
 gb|EUX09626.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0318]
 gb|EVJ82056.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0750]
 gb|EVK04410.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0777]
 gb|EVK25399.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0790]
 gb|EVK85881.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0821]
 gb|EVK87031.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0820]
 gb|EVL53901.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0866]
 gb|EVM42173.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0916]
 gb|EVM78135.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0937]
 gb|EVP71178.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0761]
 gb|EWO31739.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1292]
 gb|EWO57481.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1278]
 gb|EWO68980.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1272]
 gb|EWO94613.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1260]
 gb|EWP29327.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1237]
 gb|EWP58823.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1225]
 gb|EWP77244.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1213]
 gb|EWP86373.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1208]
 gb|EWQ64826.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1151]
 emb|CEF81679.1| Molybdopterin-synthase adenylyltransferase [Staphylococcus aureus]
Length=334

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_000076929.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 ref|YP_187076.1| molybdopterin biosynthesis MoeB protein [Staphylococcus aureus 
subsp. aureus COL]
 ref|YP_494862.1| molybdopterin biosynthesis protein B [Staphylococcus aureus subsp. 
aureus USA300_FPR3757]
 ref|YP_501008.1| hypothetical protein SAOUHSC_02545 [Staphylococcus aureus subsp. 
aureus NCTC 8325]
 ref|YP_001333210.1| molybdopterin biosynthesis MoeB [Staphylococcus aureus subsp. 
aureus str. Newman]
 ref|YP_001576130.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus USA300_TCH1516]
 ref|YP_005291635.1| molybdopterin biosynthesis protein B [Staphylococcus aureus subsp. 
aureus VC40]
 ref|YP_005745640.1| thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein [Staphylococcus 
aureus subsp. aureus str. JKD6008]
 ref|YP_005753539.1| Molybdopterin biosynthesis MoeB [Staphylococcus aureus subsp. 
aureus T0131]
 ref|YP_005732373.1| putative molybdopterin synthase sulfurylase [Staphylococcus aureus 
subsp. aureus TW20]
 ref|YP_007869334.1| Molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
M1]
 ref|YP_008169380.1| Sulfur carrier protein moaD adenylyltransferase [Staphylococcus 
aureus Bmb9393]
 ref|YP_008716961.1| Molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus Z172]
 gb|AAW38489.1| molybdopterin biosynthesis MoeB protein, putative [Staphylococcus 
aureus subsp. aureus COL]
 gb|ABD20991.1| molybdopterin biosynthesis protein B [Staphylococcus aureus subsp. 
aureus USA300_FPR3757]
 gb|ABD31559.1| conserved hypothetical protein [Staphylococcus aureus subsp. 
aureus NCTC 8325]
 dbj|BAF68448.1| molybdopterin biosynthesis MoeB [Staphylococcus aureus subsp. 
aureus str. Newman]
 gb|ABX30251.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus USA300_TCH1516]
 gb|EEV84315.1| molybdopterin biosynthesis protein B [Staphylococcus aureus A5948]
 gb|EEW44850.1| molybdopterin biosynthesis protein moeB [Staphylococcus aureus 
930918-3]
 gb|EEW47953.1| molybdopterin biosynthesis protein moeB [Staphylococcus aureus 
D30]
 emb|CBI50273.1| putative molybdopterin synthase sulfurylase [Staphylococcus aureus 
subsp. aureus TW20]
 gb|EFB98605.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
A9765]
 gb|EFG40616.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
A9754]
 gb|ADL66326.1| thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein [Staphylococcus 
aureus subsp. aureus str. JKD6008]
 gb|EFM07897.1| ThiF family protein [Staphylococcus aureus subsp. aureus ATCC 
BAA-39]
 gb|EFU28521.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus CGS01]
 gb|EFW32044.1| ThiF family protein [Staphylococcus aureus subsp. aureus MRSA131]
 gb|EFW35236.1| ThiF family protein [Staphylococcus aureus subsp. aureus MRSA177]
 gb|AEB89373.1| Molybdopterin biosynthesis MoeB [Staphylococcus aureus subsp. 
aureus T0131]
 gb|EGG68414.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21189]
 gb|EHM56428.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21209]
 gb|EHM61348.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21178]
 gb|EHM69097.1| ThiF family protein [Staphylococcus aureus subsp. aureus VCU006]
 gb|EHM80573.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21340]
 gb|EHM82111.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21232]
 gb|EHO95002.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21283]
 gb|AEZ38201.1| molybdopterin biosynthesis protein B [Staphylococcus aureus subsp. 
aureus VC40]
 gb|EHS09008.1| ThiF family protein [Staphylococcus aureus subsp. aureus IS-24]
 gb|EHS19122.1| ThiF family protein [Staphylococcus aureus subsp. aureus IS-88]
 gb|EHS20755.1| ThiF family protein [Staphylococcus aureus subsp. aureus IS-91]
 gb|EHS25866.1| ThiF family protein [Staphylococcus aureus subsp. aureus IS-111]
 gb|EHS71238.1| ThiF family protein [Staphylococcus aureus subsp. aureus IS-125]
 gb|EHS77973.1| ThiF family protein [Staphylococcus aureus subsp. aureus IS-157]
 gb|EHS79499.1| ThiF family protein [Staphylococcus aureus subsp. aureus IS-189]
 gb|EHT23704.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
CIG1114]
 gb|EHT52021.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
CIG547]
 gb|EHT64548.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
CIG1612]
 gb|EHT69171.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
CIG1770]
 gb|EHT72230.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
CIG2018]
 gb|EHT90013.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
CIGC345D]
 gb|EHT91646.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
CIGC93]
 gb|EID88333.1| ThiF family protein [Staphylococcus aureus subsp. aureus CO-23]
 gb|EKU07866.1| Molybdopterin biosynthesis protein [Staphylococcus aureus CN79]
 gb|ELP27875.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus DSM 20231]
 gb|ELP42539.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21282]
 gb|ENI22934.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
HI010B]
 gb|ENI27807.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
HI010]
 gb|ENI30582.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
HI022]
 gb|ENI35095.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
HI049B]
 gb|ENI36379.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
HI013]
 gb|ENI38310.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
HI049C]
 gb|ENI41409.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
HI049]
 gb|ENI43630.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
HI111]
 gb|ENI47811.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
HIF003_B2N-C]
 gb|ENI52385.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
HI168]
 gb|ENI64938.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0055]
 gb|ENJ25948.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0221]
 gb|ENJ30971.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0239]
 gb|ENJ58437.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0312]
 gb|ENJ75943.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0340]
 gb|ENJ96886.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0396]
 gb|ENK16083.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0424]
 gb|ENK29412.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0468]
 gb|ENK53828.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0531]
 gb|ENK86904.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0633]
 gb|ENL37445.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0831]
 gb|ENL80637.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1007]
 gb|ENM13062.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1064]
 gb|ENM50927.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1223]
 gb|ENN09664.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1462]
 emb|CCW22599.1| Molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
M1]
 gb|EOR39596.1| molybdopterin biosynthesis protein moeB [Staphylococcus aureus 
subsp. aureus MRGR3]
 gb|AGP29216.1| Sulfur carrier protein moaD adenylyltransferase [Staphylococcus 
aureus Bmb9393]
 gb|AGY90476.1| Molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus Z172]
 gb|ESR29540.1| Putative molybdopterin synthase sulfurylase [Staphylococcus aureus 
subsp. aureus PSP1996]
 gb|ETD10982.1| hypothetical protein HMPREF1269_00871 [Staphylococcus aureus 
subsp. aureus KPL1828]
 gb|EUD83064.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0630]
 gb|EUD93325.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0636]
 gb|EUE05925.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0645]
 gb|EUE25228.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0658]
 gb|EUE40379.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0668]
 gb|EUE51564.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0671]
 gb|EUF16299.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0709]
 gb|EUF46090.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0729]
 gb|EUF49233.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0730]
 gb|EUF97180.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0511]
 gb|EUG01303.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0524]
 gb|EUG55815.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0284]
 gb|EUG70451.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0352]
 gb|EUH02177.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0002]
 gb|EUH12834.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0047]
 gb|EUH19369.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0088]
 gb|EUH20989.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0059]
 gb|EUH30588.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0113]
 gb|EUI03808.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1375]
 gb|EUI20214.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1427]
 gb|EUI57365.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1183]
 gb|EUI73782.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1294]
 gb|EUI91566.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1346]
 gb|EUP43303.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
GGMC6057]
 gb|EUP51218.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
PLAC6058]
 gb|EUP54250.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WAMC6081]
 gb|EUP57594.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6146]
 gb|EUP59728.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
KINW6062]
 gb|EUP62977.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
KINW6061]
 gb|EUP63622.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WMCA6123]
 gb|EUP67806.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
FVRH6138]
 gb|EUP70781.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WMCA6100]
 gb|EUP83071.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WMCA6091]
 gb|EUP87087.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WAMC6108]
 gb|EUP87773.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6134]
 gb|EUP92139.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6126]
 gb|EUP96466.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
COAS6095]
 gb|EUP98792.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WMCA6084]
 gb|EUQ03147.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WMCA6180]
 gb|EUQ06186.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
LAMC6094]
 gb|EUQ09104.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
FVRH6076]
 gb|EUQ10629.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6085]
 gb|EUQ12442.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJOS6139]
 gb|EUQ16750.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
LAMC6066]
 gb|EUQ17602.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
KINB6009]
 gb|EUQ22917.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6065]
 gb|EUQ27552.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJUD6114]
 gb|EUQ32832.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
HSOU6002]
 gb|EUQ33756.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SMMC6087]
 gb|EUQ38627.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6057]
 gb|EUQ45824.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJUD6022]
 gb|EUQ54500.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
AGEN6010]
 gb|EUQ57126.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SCLE6005]
 gb|EUQ66038.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
COAS6001]
 gb|EUQ84834.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJOS6098]
 gb|EUQ87899.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
CHOC6045]
 gb|EUQ88196.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
COAS6039]
 gb|EUQ94393.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
TUSH6001]
 gb|EUQ96702.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6019]
 gb|EUR01053.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
MISS6007]
 gb|EUR01401.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
HOAG6059]
 gb|EUR11387.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6015]
 gb|EUR11831.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SCOA6012]
 gb|EUR12922.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
LAMC0037]
 gb|EUR17804.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJUD6064]
 gb|EUR25201.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
COAS6025]
 gb|EUR25760.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SMMC6007]
 gb|EUR31112.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
GGMC6008]
 gb|EUR32481.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJOS6061]
 gb|EUR38223.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJOS6051]
 gb|EUR52819.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0007]
 gb|EUR56704.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0008]
 gb|EUS16994.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0037]
 gb|EUS86993.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0080]
 gb|EUT22081.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0097]
 gb|EUT37085.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0100]
 gb|EUT38896.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0107]
 gb|EUT40394.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0101]
 gb|EUT46316.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0109]
 gb|EUT51696.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0111]
 gb|EUT75598.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0123]
 gb|EUV00455.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0186]
 gb|EUX44628.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0337]
 gb|EUX70155.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0353]
 gb|EUY59543.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0413]
 gb|EUZ32250.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0453]
 gb|EUZ35455.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0454]
 gb|EUZ38849.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0457]
 gb|EUZ57684.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0469]
 gb|EUZ81413.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0486]
 gb|EVA39209.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0527]
 gb|EVA60560.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0542]
 gb|EVB01769.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0563]
 gb|EVB04598.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0564]
 gb|EVB11121.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0567]
 gb|EVB22947.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0577]
 gb|EVB57930.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0593]
 gb|EVB95036.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0615]
 gb|EVC16209.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
LAMC0024]
 gb|EVC21115.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJOS6050]
 gb|EVC22827.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
AMMC6040]
 gb|EVC30720.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJOS6053]
 gb|EVC31930.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
AMMC6051]
 gb|EVC47066.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJOS6072]
 gb|EVC48914.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SMMC0005]
 gb|EVC50965.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WMCA6041]
 gb|EVC56217.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WAMC6010]
 gb|EVC56506.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJUD6063]
 gb|EVC65301.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
MISS6017]
 gb|EVC79146.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJOS6076]
 gb|EVC83887.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6037]
 gb|EVC86421.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SCOA6011]
 gb|EVC92460.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WAMC6013]
 gb|EVD02585.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6018]
 gb|EVD13713.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
PLAC6017]
 gb|EVD16199.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJUD6086]
 gb|EVD25402.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
COAS6038]
 gb|EVD27579.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJUD6087]
 gb|EVD37849.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJOS6100]
 gb|EVD41381.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
LPIH6021]
 gb|EVD44648.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WMCS6039]
 gb|EVD47892.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6045]
 gb|EVD52403.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6048]
 gb|EVD57112.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
AMMC6071]
 gb|EVD61096.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
AMMC6070]
 gb|EVD63099.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
AMMC6072]
 gb|EVD67426.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
AMMC6075]
 gb|EVD71565.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
MISS6110]
 gb|EVD74197.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
LAMC0050]
 gb|EVD91277.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
FVRH6002]
 gb|EVD94506.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
HOAG6084]
 gb|EVE07118.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJOS6001]
 gb|EVE13036.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
AMMC6002]
 gb|EVE18724.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
AMMC6011]
 gb|EVE19188.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
AMMC6003]
 gb|EVE26160.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
AMMC6008]
 gb|EVE30003.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
LAMC0001]
 gb|EVE50517.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJUD6015]
 gb|EVE58537.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
HOAG6017]
 gb|EVE67429.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
LAMC0013]
 gb|EVE69316.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
AMMC6015]
 gb|EVE74333.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
LAMC0011]
 gb|EVE83279.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
HBHO6002]
 gb|EVE85858.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
LPIH6001]
 gb|EVF03551.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6009]
 gb|EVF08742.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SCOA6006]
 gb|EVF23482.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
COAS6049]
 gb|EVF24594.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
KINW6003]
 gb|EVF42233.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
MISS6033]
 gb|EVF48683.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
COLL6021]
 gb|EVF51250.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJUD6040]
 gb|EVF57506.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6042]
 gb|EVF58540.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
LPIH6011]
 gb|EVF68170.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
PLAC6004]
 gb|EVF73392.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SCLE6011]
 gb|EVF87082.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
MISS6125]
 gb|EVF88001.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6057]
 gb|EVF90788.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6056]
 gb|EVG00840.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SCOA6048]
 gb|EVG09087.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
COAS6052]
 gb|EVG24019.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJUD6110]
 gb|EVG24945.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJUD6111]
 gb|EVG37304.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
MISS6119]
 gb|EVG42534.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
COAS6055]
 gb|EVG46082.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
COAS6059]
 gb|EVG50510.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WMCS6055]
 gb|EVG56427.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
GGMC6049]
 gb|EVG68413.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6065]
 gb|EVG82875.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
FVRH6021]
 gb|EVG95239.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6071]
 gb|EVG96759.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6075]
 gb|EVH05769.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WMCA6015]
 gb|EVH18720.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WMCA6025]
 gb|EVH62380.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
FVRH6052]
 gb|EVH73477.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
MISS6057]
 gb|EVH77322.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SCLE6029]
 gb|EVH80240.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WMCS6079]
 gb|EVH85503.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
TUSH6007]
 gb|EVH93104.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6101]
 gb|EVH93636.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
FVRH6067]
 gb|EVH98809.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
FVRH6074]
 gb|EVI01914.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
GGMC6018]
 gb|EVI07725.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SCLE6035]
 gb|EVI10083.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
COAS6087]
 gb|EVI31900.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WAMC6043]
 gb|EVI37673.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6102]
 gb|EVI59674.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WAMC6102]
 gb|EVI71250.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WMCA6092]
 gb|EVI79853.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
GGMC6027]
 gb|EVI82296.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
LAMC6115]
 gb|EVI87679.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
PLAC6043]
 gb|EVI91128.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6124]
 gb|EVI96086.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
FVRH6131]
 gb|EVI97594.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
FVRH6130]
 gb|EVJ01205.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
COAS6112]
 gb|EVJ05566.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
COAS6114]
 gb|EVJ07035.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
FVRH6132]
 gb|EVJ10997.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6137]
 gb|EVJ14383.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6140]
 gb|EVJ16265.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WAMC6060]
 gb|EVJ17570.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
GGMC6036]
 gb|EVJ22685.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
CHAP6035]
 gb|EVJ29267.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
HBHO6022]
 gb|EVJ43300.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6145]
 gb|EVJ44155.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6144]
 gb|EVJ53330.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6147]
 gb|EVJ58617.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WAMC6080]
 gb|EVJ68046.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
FVRH6118]
 gb|EVJ69959.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6129]
 gb|EVJ79947.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
KINW6048]
 gb|EVJ98545.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0773]
 gb|EVK45374.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0800]
 gb|EVK47388.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0801]
 gb|EVL00051.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0833]
 gb|EVL37890.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0853]
 gb|EVL43503.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0858]
 gb|EVL97076.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0893]
 gb|EVM00447.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0894]
 gb|EVM28680.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0910]
 gb|EVM85355.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0945]
 gb|EVN47170.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0982]
 gb|EVN94732.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1017]
 gb|EVO22983.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1035]
 gb|EVO50928.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1056]
 gb|EVP07296.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1094]
 gb|EVP10120.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1101]
 gb|EVP67626.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0758]
 gb|EVP72435.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0760]
 gb|EVP86335.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0766]
 gb|EVP90637.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0768]
 gb|EVP95789.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0771]
 gb|EVQ17166.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1382]
 gb|EVQ48684.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1400]
 gb|EVQ61065.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1408]
 gb|EVR26581.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1436]
 gb|EVR45599.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1447]
 gb|EVR59301.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1453]
 gb|EVS18202.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1348]
 gb|EVS24013.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1351]
 gb|EVU24331.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W25097]
 gb|EVU25336.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M81490]
 gb|EVU33099.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W28469]
 gb|EVU34298.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T45974]
 gb|EVU39479.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F41886]
 gb|EVU48723.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M85201]
 gb|EVU62744.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F45300]
 gb|EVU76561.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M92086]
 gb|EVU83773.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T56203]
 gb|EVU85942.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W38597]
 gb|EVU93673.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M13384]
 gb|EVU94251.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M13403]
 gb|EVU99343.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W35356]
 gb|EVV05845.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H19520]
 gb|EVV15336.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F54461]
 gb|EVV28369.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M52055]
 gb|EVV31368.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H60145]
 gb|EVV34948.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W85047]
 gb|EVV41389.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T62328]
 gb|EVV45158.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M20676]
 gb|EVV48808.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T66282]
 gb|EVV50686.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W48872]
 gb|EVV52047.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T66286]
 gb|EVV55081.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F90608]
 gb|EVV58977.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M45245]
 gb|EVV70453.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M64164]
 gb|EVV73191.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M67290]
 gb|EVV80102.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M64191]
 gb|EVV80723.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H75198]
 gb|EVV86041.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M70590]
 gb|EVV89152.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T34696]
 gb|EVV91305.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T34703]
 gb|EVV94383.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W21472]
 gb|EVV99064.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H81437]
 gb|EVW01236.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W24216]
 gb|EVW12749.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H84492]
 gb|EVW14880.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H84507]
 gb|EVW23679.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F43676]
 gb|EVW28506.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W33796]
 gb|EVW32016.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T47181]
 gb|EVW34627.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F46632]
 gb|EVW55536.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W42929]
 gb|EVW57085.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W42932]
 gb|EVW74493.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H21935]
 gb|EVW79322.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H21924]
 gb|EVW81670.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F59156]
 gb|EVW84634.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W48906]
 gb|EVW93137.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H24884]
 gb|EVX06446.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W51776]
 gb|EVX13419.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H27761]
 gb|EVX19713.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M24400]
 gb|EVX30165.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T71868]
 gb|EVX34058.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T71872]
 gb|EVX35526.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H33602]
 gb|EVX40906.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H33636]
 gb|EVX48176.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W60774]
 gb|EVX55832.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W60801]
 gb|EVX59351.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F74139]
 gb|EVX70270.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F76996]
 gb|EVX77914.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H42737]
 gb|EVX84361.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H42759]
 gb|EVX89033.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F80381]
 gb|EVY05282.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H45765]
 gb|EVY18237.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T87526]
 gb|EVY18895.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F83272]
 gb|EVY22447.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W73060]
 gb|EVY26487.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H48646]
 gb|EVY43014.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T12923]
 gb|EVY54024.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F92765]
 gb|EVY68690.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H71785]
 gb|EVY74047.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H71781]
 gb|EVY75363.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T45945]
 gb|EVY86920.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H79477]
 gb|EVY87937.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H23829]
 gb|EVY90637.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H23830]
 gb|EVZ03160.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H37776]
 gb|EVZ08001.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H37781]
 gb|EVZ09966.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F77710]
 gb|EVZ14941.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
S39407]
 gb|EVZ19243.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F81035]
 gb|EVZ24846.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T12805]
 gb|EVZ25211.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
S39411]
 gb|EVZ28405.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T12818]
 gb|EVZ35175.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F19383]
 gb|EVZ39447.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F26088]
 gb|EVZ39540.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F22893]
 gb|EVZ43334.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F22898]
 gb|EVZ48244.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F63154]
 gb|EVZ57264.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F74220]
 gb|EVZ82044.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H31290]
 gb|EVZ85694.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H40575]
 gb|EVZ89854.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H40583]
 gb|EWA08582.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H64303]
 gb|EWA09882.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H70821]
 gb|EWA21466.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H77094]
 gb|EWA37376.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M31588]
 gb|EWA42451.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M65003]
 gb|EWA47526.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M68467]
 gb|EWA52219.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M71813]
 gb|EWA56863.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M74952]
 gb|EWA57290.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T26751]
 gb|EWA62664.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T30033]
 gb|EWA66481.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T33147]
 gb|EWA70420.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T39328]
 gb|EWA75444.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T62346]
 gb|EWA86438.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T69716]
 gb|EWB00332.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T76030]
 gb|EWB19126.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W12628]
 gb|EWB21776.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W15997]
 gb|EWB62419.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W85440]
 gb|EWB69096.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W88555]
 gb|EWB76843.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W31947]
 gb|EWB79985.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H12822]
 gb|EWB83049.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T59609]
 gb|EWB87611.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M16486]
 gb|EWB91026.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T66243]
 gb|EWB92167.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T66292]
 gb|EWB95764.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W12461]
 gb|EWB98241.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M80329]
 gb|EWC00759.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F46600]
 gb|EWC03557.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F55987]
 gb|EWC08826.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T74602]
 gb|EWC12918.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F27253]
 gb|EWC13093.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F86379]
 gb|EWC16618.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F27254]
 gb|EWC20286.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T72814]
 gb|EWC22517.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M44988]
 gb|EWC25593.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F12856]
 gb|EWC28451.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H37235]
 gb|EWC31182.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M24487]
 gb|EWC31854.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T23068]
 gb|AHJ08090.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
USA300-ISMMS1]
 gb|EWH43113.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W39826]
 gb|EWH47929.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T54283]
 gb|EWH50750.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M16597]
 gb|EWH53784.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M13048]
 gb|EWH57026.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H85008]
 gb|EWH60126.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H81885]
 gb|EWH63488.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H81800]
 gb|EWH64760.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F50126]
 gb|EWH65403.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H81809]
 gb|EWH71295.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F36670]
 gb|EWH73872.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F50076]
 gb|EWH76884.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W92100]
 gb|EWH79747.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W85326]
 gb|EWH80795.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W92052]
 gb|EWH84696.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W75132]
 gb|EWH88019.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T37849]
 gb|EWH88308.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W64921]
 gb|EWH93541.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T30569]
 gb|EWH96328.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M53356]
 gb|EWH99319.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M49691]
 gb|EWI04057.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H58198]
 gb|EWI07360.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H58177]
 gb|EWI10242.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H51158]
 gb|EWI14602.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F77942]
 gb|EWI18898.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F26873]
 gb|EWI20589.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F23347]
 gb|EWI21238.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F23336]
 gb|EWI25953.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F20105]
 gb|EWI28105.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W50092]
 gb|EWI32652.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W46883]
 gb|EWI34974.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W36570]
 gb|EWI37363.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W36553]
 gb|EWI40959.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W33578]
 gb|EWI45376.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W33592]
 gb|EWI48650.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W23225]
 gb|EWI55742.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W23207]
 gb|EWI60942.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T64318]
 gb|EWI63565.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T57415]
 gb|EWI69126.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T54294]
 gb|EWI74202.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T54280]
 gb|EWI75013.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T51022]
 gb|EWI83502.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T51001]
 gb|EWI83986.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T44834]
 gb|EWI86659.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T44811]
 gb|EWJ16120.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M77229]
 gb|EWJ19789.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M77225]
 gb|EWJ26122.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M77210]
 gb|EWJ28616.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M20198]
 gb|EWJ29303.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M20180]
 gb|EWJ39319.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H91384]
 gb|EWJ58219.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H12930]
 gb|EWJ83645.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F36699]
 gb|EWJ89627.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F36687]
 gb|EWJ94899.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W81816]
 gb|EWK02103.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W75119]
 gb|EWK10164.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W64958]
 gb|EWK18131.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T92889]
 gb|EWK31996.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T34036]
 gb|EWK36293.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T30565]
 gb|EWK39507.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T20142]
 gb|EWK56363.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T16664]
 gb|EWK60521.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T16669]
 gb|EWK63564.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
S56450]
 gb|EWK67291.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M73702]
 gb|EWK69648.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M73703]
 gb|EWK72049.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M70073]
 gb|EWK78252.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M66661]
 gb|EWK82705.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M56985]
 gb|EWK85957.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M53327]
 gb|EWK91130.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M46077]
 gb|EWK96506.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H75143]
 gb|EWL01283.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H71538]
 gb|EWL02251.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H71553]
 gb|EWL18182.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H64962]
 gb|EWL20680.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H58183]
 gb|EWL25813.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H58165]
 gb|EWL29984.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H47671]
 gb|EWL34245.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F88387]
 gb|EWL49990.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F81381]
 gb|EWL72955.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F26884]
 gb|EWL78305.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F26858]
 gb|EWL89942.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F16432]
 gb|EWM00400.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T60795]
 gb|EWM04575.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
AMMC6114]
 gb|EWM05118.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W29641]
 gb|EWM05443.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6049]
 gb|EWN56435.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1334]
 gb|EWN59473.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1333]
 gb|EWN68696.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1329]
 gb|EWN88826.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1319]
 gb|EWO16624.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1304]
 gb|EWO24756.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1297]
 gb|EWO37663.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1290]
 gb|EWO39349.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1289]
 gb|EWO74849.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1270]
 gb|EWO88810.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1263]
 gb|EWO95581.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1262]
 gb|EWQ63989.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1153]
 gb|EWR02710.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1132]
 gb|EWR18674.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1124]
 gb|EWR43593.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WAMC6055]
 gb|EWR45507.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WMCA6126]
 gb|EWR46052.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
HBHO6021]
 gb|EWR53053.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WMCS6114]
 gb|EWR53597.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6115]
 gb|EWR54241.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WMCS6115]
 gb|EWR63889.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WMCA6086]
 gb|EWR67461.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
FVRH6079]
 gb|EWR70682.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
FVRH6066]
 gb|EWR77323.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
FVRH6040]
 gb|EWR79302.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
MISS6131]
 gb|EWR87606.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJOS6145]
 gb|EWR98825.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SMMC6014]
 gb|EWS08191.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WAMC6049]
 gb|EWS11388.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SMMC6016]
 gb|EWS15919.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
LPIH6008]
 gb|EWS19624.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
LPIH6004]
 gb|EWS20168.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
HBHO6050]
 gb|EWS26043.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WMCS6047]
 gb|EWS32487.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SCOA6009]
 gb|EWS35779.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJUD6085]
 gb|EWS38672.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
COAS6044]
 gb|EWS43068.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
LPIH6010]
 gb|EWT09329.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T70944]
 gb|EWT16891.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T74154]
 gb|EWT20248.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T74060]
 gb|EWT20891.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T74141]
 gb|EWT25948.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F63730]
 gb|EWT28201.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H32126]
 gb|EWT30795.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M32688]
 gb|EWT33893.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W60060]
 gb|EWT37005.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H35283]
 gb|EWT40177.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W62934]
 gb|EWT42332.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W57390]
 gb|EWT54874.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W65865]
 gb|EWT56106.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H41070]
 gb|EWT63410.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H41109]
 gb|EWT63166.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H43996]
 gb|EWT64598.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F76239]
 gb|EWT69096.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H47169]
 gb|EWT70130.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W70659]
 gb|EWT77576.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F85184]
 gb|EWT82615.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F89046]
 gb|EWT83923.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F85609]
 gb|EWT87955.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F89062]
 gb|EWT91213.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F92073]
 gb|EWT94099.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F89073]
 gb|EWT97210.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F92105_080312]
 gb|EWU01453.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F92125]
 gb|EWU03761.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F92127]
 gb|EWU04323.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F92128]
 gb|EWU07530.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H65830]
 gb|EWU09205.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H72115]
 gb|EWU14409.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M52622]
 gb|EWU16986.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T18851]
 gb|EWU22283.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T18865]
 gb|EWU23470.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T36127]
 gb|EWU27560.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T39082]
 gb|EWU30734.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W73649]
 gb|EWU36786.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W83133]
 gb|EWU37822.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W89268]
 gb|EWU41851.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F41902]
 gb|EWU45151.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F52754]
 gb|EWU52824.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F80354]
 gb|EWU55157.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M36089]
 gb|EWU57480.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T45940]
 gb|EWU66822.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M44986]
 gb|EWU71903.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M44987]
 gb|EWU74655.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F77709]
 gb|EWU78932.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F74035]
 gb|EWU81456.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F74039]
 gb|EWU83974.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H41336]
 gb|EWU86654.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F31094]
 gb|EWU93347.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F46780]
 gb|EWU94006.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F46785]
 gb|EWU96876.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F50093]
 gb|EWV02329.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F53393]
 gb|EWV10545.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H16097]
 gb|EWV20162.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H25869]
 gb|EWV24424.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T67319]
 gb|EWV29762.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W29625]
 gb|EWV37279.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W50110]
 gb|EWV40119.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W46839]
 gb|EWV43286.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F60357]
 gb|EWV47077.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F60360]
 gb|EWV50476.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F63750]
 gb|EWV51007.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F63687]
 gb|EWV61366.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M28487]
 gb|EWV63936.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M29068]
 gb|EWV74815.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H32166]
 gb|EWV79230.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F63786]
 gb|EWV79925.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H32181]
 gb|EWV85908.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M32679]
 gb|EWV86196.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F66778]
 gb|EWV92095.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T77618]
 gb|EWW05104.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W62972]
 gb|EWW17918.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F73229]
 gb|EWW24944.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M39265]
 gb|EWW30079.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W65910]
 gb|EWW33223.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W65904]
 gb|EWW38755.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H41079]
 gb|EWW50501.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H43986]
 gb|EWW56277.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H44015]
 gb|EWW59623.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T89906]
 gb|EWW63134.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M45704]
 gb|EWW63709.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W70590]
 gb|EWW74931.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M42514]
 gb|EWW80144.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F82568]
 gb|EWW90379.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M49455]
 gb|EWW93926.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M49474]
 gb|EWX04305.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H49922]
 gb|EWX17578.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F26021]
 gb|EWX24450.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F85711]
 gb|EWX29669.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F89053]
 gb|EWX32320.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F89078]
 gb|EWX35743.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F92047]
 gb|EWX41489.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F92119_080312]
 gb|EWX44407.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H49831]
 gb|EWX50589.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H56219]
 gb|EWX57277.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H59298]
 gb|EWX58102.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H56227]
 gb|EWX65047.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H75423]
 gb|EWX65606.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H75425]
 gb|EWX68671.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H65794]
 gb|EWX71069.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M55878]
 gb|EWX74452.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M49501]
 gb|EWX77235.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M55902]
 gb|EWX80208.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M59248]
 gb|EWX83765.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M59257]
 gb|EWX87726.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M70006]
 gb|EWX99535.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T28640]
 gb|EWY05259.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T36111]
 gb|EWY08779.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T39093]
 gb|EWY11545.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W15951]
 gb|EWY17841.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W76930]
 gb|EWY23497.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W76994_072512]
 gb|EWY27389.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W79968]
 gb|EXO71094.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W12586]
 gb|EXO77821.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T86792]
 gb|EXO82013.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T39102]
 gb|EXO83662.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T32092]
 gb|EXO86375.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T24515]
 gb|EXO88129.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T13127]
 gb|EXO90822.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T13126]
 gb|EXO94876.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T13125]
 gb|EXO98771.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M79684]
 gb|EXP01772.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H84958]
 gb|EXP02447.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H84956]
 gb|EXP06585.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H75430]
 gb|EXP07634.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H72152]
 gb|EXP11570.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H71778]
 gb|EXP13055.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H65853]
 gb|EXP17448.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F64897]
 gb|EXP17641.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H31085]
 gb|EXP21713.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F45779]
 gb|EXP22574.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F36091]
 gb|EXP35294.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W28921]
 gb|EXP59272.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W12583]
 gb|EXP60659.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W12582]
 gb|EXP65277.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T62976]
 gb|EXP69486.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T35622]
 gb|EXP74621.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T32086]
 gb|EXP77368.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M86943]
 gb|EXP80818.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M86940]
 gb|EXP84628.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M90388]
 gb|EXP86631.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M79686]
 gb|EXP90398.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M79254]
 gb|EXP91704.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M79256]
 gb|EXP98426.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M70017]
 gb|EXP98716.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M72097]
 gb|EXQ02200.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M70018]
 gb|EXQ05612.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M67938]
 gb|EXQ10782.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M42184]
 gb|EXQ16401.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H75421]
 gb|EXQ17004.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H84959]
 gb|EXQ21402.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H68996]
 gb|EXQ24163.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H65883]
 gb|EXQ30763.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H65882]
 gb|EXQ31821.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H65878]
 gb|EXQ33284.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H65881]
 gb|EXQ40083.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H31086]
 gb|EXQ41779.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H31084]
 gb|EXQ44580.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H22656]
 gb|EXQ45908.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F64896]
 gb|EXQ56529.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F36090]
 gb|EXQ60984.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F27252]
 gb|EXQ65128.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F26032]
 gb|EXQ68239.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F26051]
 gb|EYF11765.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F16108]
 gb|EYF29297.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H59329]
 gb|EYF35181.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M62794]
 gb|EYF37491.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M66468]
 gb|EYF37940.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T25283]
 gb|EYF43236.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T35596]
 gb|EYF48891.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W12538]
 gb|EYF68525.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F91072]
 gb|EYF72739.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F91077]
 gb|EYF76647.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M72054]
 gb|EYF90370.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W75229]
 gb|EYF95172.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W82215]
 gb|EYF99090.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W85837]
 gb|EYG10164.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F48959]
 gb|EYG19499.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F74820]
 gb|EYG23986.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H19398]
 gb|EYG30493.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H19420]
 gb|EYG33403.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H43694]
 gb|EYG36641.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H47117]
 gb|EYG38855.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M20726]
 gb|EYG44745.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M42212]
 gb|EYG47456.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M57729]
 gb|EYG53138.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T42550]
 gb|EYG54851.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T47161]
 gb|EYG61839.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W19225]
 gb|EYG63254.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W35455]
 gb|EYG69021.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W42270]
 gb|EYG71073.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F31078]
 gb|EYG74914.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W52298]
 gb|EYG80031.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F48607]
 gb|EYG80671.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F48611]
 gb|EYG85636.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H12890]
 gb|EYG86777.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H20315]
 gb|EYG90846.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H50411]
 gb|EYG95028.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M67929_020413]
 gb|EYG99552.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M67957]
 gb|EYH09705.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W24177]
 gb|EYH11200.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W41765]
 gb|EYH12909.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W80041]
 gb|EYH18077.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W80042]
 gb|EYH21888.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F71592]
 gb|EYH23586.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F91084]
 gb|EYJ04205.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F63712]
 gb|EYJ08084.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M32669]
 gb|EYJ20192.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H72119]
 gb|EYJ27559.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T28653]
 gb|EYJ34103.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T35615]
 gb|EYJ52880.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F48950]
 gb|EYJ60400.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F80972]
 gb|EYJ64042.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H12662]
 gb|EYJ76700.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H22637]
 gb|EYJ79043.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H43687]
 gb|EYJ91599.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H88170]
 gb|EYJ97999.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M13099]
 gb|EYK05952.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M24416]
 gb|EYK10978.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M24418]
 gb|EYK39856.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T13128]
 gb|EYK43985.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T42547]
 gb|EYK47890.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T45839]
 gb|EYK56910.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T52642]
 gb|EYK58682.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T52649]
 gb|EYK63700.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T55950]
 gb|EYK68625.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T66622]
 gb|EYK72345.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T83543]
 gb|EYK75053.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T70161]
 gb|EYK76602.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T66632]
 gb|EYK81167.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T86825]
 gb|EYK81856.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T83563]
 gb|EYK97681.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W42255]
 gb|EYL03091.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W45750]
 gb|EYL11142.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W52294]
 gb|EYL14513.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W55536]
 gb|EYL20381.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F16533]
 gb|EYL25578.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F27233]
 gb|EYL30274.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F48420]
 gb|EYL32225.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F38211]
 gb|EYL36023.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F48422]
 gb|EYL41137.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F48603]
 gb|EYL45078.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F92121]
 gb|EYL48121.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F76253]
 gb|EYL53789.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H32175]
 gb|EYL57555.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H50387]
 gb|EYL62372.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H50403]
 gb|EYL65010.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H59325]
 gb|EYL66310.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H64570]
 gb|EYL92633.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M67953]
 gb|EYL99291.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M72095_021113]
 gb|EYM10816.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T31892]
 gb|EYM14884.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T59813]
 gb|EYM19067.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W13012_022013]
 gb|EYM27108.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W27852]
 gb|EYM42161.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W45421]
 gb|EYM46391.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W75262]
 gb|EYM47438.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W76995]
 gb|AHW66076.1| moeZ/MoeB domain protein [Staphylococcus aureus]
 gb|EZH85305.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21239]
 gb|EZH85916.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21267]
 gb|EZI03196.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21311]
 gb|EZI16776.1| ThiF family protein [Staphylococcus aureus subsp. aureus CO-49]
 gb|EZI25176.1| ThiF family protein [Staphylococcus aureus subsp. aureus CO-85]
 gb|KAJ48591.1| ThiF family protein [Staphylococcus aureus 880]
 gb|KAK64148.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21205]
 gb|AIA28760.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 emb|CDP55063.1| Molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus]
 gb|KDP56621.1| ThiF family protein [Staphylococcus aureus subsp. aureus CO-86]
 gb|KEK30631.1| moeZ/MoeB domain protein [Staphylococcus aureus Lyso 1 2010]
 gb|KEK39492.1| moeZ/MoeB domain protein [Staphylococcus aureus 1101-2 2010]
 gb|KEK41621.1| moeZ/MoeB domain protein [Staphylococcus aureus 1101-1 2010]
 gb|KEK59179.1| moeZ/MoeB domain protein [Staphylococcus aureus LysK 2 2011]
 gb|KEK62163.1| moeZ/MoeB domain protein [Staphylococcus aureus 1101-2 2011]
 gb|KEK67827.1| moeZ/MoeB domain protein [Staphylococcus aureus 1801-2 2011]
 gb|KFA42709.1| moeZ/MoeB domain protein [Staphylococcus aureus]
 gb|KFB79735.1| ThiF family protein [Staphylococcus aureus subsp. aureus CO-06]
 gb|KFD35607.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus]
 gb|KFL06526.1| thiF family protein [Staphylococcus aureus]
 gb|AIL58774.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|AIU86204.1| Sulfur carrier protein moaD adenylyltransferase [Staphylococcus 
aureus subsp. aureus]
 gb|AJC29662.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|AJC32508.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|AJC35351.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|AJC38200.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|AJC41039.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|AJC43885.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|KIE16012.1| ThiF family protein [Staphylococcus aureus 917]
Length=334

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_033856370.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|EWJ00865.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M91141]
 gb|EYG14641.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F71576]
 gb|EYG47161.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M79667]
Length=334

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_023914062.1| hypothetical protein [Staphylococcus aureus]
 gb|ETD12165.1| hypothetical protein HMPREF1276_01158 [Staphylococcus aureus 
subsp. aureus KPL1845]
Length=334

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_001657011.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus]
 gb|ENL46007.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0877]
Length=334

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_000076931.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|EHS16014.1| ThiF family protein [Staphylococcus aureus subsp. aureus IS-55]
 gb|EJE56151.1| molybdopterin biosynthesis protein [Staphylococcus aureus subsp. 
aureus str. Newbould 305]
 gb|ELS68422.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21196]
 gb|ELY18974.1| ThiF family protein [Staphylococcus aureus KT/Y21]
 gb|ERE93968.1| ThiF family protein [Staphylococcus aureus subsp. aureus CO-08]
 gb|EUG36252.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0443]
 gb|EWG56431.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
MUF168]
 gb|EZV48919.1| hypothetical protein U947_01943 [Staphylococcus aureus 18754-2]
 gb|EZW67845.1| hypothetical protein U973_01939 [Staphylococcus aureus 56864-11]
Length=334

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_000076919.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|EGL89398.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21310]
Length=334

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_014532680.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 ref|YP_005737738.1| molybdopterin biosynthesis protein [Staphylococcus aureus subsp. 
aureus ED133]
 gb|ADI98756.1| molybdopterin biosynthesis protein [Staphylococcus aureus subsp. 
aureus ED133]
Length=302

 Score = 59.7 bits (143),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  250  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  288



>gb|EHT87650.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
CIGC341D]
Length=306

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  254  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  292



>ref|WP_031912451.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|EZS46452.1| hypothetical protein W572_01426 [Staphylococcus aureus VET0306R]
 gb|EZZ97039.1| hypothetical protein W397_01430 [Staphylococcus aureus VET0059R]
 gb|KAA06364.1| hypothetical protein W398_01432 [Staphylococcus aureus VET0060R]
 gb|KAA64358.1| hypothetical protein W423_01686 [Staphylococcus aureus VET0091R]
 gb|KAD54068.1| hypothetical protein W570_01488 [Staphylococcus aureus VET0304R]
 gb|KAD57074.1| hypothetical protein W571_01487 [Staphylococcus aureus VET0305R]
 gb|KAE93236.1| hypothetical protein W634_01249 [Staphylococcus aureus VET0406R]
 gb|KAE94766.1| hypothetical protein W635_01450 [Staphylococcus aureus VET0407R]
 gb|KAH25516.1| hypothetical protein W694_01436 [Staphylococcus aureus VET1834R]
 gb|KAH28923.1| hypothetical protein W695_01485 [Staphylococcus aureus VET1835R]
Length=334

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_000076916.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|EGB01379.1| molybdopterin biosynthesis protein [Staphylococcus aureus O46]
Length=334

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_000076925.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 ref|YP_005740312.1| thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein [Staphylococcus 
aureus subsp. aureus JKD6159]
 gb|ADL24103.1| thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein [Staphylococcus 
aureus subsp. aureus JKD6159]
Length=334

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_000076927.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 ref|YP_006238501.1| putative molybdopterin synthase sulfurylase [Staphylococcus aureus 
subsp. aureus HO 5096 0412]
 ref|YP_008492429.1| Molybdopterin biosynthesis MoeB protein [Staphylococcus aureus 
subsp. aureus CN1]
 gb|EES95119.1| ThiF family protein [Staphylococcus aureus subsp. aureus USA300_TCH959]
 gb|EES96459.1| ThiF family protein [Staphylococcus aureus subsp. aureus TCH130]
 gb|EGG66498.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21193]
 gb|EGL88839.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21305]
 gb|EGS87927.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21266]
 gb|EGS88132.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21259]
 gb|EHQ69016.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21343]
 gb|EHS24011.1| ThiF family protein [Staphylococcus aureus subsp. aureus IS-105]
 emb|CCG16885.1| putative molybdopterin synthase sulfurylase [Staphylococcus aureus 
subsp. aureus HO 5096 0412]
 gb|EMS37058.1| Putative molybdopterin synthase sulfurylase [Staphylococcus aureus 
KLT6]
 gb|EMZ10776.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1228]
 gb|AGU62381.1| Molybdopterin biosynthesis MoeB protein [Staphylococcus aureus 
subsp. aureus CN1]
 gb|ETO55860.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
MUM270]
 gb|EUG78879.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0139]
 gb|EVF83737.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
COAS6020]
 gb|EVH04271.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6080]
 gb|EWB71576.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W85432]
 gb|EWI53050.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W33563]
 gb|EWP22769.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1242]
 gb|EZI05393.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21338]
 gb|EZR76535.1| hypothetical protein W784_01845 [Staphylococcus aureus VET1373S]
 gb|EZR81819.1| hypothetical protein W783_01105 [Staphylococcus aureus VET1368S]
 gb|KAG11881.1| hypothetical protein W753_02285 [Staphylococcus aureus VET0632S]
 gb|KAG21580.1| hypothetical protein W756_00917 [Staphylococcus aureus VET0678S]
 gb|KAG26028.1| hypothetical protein W757_00591 [Staphylococcus aureus VET0679S]
 gb|KAG43609.1| hypothetical protein W767_01571 [Staphylococcus aureus VET1020S]
 gb|KAG47702.1| hypothetical protein W768_00318 [Staphylococcus aureus VET1024S]
 gb|KAG49496.1| hypothetical protein W769_00625 [Staphylococcus aureus VET1025S]
 gb|KAG52864.1| hypothetical protein W770_00656 [Staphylococcus aureus VET1026S]
 gb|KAG99513.1| hypothetical protein W796_01761 [Staphylococcus aureus VET1646S]
 gb|KAH04229.1| hypothetical protein W797_00894 [Staphylococcus aureus VET1653S]
 gb|AIA00094.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus]
 gb|KDP55009.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21251]
Length=334

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_000076913.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|EHO92433.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21252]
 gb|EHT73530.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
CIG290]
 gb|EVY94906.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W56227]
 gb|EVY97630.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W56243]
 gb|EVZ00063.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W56246]
 gb|EWQ36283.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1169]
 gb|EXP28434.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W85807]
 gb|EXP29655.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W85810]
 gb|EXP34410.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W42304]
 gb|EYF11498.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F12926_081012]
 gb|EYG00954.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W85806_020613]
 gb|EYJ25792.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F29450_091412]
 gb|EYL03242.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W42298_110712]
 gb|KFD31063.1| Molybdopterin-synthase adenylyltransferase [Staphylococcus aureus 
subsp. aureus SK1585]
Length=334

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_000076926.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|EFB48942.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus D139]
 gb|EFC08330.1| molybdopterin biosynthesis protein moeB [Staphylococcus aureus 
subsp. aureus H19]
 gb|EGA97758.1| molybdopterin biosynthesis protein [Staphylococcus aureus O11]
 gb|EGS90283.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21269]
 gb|EWC65790.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus ST 1413]
 gb|EZI07521.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21337]
 gb|KDP61630.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21320]
Length=334

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_000076915.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 ref|YP_006196369.1| Molybdopterin biosynthesis MoeB protein [Staphylococcus aureus 
subsp. aureus 71193]
 ref|YP_005735079.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus ST398]
 ref|YP_006711002.1| molybdopterin synthase sulfurylase [Staphylococcus aureus 08BA02176]
 emb|CAQ50707.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus ST398]
 gb|EHM76652.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21331]
 gb|EIA13429.1| Molybdopterin biosynthesis MoeB protein [Staphylococcus aureus 
subsp. aureus DR10]
 gb|AFH70526.1| Molybdopterin biosynthesis MoeB protein [Staphylococcus aureus 
subsp. aureus 71193]
 gb|AFR74254.1| putative molybdopterin synthase sulfurylase [Staphylococcus aureus 
08BA02176]
 gb|EOR49102.1| molybdopterin biosynthesis protein moeB [Staphylococcus aureus 
subsp. aureus 112808A]
 gb|EPZ04581.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
S100]
 gb|EPZ06968.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
S130]
 gb|EPZ08194.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
S123]
 gb|EPZ12237.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
S94]
 gb|EQM91249.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
S1]
 gb|EZR33875.1| hypothetical protein V135_01311 [Staphylococcus aureus ZTA09/03576-9HST]
 gb|EZR33988.1| hypothetical protein V138_01664 [Staphylococcus aureus ZTA11/03130-3ST]
 gb|EZR37221.1| hypothetical protein V143_01098 [Staphylococcus aureus ZTA09/03739-9HSA]
 gb|EZR40626.1| hypothetical protein W750_01463 [Staphylococcus aureus VET1915R]
 gb|EZR42913.1| hypothetical protein W805_01223 [Staphylococcus aureus VET1918S]
 gb|EZR45527.1| hypothetical protein W745_01390 [Staphylococcus aureus VET1910R]
 gb|EZR47918.1| hypothetical protein W742_01455 [Staphylococcus aureus VET1907R]
 gb|EZR51113.1| hypothetical protein W736_01137 [Staphylococcus aureus VET1898R]
 gb|EZR52991.1| hypothetical protein W734_01383 [Staphylococcus aureus VET1896R]
 gb|EZR55980.1| hypothetical protein W725_01239 [Staphylococcus aureus VET1876R]
 gb|EZR58790.1| hypothetical protein W720_01158 [Staphylococcus aureus VET1869R]
 gb|EZR60804.1| hypothetical protein W712_01962 [Staphylococcus aureus VET1858R]
 gb|EZR62043.1| hypothetical protein W698_01392 [Staphylococcus aureus VET1842R]
 gb|EZR66148.1| hypothetical protein W693_01538 [Staphylococcus aureus VET1833R]
 gb|EZR68886.1| hypothetical protein W792_01650 [Staphylococcus aureus VET1515S]
 gb|EZR71642.1| hypothetical protein W787_01273 [Staphylococcus aureus VET1422S]
 gb|EZR73638.1| hypothetical protein W786_01549 [Staphylococcus aureus VET1419S]
 gb|EZR78544.1| hypothetical protein W778_01452 [Staphylococcus aureus VET1103S]
 gb|EZR83856.1| hypothetical protein W761_01739 [Staphylococcus aureus VET0798S]
 gb|EZR87653.1| hypothetical protein W758_01234 [Staphylococcus aureus VET0765S]
 gb|EZR87811.1| hypothetical protein W752_01502 [Staphylococcus aureus VET0612S]
 gb|EZR92100.1| hypothetical protein W689_01680 [Staphylococcus aureus VET0489R]
 gb|EZR93920.1| hypothetical protein W682_01458 [Staphylococcus aureus VET0472R]
 gb|EZR96931.1| hypothetical protein W683_01476 [Staphylococcus aureus VET0473R]
 gb|EZR99269.1| hypothetical protein W679_01701 [Staphylococcus aureus VET0469R]
 gb|EZS02363.1| hypothetical protein W681_01366 [Staphylococcus aureus VET0471R]
 gb|EZS05184.1| hypothetical protein W677_01277 [Staphylococcus aureus VET0467R]
 gb|EZS06569.1| hypothetical protein W658_01569 [Staphylococcus aureus VET0437R]
 gb|EZS09787.1| hypothetical protein W649_01383 [Staphylococcus aureus VET0426R]
 gb|EZS12630.1| hypothetical protein W647_01343 [Staphylococcus aureus VET0424R]
 gb|EZS15522.1| hypothetical protein W645_01452 [Staphylococcus aureus VET0422R]
 gb|EZS18036.1| hypothetical protein W640_01855 [Staphylococcus aureus VET0414R]
 gb|EZS19013.1| hypothetical protein W657_01604 [Staphylococcus aureus VET0436R]
 gb|EZS23458.1| hypothetical protein W630_01409 [Staphylococcus aureus VET0400R]
 gb|EZS25052.1| hypothetical protein W614_02287 [Staphylococcus aureus VET0368R]
 gb|EZS26270.1| hypothetical protein W609_01289 [Staphylococcus aureus VET0361R]
 gb|EZS29852.1| hypothetical protein W606_02023 [Staphylococcus aureus VET0358R]
 gb|EZS33682.1| hypothetical protein W603_01322 [Staphylococcus aureus VET0353R]
 gb|EZS35930.1| hypothetical protein W601_01468 [Staphylococcus aureus VET0343R]
 gb|EZS37770.1| hypothetical protein W600_01733 [Staphylococcus aureus VET0342R]
 gb|EZS40989.1| hypothetical protein W591_01481 [Staphylococcus aureus VET0332R]
 gb|EZS43434.1| hypothetical protein W583_01651 [Staphylococcus aureus VET0319R]
 gb|EZS50972.1| hypothetical protein W567_00227 [Staphylococcus aureus VET0301R]
 gb|EZS51249.1| hypothetical protein W564_01588 [Staphylococcus aureus VET0298R]
 gb|EZS53493.1| hypothetical protein W559_01967 [Staphylococcus aureus VET0293R]
 gb|EZS57956.1| hypothetical protein W531_00895 [Staphylococcus aureus VET0251R]
 gb|EZS59255.1| hypothetical protein W528_01376 [Staphylococcus aureus VET0244R]
 gb|EZS61413.1| hypothetical protein W523_01686 [Staphylococcus aureus VET0235R]
 gb|EZS64071.1| hypothetical protein W522_01782 [Staphylococcus aureus VET0232R]
 gb|EZS66012.1| hypothetical protein W520_01632 [Staphylococcus aureus VET0229R]
 gb|EZS70384.1| hypothetical protein W502_01547 [Staphylococcus aureus VET0203R]
 gb|EZS72207.1| hypothetical protein W514_01058 [Staphylococcus aureus VET0219R]
 gb|EZS74322.1| hypothetical protein W496_01617 [Staphylococcus aureus VET0197R]
 gb|EZS77348.1| hypothetical protein W490_01908 [Staphylococcus aureus VET0191R]
 gb|EZS78668.1| hypothetical protein W484_01309 [Staphylococcus aureus VET0184R]
 gb|EZS82466.1| hypothetical protein W483_01353 [Staphylococcus aureus VET0183R]
 gb|EZS85289.1| hypothetical protein W469_01380 [Staphylococcus aureus VET0158R]
 gb|EZS87679.1| hypothetical protein W470_01761 [Staphylococcus aureus VET0159R]
 gb|EZS89577.1| hypothetical protein W468_01369 [Staphylococcus aureus VET0157R]
 gb|EZS92513.1| hypothetical protein W465_01653 [Staphylococcus aureus VET0154R]
 gb|EZS95488.1| hypothetical protein W462_01517 [Staphylococcus aureus VET0150R]
 gb|EZS96669.1| hypothetical protein W460_02060 [Staphylococcus aureus VET0141R]
 gb|EZT00535.1| hypothetical protein W458_01623 [Staphylococcus aureus VET0136R]
 gb|EZT02966.1| hypothetical protein W449_01847 [Staphylococcus aureus VET0125R]
 gb|EZT06195.1| hypothetical protein W446_01464 [Staphylococcus aureus VET0120R]
 gb|EZT09168.1| hypothetical protein W440_01070 [Staphylococcus aureus VET0113R]
 gb|EZT11289.1| hypothetical protein W438_01505 [Staphylococcus aureus VET0111R]
 gb|EZT13450.1| hypothetical protein W432_01552 [Staphylococcus aureus VET0102R]
 gb|EZT16684.1| hypothetical protein W414_01422 [Staphylococcus aureus VET0081R]
 gb|EZT19675.1| hypothetical protein W396_01461 [Staphylococcus aureus VET0058R]
 gb|EZT20431.1| hypothetical protein W412_01345 [Staphylococcus aureus VET0078R]
 gb|EZT24414.1| hypothetical protein W389_01454 [Staphylococcus aureus VET0050R]
 gb|EZT26238.1| hypothetical protein V010_01717 [Staphylococcus aureus VE08/02242ST1]
 gb|EZT29321.1| hypothetical protein V163_01331 [Staphylococcus aureus USA_6]
 gb|EZT33353.1| hypothetical protein V126_01148 [Staphylococcus aureus Tur-5]
 gb|EZT35232.1| hypothetical protein V113_01083 [Staphylococcus aureus Tur-4]
 gb|EZT35923.1| hypothetical protein V047_01858 [Staphylococcus aureus S64_POEL]
 gb|EZT39581.1| hypothetical protein V125_01817 [Staphylococcus aureus Rd.290]
 gb|EZT42788.1| hypothetical protein V046_01323 [Staphylococcus aureus S63_POEL]
 gb|EZT45576.1| hypothetical protein V054_01143 [Staphylococcus aureus MSSA-47]
 gb|EZT48454.1| hypothetical protein V053_01140 [Staphylococcus aureus MSSA-37]
 gb|EZT51044.1| hypothetical protein V056_01332 [Staphylococcus aureus MSSA-123]
 gb|EZT54350.1| hypothetical protein V096_00817 [Staphylococcus aureus GD2010-169]
 gb|EZT55723.1| hypothetical protein V095_01459 [Staphylococcus aureus GD2010-159]
 gb|EZT58353.1| hypothetical protein V033_01696 [Staphylococcus aureus C3452]
 gb|EZT61507.1| hypothetical protein V071_01529 [Staphylococcus aureus C0676]
 gb|EZT62583.1| hypothetical protein V067_01134 [Staphylococcus aureus C0626]
 gb|EZT67029.1| hypothetical protein U885_01217 [Staphylococcus aureus 81629]
 gb|EZT69335.1| hypothetical protein U903_01669 [Staphylococcus aureus 63-D10]
 gb|EZT70395.1| hypothetical protein U948_01351 [Staphylococcus aureus 53180-1]
 gb|EZT74828.1| hypothetical protein V107_01255 [Staphylococcus aureus 45(2607)]
 gb|EZT75059.1| hypothetical protein V104_02064 [Staphylococcus aureus 28(3K2-5)]
 gb|EZT79611.1| hypothetical protein V103_01230 [Staphylococcus aureus 22(2K81-5)]
 gb|EZT81951.1| hypothetical protein V082_01983 [Staphylococcus aureus 2011-60-2275-7]
 gb|EZT83951.1| hypothetical protein U954_01161 [Staphylococcus aureus 1484-9]
 gb|EZT90466.1| hypothetical protein U990_01397 [Staphylococcus aureus 1111001578]
 gb|EZT94255.1| hypothetical protein U917_01610 [Staphylococcus aureus 10S00488]
 gb|EZT97431.1| hypothetical protein V120_01656 [Staphylococcus aureus 1(04GN_04-02-52-07)]
 gb|EZU01130.1| hypothetical protein U916_01000 [Staphylococcus aureus 09S01694]
 gb|EZU02118.1| hypothetical protein U909_01635 [Staphylococcus aureus 09-00736]
 gb|EZU04719.1| hypothetical protein U906_01511 [Staphylococcus aureus 08-01229]
 gb|EZU07725.1| hypothetical protein U905_01557 [Staphylococcus aureus 08-01062]
 gb|EZU10722.1| hypothetical protein U904_01200 [Staphylococcus aureus 08-01059]
 gb|EZU15928.1| hypothetical protein U913_01631 [Staphylococcus aureus 08-01085]
 gb|EZU19767.1| hypothetical protein U912_00525 [Staphylococcus aureus 08-01084]
 gb|EZU22505.1| hypothetical protein U907_01979 [Staphylococcus aureus 08-01728]
 gb|EZU26064.1| hypothetical protein V157_01640 [Staphylococcus aureus 08134-6]
 gb|EZU30375.1| hypothetical protein V158_01711 [Staphylococcus aureus 08139-6]
 gb|EZU33704.1| hypothetical protein V159_01408 [Staphylococcus aureus 08142-8]
 gb|EZU36817.1| hypothetical protein U915_01693 [Staphylococcus aureus 09S00475]
 gb|EZU39547.1| hypothetical protein V160_00226 [Staphylococcus aureus 08143-5]
 gb|EZU42159.1| hypothetical protein U918_00842 [Staphylococcus aureus 10S01493]
 gb|EZU44278.1| hypothetical protein U983_01315 [Staphylococcus aureus 110802495]
 gb|EZU44430.1| hypothetical protein U978_02171 [Staphylococcus aureus 1110601704]
 gb|EZU48695.1| hypothetical protein U979_01546 [Staphylococcus aureus 1110601896]
 gb|EZU49412.1| hypothetical protein U980_02120 [Staphylococcus aureus 1110700562]
 gb|EZU53908.1| hypothetical protein U981_01464 [Staphylococcus aureus 1110700610]
 gb|EZU57423.1| hypothetical protein U982_01025 [Staphylococcus aureus 1110701127]
 gb|EZU58037.1| hypothetical protein U984_01412 [Staphylococcus aureus 1110802883]
 gb|EZU62057.1| hypothetical protein U986_01620 [Staphylococcus aureus 1110807699]
 gb|EZU65556.1| hypothetical protein U987_01408 [Staphylococcus aureus 1110904178]
 gb|EZU77251.1| hypothetical protein U992_00667 [Staphylococcus aureus 1111101949]
 gb|EZU80311.1| hypothetical protein U993_00906 [Staphylococcus aureus 1111102620]
 gb|EZU81746.1| hypothetical protein U995_02316 [Staphylococcus aureus 1111203374]
 gb|EZU81827.1| hypothetical protein U994_01728 [Staphylococcus aureus 1111200013]
 gb|EZU87215.1| hypothetical protein U996_01550 [Staphylococcus aureus 1111205429]
 gb|EZU88918.1| hypothetical protein U997_01807 [Staphylococcus aureus 1111206270]
 gb|EZU90590.1| hypothetical protein V147_01763 [Staphylococcus aureus 11P4]
 gb|EZU95623.1| hypothetical protein V148_01288 [Staphylococcus aureus 11P8]
 gb|EZV03870.1| hypothetical protein U923_01276 [Staphylococcus aureus 11S01586]
 gb|EZV09032.1| hypothetical protein V051_02011 [Staphylococcus aureus 122]
 gb|EZV12557.1| hypothetical protein U976_01702 [Staphylococcus aureus 12464]
 gb|EZV19670.1| hypothetical protein U925_01014 [Staphylococcus aureus 12S00579]
 gb|EZV20172.1| hypothetical protein U926_00836 [Staphylococcus aureus 12S00881]
 gb|EZV23525.1| hypothetical protein U928_01527 [Staphylococcus aureus 12S01153]
 gb|EZV26179.1| hypothetical protein U929_01282 [Staphylococcus aureus 12S01399]
 gb|EZV30648.1| hypothetical protein U931_01856 [Staphylococcus aureus 12-ST01988]
 gb|EZV33609.1| hypothetical protein V122_02226 [Staphylococcus aureus 14(11MN_17-08-66-05)]
 gb|EZV38607.1| hypothetical protein U961_01433 [Staphylococcus aureus 150211/pool 
1]
 gb|EZV41624.1| hypothetical protein U962_01155 [Staphylococcus aureus 18439-17]
 gb|EZV42922.1| hypothetical protein V118_01544 [Staphylococcus aureus 16(11S1S4-09)]
 gb|EZV46039.1| hypothetical protein U965_01675 [Staphylococcus aureus 18439-62]
 gb|EZV51268.1| hypothetical protein U893_00636 [Staphylococcus aureus 19571]
 gb|EZV52829.1| hypothetical protein V121_01822 [Staphylococcus aureus 2(04HN_17-03-52-05)]
 gb|EZV56695.1| hypothetical protein V079_01741 [Staphylococcus aureus 2009-60-561-1]
 gb|EZV58092.1| hypothetical protein U888_01916 [Staphylococcus aureus 2010-60-6063-29]
 gb|EZV62201.1| hypothetical protein V074_01321 [Staphylococcus aureus 2010-60-1240-1]
 gb|EZV64664.1| hypothetical protein V076_01466 [Staphylococcus aureus 2010-60-6063-39]
 gb|EZV68270.1| hypothetical protein V075_00915 [Staphylococcus aureus 2010-60-6511-10]
 gb|EZV69559.1| hypothetical protein V077_01668 [Staphylococcus aureus 2010-60-6511-39]
 gb|EZV72290.1| hypothetical protein V078_01990 [Staphylococcus aureus 2010-60-6511-5]
 gb|EZV73723.1| hypothetical protein U889_01768 [Staphylococcus aureus 2010-60-7626-19]
 gb|EZV78738.1| hypothetical protein V084_01722 [Staphylococcus aureus 2011-60-1490-31]
 gb|EZV79395.1| hypothetical protein V083_01438 [Staphylococcus aureus 2011-60-2078-5]
 gb|EZV82275.1| hypothetical protein U890_01566 [Staphylococcus aureus 2011-60-2256-5]
 gb|EZV87346.1| hypothetical protein U894_00775 [Staphylococcus aureus 22825]
 gb|EZV88025.1| hypothetical protein V081_01561 [Staphylococcus aureus 2011-60-2275-1]
 gb|EZV90829.1| hypothetical protein U896_01352 [Staphylococcus aureus 22835]
 gb|EZV93909.1| hypothetical protein U897_01333 [Staphylococcus aureus 22837]
 gb|EZV96705.1| hypothetical protein U898_00743 [Staphylococcus aureus 22838]
 gb|EZV97958.1| hypothetical protein U899_01576 [Staphylococcus aureus 22841]
 gb|EZW00788.1| hypothetical protein U900_01614 [Staphylococcus aureus 22843]
 gb|EZW03542.1| hypothetical protein U901_01507 [Staphylococcus aureus 22846]
 gb|EZW06292.1| hypothetical protein U998_01272 [Staphylococcus aureus 22P79]
 gb|EZW08705.1| hypothetical protein U902_01352 [Staphylococcus aureus 23237]
 gb|EZW11040.1| hypothetical protein U974_01650 [Staphylococcus aureus 2393-15]
 gb|EZW14056.1| hypothetical protein U975_01165 [Staphylococcus aureus 2393-19]
 gb|EZW16383.1| hypothetical protein V105_01401 [Staphylococcus aureus 25(2889)]
 gb|EZW18679.1| hypothetical protein U966_01571 [Staphylococcus aureus 27999-3]
 gb|EZW22190.1| hypothetical protein V149_01512 [Staphylococcus aureus 36P1]
 gb|EZW24961.1| hypothetical protein V117_00709 [Staphylococcus aureus 28(18S1K13-24-05)]
 gb|EZW25939.1| hypothetical protein V150_01845 [Staphylococcus aureus 36P5]
 gb|EZW29124.1| hypothetical protein V152_01824 [Staphylococcus aureus 40P10]
 gb|EZW31692.1| hypothetical protein V119_01567 [Staphylococcus aureus 37(18S2S5-05)]
 gb|EZW34923.1| hypothetical protein V151_01345 [Staphylococcus aureus 40P5 1_1]
 gb|EZW35284.1| hypothetical protein V153_01800 [Staphylococcus aureus 43P3]
 gb|EZW39195.1| hypothetical protein V154_01549 [Staphylococcus aureus 43P8]
 gb|EZW42357.1| hypothetical protein V155_01605 [Staphylococcus aureus 47P5]
 gb|EZW43470.1| hypothetical protein V106_01513 [Staphylococcus aureus 44(2608)]
 gb|EZW47299.1| hypothetical protein V156_01307 [Staphylococcus aureus 47P9]
 gb|EZW49527.1| hypothetical protein U944_01664 [Staphylococcus aureus 5670-1]
 gb|EZW52706.1| hypothetical protein U970_01569 [Staphylococcus aureus 56824-10]
 gb|EZW53846.1| hypothetical protein U971_01504 [Staphylococcus aureus 56824-15]
 gb|EZW58138.1| hypothetical protein U967_00764 [Staphylococcus aureus 56824-2]
 gb|EZW60422.1| hypothetical protein U968_01559 [Staphylococcus aureus 56824-5]
 gb|EZW61897.1| hypothetical protein U972_01637 [Staphylococcus aureus 56824-21]
 gb|EZW64998.1| hypothetical protein U969_01713 [Staphylococcus aureus 56824-7]
 gb|EZW68484.1| hypothetical protein U945_01634 [Staphylococcus aureus 6665-5]
 gb|EZW72954.1| hypothetical protein U955_01735 [Staphylococcus aureus 75495-3]
 gb|EZW75407.1| hypothetical protein U956_01580 [Staphylococcus aureus 76669-6]
 gb|EZW79742.1| hypothetical protein U884_01398 [Staphylococcus aureus 81070]
 gb|EZW81875.1| hypothetical protein U957_01448 [Staphylococcus aureus 84069-2]
 gb|EZW86338.1| hypothetical protein U958_01582 [Staphylococcus aureus 86770-7]
 gb|EZW87828.1| hypothetical protein U949_01558 [Staphylococcus aureus 87807-1]
 gb|EZW91173.1| hypothetical protein U950_01238 [Staphylococcus aureus 87807-11]
 gb|EZW93405.1| hypothetical protein U952_01769 [Staphylococcus aureus 87807-12]
 gb|EZW96320.1| hypothetical protein U953_01380 [Staphylococcus aureus 87807-16]
 gb|EZW97649.1| hypothetical protein U951_01871 [Staphylococcus aureus 87807-9]
 gb|EZX01036.1| hypothetical protein U959_01859 [Staphylococcus aureus 88088-1]
 gb|EZX04267.1| hypothetical protein U960_01377 [Staphylococcus aureus 88088-2]
 gb|EZX05933.1| hypothetical protein V146_01261 [Staphylococcus aureus 9P9]
 gb|EZX09209.1| hypothetical protein U943_01780 [Staphylococcus aureus BG407]
 gb|EZX10419.1| hypothetical protein V068_01604 [Staphylococcus aureus C0630]
 gb|EZX11401.1| hypothetical protein V069_02049 [Staphylococcus aureus C0637]
 gb|EZX16778.1| hypothetical protein V026_01877 [Staphylococcus aureus C1655]
 gb|EZX19217.1| hypothetical protein V030_02108 [Staphylococcus aureus C1673]
 gb|EZX23129.1| hypothetical protein V021_02174 [Staphylococcus aureus C1842]
 gb|EZX27203.1| hypothetical protein V018_01774 [Staphylococcus aureus C1891]
 gb|EZX30131.1| hypothetical protein V041_01705 [Staphylococcus aureus C2549]
 gb|EZX30958.1| hypothetical protein V019_01815 [Staphylococcus aureus C1894]
 gb|EZX34988.1| hypothetical protein V042_01518 [Staphylococcus aureus C2679]
 gb|EZX37813.1| hypothetical protein V027_01742 [Staphylococcus aureus C2706]
 gb|EZX39601.1| hypothetical protein V034_01865 [Staphylococcus aureus C2928]
 gb|EZX44139.1| hypothetical protein V032_00060 [Staphylococcus aureus C2930]
 gb|EZX46550.1| hypothetical protein V035_01586 [Staphylococcus aureus C2942]
 gb|EZX47767.1| hypothetical protein V014_01283 [Staphylococcus aureus C3489]
 gb|EZX50928.1| hypothetical protein V036_01396 [Staphylococcus aureus C3672]
 gb|EZX54213.1| hypothetical protein V043_01556 [Staphylococcus aureus C3965]
 gb|EZX54718.1| hypothetical protein V016_01472 [Staphylococcus aureus C3865]
 gb|EZX58168.1| hypothetical protein V037_01786 [Staphylococcus aureus C4151]
 gb|EZX61024.1| hypothetical protein V031_01645 [Staphylococcus aureus C4155]
 gb|EZX63040.1| hypothetical protein V015_02238 [Staphylococcus aureus C5086]
 gb|EZX63742.1| hypothetical protein V017_01681 [Staphylococcus aureus C4668]
 gb|EZX68161.1| hypothetical protein V040_01940 [Staphylococcus aureus C5453]
 gb|EZX71455.1| hypothetical protein V108_01871 [Staphylococcus aureus Chi-4]
 gb|EZX72175.1| hypothetical protein V109_01703 [Staphylococcus aureus Chi-10]
 gb|EZX78669.1| hypothetical protein V110_00143 [Staphylococcus aureus Chi-8]
 gb|EZX79371.1| hypothetical protein V140_01684 [Staphylococcus aureus DICM09/01587-13HST]
 gb|EZX83341.1| hypothetical protein V137_00640 [Staphylococcus aureus DICM09/00997-9HST2]
 gb|EZX84804.1| hypothetical protein U999_01391 [Staphylococcus aureus FP_N239]
 gb|EZX86271.1| hypothetical protein V000_01869 [Staphylococcus aureus FP_N5203 
OX]
 gb|EZX89351.1| hypothetical protein V001_01849 [Staphylococcus aureus FP_N5208 
OX]
 gb|EZX92540.1| hypothetical protein V127_01409 [Staphylococcus aureus GD2010-052]
 gb|EZX94967.1| hypothetical protein V128_01405 [Staphylococcus aureus GD2010-061]
 gb|EZX98198.1| hypothetical protein V086_01330 [Staphylococcus aureus GD2010-090]
 gb|EZX99332.1| hypothetical protein V129_01656 [Staphylococcus aureus GD2010-102]
 gb|EZY04231.1| hypothetical protein V088_00227 [Staphylococcus aureus GD2010-107]
 gb|EZY05495.1| hypothetical protein V087_01516 [Staphylococcus aureus GD2010-110]
 gb|EZY07776.1| hypothetical protein V090_01598 [Staphylococcus aureus GD2010-112]
 gb|EZY11456.1| hypothetical protein V089_00646 [Staphylococcus aureus GD2010-115]
 gb|EZY15680.1| hypothetical protein V092_01272 [Staphylococcus aureus GD2010-147]
 gb|EZY17510.1| hypothetical protein V093_01475 [Staphylococcus aureus GD2010-155]
 gb|EZY21939.1| hypothetical protein V094_01147 [Staphylococcus aureus GD2010-158]
 gb|EZY22692.1| hypothetical protein V097_01650 [Staphylococcus aureus GD2010-168]
 gb|EZY24968.1| hypothetical protein V085_01715 [Staphylococcus aureus GD2010-177]
 gb|EZY29178.1| hypothetical protein U883_01193 [Staphylococcus aureus M118-B]
 gb|EZY31421.1| hypothetical protein V002_00945 [Staphylococcus aureus M267-1]
 gb|EZY33702.1| hypothetical protein V003_01267 [Staphylococcus aureus M357]
 gb|EZY36952.1| hypothetical protein V004_01153 [Staphylococcus aureus M457-1]
 gb|EZY37438.1| hypothetical protein V005_01839 [Staphylococcus aureus M520-1]
 gb|EZY41670.1| hypothetical protein V055_00641 [Staphylococcus aureus MRSA-118]
 gb|EZY43850.1| hypothetical protein V052_02229 [Staphylococcus aureus MSSA-93]
 gb|EZY44276.1| hypothetical protein V057_01572 [Staphylococcus aureus MRSA-136]
 gb|EZY48639.1| hypothetical protein V058_01519 [Staphylococcus aureus N0426]
 gb|EZY51935.1| hypothetical protein V059_01481 [Staphylococcus aureus N1343]
 gb|EZY54208.1| hypothetical protein V072_01408 [Staphylococcus aureus P0218]
 gb|EZY56897.1| hypothetical protein V049_01267 [Staphylococcus aureus PA11]
 gb|EZY59089.1| hypothetical protein V050_01753 [Staphylococcus aureus PA57]
 gb|EZY62643.1| hypothetical protein V061_01760 [Staphylococcus aureus R0353]
 gb|EZY63862.1| hypothetical protein V060_01229 [Staphylococcus aureus R0294]
 gb|EZY67413.1| hypothetical protein V062_01434 [Staphylococcus aureus R0357]
 gb|EZY70639.1| hypothetical protein V063_01704 [Staphylococcus aureus R0487]
 gb|EZY72184.1| hypothetical protein V064_01193 [Staphylococcus aureus R0545]
 gb|EZY75244.1| hypothetical protein V065_01603 [Staphylococcus aureus R0611]
 gb|EZY79407.1| hypothetical protein V066_01725 [Staphylococcus aureus R0615]
 gb|EZY79604.1| hypothetical protein V098_01083 [Staphylococcus aureus Rd.3]
 gb|EZY83370.1| hypothetical protein V100_01367 [Staphylococcus aureus Rd.40]
 gb|EZY85742.1| hypothetical protein V101_01820 [Staphylococcus aureus Rd.51]
 gb|EZY90090.1| hypothetical protein V102_01579 [Staphylococcus aureus Rd.60]
 gb|EZY90874.1| hypothetical protein V123_00585 [Staphylococcus aureus Rd.545]
 gb|EZY93931.1| hypothetical protein V124_01435 [Staphylococcus aureus Rd.614]
 gb|EZY96485.1| hypothetical protein V099_01792 [Staphylococcus aureus Rd.9]
 gb|EZZ00415.1| hypothetical protein V044_00902 [Staphylococcus aureus S56_POEL]
 gb|EZZ01678.1| hypothetical protein V045_01643 [Staphylococcus aureus S62_POEL]
 gb|EZZ06349.1| hypothetical protein V006_01323 [Staphylococcus aureus SARM C4155]
 gb|EZZ06789.1| hypothetical protein V048_00900 [Staphylococcus aureus S69_POEL]
 gb|EZZ08353.1| hypothetical protein V007_01804 [Staphylococcus aureus SARM C5621]
 gb|EZZ11434.1| hypothetical protein U942_02477 [Staphylococcus aureus Sau 194]
 gb|EZZ13120.1| hypothetical protein U934_01622 [Staphylococcus aureus Sau 44]
 gb|EZZ16792.1| hypothetical protein U935_01449 [Staphylococcus aureus Sau 46]
 gb|EZZ20674.1| hypothetical protein U937_01683 [Staphylococcus aureus Sau 74]
 gb|EZZ21886.1| hypothetical protein U936_01271 [Staphylococcus aureus Sau 47]
 gb|EZZ24486.1| hypothetical protein U938_01722 [Staphylococcus aureus Sau 93]
 gb|EZZ28466.1| hypothetical protein U939_01776 [Staphylococcus aureus Sau 95]
 gb|EZZ28661.1| hypothetical protein U940_01281 [Staphylococcus aureus Sau 98]
 gb|EZZ32645.1| hypothetical protein U941_01556 [Staphylococcus aureus Sau 99]
 gb|EZZ36270.1| hypothetical protein V116_01474 [Staphylococcus aureus Tur-15]
 gb|EZZ38428.1| hypothetical protein V115_01186 [Staphylococcus aureus Tur-12]
 gb|EZZ39419.1| hypothetical protein U933_01799 [Staphylococcus aureus Tur-16]
 gb|EZZ44331.1| hypothetical protein V111_01464 [Staphylococcus aureus Tur-20]
 gb|EZZ45835.1| hypothetical protein V112_01253 [Staphylococcus aureus Tur-22]
 gb|EZZ48131.1| hypothetical protein V114_01485 [Staphylococcus aureus Tur-6]
 gb|EZZ52087.1| hypothetical protein U891_00998 [Staphylococcus aureus UB 08-116]
 gb|EZZ52842.1| hypothetical protein U892_01669 [Staphylococcus aureus UB 08-172]
 gb|EZZ56086.1| hypothetical protein V162_01617 [Staphylococcus aureus USA_1]
 gb|EZZ59822.1| hypothetical protein V168_01743 [Staphylococcus aureus USA_12]
 gb|EZZ62340.1| hypothetical protein V167_00226 [Staphylococcus aureus USA_11]
 gb|EZZ63901.1| hypothetical protein V169_01402 [Staphylococcus aureus USA_15]
 gb|EZZ66820.1| hypothetical protein V166_01461 [Staphylococcus aureus USA_9]
 gb|EZZ70122.1| hypothetical protein V165_01174 [Staphylococcus aureus USA_8]
 gb|EZZ70838.1| hypothetical protein V164_01222 [Staphylococcus aureus USA7]
 gb|EZZ74700.1| hypothetical protein V008_01580 [Staphylococcus aureus VE07/03048STA]
 gb|EZZ76874.1| hypothetical protein V009_01343 [Staphylococcus aureus VE08/02126ST1]
 gb|EZZ77164.1| hypothetical protein V011_01576 [Staphylococcus aureus VE08/02244ST1]
 gb|EZZ82212.1| hypothetical protein W390_01560 [Staphylococcus aureus VET0051R]
 gb|EZZ85333.1| hypothetical protein W392_01533 [Staphylococcus aureus VET0053R]
 gb|EZZ85806.1| hypothetical protein W391_01359 [Staphylococcus aureus VET0052R]
 gb|EZZ88907.1| hypothetical protein W393_02189 [Staphylococcus aureus VET0054R]
 gb|EZZ93086.1| hypothetical protein W395_01392 [Staphylococcus aureus VET0057R]
 gb|EZZ96014.1| hypothetical protein W394_01017 [Staphylococcus aureus VET0055R]
 gb|KAA06549.1| hypothetical protein W400_01505 [Staphylococcus aureus VET0062R]
 gb|KAA07692.1| hypothetical protein W399_01459 [Staphylococcus aureus VET0061R]
 gb|KAA13796.1| hypothetical protein W402_01468 [Staphylococcus aureus VET0065R]
 gb|KAA15048.1| hypothetical protein W403_01517 [Staphylococcus aureus VET0066R]
 gb|KAA15821.1| hypothetical protein W401_01231 [Staphylococcus aureus VET0063R]
 gb|KAA22767.1| hypothetical protein W404_00961 [Staphylococcus aureus VET0067R]
 gb|KAA23869.1| hypothetical protein W405_01386 [Staphylococcus aureus VET0069R]
 gb|KAA24020.1| hypothetical protein W406_01454 [Staphylococcus aureus VET0070R]
 gb|KAA29403.1| hypothetical protein W407_01496 [Staphylococcus aureus VET0072R]
 gb|KAA31388.1| hypothetical protein W409_01352 [Staphylococcus aureus VET0075R]
 gb|KAA31540.1| hypothetical protein W408_01421 [Staphylococcus aureus VET0073R]
 gb|KAA35972.1| hypothetical protein W410_01570 [Staphylococcus aureus VET0076R]
 gb|KAA38343.1| hypothetical protein W411_01826 [Staphylococcus aureus VET0077R]
 gb|KAA39665.1| hypothetical protein W413_01708 [Staphylococcus aureus VET0080R]
 gb|KAA42861.1| hypothetical protein W415_02190 [Staphylococcus aureus VET0083R]
 gb|KAA46999.1| hypothetical protein W416_01269 [Staphylococcus aureus VET0084R]
 gb|KAA49526.1| hypothetical protein W417_01199 [Staphylococcus aureus VET0085R]
 gb|KAA49678.1| hypothetical protein W418_02129 [Staphylococcus aureus VET0086R]
 gb|KAA54094.1| hypothetical protein W419_01388 [Staphylococcus aureus VET0087R]
 gb|KAA58531.1| hypothetical protein W421_00226 [Staphylococcus aureus VET0089R]
 gb|KAA59540.1| hypothetical protein W420_01544 [Staphylococcus aureus VET0088R]
 gb|KAA61661.1| hypothetical protein W422_01777 [Staphylococcus aureus VET0090R]
 gb|KAA67881.1| hypothetical protein W424_01232 [Staphylococcus aureus VET0092R]
 gb|KAA70262.1| hypothetical protein W425_01206 [Staphylococcus aureus VET0093R]
 gb|KAA73637.1| hypothetical protein W426_00788 [Staphylococcus aureus VET0094R]
 gb|KAA75120.1| hypothetical protein W427_01718 [Staphylococcus aureus VET0095R]
 gb|KAA78080.1| hypothetical protein W428_01371 [Staphylococcus aureus VET0097R]
 gb|KAA80277.1| hypothetical protein W429_01678 [Staphylococcus aureus VET0098R]
 gb|KAA83276.1| hypothetical protein W430_01587 [Staphylococcus aureus VET0099R]
 gb|KAA86154.1| hypothetical protein W431_01380 [Staphylococcus aureus VET0101R]
 gb|KAA87842.1| hypothetical protein W433_01430 [Staphylococcus aureus VET0103R]
 gb|KAA89714.1| hypothetical protein W434_02113 [Staphylococcus aureus VET0104R]
 gb|KAA94333.1| hypothetical protein W435_01466 [Staphylococcus aureus VET0105R]
 gb|KAA95252.1| hypothetical protein W436_01393 [Staphylococcus aureus VET0107R]
 gb|KAA98464.1| hypothetical protein W437_01596 [Staphylococcus aureus VET0110R]
 gb|KAB01088.1| hypothetical protein W439_01736 [Staphylococcus aureus VET0112R]
 gb|KAB04311.1| hypothetical protein W441_01413 [Staphylococcus aureus VET0114R]
 gb|KAB06980.1| hypothetical protein W442_01132 [Staphylococcus aureus VET0115R]
 gb|KAB09577.1| hypothetical protein W443_01459 [Staphylococcus aureus VET0116R]
 gb|KAB12265.1| hypothetical protein W444_01478 [Staphylococcus aureus VET0117R]
 gb|KAB13063.1| hypothetical protein W445_01623 [Staphylococcus aureus VET0119R]
 gb|KAB17116.1| hypothetical protein W447_01512 [Staphylococcus aureus VET0123R]
 gb|KAB18571.1| hypothetical protein W448_02129 [Staphylococcus aureus VET0124R]
 gb|KAB21557.1| hypothetical protein W450_01464 [Staphylococcus aureus VET0126R]
 gb|KAB24694.1| hypothetical protein W451_01532 [Staphylococcus aureus VET0127R]
 gb|KAB28355.1| hypothetical protein W452_01993 [Staphylococcus aureus VET0128R]
 gb|KAB29601.1| hypothetical protein W453_00226 [Staphylococcus aureus VET0129R]
 gb|KAB32863.1| hypothetical protein W454_01480 [Staphylococcus aureus VET0130R]
 gb|KAB35409.1| hypothetical protein W455_01435 [Staphylococcus aureus VET0132R]
 gb|KAB39112.1| hypothetical protein W457_01488 [Staphylococcus aureus VET0134R]
 gb|KAB39859.1| hypothetical protein W456_01057 [Staphylococcus aureus VET0133R]
 gb|KAB42798.1| hypothetical protein W459_01835 [Staphylococcus aureus VET0140R]
 gb|KAB46413.1| hypothetical protein W461_01451 [Staphylococcus aureus VET0148R]
 gb|KAB47741.1| hypothetical protein W463_01358 [Staphylococcus aureus VET0151R]
 gb|KAB50393.1| hypothetical protein W464_02131 [Staphylococcus aureus VET0152R]
 gb|KAB54735.1| hypothetical protein W466_01048 [Staphylococcus aureus VET0155R]
 gb|KAB56096.1| hypothetical protein W467_01229 [Staphylococcus aureus VET0156R]
 gb|KAB58480.1| hypothetical protein W471_01915 [Staphylococcus aureus VET0161R]
 gb|KAB61596.1| hypothetical protein W472_01356 [Staphylococcus aureus VET0162R]
 gb|KAB64190.1| hypothetical protein W473_01376 [Staphylococcus aureus VET0164R]
 gb|KAB67485.1| hypothetical protein W474_01093 [Staphylococcus aureus VET0165R]
 gb|KAB69770.1| hypothetical protein W475_01368 [Staphylococcus aureus VET0166R]
 gb|KAB72025.1| hypothetical protein W476_01287 [Staphylococcus aureus VET0167R]
 gb|KAB74114.1| hypothetical protein W477_01797 [Staphylococcus aureus VET0171R]
 gb|KAB77615.1| hypothetical protein W478_01120 [Staphylococcus aureus VET0176R]
 gb|KAB78175.1| hypothetical protein W479_02041 [Staphylococcus aureus VET0177R]
 gb|KAB82178.1| hypothetical protein W480_01464 [Staphylococcus aureus VET0178R]
 gb|KAB85202.1| hypothetical protein W482_01898 [Staphylococcus aureus VET0180R]
 gb|KAB85774.1| hypothetical protein W481_01408 [Staphylococcus aureus VET0179R]
 gb|KAB91540.1| hypothetical protein W487_00611 [Staphylococcus aureus VET0188R]
 gb|KAB93104.1| hypothetical protein W488_01545 [Staphylococcus aureus VET0189R]
 gb|KAB94380.1| hypothetical protein W489_01676 [Staphylococcus aureus VET0190R]
 gb|KAB98228.1| hypothetical protein W492_02134 [Staphylococcus aureus VET0193R]
 gb|KAB99085.1| hypothetical protein W491_00957 [Staphylococcus aureus VET0192R]
 gb|KAC03615.1| hypothetical protein W493_01234 [Staphylococcus aureus VET0194R]
 gb|KAC05189.1| hypothetical protein W494_01804 [Staphylococcus aureus VET0195R]
 gb|KAC08870.1| hypothetical protein W497_01208 [Staphylococcus aureus VET0198R]
 gb|KAC11270.1| hypothetical protein W499_01340 [Staphylococcus aureus VET0200R]
 gb|KAC13848.1| hypothetical protein W507_01354 [Staphylococcus aureus VET0212R]
 gb|KAC15962.1| hypothetical protein W508_01732 [Staphylococcus aureus VET0213R]
 gb|KAC19274.1| hypothetical protein W509_01324 [Staphylococcus aureus VET0214R]
 gb|KAC21826.1| hypothetical protein W510_01243 [Staphylococcus aureus VET0215R]
 gb|KAC24214.1| hypothetical protein W511_01615 [Staphylococcus aureus VET0216R]
 gb|KAC27057.1| hypothetical protein W512_01570 [Staphylococcus aureus VET0217R]
 gb|KAC28283.1| hypothetical protein W513_02007 [Staphylococcus aureus VET0218R]
 gb|KAC33678.1| hypothetical protein W515_00226 [Staphylococcus aureus VET0221R]
 gb|KAC34756.1| hypothetical protein W516_01560 [Staphylococcus aureus VET0222R]
 gb|KAC37517.1| hypothetical protein W517_01507 [Staphylococcus aureus VET0224R]
 gb|KAC38666.1| hypothetical protein W518_01550 [Staphylococcus aureus VET0227R]
 gb|KAC44894.1| hypothetical protein W519_00554 [Staphylococcus aureus VET0228R]
 gb|KAC45250.1| hypothetical protein W521_01689 [Staphylococcus aureus VET0230R]
 gb|KAC46566.1| hypothetical protein W524_01604 [Staphylococcus aureus VET0236R]
 gb|KAC50627.1| hypothetical protein W525_01599 [Staphylococcus aureus VET0237R]
 gb|KAC51737.1| hypothetical protein W526_01773 [Staphylococcus aureus VET0241R]
 gb|KAC55410.1| hypothetical protein W527_01594 [Staphylococcus aureus VET0243R]
 gb|KAC57589.1| hypothetical protein W529_02224 [Staphylococcus aureus VET0247R]
 gb|KAC59665.1| hypothetical protein W530_01819 [Staphylococcus aureus VET0249R]
 gb|KAC65026.1| hypothetical protein W532_00646 [Staphylococcus aureus VET0252R]
 gb|KAC66424.1| hypothetical protein W533_01428 [Staphylococcus aureus VET0253R]
 gb|KAC67259.1| hypothetical protein W534_01718 [Staphylococcus aureus VET0254R]
 gb|KAC72580.1| hypothetical protein W536_00705 [Staphylococcus aureus VET0259R]
 gb|KAC75630.1| hypothetical protein W537_01547 [Staphylococcus aureus VET0260R]
 gb|KAC76376.1| hypothetical protein W535_00198 [Staphylococcus aureus VET0256R]
 gb|KAC80783.1| hypothetical protein W538_00485 [Staphylococcus aureus VET0261R]
 gb|KAC82085.1| hypothetical protein W540_01604 [Staphylococcus aureus VET0267R]
 gb|KAC84491.1| hypothetical protein W539_01162 [Staphylococcus aureus VET0263R]
 gb|KAC87041.1| hypothetical protein W541_01396 [Staphylococcus aureus VET0268R]
 gb|KAC89838.1| hypothetical protein W542_01742 [Staphylococcus aureus VET0269R]
 gb|KAC92648.1| hypothetical protein W543_00730 [Staphylococcus aureus VET0270R]
 gb|KAC94726.1| hypothetical protein W544_01254 [Staphylococcus aureus VET0271R]
 gb|KAC97462.1| hypothetical protein W545_01599 [Staphylococcus aureus VET0275R]
 gb|KAC99100.1| hypothetical protein W546_01872 [Staphylococcus aureus VET0278R]
 gb|KAC99454.1| hypothetical protein W547_02187 [Staphylococcus aureus VET0279R]
 gb|KAD04208.1| hypothetical protein W548_02158 [Staphylococcus aureus VET0280R]
 gb|KAD08647.1| hypothetical protein W549_01140 [Staphylococcus aureus VET0282R]
 gb|KAD09936.1| hypothetical protein W550_01320 [Staphylococcus aureus VET0283R]
 gb|KAD13600.1| hypothetical protein W551_01271 [Staphylococcus aureus VET0284R]
 gb|KAD15907.1| hypothetical protein W552_01370 [Staphylococcus aureus VET0286R]
 gb|KAD18145.1| hypothetical protein W553_01186 [Staphylococcus aureus VET0287R]
 gb|KAD20827.1| hypothetical protein W554_01603 [Staphylococcus aureus VET0288R]
 gb|KAD21566.1| hypothetical protein W555_01704 [Staphylococcus aureus VET0289R]
 gb|KAD26406.1| hypothetical protein W556_00535 [Staphylococcus aureus VET0290R]
 gb|KAD28030.1| hypothetical protein W557_01688 [Staphylococcus aureus VET0291R]
 gb|KAD31000.1| hypothetical protein W558_01462 [Staphylococcus aureus VET0292R]
 gb|KAD33307.1| hypothetical protein W560_01340 [Staphylococcus aureus VET0294R]
 gb|KAD35309.1| hypothetical protein W561_01885 [Staphylococcus aureus VET0295R]
 gb|KAD38740.1| hypothetical protein W563_01567 [Staphylococcus aureus VET0297R]
 gb|KAD41302.1| hypothetical protein W562_01233 [Staphylococcus aureus VET0296R]
 gb|KAD42537.1| hypothetical protein W565_01732 [Staphylococcus aureus VET0299R]
 gb|KAD46007.1| hypothetical protein W566_01596 [Staphylococcus aureus VET0300R]
 gb|KAD48257.1| hypothetical protein W569_02074 [Staphylococcus aureus VET0303R]
 gb|KAD50913.1| hypothetical protein W568_01418 [Staphylococcus aureus VET0302R]
 gb|KAD59522.1| hypothetical protein W573_01632 [Staphylococcus aureus VET0307R]
 gb|KAD61381.1| hypothetical protein W574_01589 [Staphylococcus aureus VET0308R]
 gb|KAD66260.1| hypothetical protein W575_00420 [Staphylococcus aureus VET0309R]
 gb|KAD66655.1| hypothetical protein W576_01734 [Staphylococcus aureus VET0312R]
 gb|KAD71202.1| hypothetical protein W579_01767 [Staphylococcus aureus VET0315R]
 gb|KAD72263.1| hypothetical protein W577_01168 [Staphylococcus aureus VET0313R]
 gb|KAD76268.1| hypothetical protein W578_00226 [Staphylococcus aureus VET0314R]
 gb|KAD79300.1| hypothetical protein W580_01714 [Staphylococcus aureus VET0316R]
 gb|KAD79432.1| hypothetical protein W581_00922 [Staphylococcus aureus VET0317R]
 gb|KAD83275.1| hypothetical protein W582_01130 [Staphylococcus aureus VET0318R]
 gb|KAD85958.1| hypothetical protein W584_01642 [Staphylococcus aureus VET0320R]
 gb|KAD86620.1| hypothetical protein W585_01711 [Staphylococcus aureus VET0322R]
 gb|KAD91565.1| hypothetical protein W586_01347 [Staphylococcus aureus VET0323R]
 gb|KAD93994.1| hypothetical protein W587_01632 [Staphylococcus aureus VET0325R]
 gb|KAD94797.1| hypothetical protein W588_01616 [Staphylococcus aureus VET0326R]
 gb|KAD98515.1| hypothetical protein W589_01920 [Staphylococcus aureus VET0329R]
 gb|KAE00978.1| hypothetical protein W590_01299 [Staphylococcus aureus VET0331R]
 gb|KAE03719.1| hypothetical protein W592_01536 [Staphylococcus aureus VET0333R]
 gb|KAE07104.1| hypothetical protein W594_01408 [Staphylococcus aureus VET0336R]
 gb|KAE07976.1| hypothetical protein W593_01647 [Staphylococcus aureus VET0335R]
 gb|KAE11711.1| hypothetical protein W595_01338 [Staphylococcus aureus VET0337R]
 gb|KAE14112.1| hypothetical protein W596_01602 [Staphylococcus aureus VET0338R]
 gb|KAE17525.1| hypothetical protein W597_01298 [Staphylococcus aureus VET0339R]
 gb|KAE19492.1| hypothetical protein W598_01476 [Staphylococcus aureus VET0340R]
 gb|KAE22546.1| hypothetical protein W599_01480 [Staphylococcus aureus VET0341R]
 gb|KAE24913.1| hypothetical protein W602_01520 [Staphylococcus aureus VET0352R]
 gb|KAE27737.1| hypothetical protein W604_01400 [Staphylococcus aureus VET0354R]
 gb|KAE30328.1| hypothetical protein W605_01479 [Staphylococcus aureus VET0357R]
 gb|KAE30873.1| hypothetical protein W607_02046 [Staphylococcus aureus VET0359R]
 gb|KAE35248.1| hypothetical protein W608_01630 [Staphylococcus aureus VET0360R]
 gb|KAE38170.1| hypothetical protein W610_01448 [Staphylococcus aureus VET0363R]
 gb|KAE39716.1| hypothetical protein W612_01658 [Staphylococcus aureus VET0366R]
 gb|KAE42777.1| hypothetical protein W613_01679 [Staphylococcus aureus VET0367R]
 gb|KAE46364.1| hypothetical protein W615_01276 [Staphylococcus aureus VET0369R]
 gb|KAE47019.1| hypothetical protein W616_01613 [Staphylococcus aureus VET0373R]
 gb|KAE50646.1| hypothetical protein W617_01847 [Staphylococcus aureus VET0376R]
 gb|KAE53431.1| hypothetical protein W618_01451 [Staphylococcus aureus VET0382R]
 gb|KAE57087.1| hypothetical protein W619_01397 [Staphylococcus aureus VET0383R]
 gb|KAE58743.1| hypothetical protein W620_00897 [Staphylococcus aureus VET0384R]
 gb|KAE61192.1| hypothetical protein W621_01584 [Staphylococcus aureus VET0387R]
 gb|KAE64745.1| hypothetical protein W622_01605 [Staphylococcus aureus VET0388R]
 gb|KAE64849.1| hypothetical protein W623_01426 [Staphylococcus aureus VET0389R]
 gb|KAE69317.1| hypothetical protein W624_01603 [Staphylococcus aureus VET0390R]
 gb|KAE69999.1| hypothetical protein W625_01868 [Staphylococcus aureus VET0393R]
 gb|KAE73925.1| hypothetical protein W626_01801 [Staphylococcus aureus VET0394R]
 gb|KAE77257.1| hypothetical protein W628_01712 [Staphylococcus aureus VET0396R]
 gb|KAE78145.1| hypothetical protein W627_01568 [Staphylococcus aureus VET0395R]
 gb|KAE81838.1| hypothetical protein W629_01765 [Staphylococcus aureus VET0399R]
 gb|KAE85094.1| hypothetical protein W631_01775 [Staphylococcus aureus VET0401R]
 gb|KAE86804.1| hypothetical protein W632_01268 [Staphylococcus aureus VET0402R]
 gb|KAE90139.1| hypothetical protein W633_01695 [Staphylococcus aureus VET0403R]
 gb|KAE97135.1| hypothetical protein W636_02119 [Staphylococcus aureus VET0410R]
 gb|KAE98122.1| hypothetical protein W638_02469 [Staphylococcus aureus VET0412R]
 gb|KAF01046.1| hypothetical protein W637_01627 [Staphylococcus aureus VET0411R]
 gb|KAF05224.1| hypothetical protein W639_01718 [Staphylococcus aureus VET0413R]
 gb|KAF08283.1| hypothetical protein W642_01572 [Staphylococcus aureus VET0417R]
 gb|KAF10891.1| hypothetical protein W641_01375 [Staphylococcus aureus VET0415R]
 gb|KAF13139.1| hypothetical protein W643_01710 [Staphylococcus aureus VET0418R]
 gb|KAF16307.1| hypothetical protein W644_01250 [Staphylococcus aureus VET0421R]
 gb|KAF18832.1| hypothetical protein W646_01261 [Staphylococcus aureus VET0423R]
 gb|KAF21694.1| hypothetical protein W650_01728 [Staphylococcus aureus VET0427R]
 gb|KAF22948.1| hypothetical protein W648_01333 [Staphylococcus aureus VET0425R]
 gb|KAF27129.1| hypothetical protein W651_01360 [Staphylococcus aureus VET0428R]
 gb|KAF27630.1| hypothetical protein W653_02178 [Staphylococcus aureus VET0432R]
 gb|KAF32028.1| hypothetical protein W652_01169 [Staphylococcus aureus VET0431R]
 gb|KAF34535.1| hypothetical protein W654_01519 [Staphylococcus aureus VET0433R]
 gb|KAF36885.1| hypothetical protein W655_01685 [Staphylococcus aureus VET0434R]
 gb|KAF39834.1| hypothetical protein W656_01470 [Staphylococcus aureus VET0435R]
 gb|KAF43007.1| hypothetical protein W659_01337 [Staphylococcus aureus VET0438R]
 gb|KAF44880.1| hypothetical protein W660_01387 [Staphylococcus aureus VET0439R]
 gb|KAF48191.1| hypothetical protein W661_01390 [Staphylococcus aureus VET0440R]
 gb|KAF48848.1| hypothetical protein W662_01626 [Staphylococcus aureus VET0442R]
 gb|KAF52769.1| hypothetical protein W663_01518 [Staphylococcus aureus VET0443R]
 gb|KAF55757.1| hypothetical protein W665_01621 [Staphylococcus aureus VET0446R]
 gb|KAF56740.1| hypothetical protein W664_01320 [Staphylococcus aureus VET0444R]
 gb|KAF60391.1| hypothetical protein W666_01726 [Staphylococcus aureus VET0451R]
 gb|KAF63084.1| hypothetical protein W667_01617 [Staphylococcus aureus VET0452R]
 gb|KAF65837.1| hypothetical protein W668_01435 [Staphylococcus aureus VET0454R]
 gb|KAF68575.1| hypothetical protein W669_01295 [Staphylococcus aureus VET0455R]
 gb|KAF71595.1| hypothetical protein W670_01079 [Staphylococcus aureus VET0456R]
 gb|KAF73316.1| hypothetical protein W671_01593 [Staphylococcus aureus VET0459R]
 gb|KAF76220.1| hypothetical protein W672_01564 [Staphylococcus aureus VET0460R]
 gb|KAF78355.1| hypothetical protein W673_01604 [Staphylococcus aureus VET0462R]
 gb|KAF81568.1| hypothetical protein W674_01353 [Staphylococcus aureus VET0463R]
 gb|KAF84853.1| hypothetical protein W675_01157 [Staphylococcus aureus VET0464R]
 gb|KAF86983.1| hypothetical protein W676_01297 [Staphylococcus aureus VET0465R]
 gb|KAF89221.1| hypothetical protein W678_01478 [Staphylococcus aureus VET0468R]
 gb|KAF92689.1| hypothetical protein W684_01576 [Staphylococcus aureus VET0478R]
 gb|KAF95649.1| hypothetical protein W680_00092 [Staphylococcus aureus VET0470R]
 gb|KAF98859.1| hypothetical protein W687_01173 [Staphylococcus aureus VET0486R]
 gb|KAG00060.1| hypothetical protein W686_01371 [Staphylococcus aureus VET0485R]
 gb|KAG01341.1| hypothetical protein W685_01180 [Staphylococcus aureus VET0481R]
 gb|KAG04665.1| hypothetical protein W751_02188 [Staphylococcus aureus VET0519S]
 gb|KAG05732.1| hypothetical protein W688_01298 [Staphylococcus aureus VET0488R]
 gb|KAG09550.1| hypothetical protein W690_01687 [Staphylococcus aureus VET0596R]
 gb|KAG12220.1| hypothetical protein W754_02065 [Staphylococcus aureus VET0645S]
 gb|KAG16235.1| hypothetical protein W755_01625 [Staphylococcus aureus VET0657S]
 gb|KAG22040.1| hypothetical protein W759_01690 [Staphylococcus aureus VET0779S]
 gb|KAG28903.1| hypothetical protein W760_00630 [Staphylococcus aureus VET0787S]
 gb|KAG31184.1| hypothetical protein W762_00480 [Staphylococcus aureus VET0809S]
 gb|KAG32942.1| hypothetical protein W763_01439 [Staphylococcus aureus VET0810S]
 gb|KAG35904.1| hypothetical protein W765_02021 [Staphylococcus aureus VET0919S]
 gb|KAG36815.1| hypothetical protein W766_02343 [Staphylococcus aureus VET0920S]
 gb|KAG53179.1| hypothetical protein W771_01274 [Staphylococcus aureus VET1035S]
 gb|KAG56487.1| hypothetical protein W772_01160 [Staphylococcus aureus VET1048S]
 gb|KAG59833.1| hypothetical protein W774_00693 [Staphylococcus aureus VET1054S]
 gb|KAG60879.1| hypothetical protein W773_01933 [Staphylococcus aureus VET1052S]
 gb|KAG65484.1| hypothetical protein W776_00654 [Staphylococcus aureus VET1068S]
 gb|KAG67653.1| hypothetical protein W777_00227 [Staphylococcus aureus VET1088S]
 gb|KAG69056.1| hypothetical protein W779_01407 [Staphylococcus aureus VET1104S]
 gb|KAG71259.1| hypothetical protein W780_01592 [Staphylococcus aureus VET1168S]
 gb|KAG73850.1| hypothetical protein W781_01676 [Staphylococcus aureus VET1181S]
 gb|KAG77126.1| hypothetical protein W785_01899 [Staphylococcus aureus VET1411S]
 gb|KAG77310.1| hypothetical protein W782_01379 [Staphylococcus aureus VET1245S]
 gb|KAG82221.1| hypothetical protein W788_01482 [Staphylococcus aureus VET1434S]
 gb|KAG83612.1| hypothetical protein W789_01585 [Staphylococcus aureus VET1468S]
 gb|KAG85035.1| hypothetical protein W790_02125 [Staphylococcus aureus VET1495S]
 gb|KAG89934.1| hypothetical protein W791_01214 [Staphylococcus aureus VET1499S]
 gb|KAG94112.1| hypothetical protein W794_00995 [Staphylococcus aureus VET1519S]
 gb|KAG96714.1| hypothetical protein W795_01484 [Staphylococcus aureus VET1526S]
 gb|KAH03041.1| hypothetical protein W798_01454 [Staphylococcus aureus VET1727S]
 gb|KAH06975.1| hypothetical protein W799_01857 [Staphylococcus aureus VET1738S]
 gb|KAH08293.1| hypothetical protein W801_01800 [Staphylococcus aureus VET1816S]
 gb|KAH12018.1| hypothetical protein W800_01624 [Staphylococcus aureus VET1779S]
 gb|KAH16178.1| hypothetical protein W802_00956 [Staphylococcus aureus VET1817S]
 gb|KAH16871.1| hypothetical protein W803_01597 [Staphylococcus aureus VET1822S]
 gb|KAH21803.1| hypothetical protein W691_00971 [Staphylococcus aureus VET1831R]
 gb|KAH22361.1| hypothetical protein W692_01636 [Staphylococcus aureus VET1832R]
 gb|KAH31661.1| hypothetical protein W696_00880 [Staphylococcus aureus VET1838R]
 gb|KAH33987.1| hypothetical protein W697_00612 [Staphylococcus aureus VET1839R]
 gb|KAH35828.1| hypothetical protein W699_01806 [Staphylococcus aureus VET1843R]
 gb|KAH39096.1| hypothetical protein W700_01225 [Staphylococcus aureus VET1844R]
 gb|KAH41571.1| hypothetical protein W701_01551 [Staphylococcus aureus VET1845R]
 gb|KAH43456.1| hypothetical protein W702_01425 [Staphylococcus aureus VET1846R]
 gb|KAH46488.1| hypothetical protein W703_01612 [Staphylococcus aureus VET1848R]
 gb|KAH49356.1| hypothetical protein W704_01448 [Staphylococcus aureus VET1849R]
 gb|KAH50958.1| hypothetical protein W705_01784 [Staphylococcus aureus VET1850R]
 gb|KAH54600.1| hypothetical protein W706_01583 [Staphylococcus aureus VET1851R]
 gb|KAH55658.1| hypothetical protein W707_01951 [Staphylococcus aureus VET1852R]
 gb|KAH60355.1| hypothetical protein W708_00986 [Staphylococcus aureus VET1853R]
 gb|KAH62848.1| hypothetical protein W709_01107 [Staphylococcus aureus VET1854R]
 gb|KAH63766.1| hypothetical protein W710_02123 [Staphylococcus aureus VET1855R]
 gb|KAH66534.1| hypothetical protein W711_02002 [Staphylococcus aureus VET1856R]
 gb|KAH69270.1| hypothetical protein W713_02098 [Staphylococcus aureus VET1859R]
 gb|KAH72071.1| hypothetical protein W714_01605 [Staphylococcus aureus VET1860R]
 gb|KAH75725.1| hypothetical protein W715_01571 [Staphylococcus aureus VET1861R]
 gb|KAH78357.1| hypothetical protein W717_01907 [Staphylococcus aureus VET1866R]
 gb|KAH78772.1| hypothetical protein W716_01531 [Staphylococcus aureus VET1865R]
 gb|KAH82696.1| hypothetical protein W718_01809 [Staphylococcus aureus VET1867R]
 gb|KAH86311.1| hypothetical protein W719_01395 [Staphylococcus aureus VET1868R]
 gb|KAH88650.1| hypothetical protein W721_01466 [Staphylococcus aureus VET1871R]
 gb|KAH90795.1| hypothetical protein W722_01705 [Staphylococcus aureus VET1872R]
 gb|KAH92955.1| hypothetical protein W723_01602 [Staphylococcus aureus VET1873R]
 gb|KAH96959.1| hypothetical protein W726_01664 [Staphylococcus aureus VET1877R]
 gb|KAH97696.1| hypothetical protein W724_01250 [Staphylococcus aureus VET1875R]
 gb|KAI01466.1| hypothetical protein W727_01644 [Staphylococcus aureus VET1880R]
 gb|KAI04434.1| hypothetical protein W729_01650 [Staphylococcus aureus VET1886R]
 gb|KAI06414.1| hypothetical protein W728_01184 [Staphylococcus aureus VET1884R]
 gb|KAI09547.1| hypothetical protein W730_01390 [Staphylococcus aureus VET1890R]
 gb|KAI11840.1| hypothetical protein W731_01551 [Staphylococcus aureus VET1892R]
 gb|KAI14517.1| hypothetical protein W732_01500 [Staphylococcus aureus VET1893R]
 gb|KAI16557.1| hypothetical protein W733_01657 [Staphylococcus aureus VET1895R]
 gb|KAI19651.1| hypothetical protein W735_01484 [Staphylococcus aureus VET1897R]
 gb|KAI22779.1| hypothetical protein W737_01438 [Staphylococcus aureus VET1899R]
 gb|KAI23388.1| hypothetical protein W738_01663 [Staphylococcus aureus VET1901R]
 gb|KAI27660.1| hypothetical protein W739_01368 [Staphylococcus aureus VET1904R]
 gb|KAI30866.1| hypothetical protein W740_01386 [Staphylococcus aureus VET1905R]
 gb|KAI32747.1| hypothetical protein W741_01386 [Staphylococcus aureus VET1906R]
 gb|KAI35873.1| hypothetical protein W743_01091 [Staphylococcus aureus VET1908R]
 gb|KAI38502.1| hypothetical protein W744_01526 [Staphylococcus aureus VET1909R]
 gb|KAI39037.1| hypothetical protein W746_01755 [Staphylococcus aureus VET1911R]
 gb|KAI43173.1| hypothetical protein W747_01612 [Staphylococcus aureus VET1912R]
 gb|KAI43844.1| hypothetical protein W748_02213 [Staphylococcus aureus VET1913R]
 gb|KAI45493.1| hypothetical protein W749_02184 [Staphylococcus aureus VET1914R]
 gb|KAI51058.1| hypothetical protein W804_01640 [Staphylococcus aureus VET1917S]
 gb|KAI53035.1| hypothetical protein W808_01864 [Staphylococcus aureus VET1949S]
 gb|KAI55717.1| hypothetical protein W806_00480 [Staphylococcus aureus VET1923S]
 gb|KAI58328.1| hypothetical protein W809_01574 [Staphylococcus aureus VET1950S]
 gb|KAI60171.1| hypothetical protein W811_02069 [Staphylococcus aureus VET1956S]
 gb|KAI64108.1| hypothetical protein W812_00949 [Staphylococcus aureus VET1959S]
 gb|KAI66293.1| hypothetical protein V136_01503 [Staphylococcus aureus ZTA09/03576-8HST]
 gb|KAI68482.1| hypothetical protein V142_01564 [Staphylococcus aureus ZTA09/03734-9HSA]
 gb|KAI71686.1| hypothetical protein V144_01104 [Staphylococcus aureus ZTA09/03745-9HSA]
 gb|KAI73270.1| hypothetical protein V130_01576 [Staphylococcus aureus ZTA10/00045-9HST]
 gb|KAI76365.1| hypothetical protein V134_01524 [Staphylococcus aureus ZTA10/00047-8HST]
 gb|KAI79015.1| hypothetical protein V132_01516 [Staphylococcus aureus ZTA10/00058-8HST]
 gb|KAI81429.1| hypothetical protein V141_01421 [Staphylococcus aureus ZTA10/02412-8HSA]
 gb|KAI83959.1| hypothetical protein V145_01472 [Staphylococcus aureus ZTA11/00189-8HSA]
Length=334

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_031838281.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|EZU99296.1| hypothetical protein U920_00723 [Staphylococcus aureus 11S00627]
Length=334

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_000076917.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 ref|YP_005758681.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
11819-97]
 gb|AEW66249.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
11819-97]
 gb|EHP00351.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21333]
 gb|EOR34731.1| molybdopterin biosynthesis protein moeB [Staphylococcus aureus 
subsp. aureus 103564]
Length=334

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_000076924.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 ref|YP_005298601.1| Molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus M013]
 ref|YP_008486060.1| molybdopterin biosynthesis MoeB protein, putative [Staphylococcus 
aureus subsp. aureus 6850]
 ref|YP_008586200.1| putative molybdopterin synthase sulfurylase [Staphylococcus aureus 
subsp. aureus SA957]
 ref|YP_008588664.1| putative molybdopterin synthase sulfurylase [Staphylococcus aureus 
subsp. aureus SA40]
 gb|AEV79226.1| Molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus M013]
 gb|EHO88163.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21262]
 gb|AGU55867.1| molybdopterin biosynthesis MoeB protein, putative [Staphylococcus 
aureus subsp. aureus 6850]
 gb|AGW34601.1| putative molybdopterin synthase sulfurylase [Staphylococcus aureus 
subsp. aureus SA957]
 gb|AGW37065.1| putative molybdopterin synthase sulfurylase [Staphylococcus aureus 
subsp. aureus SA40]
 gb|EVG59044.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6067]
 gb|EVG61657.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6066]
 gb|EVI07306.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
OCMM6095]
 gb|EVZ13536.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H48052]
 gb|EVZ15409.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H48054]
 gb|EWY22568.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W73738]
 gb|EXP38913.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W25797]
 gb|EYF20603.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F19490]
 gb|EYH41150.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W25799]
 gb|EYK05392.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M17033]
 gb|EYL90899.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M64056]
 gb|EYM18890.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T63897]
 gb|EYM22029.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T63898]
 gb|KAG91966.1| hypothetical protein W793_01546 [Staphylococcus aureus VET1518S]
 gb|KDP59378.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21321]
 gb|AII56744.1| putative molybdopterin synthase sulfurylase [Staphylococcus aureus 
subsp. aureus SA268]
Length=334

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_000076928.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 ref|YP_005756035.1| putative molybdopterin synthase sulfurylase [Staphylococcus aureus 
subsp. aureus LGA251]
 emb|CCC88825.1| putative molybdopterin synthase sulfurylase [Staphylococcus aureus 
subsp. aureus LGA251]
Length=334

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_031385318.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|KEK30455.1| moeZ/MoeB domain protein [Staphylococcus aureus LysK 1 2010]
 gb|KEK31893.1| moeZ/MoeB domain protein [Staphylococcus aureus Lyso 2 2010]
 gb|KEK38177.1| moeZ/MoeB domain protein [Staphylococcus aureus LysK 2 2010]
 gb|KEK46936.1| moeZ/MoeB domain protein [Staphylococcus aureus 1801-2 2010]
 gb|KEK51933.1| moeZ/MoeB domain protein [Staphylococcus aureus 1801-1 2010]
 gb|KEK59861.1| moeZ/MoeB domain protein [Staphylococcus aureus LysK 1 2011]
 gb|KEK60010.1| moeZ/MoeB domain protein [Staphylococcus aureus 1101-1 2011]
 gb|KEK67407.1| moeZ/MoeB domain protein [Staphylococcus aureus 1801-1 2011]
Length=334

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_031869558.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|EZY09230.1| hypothetical protein V091_02681 [Staphylococcus aureus GD2010-131]
 gb|EZY12280.1| hypothetical protein V091_02345 [Staphylococcus aureus GD2010-131]
Length=334

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_031845249.1| molybdopterin biosynthesis protein MoeB, partial [Staphylococcus 
aureus]
 gb|EWA21540.1| hypothetical protein U408_02815, partial [Staphylococcus aureus 
H77094]
Length=162

 Score = 58.2 bits (139),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  110  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  148



>ref|WP_000076914.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 ref|YP_041715.1| molybdopterin synthase sulfurylase [Staphylococcus aureus subsp. 
aureus MRSA252]
 ref|YP_005747004.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus TCH60]
 ref|YP_008450156.1| UBA/THIF-type NAD/FAD binding protein [Staphylococcus aureus 
subsp. aureus 55/2053]
 emb|CAG41341.1| putative molybdopterin synthase sulfurylase [Staphylococcus aureus 
subsp. aureus MRSA252]
 gb|EEV04879.1| UBA/THIF-type NAD/FAD binding protein [Staphylococcus aureus 
subsp. aureus 55/2053]
 gb|EEV07519.1| molybdopterin biosynthesis protein [Staphylococcus aureus subsp. 
aureus 65-1322]
 gb|EEV10144.1| molybdopterin biosynthesis protein moeB [Staphylococcus aureus 
subsp. aureus 68-397]
 gb|EEV12734.1| molybdopterin biosynthesis protein moeB [Staphylococcus aureus 
subsp. aureus E1410]
 gb|EEV15395.1| molybdopterin biosynthesis protein [Staphylococcus aureus subsp. 
aureus M876]
 gb|EFB42989.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus C101]
 gb|EFB45650.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus C427]
 gb|EFB51179.1| putative molybdopterin biosynthesis MoeB protein [Staphylococcus 
aureus subsp. aureus M899]
 gb|EFB53848.1| thiazole biosynthesis adenylyltransferase ThiF [Staphylococcus 
aureus subsp. aureus WBG10049]
 gb|EFB56869.1| thiazole biosynthesis adenylyltransferase ThiF [Staphylococcus 
aureus subsp. aureus WW2703/97]
 gb|EFB59038.1| molybdopterin biosynthesis protein moeB [Staphylococcus aureus 
subsp. aureus Btn1260]
 gb|EFC01596.1| putative molybdopterin biosynthesis MoeB protein [Staphylococcus 
aureus subsp. aureus C160]
 gb|EFC27473.1| putative molybdopterin biosynthesis MoeB protein [Staphylococcus 
aureus subsp. aureus A017934/97]
 gb|EFD95832.1| putative molybdopterin biosynthesis MoeB protein [Staphylococcus 
aureus subsp. aureus M1015]
 gb|EFF08619.1| molybdopterin biosynthesis protein moeB [Staphylococcus aureus 
subsp. aureus M809]
 gb|EFG56849.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus EMRSA16]
 gb|EFH96879.1| ThiF family protein [Staphylococcus aureus subsp. aureus MN8]
 gb|ADQ76384.1| ThiF family protein [Staphylococcus aureus subsp. aureus TCH60]
 gb|EFU23927.1| putative molybdopterin synthase sulfurylase [Staphylococcus aureus 
subsp. aureus CGS00]
 gb|EGS96914.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21195]
 gb|EHO94431.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21264]
 gb|EHQ69953.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21345]
 gb|EHQ71927.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21342]
 gb|EHT26427.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
CIG1242]
 gb|EHT31940.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
CIG1214]
 gb|EHT33903.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
CIG1500]
 gb|EHT37636.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
CIG1605]
 gb|EHT61256.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
CIG1233]
 gb|EHT63272.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
CIG1176]
 gb|EHT77146.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
CIG1267]
 gb|EHT83955.1| moeZ/MoeB domain protein [Staphylococcus aureus subsp. aureus 
CIG149]
 gb|ENK08084.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0408]
 gb|ENK45313.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0513]
 gb|ENL94574.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1034]
 gb|ENM60602.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M1256]
 gb|ENN50904.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0946]
 gb|EOR43406.1| molybdopterin biosynthesis protein moeB [Staphylococcus aureus 
subsp. aureus 122051]
 gb|EUG14856.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0594]
 gb|EUX82892.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0359]
 gb|EUY91022.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0426]
 gb|EUZ00617.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0437]
 gb|EUZ52266.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0465]
 gb|EVA33323.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0522]
 gb|EVA57823.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0541]
 gb|EVA82707.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0552]
 gb|EVB46436.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M0590]
 gb|EVD06627.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
WMCS6019]
 gb|EVI47779.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
UCIM6119]
 gb|EVJ41488.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
KINW6056]
 gb|EVJ55502.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
KINW6066]
 gb|EWI96055.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T44444]
 gb|EWW51887.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T86574]
 gb|EWW94563.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F82600]
 gb|EXO53293.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
DAR5867]
 gb|EYF86036.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T16600]
 gb|EYJ39904.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F42556]
 gb|EYK67618.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
T55954]
 gb|EZH94319.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21230]
 gb|EZH98280.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21275]
 gb|KAG37778.1| hypothetical protein W764_01095 [Staphylococcus aureus VET0889S]
 gb|AIO21908.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus]
 emb|CEH27093.1| Molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|AIW27955.1| Molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus]
 gb|KHF79329.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus]
Length=334

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_000076922.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|EGS83016.1| ThiF family protein [Staphylococcus aureus subsp. aureus 21235]
Length=334

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_031884683.1| molybdopterin biosynthesis protein MoeB, partial [Staphylococcus 
aureus]
 gb|EWN30514.1| hypothetical protein Q150_02603, partial [Staphylococcus aureus 
M1145]
Length=94

 Score = 57.0 bits (136),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  42   FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  80



>gb|EFE26717.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus 
subsp. aureus 58-424]
Length=240

 Score = 57.8 bits (138),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  188  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  226



>ref|WP_000076921.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|EHS75722.1| ThiF family protein [Staphylococcus aureus subsp. aureus IS-160]
 gb|EVX47054.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F70893]
 gb|EVX67428.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F77047]
 gb|EWB32029.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
W21932]
 gb|EWL66020.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F77917]
 gb|EWW99736.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
H81433]
Length=334

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>ref|WP_000076918.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 ref|YP_417605.1| molybdopterin biosynthesis protein [Staphylococcus aureus RF122]
 emb|CAI81837.1| molybdopterin biosynthesis protein [Staphylococcus aureus RF122]
Length=334

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  320



>emb|CDR51275.1| putative molybdopterin synthase sulfurylase [Staphylococcus aureus]
 emb|CDR27558.1| putative molybdopterin synthase sulfurylase [Staphylococcus aureus]
Length=334

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL    + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLNEQQLNYRSNTYMVMFEFKGHRIVAFDGGRFLIHGMT  320



>emb|CDR61909.1| putative molybdopterin synthase sulfurylase [Staphylococcus aureus]
 emb|CDR54932.1| putative molybdopterin synthase sulfurylase [Staphylococcus aureus]
Length=334

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL    + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLNEQQLNYRSNTYMVMFEFKGHRIVAFDGGRFLIHGMT  320



>emb|CDR25605.1| putative molybdopterin synthase sulfurylase [Staphylococcus aureus]
Length=334

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL    + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLNEQQLNYRSNTYMVMFEFKGHRIVAFDGGRFLIHGMT  320



>emb|CDR66989.1| putative molybdopterin synthase sulfurylase [Staphylococcus aureus]
Length=334

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL    + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLNEQQLNYRSNTYMVMFEFKGHRIVAFDGGRFLIHGMT  320



>emb|CDR59100.1| putative molybdopterin synthase sulfurylase [Staphylococcus aureus]
 emb|CDR21066.1| putative molybdopterin synthase sulfurylase [Staphylococcus aureus]
 emb|CDR63968.1| putative molybdopterin synthase sulfurylase [Staphylococcus aureus]
 emb|CDR22182.1| putative molybdopterin synthase sulfurylase [Staphylococcus aureus]
Length=334

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL    + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLNEQQLNYRSNTYMIMFEFKGHRIVAFDGGRFLIHGMT  320



>ref|WP_000085834.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 ref|YP_005326598.1| putative molybdopterin synthase sulfurylase [Staphylococcus aureus 
subsp. aureus MSHR1132]
 emb|CCE59929.1| putative molybdopterin synthase sulfurylase [Staphylococcus aureus 
subsp. aureus MSHR1132]
Length=334

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL    + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLNEQQLNYRSNTYMIMFEFKGHRIVAFDGGRFLIHGMT  320



>ref|WP_031787095.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|EYG93893.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
F87619]
 gb|EYL87525.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
M21126]
 emb|CDR56277.1| putative molybdopterin synthase sulfurylase [Staphylococcus aureus]
Length=334

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL    + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  282  FLNEQQLNYRSNTYMIMFEFKGHRIVAFDGGRFLIHGMT  320



>ref|WP_031871988.1| molybdopterin biosynthesis protein MoeB [Staphylococcus aureus]
 gb|EVJ72743.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
CHAP6022]
Length=334

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF F+  RIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFEFKGRRIVAFKGGRFLIHGMT  320



>gb|EUR19944.1| adenylyltransferase and sulfurtransferase [Staphylococcus aureus 
SJUD6056]
Length=334

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+++ + YR+N YM MF  + HRIVAF GGRFLIHG T
Sbjct  282  FLKQHQLNYRSNSYMVMFESKGHRIVAFKGGRFLIHGMT  320



>ref|WP_037535968.1| molybdopterin biosynthesis protein MoeB [Staphylococcus haemolyticus]
 gb|KGJ28853.1| molybdopterin biosynthesis protein MoeB [Staphylococcus haemolyticus]
 gb|KGJ30536.1| molybdopterin biosynthesis protein MoeB [Staphylococcus haemolyticus]
Length=334

 Score = 56.6 bits (135),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FL+++H+ YR N YM MF ++ HRIV+F GGR LIHGTT+
Sbjct  282  FLKQHHLNYRENKYMIMFEYKGHRIVSFEGGRMLIHGTTK  321



>ref|WP_011275099.1| MULTISPECIES: molybdopterin biosynthesis protein MoeB [Staphylococcus]
 ref|YP_252691.1| hypothetical protein SH0776 [Staphylococcus haemolyticus JCSC1435]
 dbj|BAE04085.1| moeB [Staphylococcus haemolyticus JCSC1435]
 gb|EZI37943.1| putative molybdopterin synthase sulfurylase [Staphylococcus haemolyticus]
 gb|KDP47610.1| ThiF family protein [Staphylococcus aureus subsp. aureus CO-98]
Length=334

 Score = 56.6 bits (135),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FL+++H+ YR N YM MF ++ HRIV+F GGR LIHGTT+
Sbjct  282  FLKQHHLNYRENKYMIMFEYKGHRIVSFEGGRMLIHGTTK  321



>ref|WP_037549816.1| molybdopterin biosynthesis protein MoeB [Staphylococcus haemolyticus]
 gb|KGF28284.1| molybdopterin biosynthesis protein MoeB [Staphylococcus haemolyticus 
DNF00585]
Length=334

 Score = 56.6 bits (135),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FL+++H+ YR N YM MF ++ HRIV+F GGR LIHGTT+
Sbjct  282  FLKQHHLNYRENKYMIMFEYKGHRIVSFEGGRMLIHGTTK  321



>ref|WP_029055848.1| molybdopterin biosynthesis protein MoeB [Staphylococcus sp. URHA0057]
Length=334

 Score = 55.8 bits (133),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL  +HIQY+ N YM +F F+ +RIVAF+GGR LIHG T
Sbjct  282  FLNSHHIQYKQNPYMIVFSFKGYRIVAFNGGRLLIHGLT  320



>ref|WP_002461823.1| molybdopterin biosynthesis protein MoeB [Staphylococcus simiae]
 gb|EHJ09028.1| molybdopterin biosynthesis protein B [Staphylococcus simiae CCM 
7213]
Length=334

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHG  12
            FL  + + YR+N YM MF F+ HRIVAF GGRFLIHG
Sbjct  282  FLNEHQLNYRSNQYMVMFEFKGHRIVAFEGGRFLIHG  318



>gb|EUK97870.1| hypothetical protein O505_02772, partial [Staphylococcus aureus 
M0410]
Length=49

 Score = 52.0 bits (123),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -2

Query  104  IQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            + YR+N YM MF F+ HRIVAF GGRFLIHG T
Sbjct  3    LNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT  35



>ref|WP_002479604.1| hypothetical protein [Staphylococcus simulans]
 gb|EKS32275.1| hypothetical protein HMPREF9310_00107 [Staphylococcus simulans 
ACS-120-V-Sch1]
 gb|ERS94269.1| molybdopterin biosynthesis protein MoeB [Staphylococcus simulans 
UMC-CNS-990]
Length=333

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            +LE +HI+Y  N YM  F F  HRIV+FSGGR LIHG T+
Sbjct  281  YLETHHIKYHANPYMIRFEFNNHRIVSFSGGRMLIHGMTK  320



>ref|WP_026083547.1| molybdopterin biosynthesis protein MoeB [Staphylococcus sp. E463]
Length=334

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL  +HIQ++ N YM +F F+ +RIVAF+GGR LIHG T
Sbjct  282  FLNSHHIQFKQNPYMIVFSFKGYRIVAFNGGRLLIHGLT  320



>ref|WP_002465417.1| molybdopterin biosynthesis protein MoeB [Staphylococcus warneri]
 ref|YP_007384405.1| hypothetical protein A284_03190 [Staphylococcus warneri SG1]
 gb|EGG97989.1| ThiF family protein [Staphylococcus epidermidis VCU121]
 gb|AGC89961.1| hypothetical protein A284_03190 [Staphylococcus warneri SG1]
 gb|KEK50329.1| moeZ/MoeB domain protein [Staphylococcus warneri Lyso 1 2011]
 gb|KEK56922.1| moeZ/MoeB domain protein [Staphylococcus warneri Lyso 2 2011]
Length=334

 Score = 53.1 bits (126),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHG  12
            FL+ +HIQY+ N YM +F F  +RIVAF+GGR LIHG
Sbjct  282  FLKTHHIQYKQNPYMIVFTFNGYRIVAFNGGRLLIHG  318



>ref|WP_023373649.1| molybdopterin biosynthesis protein MoeB [Staphylococcus pasteuri]
 ref|YP_008759274.1| molybdopterin biosynthesis protein MoeB [Staphylococcus pasteuri 
SP1]
 gb|AGZ25062.1| molybdopterin biosynthesis protein MoeB [Staphylococcus pasteuri 
SP1]
Length=334

 Score = 53.1 bits (126),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHG  12
            FL+ +HIQY+ N YM +F F  +RIVAF+GGR LIHG
Sbjct  282  FLKTHHIQYKQNPYMIVFSFNGYRIVAFNGGRLLIHG  318



>ref|WP_002450299.1| molybdopterin biosynthesis protein MoeB [Staphylococcus warneri]
 gb|EEQ80930.1| ThiF family protein [Staphylococcus warneri L37603]
Length=334

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHG  12
            FL+ +HIQY+ N YM +F F  +RIVAF+GGR LIHG
Sbjct  282  FLKTHHIQYKQNPYMIVFSFNGYRIVAFNGGRLLIHG  318



>ref|WP_037567062.1| molybdopterin biosynthesis protein MoeB [Staphylococcus agnetis]
 gb|KFE41175.1| Molybdopterin biosynthesis protein MoeB [Staphylococcus agnetis]
Length=334

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FLE+ HI Y++N YM  F F+ HR++ F  GR LIHG  E
Sbjct  282  FLEQRHIAYKSNGYMVQFVFQHHRMIGFQNGRLLIHGIKE  321



>ref|WP_019468093.1| molybdopterin biosynthesis protein MoeB [Staphylococcus sp. AL1]
Length=334

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL+R  I Y+ N YM  F+++ HRIV+F GGR LIHG T
Sbjct  282  FLQRQEIPYQRNPYMLHFKYKAHRIVSFKGGRLLIHGMT  320



>ref|WP_015901006.1| molybdopterin biosynthesis protein MoeB [Staphylococcus carnosus]
 ref|YP_002634855.1| putative molybdopterin biosynthesis protein moeB [Staphylococcus 
carnosus subsp. carnosus TM300]
 gb|AAC83136.1| MoeB [Staphylococcus carnosus]
 emb|CAL28670.1| putative molybdopterin biosynthesis protein moeB [Staphylococcus 
carnosus subsp. carnosus TM300]
Length=333

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            +L+ +HI Y  N YM  F F  HRIV+FSGGR LIHG T+
Sbjct  281  YLDAHHIHYHANPYMLRFEFNGHRIVSFSGGRMLIHGMTK  320



>ref|WP_002460097.1| molybdopterin biosynthesis protein MoeB [Staphylococcus lugdunensis]
 gb|EFU84006.1| ThiF family protein [Staphylococcus lugdunensis M23590]
Length=334

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            +L+   I Y+TN Y+ MF F ++RIV F  GRFLIHG T
Sbjct  282  YLDSRQIDYQTNGYLVMFHFNKYRIVCFHDGRFLIHGMT  320



>ref|WP_002492280.1| molybdopterin biosynthesis protein MoeB [Staphylococcus lugdunensis]
 gb|EHS04935.1| ThiF family protein [Staphylococcus lugdunensis VCU139]
 gb|EVI53755.1| adenylyltransferase and sulfurtransferase [Staphylococcus lugdunensis 
UCIM6116]
 gb|KAK58906.1| ThiF family protein [Staphylococcus lugdunensis VCU148]
Length=334

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            +L+   I Y+TN Y+ MF F ++RIV F  GRFLIHG T
Sbjct  282  YLDARQIDYQTNGYLVMFHFNKYRIVCFHDGRFLIHGMT  320



>ref|WP_037545112.1| molybdopterin biosynthesis protein MoeB [Staphylococcus lugdunensis]
 gb|KAK56083.1| ThiF family protein [Staphylococcus lugdunensis VCU150]
Length=334

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            +L+   I Y+TN Y+ MF F ++RIV F  GRFLIHG T
Sbjct  282  YLDARQIDYQTNGYLVMFHFNKYRIVCFHDGRFLIHGMT  320



>ref|WP_002478814.1| molybdopterin biosynthesis protein MoeB [Staphylococcus lugdunensis]
 ref|YP_003471024.1| molybdopterin biosynthesis protein B [Staphylococcus lugdunensis 
HKU09-01]
 ref|YP_005759869.1| putative molybdopterin synthase sulfurylase [Staphylococcus lugdunensis 
N920143]
 gb|ADC86897.1| Molybdopterin biosynthesis protein B [Staphylococcus lugdunensis 
HKU09-01]
 emb|CCB53199.1| putative molybdopterin synthase sulfurylase [Staphylococcus lugdunensis 
N920143]
 gb|EKS23704.1| hypothetical protein HMPREF9308_01388 [Staphylococcus lugdunensis 
ACS-027-V-Sch2]
Length=334

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            +L    I Y+TN Y+ MF F ++RIV F  GRFLIHG T
Sbjct  282  YLGARQIDYQTNGYLVMFHFNKYRIVCFHDGRFLIHGMT  320



>ref|WP_039647528.1| molybdopterin biosynthesis protein MoeB [Staphylococcus hyicus]
Length=333

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FLE+ +I Y+TN Y+  F+F++ R++AF  GR LIHG  E
Sbjct  281  FLEQRNIAYKTNGYIVQFQFQQRRMIAFQNGRILIHGLKE  320



>gb|AJC95410.1| molybdopterin biosynthesis protein MoeB [Staphylococcus hyicus]
Length=335

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FLE+ +I Y+TN Y+  F+F++ R++AF  GR LIHG  E
Sbjct  283  FLEQRNIAYKTNGYIVQFQFQQRRMIAFQNGRILIHGLKE  322



>ref|WP_019835261.1| molybdopterin biosynthesis protein MoeB [Staphylococcus sp. MDS7B]
Length=334

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FL    I+Y  N YM +F F++HRIV F GGR LIHGTT+
Sbjct  282  FLTALDIRYHENQYMLVFEFKKHRIVYFEGGRMLIHGTTK  321



>ref|WP_017174868.1| MULTISPECIES: molybdopterin biosynthesis protein MoeB [Staphylococcus]
 gb|EUZ68462.1| adenylyltransferase and sulfurtransferase [Staphylococcus sp. 
M0480]
Length=334

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FL    I+Y  N YM +F F++HRIV F GGR LIHGTT+
Sbjct  282  FLTALDIRYHENQYMLVFEFKKHRIVYFEGGRMLIHGTTK  321



>gb|KDP12739.1| Molybdopterin biosynthesis protein MoeB [Staphylococcus chromogenes 
MU 970]
Length=333

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FL+++ I Y++N Y+  F F+ HRIV F  GR LIHG T+
Sbjct  281  FLDKHRIAYKSNGYIVQFMFQNHRIVGFQNGRLLIHGMTD  320



>ref|WP_002471317.1| molybdopterin biosynthesis protein MoeB [Staphylococcus pettenkoferi]
 gb|EHM71700.1| ThiF family protein [Staphylococcus pettenkoferi VCU012]
Length=333

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHG  12
            FL    ++Y+ N YM MF F+ HRI++F+GGR LIHG
Sbjct  281  FLGTKGMKYKQNDYMLMFEFKGHRIISFTGGRMLIHG  317



>ref|WP_037574840.1| molybdopterin biosynthesis protein MoeB [Staphylococcus chromogenes]
Length=334

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FL+++ I Y++N Y+  F F+ HRIV F  GR LIHG T+
Sbjct  282  FLDKHRIAYKSNGYIVQFMFQNHRIVGFQNGRLLIHGMTD  321



>ref|WP_002454995.1| molybdopterin biosynthesis protein MoeB [Staphylococcus hominis]
 gb|EFS20112.1| putative molybdopterin biosynthesis MoeB protein [Staphylococcus 
hominis subsp. hominis C80]
 gb|EHR86866.1| ThiF family protein [Staphylococcus hominis VCU122]
Length=334

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FL    I+Y  N YM +F F++HRIV F GGR LIHGTT+
Sbjct  282  FLIALDIRYHENQYMLVFEFKKHRIVYFEGGRMLIHGTTK  321



>ref|WP_002448508.1| molybdopterin biosynthesis protein MoeB [Staphylococcus hominis]
 gb|EEK12749.1| ThiF family protein [Staphylococcus hominis SK119]
Length=334

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FL    I+Y  N YM +F F++HRIV F GGR LIHGTT+
Sbjct  282  FLIALDIRYHENQYMLVFEFKKHRIVYFEGGRMLIHGTTK  321



>ref|WP_002506940.1| MULTISPECIES: molybdopterin biosynthesis protein MoeB [Staphylococcus]
 emb|CCI58784.1| molybdopterin biosynthesis protein MoeB [Staphylococcus equorum 
subsp. equorum Mu2]
 gb|EJX18787.1| molybdopterin synthase sulfurylase [Staphylococcus sp. OJ82]
Length=334

 Score = 47.8 bits (112),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL + +I YR N YM  F +  +RIV+F GGR LIHG T
Sbjct  282  FLTQQNIAYRRNPYMIHFEYNGYRIVSFKGGRLLIHGMT  320



>ref|WP_009382828.1| putative molybdopterin biosynthesis protein moeB [Staphylococcus 
massiliensis]
 gb|EKU48951.1| putative molybdopterin biosynthesis protein moeB [Staphylococcus 
massiliensis S46]
Length=334

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            +LE   IQY TN Y+  F+F  +RIV F  GR LIHG T+
Sbjct  282  YLEDKGIQYHTNGYLVRFKFESYRIVCFQDGRMLIHGLTD  321



>ref|WP_002509301.1| MULTISPECIES: molybdopterin biosynthesis protein MoeB [Staphylococcus]
 gb|EJY96484.1| molybdopterin synthase sulfurylase [Staphylococcus arlettae CVD059]
 gb|ERF49518.1| molybdopterin biosynthesis protein MoeB [Staphylococcus sp. EGD-HP3]
Length=334

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/40 (48%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FL    I +++N YM MF++  HRI++F  GR LIHG T+
Sbjct  282  FLIAKAIPFKSNNYMIMFQYEGHRIISFQNGRLLIHGMTK  321



>ref|WP_021338414.1| molybdopterin biosynthesis protein MoeB [Staphylococcus equorum]
 gb|ERH36242.1| molybdopterin biosynthesis protein MoeB [Staphylococcus equorum 
UMC-CNS-924]
Length=334

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTT  6
            FL + +I YR N YM  F +  +RIV+F GGR LIHG T
Sbjct  282  FLTQQNIAYRRNPYMIHFEYNGYRIVSFKGGRLLIHGMT  320



>ref|WP_026067065.1| molybdopterin biosynthesis protein MoeB [Staphylococcus delphini]
Length=334

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIHGTTE  3
            FL+   + Y++N Y+  F+F   RIVAF  GR LIHG T+
Sbjct  282  FLDARALPYKSNGYLLQFKFENSRIVAFQDGRLLIHGLTD  321



>ref|WP_016911490.1| hypothetical protein [Staphylococcus vitulinus]
Length=333

 Score = 44.3 bits (103),  Expect = 0.001, Method: Composition-based stats.
 Identities = 17/36 (47%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -2

Query  122  FLERNHIQYRTNLYMTMFRFREHRIVAFSGGRFLIH  15
            F+ +N + +R+N YM  + + +HR+VAFS GR LIH
Sbjct  281  FVAQNGLLHRSNAYMIQYLYDDHRVVAFSNGRLLIH  316



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 516678285084


  Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF
excluding environmental samples from WGS projects
    Posted date:  Jan 17, 2015  1:43 AM
  Number of letters in database: 20,740,007,484
  Number of sequences in database:  57,851,050



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 12
Window for multiple hits: 40
BLASTX 2.2.30+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF
excluding environmental samples from WGS projects
           57,851,050 sequences; 20,740,007,484 total letters