BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c129915_g1_i1 len=125 path=[1:0-124]

Length=125
                                                                      Score     E

ref|XP_010325863.1|  PREDICTED: WD repeat-containing protein 44-like  73.9    1e-13   
ref|XP_006341215.1|  PREDICTED: WD repeat-containing protein 44-like  73.9    1e-13   
ref|XP_009611532.1|  PREDICTED: WD repeat-containing protein 44-l...  73.9    1e-13   
ref|XP_009611531.1|  PREDICTED: WD repeat-containing protein 44-l...  73.9    1e-13   
ref|XP_004487750.1|  PREDICTED: uncharacterized protein LOC101506788  73.2    2e-13   
gb|KEH38772.1|  transducin/WD-like repeat-protein                     73.2    2e-13   
ref|XP_009803768.1|  PREDICTED: WD repeat-containing protein 44-l...  72.8    2e-13   
ref|XP_009803767.1|  PREDICTED: WD repeat-containing protein 44-l...  72.8    3e-13   
gb|AFW65473.1|  hypothetical protein ZEAMMB73_473274                  72.0    5e-13   
ref|XP_008679648.1|  PREDICTED: uncharacterized protein LOC103654...  72.0    5e-13   
ref|XP_006349512.1|  PREDICTED: WD repeat-containing protein 44-like  72.0    5e-13   
gb|KHN37162.1|  WD repeat-containing protein 44                       71.6    5e-13   
ref|XP_010256510.1|  PREDICTED: WD repeat-containing protein 44-like  72.0    5e-13   
ref|XP_008679649.1|  PREDICTED: uncharacterized protein LOC103654...  72.0    5e-13   
ref|XP_006827823.1|  hypothetical protein AMTR_s00009p00268480        72.0    5e-13   
ref|XP_004980246.1|  PREDICTED: WD repeat-containing protein 44-like  72.0    5e-13   
ref|XP_006592592.1|  PREDICTED: WD repeat-containing protein 44-l...  71.6    5e-13   
ref|XP_010543310.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...  72.0    5e-13   
ref|XP_010047620.1|  PREDICTED: uncharacterized protein LOC104436517  72.0    5e-13   
gb|KCW88929.1|  hypothetical protein EUGRSUZ_A01259                   71.6    6e-13   
ref|XP_010907751.1|  PREDICTED: WD repeat-containing protein 44-l...  71.6    6e-13   
ref|XP_006592591.1|  PREDICTED: WD repeat-containing protein 44-l...  71.6    6e-13   
gb|KHN36799.1|  WD repeat-containing protein 44                       71.2    7e-13   
ref|XP_006582180.1|  PREDICTED: WD repeat-containing protein 44-l...  71.6    7e-13   
emb|CDP11271.1|  unnamed protein product                              71.6    7e-13   
ref|XP_010111476.1|  WD repeat-containing protein 44                  71.6    8e-13   
ref|XP_003526075.1|  PREDICTED: WD repeat-containing protein 44-l...  71.2    9e-13   
ref|XP_006854481.1|  hypothetical protein AMTR_s00175p00024710        71.2    9e-13   
ref|XP_002309053.1|  WD-40 repeat family protein                      71.2    9e-13   Populus trichocarpa [western balsam poplar]
ref|XP_004249562.1|  PREDICTED: WD repeat-containing protein 44-like  71.2    9e-13   
ref|XP_011019878.1|  PREDICTED: WD repeat-containing protein 44       71.2    9e-13   
ref|XP_010907750.1|  PREDICTED: WD repeat-containing protein 44-l...  71.2    1e-12   
ref|XP_007133070.1|  hypothetical protein PHAVU_011G149100g           70.9    1e-12   
ref|XP_006592589.1|  PREDICTED: WD repeat-containing protein 44-l...  70.9    1e-12   
ref|XP_006592590.1|  PREDICTED: WD repeat-containing protein 44-l...  70.9    1e-12   
ref|XP_007133071.1|  hypothetical protein PHAVU_011G149100g           70.9    1e-12   
ref|XP_006296948.1|  hypothetical protein CARUB_v10012940mg           70.9    1e-12   
ref|XP_010060530.1|  PREDICTED: WD repeat-containing protein 44-l...  70.9    1e-12   
ref|XP_010675626.1|  PREDICTED: WD repeat-containing protein 44-l...  70.9    1e-12   
ref|XP_010675627.1|  PREDICTED: WD repeat-containing protein 44-l...  70.9    1e-12   
ref|XP_002534244.1|  WD-repeat protein, putative                      70.9    1e-12   Ricinus communis
ref|XP_010060531.1|  PREDICTED: WD repeat-containing protein 44-l...  70.9    1e-12   
gb|KHN23456.1|  WD repeat-containing protein 44                       70.9    1e-12   
ref|XP_007027038.1|  Transducin/WD40 repeat-like superfamily prot...  70.9    1e-12   
ref|XP_002317512.1|  WD-40 repeat family protein                      70.9    1e-12   Populus trichocarpa [western balsam poplar]
ref|XP_009385886.1|  PREDICTED: WD repeat-containing protein 44-l...  70.9    1e-12   
ref|XP_003539589.1|  PREDICTED: WD repeat-containing protein 44-like  70.5    2e-12   
ref|XP_009385885.1|  PREDICTED: WD repeat-containing protein 44-l...  70.5    2e-12   
ref|XP_007149607.1|  hypothetical protein PHAVU_005G083800g           70.5    2e-12   
gb|EPS73803.1|  hypothetical protein M569_00953                       68.9    2e-12   
ref|XP_011029441.1|  PREDICTED: WD repeat-containing protein 44-like  70.5    2e-12   
ref|XP_011042489.1|  PREDICTED: WD repeat-containing protein 44-l...  70.5    2e-12   
gb|KHG27240.1|  WD repeat-containing 44                               70.5    2e-12   
ref|XP_011013673.1|  PREDICTED: WD repeat-containing protein 44-l...  70.5    2e-12   
ref|XP_010452082.1|  PREDICTED: WD repeat-containing protein 44-like  70.5    2e-12   
gb|KDP27024.1|  hypothetical protein JCGZ_20959                       70.5    2e-12   
ref|XP_007214620.1|  hypothetical protein PRUPE_ppa001338mg           70.1    2e-12   
ref|XP_009343571.1|  PREDICTED: WD repeat-containing protein 44-like  70.1    2e-12   
ref|XP_011042491.1|  PREDICTED: WD repeat-containing protein 44-l...  70.1    2e-12   
ref|XP_011013674.1|  PREDICTED: WD repeat-containing protein 44-l...  70.1    2e-12   
ref|XP_008349982.1|  PREDICTED: WD repeat-containing protein 44-like  70.1    2e-12   
ref|XP_008777434.1|  PREDICTED: WD repeat-containing protein 44-l...  70.1    2e-12   
gb|AFW65472.1|  hypothetical protein ZEAMMB73_473274                  70.1    2e-12   
ref|XP_008777435.1|  PREDICTED: WD repeat-containing protein 44-l...  70.1    2e-12   
ref|XP_008226666.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...  70.1    2e-12   
ref|NP_195863.1|  transducin/WD40 domain-containing protein           70.1    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010490696.1|  PREDICTED: WD repeat-containing protein 44-l...  70.1    3e-12   
ref|XP_010907752.1|  PREDICTED: WD repeat-containing protein 44-l...  69.7    3e-12   
ref|XP_010272566.1|  PREDICTED: WD repeat-containing protein 44-like  69.7    3e-12   
ref|XP_010423864.1|  PREDICTED: WD repeat-containing protein 44-like  69.7    3e-12   
ref|XP_010535112.1|  PREDICTED: WD repeat-containing protein 44       69.7    3e-12   
ref|XP_010099011.1|  WD repeat-containing protein 44                  69.7    3e-12   
ref|XP_002870972.1|  WD-40 repeat family protein                      69.7    3e-12   
emb|CDP05886.1|  unnamed protein product                              69.7    4e-12   
ref|XP_006398703.1|  hypothetical protein EUTSA_v10012625mg           69.7    4e-12   
ref|XP_010465516.1|  PREDICTED: WD repeat-containing protein 44-like  69.3    4e-12   
ref|XP_006406965.1|  hypothetical protein EUTSA_v10020024mg           69.3    4e-12   
ref|XP_009786100.1|  PREDICTED: WD repeat-containing protein 44       69.3    4e-12   
ref|XP_011098333.1|  PREDICTED: WD repeat-containing protein 44 i...  69.3    4e-12   
ref|XP_002282052.1|  PREDICTED: WD repeat-containing protein 44-l...  69.3    4e-12   Vitis vinifera
ref|XP_011098334.1|  PREDICTED: WD repeat-containing protein 44 i...  69.3    4e-12   
ref|XP_010503009.1|  PREDICTED: WD repeat-containing protein 44-like  69.3    4e-12   
ref|XP_009627607.1|  PREDICTED: WD repeat-containing protein 44-like  69.3    4e-12   
ref|XP_002527721.1|  WD-repeat protein, putative                      69.3    4e-12   Ricinus communis
ref|XP_010644216.1|  PREDICTED: WD repeat-containing protein 44-l...  69.3    5e-12   
ref|XP_002885089.1|  WD-40 repeat family protein                      69.3    5e-12   
ref|XP_009394710.1|  PREDICTED: WD repeat-containing protein 44-like  68.9    5e-12   
gb|KDO74135.1|  hypothetical protein CISIN_1g002407mg                 68.9    5e-12   
ref|NP_566515.1|  WD40 domain-containing protein                      68.9    5e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002862468.1|  hypothetical protein ARALYDRAFT_359594           68.6    5e-12   
ref|XP_010918446.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...  68.9    5e-12   
ref|XP_009767447.1|  PREDICTED: uncharacterized protein LOC104218607  68.9    6e-12   
ref|XP_002449141.1|  hypothetical protein SORBIDRAFT_05g005700        68.9    6e-12   Sorghum bicolor [broomcorn]
emb|CBI20340.3|  unnamed protein product                              68.9    6e-12   
emb|CDX80821.1|  BnaC03g00750D                                        68.9    6e-12   
gb|KFK38890.1|  hypothetical protein AALP_AA3G174300                  68.9    6e-12   
emb|CDX97670.1|  BnaA05g24090D                                        68.9    6e-12   
ref|XP_004244210.1|  PREDICTED: WD repeat-containing protein 44 i...  68.9    6e-12   
gb|EYU44889.1|  hypothetical protein MIMGU_mgv1a005216mg              68.2    6e-12   
ref|XP_004248274.1|  PREDICTED: WD repeat-containing protein 44-like  68.9    6e-12   
ref|XP_006348232.1|  PREDICTED: WD repeat-containing protein 44-like  68.9    7e-12   
ref|XP_004244209.1|  PREDICTED: uncharacterized protein LOC101249...  68.9    7e-12   
gb|ACF81100.1|  unknown                                               67.4    7e-12   Zea mays [maize]
ref|XP_011095202.1|  PREDICTED: WD repeat-containing protein 44-like  68.9    7e-12   
ref|XP_006451928.1|  hypothetical protein CICLE_v10007384mg           68.6    7e-12   
emb|CDY55551.1|  BnaA03g54840D                                        68.6    7e-12   
ref|XP_006464715.1|  PREDICTED: WD repeat-containing protein 44-like  68.6    7e-12   
ref|XP_009617547.1|  PREDICTED: uncharacterized protein LOC104109879  68.6    7e-12   
ref|NP_001174023.1|  Os04g0529400                                     65.1    7e-12   
ref|XP_006362948.1|  PREDICTED: WD repeat-containing protein 44-like  68.6    7e-12   
ref|XP_002452509.1|  hypothetical protein SORBIDRAFT_04g027190        68.6    8e-12   Sorghum bicolor [broomcorn]
emb|CBI30564.3|  unnamed protein product                              67.0    9e-12   
ref|XP_010932998.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...  68.2    9e-12   
gb|EEE51781.1|  hypothetical protein OsJ_33233                        68.6    9e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009146242.1|  PREDICTED: WD repeat-containing protein 44       68.2    9e-12   
ref|XP_003569955.1|  PREDICTED: WD repeat-containing protein 44       68.2    1e-11   
ref|XP_006370296.1|  hypothetical protein POPTR_0001s41390g           68.2    1e-11   
gb|KHN37131.1|  WD repeat-containing protein 44                       68.2    1e-11   
gb|KFK27037.1|  hypothetical protein AALP_AA8G325800                  68.2    1e-11   
emb|CDY56822.1|  BnaC05g37770D                                        68.2    1e-11   
ref|XP_006576622.1|  PREDICTED: WD repeat-containing protein 44-like  68.2    1e-11   
ref|XP_008790501.1|  PREDICTED: WD repeat-containing protein 44-like  67.8    1e-11   
ref|XP_008366762.1|  PREDICTED: WD repeat-containing protein 44-like  67.8    1e-11   
ref|XP_009378485.1|  PREDICTED: WD repeat-containing protein 44       67.8    1e-11   
gb|EEE52865.1|  hypothetical protein OsJ_35420                        68.2    1e-11   Oryza sativa Japonica Group [Japonica rice]
gb|KHG15000.1|  WD repeat-containing 44                               67.8    1e-11   
ref|XP_009774676.1|  PREDICTED: WD repeat-containing protein 44-like  67.8    1e-11   
ref|XP_004142205.1|  PREDICTED: uncharacterized protein LOC101206616  67.8    1e-11   
gb|KGN54248.1|  hypothetical protein Csa_4G295520                     67.8    1e-11   
gb|AAX96348.1|  hypothetical protein LOC_Os11g08400                   67.8    1e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008802503.1|  PREDICTED: WD repeat-containing protein 44-l...  67.4    1e-11   
ref|XP_007134029.1|  hypothetical protein PHAVU_010G013300g           67.8    1e-11   
ref|XP_008447805.1|  PREDICTED: WD repeat-containing protein 44       67.8    2e-11   
dbj|BAD25345.1|  WD-40 repeat protein-like                            66.2    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004305208.1|  PREDICTED: WD repeat-containing protein 44-like  67.8    2e-11   
ref|XP_002270206.1|  PREDICTED: WD repeat-containing protein 44-like  67.8    2e-11   Vitis vinifera
ref|XP_009401808.1|  PREDICTED: WD repeat-containing protein 44-like  67.8    2e-11   
gb|EMT10680.1|  hypothetical protein F775_16978                       67.4    2e-11   
ref|XP_003522540.1|  PREDICTED: WD repeat-containing protein 44-like  67.4    2e-11   
ref|XP_008802494.1|  PREDICTED: WD repeat-containing protein 44-l...  67.4    2e-11   
ref|XP_009125445.1|  PREDICTED: WD repeat-containing protein 44-like  67.4    2e-11   
ref|XP_010245315.1|  PREDICTED: WD repeat-containing protein 44-like  67.4    2e-11   
emb|CDY18310.1|  BnaC09g30600D                                        67.4    2e-11   
gb|KHN19514.1|  WD repeat-containing protein 44                       67.4    2e-11   
ref|XP_008776164.1|  PREDICTED: WD repeat-containing protein 44-l...  67.4    2e-11   
ref|XP_007021341.1|  Transducin/WD40 repeat-like superfamily protein  67.4    2e-11   
ref|XP_009601332.1|  PREDICTED: WD repeat-containing protein 44-l...  67.4    2e-11   
ref|XP_006279997.1|  hypothetical protein CARUB_v10025868mg           67.4    2e-11   
emb|CDY48097.1|  BnaC02g03540D                                        67.4    2e-11   
ref|XP_009601333.1|  PREDICTED: WD repeat-containing protein 44-l...  67.4    2e-11   
dbj|BAK00713.1|  predicted protein                                    67.4    2e-11   
ref|XP_008681193.1|  PREDICTED: signal transducer isoform X1          67.4    2e-11   
ref|XP_006429072.1|  hypothetical protein CICLE_v10013628mg           67.4    2e-11   
ref|XP_010482829.1|  PREDICTED: WD repeat-containing protein 44-like  67.4    2e-11   
ref|XP_010446663.1|  PREDICTED: WD repeat-containing protein 44-like  67.4    2e-11   
ref|XP_009119955.1|  PREDICTED: WD repeat-containing protein 44       67.4    2e-11   
ref|XP_003527990.1|  PREDICTED: WD repeat-containing protein 44-like  67.0    2e-11   
gb|KDO47180.1|  hypothetical protein CISIN_1g002086mg                 67.4    2e-11   
emb|CDY04852.1|  BnaAnng00340D                                        67.4    2e-11   
ref|XP_010442997.1|  PREDICTED: WD repeat-containing protein 44-like  67.4    2e-11   
ref|NP_001132305.1|  signal transducer                                67.0    2e-11   Zea mays [maize]
emb|CDY43837.1|  BnaC03g14700D                                        67.4    2e-11   
ref|XP_002866029.1|  WD-40 repeat family protein                      67.0    2e-11   
ref|XP_010487372.1|  PREDICTED: WD repeat-containing protein 44-like  67.0    2e-11   
gb|EYU26402.1|  hypothetical protein MIMGU_mgv1a001267mg              67.0    2e-11   
emb|CDY43049.1|  BnaA03g11960D                                        67.0    2e-11   
ref|NP_001047535.1|  Os02g0638900                                     66.6    2e-11   Oryza sativa Japonica Group [Japonica rice]
gb|KFK24743.1|  hypothetical protein AALP_AA8G018700                  67.0    2e-11   
ref|XP_009132448.1|  PREDICTED: WD repeat-containing protein 44-like  67.0    2e-11   
ref|XP_010537008.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...  67.0    3e-11   
ref|XP_010935623.1|  PREDICTED: WD repeat-containing protein 44-like  67.0    3e-11   
ref|XP_009408732.1|  PREDICTED: WD repeat-containing protein 44-like  67.0    3e-11   
ref|XP_006480802.1|  PREDICTED: WD repeat-containing protein 44-like  67.0    3e-11   
emb|CAN65559.1|  hypothetical protein VITISV_034983                   67.0    3e-11   Vitis vinifera
ref|XP_010242005.1|  PREDICTED: uncharacterized protein LOC104586456  67.0    3e-11   
gb|EMS48390.1|  WD repeat-containing protein 44                       67.0    3e-11   
ref|XP_009379832.1|  PREDICTED: 2-deoxy-glucose resistant protein...  67.0    3e-11   
emb|CDY14324.1|  BnaA10g07310D                                        67.0    3e-11   
ref|XP_008678863.1|  PREDICTED: WD repeat-containing protein 44-l...  67.0    3e-11   
ref|NP_001176393.1|  Os11g0187000                                     67.0    3e-11   
ref|XP_008678862.1|  PREDICTED: WD repeat-containing protein 44-l...  67.0    3e-11   
ref|XP_004141232.1|  PREDICTED: WD repeat-containing protein 44-like  67.0    3e-11   
ref|NP_200231.1|  transducin/WD40 domain-containing protein           66.6    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008452481.1|  PREDICTED: WD repeat-containing protein 44 i...  66.6    3e-11   
gb|EMT31099.1|  hypothetical protein F775_09133                       66.2    3e-11   
emb|CDY55888.1|  BnaA04g29100D                                        66.6    3e-11   
ref|XP_008776093.1|  PREDICTED: WD repeat-containing protein 44-l...  66.6    4e-11   
ref|XP_004953234.1|  PREDICTED: WD repeat-containing protein 44-like  66.6    4e-11   
gb|EEE57449.1|  hypothetical protein OsJ_07666                        66.6    4e-11   Oryza sativa Japonica Group [Japonica rice]
gb|KHN16217.1|  WD repeat-containing protein 44                       66.6    4e-11   
gb|EMS47953.1|  WD repeat-containing protein 44                       66.2    4e-11   
ref|XP_009382122.1|  PREDICTED: WD repeat-containing protein 44-like  66.6    4e-11   
ref|XP_008452480.1|  PREDICTED: WD repeat-containing protein 44 i...  66.6    4e-11   
gb|EEC73670.1|  hypothetical protein OsI_08217                        66.2    4e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_006602578.1|  PREDICTED: WD repeat-containing protein 44-like  66.6    4e-11   
ref|XP_009141680.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...  66.6    4e-11   
ref|XP_003579484.1|  PREDICTED: WD repeat-containing protein 44-like  66.2    5e-11   
ref|XP_009398403.1|  PREDICTED: WD repeat-containing protein 44-like  66.2    5e-11   
gb|EMS49362.1|  WD repeat-containing protein 44                       66.2    5e-11   
emb|CDX93358.1|  BnaC04g45380D                                        66.2    5e-11   
gb|EEC67823.1|  hypothetical protein OsI_35405                        65.5    6e-11   Oryza sativa Indica Group [Indian rice]
ref|NP_001176818.1|  Os12g0178633                                     65.9    6e-11   
gb|EEC78257.1|  hypothetical protein OsI_17932                        65.9    6e-11   Oryza sativa Indica Group [Indian rice]
ref|NP_001054272.1|  Os04g0678300                                     65.9    6e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002441919.1|  hypothetical protein SORBIDRAFT_08g004850        65.9    6e-11   Sorghum bicolor [broomcorn]
ref|XP_006663266.1|  PREDICTED: WD repeat-containing protein 44-like  65.9    7e-11   
ref|XP_001780848.1|  predicted protein                                65.5    7e-11   
ref|XP_007048298.1|  Transducin/WD40 repeat-like superfamily prot...  65.1    7e-11   
ref|XP_009385247.1|  PREDICTED: WD repeat-containing protein 44-like  65.9    7e-11   
ref|XP_008776130.1|  PREDICTED: uncharacterized protein LOC103696...  65.5    7e-11   
ref|XP_008776128.1|  PREDICTED: POC1 centriolar protein homolog B...  65.5    7e-11   
ref|XP_006653031.1|  PREDICTED: WD repeat-containing protein 44-like  65.5    8e-11   
ref|XP_004960064.1|  PREDICTED: WD repeat-containing protein 44-like  65.5    8e-11   
ref|XP_009386077.1|  PREDICTED: WD repeat-containing protein 44-like  65.5    8e-11   
ref|XP_010529833.1|  PREDICTED: uncharacterized protein LOC104806565  65.5    8e-11   
emb|CAJ86375.1|  OSIGBa0155K17.2                                      65.5    8e-11   Oryza sativa [red rice]
ref|XP_008662533.1|  PREDICTED: uncharacterized protein LOC103640...  65.5    9e-11   
ref|XP_008662535.1|  PREDICTED: uncharacterized protein LOC103640...  65.5    9e-11   
ref|XP_004978305.1|  PREDICTED: WD repeat-containing protein 44-like  65.5    9e-11   
gb|EEC68951.1|  hypothetical protein OsI_37676                        65.1    1e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_007140294.1|  hypothetical protein PHAVU_008G100100g           65.5    1e-10   
gb|KHN23344.1|  WD repeat-containing protein 44                       65.1    1e-10   
ref|XP_004516656.1|  PREDICTED: WD repeat-containing protein 44-like  65.5    1e-10   
ref|XP_007048297.1|  Transducin/WD40 repeat-like superfamily prot...  65.1    1e-10   
dbj|BAJ95842.1|  predicted protein                                    65.1    1e-10   
ref|XP_010677871.1|  PREDICTED: WD repeat-containing protein 44       65.1    1e-10   
ref|XP_010237874.1|  PREDICTED: WD repeat-containing protein 44-like  64.7    1e-10   
gb|KFK36654.1|  hypothetical protein AALP_AA4G152800                  65.1    1e-10   
gb|KEH35471.1|  transducin/WD40 repeat protein                        65.1    1e-10   
ref|XP_010247261.1|  PREDICTED: WD repeat-containing protein 44-l...  64.7    1e-10   
ref|XP_002447325.1|  hypothetical protein SORBIDRAFT_06g033000        65.1    1e-10   Sorghum bicolor [broomcorn]
ref|XP_004293101.1|  PREDICTED: WD repeat-containing protein 44-like  65.1    1e-10   
ref|XP_004253336.1|  PREDICTED: POC1 centriolar protein homolog B...  64.7    1e-10   
ref|XP_003530889.2|  PREDICTED: uncharacterized protein LOC100793299  65.1    1e-10   
emb|CDY38748.1|  BnaC03g15010D                                        64.7    1e-10   
ref|XP_006653617.1|  PREDICTED: WD repeat-containing protein 44-like  64.7    1e-10   
dbj|BAK00277.1|  predicted protein                                    64.7    2e-10   
emb|CBG76443.1|  OO_Ba0013J05-OO_Ba0033A15.30                         64.7    2e-10   Oryza officinalis
ref|XP_009130702.1|  PREDICTED: WD repeat-containing protein 44-like  64.7    2e-10   
ref|XP_008369885.1|  PREDICTED: WD repeat-containing protein 44       64.7    2e-10   
gb|EYU26583.1|  hypothetical protein MIMGU_mgv1a000854mg              64.7    2e-10   
ref|XP_002321388.1|  WD-40 repeat family protein                      64.7    2e-10   Populus trichocarpa [western balsam poplar]
ref|XP_010247260.1|  PREDICTED: WD repeat-containing protein 44-l...  64.7    2e-10   
ref|XP_006410958.1|  hypothetical protein EUTSA_v10016206mg           64.7    2e-10   
ref|XP_006280149.1|  hypothetical protein CARUB_v10026048mg           64.3    2e-10   
gb|EEC77683.1|  hypothetical protein OsI_16737                        64.3    2e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_010238654.1|  PREDICTED: uncharacterized protein LOC100842788  64.7    2e-10   
gb|EEE61382.1|  hypothetical protein OsJ_15550                        64.3    2e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EMT02449.1|  hypothetical protein F775_13429                       63.9    2e-10   
gb|EMT29791.1|  hypothetical protein F775_11999                       64.3    2e-10   
ref|XP_010509294.1|  PREDICTED: WD repeat-containing protein 44-like  64.3    2e-10   
ref|XP_002275497.1|  PREDICTED: WD repeat-containing protein YMR102C  64.3    2e-10   Vitis vinifera
ref|XP_010062889.1|  PREDICTED: WD repeat-containing protein 44-like  64.3    2e-10   
ref|NP_181303.1|  WD-40 repeat-containing protein                     64.3    2e-10   Arabidopsis thaliana [mouse-ear cress]
gb|ADT92204.1|  W40 repeat domain-containing protein                  62.8    3e-10   
ref|XP_002862187.1|  hypothetical protein ARALYDRAFT_359776           63.2    3e-10   
ref|XP_010505363.1|  PREDICTED: WD repeat-containing protein 44-like  64.3    3e-10   
emb|CAE02139.2|  OSJNBa0074L08.11                                     63.9    3e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006293640.1|  hypothetical protein CARUB_v10022596mg           64.3    3e-10   
emb|CBI37573.3|  unnamed protein product                              63.9    3e-10   
ref|XP_002881542.1|  WD-40 repeat family protein                      63.9    3e-10   
ref|XP_002446829.1|  hypothetical protein SORBIDRAFT_06g023320        63.9    3e-10   Sorghum bicolor [broomcorn]
ref|XP_006293641.1|  hypothetical protein CARUB_v10022596mg           63.9    3e-10   
gb|KHN24990.1|  WD repeat-containing protein 44                       63.5    3e-10   
ref|XP_001777339.1|  predicted protein                                63.5    3e-10   
ref|XP_010555742.1|  PREDICTED: WD repeat-containing protein 44-like  63.5    4e-10   
ref|XP_010517040.1|  PREDICTED: WD repeat-containing protein 44-like  63.5    4e-10   
gb|AFW59911.1|  hypothetical protein ZEAMMB73_849324                  63.5    4e-10   
ref|XP_010694812.1|  PREDICTED: WD repeat-containing protein 44-like  63.5    4e-10   
ref|XP_008661428.1|  PREDICTED: uncharacterized protein LOC100193...  63.2    5e-10   
gb|KHG23616.1|  WD repeat-containing 44                               63.2    5e-10   
ref|NP_001132236.1|  uncharacterized protein LOC100193671             62.4    5e-10   Zea mays [maize]
gb|KDO58373.1|  hypothetical protein CISIN_1g005956mg                 62.8    5e-10   
ref|XP_002517227.1|  WD-repeat protein, putative                      63.2    5e-10   Ricinus communis
ref|XP_003623038.1|  WD repeat-containing protein                     63.2    6e-10   
ref|XP_008669100.1|  PREDICTED: WD repeat-containing protein 44-like  63.2    6e-10   
ref|XP_002271917.2|  PREDICTED: WD repeat-containing protein YMR102C  62.8    7e-10   Vitis vinifera
emb|CEF98055.1|  G-protein beta WD-40 repeat                          62.8    7e-10   
emb|CBI23039.3|  unnamed protein product                              62.8    7e-10   
ref|XP_005643702.1|  WD40 repeat-like protein                         62.4    8e-10   
ref|XP_007514345.1|  predicted protein                                62.8    8e-10   
ref|XP_009338777.1|  PREDICTED: WD repeat-containing protein 44-like  62.8    8e-10   
ref|XP_010027691.1|  PREDICTED: WD repeat-containing protein 44       62.4    8e-10   
ref|XP_003588487.1|  WD repeat-containing protein                     62.8    8e-10   
ref|XP_007207579.1|  hypothetical protein PRUPE_ppa018477mg           62.8    9e-10   
ref|XP_008241073.1|  PREDICTED: WD repeat-containing protein 44       62.8    9e-10   
emb|CDY68513.1|  BnaCnng59300D                                        62.4    9e-10   
ref|XP_007136464.1|  hypothetical protein PHAVU_009G047400g           62.4    9e-10   
ref|XP_003079440.1|  WD40 repeat-containing protein (ISS)             62.0    1e-09   
ref|XP_010245259.1|  PREDICTED: transcription initiation factor T...  62.0    1e-09   
ref|XP_001761107.1|  predicted protein                                61.2    1e-09   
ref|XP_008663405.1|  PREDICTED: WD repeat-containing protein 44-l...  62.0    1e-09   
ref|XP_010252806.1|  PREDICTED: WD repeat-containing protein 44       62.0    1e-09   
ref|XP_004976314.1|  PREDICTED: WD repeat-containing protein 44-l...  62.0    1e-09   
ref|XP_006401696.1|  hypothetical protein EUTSA_v10012916mg           62.0    1e-09   
ref|XP_008663404.1|  PREDICTED: WD repeat-containing protein 44-l...  62.0    1e-09   
ref|NP_200162.1|  transducin/WD40 domain-containing protein           62.0    1e-09   
ref|XP_010680260.1|  PREDICTED: uncharacterized WD repeat-contain...  61.6    1e-09   
ref|XP_010267520.1|  PREDICTED: 2-deoxy-glucose resistant protein 2   62.0    2e-09   
emb|CDY35661.1|  BnaC09g29830D                                        61.6    2e-09   
ref|XP_009119898.1|  PREDICTED: WD repeat-containing protein 44       61.6    2e-09   
emb|CDY14377.1|  BnaA10g06780D                                        61.6    2e-09   
ref|XP_004289406.1|  PREDICTED: WD repeat-containing protein 44-like  61.6    2e-09   
ref|XP_010520951.1|  PREDICTED: WD repeat-containing protein 44-like  61.6    2e-09   
ref|XP_010109232.1|  WD repeat-containing protein 44                  61.6    2e-09   
gb|KHG04425.1|  WD repeat-containing 44                               61.6    2e-09   
ref|XP_010931045.1|  PREDICTED: lissencephaly-1 homolog 1-like        61.6    2e-09   
ref|XP_004976313.1|  PREDICTED: WD repeat-containing protein 44-l...  61.6    2e-09   
ref|XP_004976315.1|  PREDICTED: WD repeat-containing protein 44-l...  61.6    2e-09   
gb|KDP28461.1|  hypothetical protein JCGZ_14232                       61.6    2e-09   
ref|XP_010090876.1|  WD repeat-containing protein 44                  61.6    2e-09   
gb|KDP23830.1|  hypothetical protein JCGZ_00073                       61.6    2e-09   
emb|CDY47074.1|  BnaA03g12240D                                        61.6    2e-09   
ref|XP_004502686.1|  PREDICTED: WD repeat-containing protein 44-like  61.6    2e-09   
ref|XP_002309892.1|  WD-40 repeat family protein                      61.2    2e-09   
ref|XP_009132471.1|  PREDICTED: WD repeat-containing protein 44-like  61.2    2e-09   
gb|KHG23923.1|  putative WD repeat-containing C3H5.08c                61.2    2e-09   
gb|EMT25037.1|  hypothetical protein F775_03613                       61.2    3e-09   
ref|XP_006857843.1|  hypothetical protein AMTR_s00069p00055450        61.2    3e-09   
ref|XP_008231696.1|  PREDICTED: WD repeat-containing protein 44-like  60.8    3e-09   
ref|XP_008234700.1|  PREDICTED: uncharacterized protein LOC103333609  60.8    3e-09   
ref|XP_006427813.1|  hypothetical protein CICLE_v10025084mg           60.8    3e-09   
ref|XP_004244644.1|  PREDICTED: uncharacterized WD repeat-contain...  60.8    3e-09   
gb|KDP26132.1|  hypothetical protein JCGZ_22233                       60.8    3e-09   
gb|KDO58372.1|  hypothetical protein CISIN_1g005956mg                 60.8    3e-09   
ref|XP_006427812.1|  hypothetical protein CICLE_v10025084mg           60.8    3e-09   
ref|XP_004498503.1|  PREDICTED: WD repeat-containing protein 44-like  60.8    3e-09   
gb|KDO58371.1|  hypothetical protein CISIN_1g005956mg                 60.8    3e-09   
gb|KDO58370.1|  hypothetical protein CISIN_1g005956mg                 60.8    3e-09   
ref|XP_007220614.1|  hypothetical protein PRUPE_ppa002072mg           60.8    4e-09   
ref|XP_004244645.1|  PREDICTED: uncharacterized WD repeat-contain...  60.8    4e-09   
ref|XP_001772093.1|  predicted protein                                58.9    4e-09   
ref|XP_011032355.1|  PREDICTED: WD repeat-containing protein 44-like  60.5    4e-09   
gb|EPS59825.1|  hypothetical protein M569_14979                       60.5    4e-09   
ref|XP_010659824.1|  PREDICTED: uncharacterized protein LOC100249640  60.5    4e-09   
emb|CBI34556.3|  unnamed protein product                              60.5    5e-09   
ref|XP_008775396.1|  PREDICTED: WD repeat-containing protein 44       60.5    5e-09   
gb|KHG15202.1|  wdr44                                                 60.5    5e-09   
gb|KHG15203.1|  wdr44                                                 60.5    5e-09   
ref|XP_007206323.1|  hypothetical protein PRUPE_ppa002479mg           60.1    5e-09   
ref|XP_002865975.1|  WD-40 repeat family protein                      60.1    5e-09   
ref|XP_008361062.1|  PREDICTED: uncharacterized WD repeat-contain...  60.1    6e-09   
ref|XP_010933843.1|  PREDICTED: WD repeat-containing protein 44 i...  60.1    7e-09   
emb|CDP12205.1|  unnamed protein product                              59.7    7e-09   
ref|XP_002534336.1|  WD-repeat protein, putative                      59.7    7e-09   
ref|XP_010919289.1|  PREDICTED: uncharacterized protein LOC105043...  59.7    8e-09   
ref|XP_010919285.1|  PREDICTED: uncharacterized protein LOC105043...  59.7    8e-09   
ref|XP_002523311.1|  WD-repeat protein, putative                      59.7    8e-09   
ref|XP_010933844.1|  PREDICTED: WD repeat-containing protein 44 i...  59.7    8e-09   
gb|EPS61764.1|  hypothetical protein M569_13028                       59.7    8e-09   
ref|XP_011023006.1|  PREDICTED: WD repeat-containing protein 44-like  59.7    8e-09   
gb|EYU45248.1|  hypothetical protein MIMGU_mgv1a002075mg              59.3    9e-09   
ref|XP_008775006.1|  PREDICTED: WD repeat-containing protein 44-like  59.7    9e-09   
ref|XP_011024872.1|  PREDICTED: WD repeat-containing protein 44-l...  59.7    9e-09   
ref|XP_002318441.1|  WD-40 repeat family protein                      59.7    9e-09   
ref|XP_011024871.1|  PREDICTED: WD repeat-containing protein 44-l...  59.7    9e-09   
ref|XP_011024870.1|  PREDICTED: WD repeat-containing protein 44-l...  59.7    9e-09   
ref|XP_007039113.1|  Transducin/WD40 repeat-like superfamily prot...  59.3    1e-08   
gb|EYU45249.1|  hypothetical protein MIMGU_mgv1a002075mg              59.3    1e-08   
ref|XP_009390051.1|  PREDICTED: uncharacterized protein LOC103976536  59.3    1e-08   
ref|XP_008645769.1|  PREDICTED: uncharacterized protein LOC103627...  59.3    1e-08   
ref|XP_002447816.1|  hypothetical protein SORBIDRAFT_06g016295        59.3    1e-08   
ref|XP_008645768.1|  PREDICTED: uncharacterized protein LOC103627...  59.3    1e-08   
ref|XP_010445864.1|  PREDICTED: WD repeat-containing protein 44-like  59.3    1e-08   
ref|XP_007039112.1|  Transducin/WD40 repeat-like superfamily prot...  59.3    1e-08   
ref|XP_010482750.1|  PREDICTED: WD repeat-containing protein 44-like  59.3    1e-08   
ref|XP_006652275.1|  PREDICTED: general transcriptional corepress...  59.3    1e-08   
gb|AES72820.2|  transducin/WD-like repeat-protein                     59.3    1e-08   
ref|XP_006352232.1|  PREDICTED: uncharacterized protein LOC102579...  59.3    1e-08   
ref|XP_003602569.1|  WD repeat-containing protein, putative           58.9    1e-08   
ref|XP_004309119.1|  PREDICTED: uncharacterized protein LOC101310847  58.9    1e-08   
gb|KHN09592.1|  WD repeat-containing protein 44                       58.9    1e-08   
ref|XP_010541487.1|  PREDICTED: WD repeat-containing protein 44       58.9    1e-08   
ref|XP_009597709.1|  PREDICTED: uncharacterized WD repeat-contain...  58.9    1e-08   
ref|XP_008669015.1|  PREDICTED: WD repeat-containing protein 44-like  58.9    1e-08   
ref|XP_002446949.1|  hypothetical protein SORBIDRAFT_06g025690        58.9    1e-08   
ref|XP_004975600.1|  PREDICTED: WD repeat-containing protein 44-like  58.9    2e-08   
ref|XP_009383058.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...  58.2    2e-08   
ref|XP_010537067.1|  PREDICTED: uncharacterized WD repeat-contain...  58.9    2e-08   
ref|XP_009121391.1|  PREDICTED: uncharacterized WD repeat-contain...  55.8    2e-08   
ref|XP_002264456.1|  PREDICTED: WD repeat-containing protein YMR1...  58.9    2e-08   
emb|CBI40579.3|  unnamed protein product                              58.5    2e-08   
ref|XP_009770473.1|  PREDICTED: WD repeat-containing protein 44-like  58.5    2e-08   
ref|XP_009781900.1|  PREDICTED: uncharacterized WD repeat-contain...  58.5    2e-08   
emb|CAN69136.1|  hypothetical protein VITISV_019124                   58.5    2e-08   
ref|XP_009127162.1|  PREDICTED: WD repeat-containing protein 44-like  58.5    2e-08   
ref|XP_010671399.1|  PREDICTED: uncharacterized protein LOC104888203  58.5    2e-08   
ref|XP_003580346.1|  PREDICTED: WD repeat-containing protein 44-like  58.5    2e-08   
ref|XP_003528038.1|  PREDICTED: WD repeat-containing protein YMR1...  58.5    2e-08   
ref|XP_009625118.1|  PREDICTED: WD repeat-containing protein 44-like  58.5    2e-08   
ref|XP_004502913.1|  PREDICTED: WD repeat-containing protein 44-l...  58.2    2e-08   
gb|EEE61519.1|  hypothetical protein OsJ_15820                        57.8    2e-08   
ref|XP_006854606.1|  hypothetical protein AMTR_s00030p00138110        58.5    2e-08   
dbj|BAK02261.1|  predicted protein                                    58.2    3e-08   
ref|XP_008351542.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  57.8    3e-08   
ref|XP_009764325.1|  PREDICTED: WD repeat-containing protein 44-like  58.2    3e-08   
ref|XP_011099777.1|  PREDICTED: uncharacterized protein LOC105178110  58.2    3e-08   
ref|XP_007051501.1|  Transducin/WD40 repeat superfamily protein i...  58.2    3e-08   
ref|XP_007051502.1|  Transducin/WD40 repeat superfamily protein i...  58.2    3e-08   
ref|XP_002302646.2|  hypothetical protein POPTR_0002s17470g           58.2    3e-08   
ref|XP_011023150.1|  PREDICTED: F-box-like/WD repeat-containing p...  58.2    3e-08   
emb|CDP05030.1|  unnamed protein product                              58.2    3e-08   
ref|XP_006350983.1|  PREDICTED: nuclear distribution protein PAC1...  57.8    3e-08   
ref|XP_001418045.1|  predicted protein                                56.2    3e-08   
ref|XP_008437636.1|  PREDICTED: WD repeat-containing protein 44-l...  57.8    3e-08   
ref|XP_006343802.1|  PREDICTED: WD repeat-containing protein 44-like  57.8    4e-08   
ref|XP_004245475.1|  PREDICTED: uncharacterized protein LOC101244103  57.8    4e-08   
emb|CAE03168.1|  OSJNBa0033G16.13                                     57.8    4e-08   
ref|NP_001052770.1|  Os04g0417800                                     57.8    4e-08   
ref|XP_008790515.1|  PREDICTED: uncharacterized protein LOC103707703  57.8    4e-08   
ref|XP_008392053.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  57.0    4e-08   
ref|XP_009361332.1|  PREDICTED: uncharacterized protein LOC103951627  57.8    4e-08   
ref|XP_010549205.1|  PREDICTED: WD repeat-containing protein 44       57.4    4e-08   
ref|XP_008376769.1|  PREDICTED: vegetative incompatibility protei...  57.8    4e-08   
ref|XP_001781805.1|  predicted protein                                56.6    4e-08   
gb|KDD73532.1|  hypothetical protein H632_c2081p0                     57.0    4e-08   
ref|XP_010100708.1|  WD repeat-containing protein 44                  57.8    5e-08   
emb|CAH67601.1|  OSIGBa0092M08.13                                     57.4    5e-08   
ref|XP_010312469.1|  PREDICTED: uncharacterized WD repeat-contain...  57.4    5e-08   
ref|XP_006648708.1|  PREDICTED: uncharacterized WD repeat-contain...  57.4    5e-08   
dbj|BAJ99227.1|  predicted protein                                    57.4    6e-08   
ref|XP_006382834.1|  WD-40 repeat family protein                      57.0    6e-08   
gb|EMS66574.1|  WD repeat-containing protein 44                       57.0    6e-08   
ref|NP_851068.1|  transducin/WD40 domain-containing protein           57.0    6e-08   
ref|XP_006394689.1|  hypothetical protein EUTSA_v10003733mg           57.0    7e-08   
ref|NP_197820.2|  transducin/WD40 domain-containing protein           57.0    7e-08   
ref|NP_001147817.1|  protein phosphatase type 2A regulator/ signa...  57.0    7e-08   
ref|XP_004985995.1|  PREDICTED: WD repeat-containing protein 44-like  57.0    7e-08   
ref|NP_001147943.1|  signal transducer                                57.0    7e-08   
tpg|DAA42921.1|  TPA: signal transducer                               57.0    7e-08   
ref|XP_010544856.1|  PREDICTED: uncharacterized protein LOC104817380  57.0    8e-08   
ref|XP_007137699.1|  hypothetical protein PHAVU_009G148300g           57.0    8e-08   
ref|XP_008437633.1|  PREDICTED: WD repeat-containing protein 44-l...  57.0    8e-08   
ref|XP_002874189.1|  predicted protein                                57.0    8e-08   
ref|XP_004145945.1|  PREDICTED: WD repeat-containing protein 44-like  57.0    8e-08   
ref|XP_010676850.1|  PREDICTED: uncharacterized WD repeat-contain...  57.0    8e-08   
ref|XP_004976524.1|  PREDICTED: uncharacterized WD repeat-contain...  56.6    9e-08   
ref|XP_010676852.1|  PREDICTED: uncharacterized WD repeat-contain...  56.6    9e-08   
ref|NP_199016.1|  WD40 domain-containing protein                      56.6    9e-08   
ref|XP_010676851.1|  PREDICTED: uncharacterized WD repeat-contain...  56.6    9e-08   
gb|EMT22442.1|  hypothetical protein F775_16042                       56.6    1e-07   
gb|EMT30395.1|  hypothetical protein F775_32248                       56.6    1e-07   
emb|CDX80433.1|  BnaC07g30110D                                        56.6    1e-07   
gb|AGT17419.1|  signal transducer                                     56.6    1e-07   
ref|XP_006652653.1|  PREDICTED: WD repeat-containing protein 44-like  56.2    1e-07   
ref|XP_005843714.1|  hypothetical protein CHLNCDRAFT_27787            53.9    1e-07   
ref|XP_009588536.1|  PREDICTED: WD repeat-containing protein 44-l...  56.2    1e-07   
ref|XP_006439270.1|  hypothetical protein CICLE_v10019710mg           56.2    1e-07   
ref|XP_007039448.1|  Transducin/WD40 repeat-like superfamily prot...  56.2    1e-07   
ref|XP_007039449.1|  Transducin/WD40 repeat-like superfamily prot...  56.2    1e-07   
ref|XP_003522494.1|  PREDICTED: uncharacterized protein LOC100780...  56.2    1e-07   
ref|XP_009351967.1|  PREDICTED: uncharacterized protein LOC103943394  56.2    1e-07   
ref|XP_008381066.1|  PREDICTED: striatin homolog                      56.2    1e-07   
gb|EEC73357.1|  hypothetical protein OsI_07570                        55.8    1e-07   
ref|XP_002468648.1|  hypothetical protein SORBIDRAFT_01g049570        56.2    1e-07   
ref|XP_008437430.1|  PREDICTED: uncharacterized protein LOC103482847  56.2    1e-07   
ref|XP_010940865.1|  PREDICTED: WD repeat-containing protein YMR1...  56.2    2e-07   
ref|XP_006287156.1|  hypothetical protein CARUB_v10000330mg           55.8    2e-07   
ref|XP_009588525.1|  PREDICTED: WD repeat-containing protein 44-l...  55.8    2e-07   
ref|XP_008803044.1|  PREDICTED: WD repeat-containing protein 44-like  55.8    2e-07   
gb|EMS56655.1|  Uncharacterized WD repeat-containing protein C3H5...  55.8    2e-07   
ref|XP_004148673.1|  PREDICTED: uncharacterized protein LOC101207772  55.8    2e-07   
ref|XP_008441025.1|  PREDICTED: WD repeat-containing protein 44       55.8    2e-07   
gb|KHG04867.1|  WD repeat-containing protein 44                       55.8    2e-07   
ref|XP_002979119.1|  hypothetical protein SELMODRAFT_110074           55.1    2e-07   
ref|XP_003558975.1|  PREDICTED: WD repeat-containing protein 44       55.8    2e-07   
ref|XP_009400872.1|  PREDICTED: WD repeat-containing protein YMR1...  55.8    2e-07   
ref|XP_010454738.1|  PREDICTED: uncharacterized WD repeat-contain...  55.8    2e-07   
ref|XP_006441153.1|  hypothetical protein CICLE_v10019098mg           55.8    2e-07   
ref|XP_010421260.1|  PREDICTED: uncharacterized WD repeat-contain...  55.8    2e-07   
gb|KDO59631.1|  hypothetical protein CISIN_1g005352mg                 55.8    2e-07   
emb|CAE02246.2|  OSJNBb0032E06.1                                      55.5    2e-07   
ref|XP_006491984.1|  PREDICTED: WD repeat-containing protein 44-like  55.5    2e-07   
ref|XP_010553565.1|  PREDICTED: WD repeat-containing protein YMR1...  55.8    2e-07   
emb|CAH66853.1|  OSIGBa0103M18.5                                      55.5    2e-07   
ref|NP_001053589.1|  Os04g0568400                                     55.5    2e-07   
ref|XP_004143851.1|  PREDICTED: uncharacterized protein LOC101204856  55.5    2e-07   
ref|XP_011044680.1|  PREDICTED: WD repeat-containing protein 44       55.5    2e-07   
gb|KDO76657.1|  hypothetical protein CISIN_1g004410mg                 55.5    2e-07   
gb|KDO59630.1|  hypothetical protein CISIN_1g005352mg                 55.5    2e-07   
ref|XP_003579722.1|  PREDICTED: WD repeat-containing protein 44-like  55.5    2e-07   
gb|KDO76655.1|  hypothetical protein CISIN_1g004410mg                 55.5    2e-07   
ref|XP_009788735.1|  PREDICTED: WD repeat-containing protein 44-like  55.5    2e-07   
emb|CDX67522.1|  BnaA07g15620D                                        55.5    2e-07   
gb|AAO17034.1|  Hypothetical protein                                  55.5    3e-07   
gb|EEE58207.1|  hypothetical protein OsJ_09165                        55.5    3e-07   
ref|XP_010493579.1|  PREDICTED: uncharacterized WD repeat-contain...  55.5    3e-07   
ref|XP_006283216.1|  hypothetical protein CARUB_v10004247mg           55.5    3e-07   
gb|KDO76652.1|  hypothetical protein CISIN_1g004410mg                 55.5    3e-07   
ref|XP_006476326.1|  PREDICTED: WD repeat-containing protein YMR1...  55.5    3e-07   
ref|XP_010473727.1|  PREDICTED: WD repeat-containing protein 44-like  55.1    3e-07   
gb|KDO76659.1|  hypothetical protein CISIN_1g004410mg                 54.7    3e-07   
emb|CDY53898.1|  BnaA09g53050D                                        55.1    4e-07   
ref|XP_009150956.1|  PREDICTED: vegetative incompatibility protei...  55.1    4e-07   
ref|XP_009112863.1|  PREDICTED: WD repeat-containing protein 44       55.1    4e-07   
gb|EYU23801.1|  hypothetical protein MIMGU_mgv1a004333mg              54.7    4e-07   
ref|XP_009393921.1|  PREDICTED: WD repeat-containing protein 44-like  55.1    4e-07   
ref|XP_006300843.1|  hypothetical protein CARUB_v10019937mg           54.7    4e-07   
ref|XP_010436150.1|  PREDICTED: WD repeat-containing protein 44-l...  55.1    4e-07   
ref|XP_010446951.1|  PREDICTED: WD repeat-containing protein 44-like  55.1    4e-07   



>ref|XP_010325863.1| PREDICTED: WD repeat-containing protein 44-like [Solanum lycopersicum]
Length=937

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIWN+PDRKVVDW D  +MV+A C+ PDG+ 
Sbjct  587  FISGSLDAKVRIWNIPDRKVVDWTDLHEMVTATCFTPDGQG  627



>ref|XP_006341215.1| PREDICTED: WD repeat-containing protein 44-like [Solanum tuberosum]
Length=938

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIWN+PDRKVVDW D  +MV+A C+ PDG+ 
Sbjct  588  FISGSLDAKVRIWNIPDRKVVDWTDLHEMVTATCFTPDGQG  628



>ref|XP_009611532.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Nicotiana 
tomentosiformis]
Length=935

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIWN+PDRKVVDW D  +MV+A C+ PDG+ 
Sbjct  585  FISGSLDAKVRIWNIPDRKVVDWTDLHEMVTATCFTPDGQG  625



>ref|XP_009611531.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Nicotiana 
tomentosiformis]
Length=937

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIWN+PDRKVVDW D  +MV+A C+ PDG+ 
Sbjct  585  FISGSLDAKVRIWNIPDRKVVDWTDLHEMVTATCFTPDGQG  625



>ref|XP_004487750.1| PREDICTED: uncharacterized protein LOC101506788 [Cicer arietinum]
Length=1057

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDWID  +MV+A CY PDG+ 
Sbjct  550  FISGSLDAKVRIWSIPDRQVVDWIDLHEMVTAACYTPDGQG  590



>gb|KEH38772.1| transducin/WD-like repeat-protein [Medicago truncatula]
Length=858

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDWID  +MV+A CY PDG+ 
Sbjct  545  FISGSLDAKVRIWSIPDRQVVDWIDLHEMVTAACYTPDGQG  585



>ref|XP_009803768.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Nicotiana 
sylvestris]
Length=935

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVR+WN+PDRKVVDW D  +MV+A C+ PDG+ 
Sbjct  585  FISGSLDAKVRLWNIPDRKVVDWTDLHEMVTATCFTPDGQG  625



>ref|XP_009803767.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Nicotiana 
sylvestris]
Length=937

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVR+WN+PDRKVVDW D  +MV+A C+ PDG+ 
Sbjct  585  FISGSLDAKVRLWNIPDRKVVDWTDLHEMVTATCFTPDGQG  625



>gb|AFW65473.1| hypothetical protein ZEAMMB73_473274 [Zea mays]
Length=935

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW+VPDR+VVDW D  DMV+A CY PDG+A
Sbjct  634  FISGSLDCKVRIWSVPDRQVVDWSDLNDMVTAACYTPDGQA  674



>ref|XP_008679648.1| PREDICTED: uncharacterized protein LOC103654584 isoform X1 [Zea 
mays]
Length=908

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW+VPDR+VVDW D  DMV+A CY PDG+A
Sbjct  599  FISGSLDCKVRIWSVPDRQVVDWSDLNDMVTAACYTPDGQA  639



>ref|XP_006349512.1| PREDICTED: WD repeat-containing protein 44-like [Solanum tuberosum]
Length=930

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIWNV DRKVVDW D  +MV+A CY+PDGE 
Sbjct  593  FISGSLDGKVRIWNVSDRKVVDWTDLHEMVTATCYSPDGEG  633



>gb|KHN37162.1| WD repeat-containing protein 44 [Glycine soja]
Length=592

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  243  FISGSLDAKVRIWSIPDRQVVDWADLHEMVTAACYTPDGQG  283



>ref|XP_010256510.1| PREDICTED: WD repeat-containing protein 44-like [Nelumbo nucifera]
Length=967

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIWN+P RKVVDW D  +MV+A CY PDG+ 
Sbjct  570  FISGSLDAKVRIWNIPKRKVVDWTDLHEMVTAACYTPDGKG  610



>ref|XP_008679649.1| PREDICTED: uncharacterized protein LOC103654584 isoform X2 [Zea 
mays]
Length=900

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW+VPDR+VVDW D  DMV+A CY PDG+A
Sbjct  599  FISGSLDCKVRIWSVPDRQVVDWSDLNDMVTAACYTPDGQA  639



>ref|XP_006827823.1| hypothetical protein AMTR_s00009p00268480 [Amborella trichopoda]
 gb|ERM95239.1| hypothetical protein AMTR_s00009p00268480 [Amborella trichopoda]
Length=930

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD+KVRIW++PDR+VVDW D  +MV+A CY PDGE 
Sbjct  604  FISGSLDSKVRIWSIPDRQVVDWSDLHEMVTAACYTPDGEG  644



>ref|XP_004980246.1| PREDICTED: WD repeat-containing protein 44-like [Setaria italica]
Length=919

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW+VPDR+VVDW D  DMV+A CY PDG+A
Sbjct  609  FISGSLDCKVRIWSVPDRQVVDWSDVSDMVTAACYTPDGQA  649



>ref|XP_006592592.1| PREDICTED: WD repeat-containing protein 44-like isoform X4 [Glycine 
max]
 ref|XP_006592593.1| PREDICTED: WD repeat-containing protein 44-like isoform X5 [Glycine 
max]
Length=711

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  578  FISGSLDAKVRIWSIPDRQVVDWTDLHEMVTAACYTPDGQG  618



>ref|XP_010543310.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat-containing protein 
44 [Tarenaya hassleriana]
Length=881

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIWN+P+R+VV+W D  +MV+A+CYAPDG+A
Sbjct  571  FISGSLDGKVRIWNIPNRQVVEWSDINEMVTAVCYAPDGQA  611



>ref|XP_010047620.1| PREDICTED: uncharacterized protein LOC104436517 [Eucalyptus grandis]
Length=933

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAK+RIW++PDR V+DW D  +MV+A+CY PDGE 
Sbjct  580  FISGSLDAKIRIWSIPDRHVIDWTDLHEMVTAVCYTPDGEG  620



>gb|KCW88929.1| hypothetical protein EUGRSUZ_A01259 [Eucalyptus grandis]
Length=925

 Score = 71.6 bits (174),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAK+RIW++PDR V+DW D  +MV+A+CY PDGE 
Sbjct  572  FISGSLDAKIRIWSIPDRHVIDWTDLHEMVTAVCYTPDGEG  612



>ref|XP_010907751.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Elaeis 
guineensis]
Length=836

 Score = 71.6 bits (174),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A+CY PDG+ 
Sbjct  620  FISGSLDAKVRIWSIPDRQVVDWSDLHEMVTAVCYTPDGQG  660



>ref|XP_006592591.1| PREDICTED: WD repeat-containing protein 44-like isoform X3 [Glycine 
max]
Length=734

 Score = 71.6 bits (174),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  578  FISGSLDAKVRIWSIPDRQVVDWTDLHEMVTAACYTPDGQG  618



>gb|KHN36799.1| WD repeat-containing protein 44 [Glycine soja]
Length=602

 Score = 71.2 bits (173),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  288  FISGSLDAKVRIWSIPDRQVVDWTDLHEMVTAACYTPDGQG  328



>ref|XP_006582180.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Glycine 
max]
Length=897

 Score = 71.6 bits (174),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  548  FISGSLDAKVRIWSIPDRQVVDWADLHEMVTAACYTPDGQG  588



>emb|CDP11271.1| unnamed protein product [Coffea canephora]
Length=924

 Score = 71.6 bits (174),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIWN+ DR+VVDWID  +MV+A CY PDG+ 
Sbjct  569  FISGSLDAKVRIWNISDRQVVDWIDIHEMVTAACYTPDGQG  609



>ref|XP_010111476.1| WD repeat-containing protein 44 [Morus notabilis]
 gb|EXC30999.1| WD repeat-containing protein 44 [Morus notabilis]
Length=944

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  593  FISGSLDAKVRIWSIPDRQVVDWTDLHEMVTAACYTPDGQG  633



>ref|XP_003526075.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Glycine 
max]
Length=863

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  548  FISGSLDAKVRIWSIPDRQVVDWADLHEMVTAACYTPDGQG  588



>ref|XP_006854481.1| hypothetical protein AMTR_s00175p00024710 [Amborella trichopoda]
 gb|ERN15948.1| hypothetical protein AMTR_s00175p00024710 [Amborella trichopoda]
Length=908

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  575  FISGSLDAKVRIWSIPDRQVVDWSDLHEMVTAACYTPDGQG  615



>ref|XP_002309053.1| WD-40 repeat family protein [Populus trichocarpa]
 gb|EEE92576.1| WD-40 repeat family protein [Populus trichocarpa]
Length=939

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR++VDW D  +MV+A+CY PDG+ 
Sbjct  572  FISGSLDAKVRIWSIPDRQLVDWTDLHEMVTAVCYTPDGQG  612



>ref|XP_004249562.1| PREDICTED: WD repeat-containing protein 44-like [Solanum lycopersicum]
Length=918

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIWN+ DRKVVDW D  +MV+A CY+PDGE 
Sbjct  585  FISGSLDGKVRIWNISDRKVVDWTDLHEMVTATCYSPDGEG  625



>ref|XP_011019878.1| PREDICTED: WD repeat-containing protein 44 [Populus euphratica]
Length=934

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR++VDW D  +MV+A+CY PDG+ 
Sbjct  571  FISGSLDAKVRIWSIPDRQLVDWTDLHEMVTAVCYTPDGQG  611



>ref|XP_010907750.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Elaeis 
guineensis]
Length=967

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A+CY PDG+ 
Sbjct  620  FISGSLDAKVRIWSIPDRQVVDWSDLHEMVTAVCYTPDGQG  660



>ref|XP_007133070.1| hypothetical protein PHAVU_011G149100g [Phaseolus vulgaris]
 gb|ESW05064.1| hypothetical protein PHAVU_011G149100g [Phaseolus vulgaris]
Length=841

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  528  FISGSLDAKVRIWSIPDRQVVDWTDLHEMVTAACYTPDGQG  568



>ref|XP_006592589.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Glycine 
max]
Length=894

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  578  FISGSLDAKVRIWSIPDRQVVDWTDLHEMVTAACYTPDGQG  618



>ref|XP_006592590.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Glycine 
max]
Length=891

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  578  FISGSLDAKVRIWSIPDRQVVDWTDLHEMVTAACYTPDGQG  618



>ref|XP_007133071.1| hypothetical protein PHAVU_011G149100g [Phaseolus vulgaris]
 gb|ESW05065.1| hypothetical protein PHAVU_011G149100g [Phaseolus vulgaris]
Length=842

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGE  5
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+
Sbjct  528  FISGSLDAKVRIWSIPDRQVVDWTDLHEMVTAACYTPDGQ  567



>ref|XP_006296948.1| hypothetical protein CARUB_v10012940mg [Capsella rubella]
 gb|EOA29846.1| hypothetical protein CARUB_v10012940mg [Capsella rubella]
Length=892

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVR+W++PDR+VVDW D  +MV++ CY PDG+A
Sbjct  576  FISGSLDAKVRVWSIPDRQVVDWYDLHEMVTSACYTPDGQA  616



>ref|XP_010060530.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Eucalyptus 
grandis]
Length=910

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  596  FISGSLDAKVRIWSIPDRQVVDWNDLHEMVTAACYTPDGQG  636



>ref|XP_010675626.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=921

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD+KVRIW++PDR+VVDW D  +MV+A CY PDG+A
Sbjct  607  FISGSLDSKVRIWSIPDRRVVDWNDLHEMVTAACYTPDGQA  647



>ref|XP_010675627.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=920

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD+KVRIW++PDR+VVDW D  +MV+A CY PDG+A
Sbjct  607  FISGSLDSKVRIWSIPDRRVVDWNDLHEMVTAACYTPDGQA  647



>ref|XP_002534244.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF28134.1| WD-repeat protein, putative [Ricinus communis]
Length=944

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  630  FISGSLDAKVRIWSIPDRQVVDWNDLHEMVTAACYTPDGQG  670



>ref|XP_010060531.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW67310.1| hypothetical protein EUGRSUZ_F01096 [Eucalyptus grandis]
Length=874

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  560  FISGSLDAKVRIWSIPDRQVVDWNDLHEMVTAACYTPDGQG  600



>gb|KHN23456.1| WD repeat-containing protein 44 [Glycine soja]
Length=825

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  512  FISGSLDAKVRIWSIPDRQVVDWTDLHEMVTAACYTPDGQG  552



>ref|XP_007027038.1| Transducin/WD40 repeat-like superfamily protein, putative [Theobroma 
cacao]
 gb|EOY07540.1| Transducin/WD40 repeat-like superfamily protein, putative [Theobroma 
cacao]
Length=1113

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIWN+PDR+VVDW D  +M ++ CY PDG+ 
Sbjct  585  FISGSLDAKVRIWNIPDRQVVDWTDLHEMATSACYTPDGQG  625



>ref|XP_002317512.1| WD-40 repeat family protein [Populus trichocarpa]
 gb|EEE98124.1| WD-40 repeat family protein [Populus trichocarpa]
Length=882

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  570  FISGSLDAKVRIWSIPDRQVVDWNDLHEMVTAACYTPDGQG  610



>ref|XP_009385886.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=932

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW+VPDR+VVDW D  +MV+A CY PDG+ 
Sbjct  599  FISGSLDAKVRIWSVPDRQVVDWTDLHEMVTAACYTPDGQG  639



>ref|XP_003539589.1| PREDICTED: WD repeat-containing protein 44-like [Glycine max]
Length=766

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  452  FISGSLDAKVRIWSIPDRQVVDWTDLHEMVTAACYTPDGQG  492



>ref|XP_009385885.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=938

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGE  5
            FISGSLDAKVRIW+VPDR+VVDW D  +MV+A CY PDG+
Sbjct  599  FISGSLDAKVRIWSVPDRQVVDWTDLHEMVTAACYTPDGQ  638



>ref|XP_007149607.1| hypothetical protein PHAVU_005G083800g [Phaseolus vulgaris]
 gb|ESW21601.1| hypothetical protein PHAVU_005G083800g [Phaseolus vulgaris]
Length=782

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  468  FISGSLDAKVRIWSIPDRQVVDWTDLHEMVTAACYTPDGQG  508



>gb|EPS73803.1| hypothetical protein M569_00953 [Genlisea aurea]
Length=336

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  47   FISGSLDAKVRIWSIPDRQVVDWNDLHEMVTAACYTPDGQG  87



>ref|XP_011029441.1| PREDICTED: WD repeat-containing protein 44-like [Populus euphratica]
Length=938

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  628  FISGSLDAKVRIWSIPDRQVVDWNDLHEMVTAACYTPDGQG  668



>ref|XP_011042489.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Populus 
euphratica]
 ref|XP_011042490.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Populus 
euphratica]
Length=964

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  628  FISGSLDAKVRIWSIPDRQVVDWNDLHEMVTAACYTPDGQG  668



>gb|KHG27240.1| WD repeat-containing 44 [Gossypium arboreum]
 gb|KHG29204.1| WD repeat-containing 44 [Gossypium arboreum]
Length=909

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDRKVVDW D  +MV+A CY PDG+ 
Sbjct  605  FISGSLDAKVRIWSIPDRKVVDWNDLHEMVTAACYTPDGQG  645



>ref|XP_011013673.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Populus 
euphratica]
Length=964

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  628  FISGSLDAKVRIWSIPDRQVVDWNDLHEMVTAACYTPDGQG  668



>ref|XP_010452082.1| PREDICTED: WD repeat-containing protein 44-like [Camelina sativa]
Length=908

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAK+RIWN+ +R+VV+W D K+MV+A+CY PDG+A
Sbjct  581  FISGSLDAKIRIWNISNRQVVEWNDLKEMVTAVCYTPDGQA  621



>gb|KDP27024.1| hypothetical protein JCGZ_20959 [Jatropha curcas]
Length=954

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  640  FISGSLDAKVRIWSIPDRQVVDWNDLHEMVTAACYTPDGQG  680



>ref|XP_007214620.1| hypothetical protein PRUPE_ppa001338mg [Prunus persica]
 gb|EMJ15819.1| hypothetical protein PRUPE_ppa001338mg [Prunus persica]
Length=850

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  539  FISGSLDAKVRIWSIPDRQVVDWNDLHEMVTAACYTPDGQG  579



>ref|XP_009343571.1| PREDICTED: WD repeat-containing protein 44-like [Pyrus x bretschneideri]
Length=877

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  569  FISGSLDAKVRIWSIPDRQVVDWNDLHEMVTAACYTPDGQG  609



>ref|XP_011042491.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Populus 
euphratica]
Length=941

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  628  FISGSLDAKVRIWSIPDRQVVDWNDLHEMVTAACYTPDGQG  668



>ref|XP_011013674.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Populus 
euphratica]
Length=941

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  628  FISGSLDAKVRIWSIPDRQVVDWNDLHEMVTAACYTPDGQG  668



>ref|XP_008349982.1| PREDICTED: WD repeat-containing protein 44-like [Malus domestica]
Length=875

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  568  FISGSLDAKVRIWSIPDRQVVDWNDLHEMVTAACYTPDGQG  608



>ref|XP_008777434.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Phoenix 
dactylifera]
Length=737

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A+CY PDG+ 
Sbjct  618  FISGSLDAKVRIWSIPDRQVVDWSDLHEMVTAVCYTPDGQG  658



>gb|AFW65472.1| hypothetical protein ZEAMMB73_473274 [Zea mays]
Length=819

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGE  5
            FISGSLD KVRIW+VPDR+VVDW D  DMV+A CY PDG+
Sbjct  564  FISGSLDCKVRIWSVPDRQVVDWSDLNDMVTAACYTPDGQ  603



>ref|XP_008777435.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Phoenix 
dactylifera]
Length=728

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A+CY PDG+ 
Sbjct  609  FISGSLDAKVRIWSIPDRQVVDWSDLHEMVTAVCYTPDGQG  649



>ref|XP_008226666.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat-containing protein 
44 [Prunus mume]
Length=872

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  561  FISGSLDAKVRIWSIPDRQVVDWNDLHEMVTAACYTPDGQG  601



>ref|NP_195863.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
 emb|CAB85980.1| putative protein [Arabidopsis thaliana]
 gb|AED90471.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
Length=905

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAK+RIWN+ +R+VV+W D K+MV+A+CY PDG+A
Sbjct  575  FISGSLDAKIRIWNISNRQVVEWNDLKEMVTAVCYTPDGQA  615



>ref|XP_010490696.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Camelina 
sativa]
 ref|XP_010490697.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Camelina 
sativa]
Length=913

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAK+RIWN+ +R+VV+W D K+MV+A+CY PDG+A
Sbjct  586  FISGSLDAKIRIWNISNRQVVEWNDLKEMVTAVCYTPDGQA  626



>ref|XP_010907752.1| PREDICTED: WD repeat-containing protein 44-like isoform X3 [Elaeis 
guineensis]
Length=713

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A+CY PDG+ 
Sbjct  620  FISGSLDAKVRIWSIPDRQVVDWSDLHEMVTAVCYTPDGQG  660



>ref|XP_010272566.1| PREDICTED: WD repeat-containing protein 44-like [Nelumbo nucifera]
Length=953

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIWN+P R+VVDW D  +MV+A CY PDG+ 
Sbjct  572  FISGSLDAKVRIWNIPARQVVDWTDLHEMVTAACYTPDGQG  612



>ref|XP_010423864.1| PREDICTED: WD repeat-containing protein 44-like [Camelina sativa]
Length=906

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAK+RIWN+ +R+VV+W D K+MV+A+CY PDG+A
Sbjct  579  FISGSLDAKIRIWNISNRQVVEWNDLKEMVTAVCYTPDGQA  619



>ref|XP_010535112.1| PREDICTED: WD repeat-containing protein 44 [Tarenaya hassleriana]
Length=914

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVR+W++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  599  FISGSLDAKVRVWSIPDRQVVDWYDLHEMVTAACYTPDGQG  639



>ref|XP_010099011.1| WD repeat-containing protein 44 [Morus notabilis]
 gb|EXB76313.1| WD repeat-containing protein 44 [Morus notabilis]
Length=981

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  652  FISGSLDAKVRIWSIPDRQVVDWNDLHEMVTAACYTPDGQG  692



>ref|XP_002870972.1| WD-40 repeat family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47231.1| WD-40 repeat family protein [Arabidopsis lyrata subsp. lyrata]
Length=906

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAK+RIWN+ +R+VV+W D K+MV+A+CY PDG+A
Sbjct  575  FISGSLDAKIRIWNISNRQVVEWNDLKEMVTAVCYTPDGQA  615



>emb|CDP05886.1| unnamed protein product [Coffea canephora]
Length=896

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++P+RKVVDW D  +MV+A CY PDG+ 
Sbjct  582  FISGSLDAKVRIWSIPERKVVDWNDLHEMVTAACYTPDGQG  622



>ref|XP_006398703.1| hypothetical protein EUTSA_v10012625mg [Eutrema salsugineum]
 gb|ESQ40156.1| hypothetical protein EUTSA_v10012625mg [Eutrema salsugineum]
Length=902

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAK+RIWN+ +R+VV+W D K+MV+A+CY PDG+A
Sbjct  576  FISGSLDAKIRIWNISNRQVVEWNDLKEMVTAVCYTPDGQA  616



>ref|XP_010465516.1| PREDICTED: WD repeat-containing protein 44-like [Camelina sativa]
Length=891

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVR+W++PDR+VVDW D  +MV++ CY PDG+ 
Sbjct  573  FISGSLDAKVRVWSIPDRQVVDWYDLHEMVTSACYTPDGQG  613



>ref|XP_006406965.1| hypothetical protein EUTSA_v10020024mg [Eutrema salsugineum]
 gb|ESQ48418.1| hypothetical protein EUTSA_v10020024mg [Eutrema salsugineum]
Length=888

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVR+W++PDR+VVDW D  +MV++ CY PDG+ 
Sbjct  570  FISGSLDAKVRVWSIPDRQVVDWYDLHEMVTSACYTPDGQG  610



>ref|XP_009786100.1| PREDICTED: WD repeat-containing protein 44 [Nicotiana sylvestris]
Length=920

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVR+WNV DRKVVDW D  +MV+A CY PDG+ 
Sbjct  583  FISGSLDGKVRVWNVSDRKVVDWTDLHEMVTATCYTPDGQG  623



>ref|XP_011098333.1| PREDICTED: WD repeat-containing protein 44 isoform X1 [Sesamum 
indicum]
Length=909

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  593  FISGSLDAKVRIWSIPDRQVVDWNDLHEMVTAACYTPDGQG  633



>ref|XP_002282052.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Vitis 
vinifera]
Length=880

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  573  FISGSLDAKVRIWSIPDRQVVDWNDLHEMVTAACYTPDGQG  613



>ref|XP_011098334.1| PREDICTED: WD repeat-containing protein 44 isoform X2 [Sesamum 
indicum]
Length=735

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  593  FISGSLDAKVRIWSIPDRQVVDWNDLHEMVTAACYTPDGQG  633



>ref|XP_010503009.1| PREDICTED: WD repeat-containing protein 44-like [Camelina sativa]
 ref|XP_010503014.1| PREDICTED: WD repeat-containing protein 44-like [Camelina sativa]
Length=901

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVR+W++PDR+VVDW D  +MV++ CY PDG+ 
Sbjct  582  FISGSLDAKVRVWSIPDRQVVDWYDLHEMVTSACYTPDGQG  622



>ref|XP_009627607.1| PREDICTED: WD repeat-containing protein 44-like [Nicotiana tomentosiformis]
Length=903

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVR+WNV DRKVVDW D  +MV+A CY PDG+ 
Sbjct  566  FISGSLDGKVRVWNVSDRKVVDWTDLHEMVTATCYTPDGQG  606



>ref|XP_002527721.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF34634.1| WD-repeat protein, putative [Ricinus communis]
Length=939

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW++PDR++VDW D  +MV+A+CY PDG+ 
Sbjct  568  FISGSLDNKVRIWSIPDRQLVDWTDLHEMVTAVCYTPDGQG  608



>ref|XP_010644216.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Vitis 
vinifera]
Length=870

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  573  FISGSLDAKVRIWSIPDRQVVDWNDLHEMVTAACYTPDGQG  613



>ref|XP_002885089.1| WD-40 repeat family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61348.1| WD-40 repeat family protein [Arabidopsis lyrata subsp. lyrata]
Length=885

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVR+W++PDR+VVDW D  +MV++ CY PDG+ 
Sbjct  571  FISGSLDAKVRVWSIPDRQVVDWYDLHEMVTSACYTPDGQG  611



>ref|XP_009394710.1| PREDICTED: WD repeat-containing protein 44-like [Musa acuminata 
subsp. malaccensis]
Length=832

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW++PDR+VVDW D  +MV+A+CY PDG+ 
Sbjct  528  FISGSLDDKVRIWSIPDRQVVDWNDLHEMVTAVCYTPDGQG  568



>gb|KDO74135.1| hypothetical protein CISIN_1g002407mg [Citrus sinensis]
Length=755

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++P+R+VVDW D  +MV+A CY PDG+ 
Sbjct  623  FISGSLDAKVRIWSIPERQVVDWNDLHEMVTAACYTPDGQG  663



>ref|NP_566515.1| WD40 domain-containing protein [Arabidopsis thaliana]
 gb|AAK50098.1|AF372960_1 AT3g15470/MJK13_13 [Arabidopsis thaliana]
 gb|AAF35413.1| unknown protein [Arabidopsis thaliana]
 dbj|BAB02376.1| WD-40 repeat protein-like [Arabidopsis thaliana]
 gb|AAL87370.1| AT3g15470/MJK13_13 [Arabidopsis thaliana]
 gb|AEE75680.1| WD40 domain-containing protein [Arabidopsis thaliana]
Length=883

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVR+W++PDR+VVDW D  +MV++ CY PDG+ 
Sbjct  569  FISGSLDAKVRVWSIPDRQVVDWYDLHEMVTSACYTPDGQG  609



>ref|XP_002862468.1| hypothetical protein ARALYDRAFT_359594 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38726.1| hypothetical protein ARALYDRAFT_359594 [Arabidopsis lyrata subsp. 
lyrata]
Length=517

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVR+W++PDR+VVDW D  +MV++ CY PDG+ 
Sbjct  461  FISGSLDAKVRVWSIPDRQVVDWYDLHEMVTSACYTPDGQG  501



>ref|XP_010918446.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat-containing protein 
44-like [Elaeis guineensis]
Length=868

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW++PDR++VDW D  DMV+A CY PDG+ 
Sbjct  571  FISGSLDEKVRIWSIPDRQIVDWNDLHDMVTAACYTPDGQG  611



>ref|XP_009767447.1| PREDICTED: uncharacterized protein LOC104218607 [Nicotiana sylvestris]
Length=944

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++P+R+VVDW D  +MV+A CY PDG+ 
Sbjct  627  FISGSLDAKVRIWSIPERQVVDWNDLHEMVTAACYTPDGQG  667



>ref|XP_002449141.1| hypothetical protein SORBIDRAFT_05g005700 [Sorghum bicolor]
 gb|EES08129.1| hypothetical protein SORBIDRAFT_05g005700 [Sorghum bicolor]
Length=849

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGE  5
            FISGSLD KVR+W+VPDR+VVDW D  DMV+A CY PDG+
Sbjct  577  FISGSLDCKVRMWSVPDRQVVDWSDLNDMVTAACYTPDGQ  616



>emb|CBI20340.3| unnamed protein product [Vitis vinifera]
Length=749

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  461  FISGSLDAKVRIWSIPDRQVVDWNDLHEMVTAACYTPDGQG  501



>emb|CDX80821.1| BnaC03g00750D [Brassica napus]
Length=878

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAK+RIWN+ +R+VV+W D  +MV+A+CY PDG+A
Sbjct  549  FISGSLDAKIRIWNISNRQVVEWTDLNEMVTAVCYTPDGQA  589



>gb|KFK38890.1| hypothetical protein AALP_AA3G174300 [Arabis alpina]
Length=866

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVR+W++PDR+VVDW D  +MV++ CY PDG+ 
Sbjct  552  FISGSLDAKVRVWSIPDRQVVDWYDLHEMVTSACYTPDGQG  592



>emb|CDX97670.1| BnaA05g24090D [Brassica napus]
Length=905

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVR+W++PDR+VVDW D  +MV++ CY PDG+ 
Sbjct  409  FISGSLDAKVRVWSIPDRQVVDWYDLHEMVTSACYTPDGQG  449



>ref|XP_004244210.1| PREDICTED: WD repeat-containing protein 44 isoform X2 [Solanum 
lycopersicum]
Length=870

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++P+R+VVDW D  +MV+A CY PDG+ 
Sbjct  553  FISGSLDAKVRIWSIPERQVVDWNDLHEMVTAACYTPDGQG  593



>gb|EYU44889.1| hypothetical protein MIMGU_mgv1a005216mg [Erythranthe guttata]
Length=493

 Score = 68.2 bits (165),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PD +VVDW D  +MV+A CY PDG+ 
Sbjct  175  FISGSLDAKVRIWSIPDHQVVDWNDLHEMVTAACYTPDGQG  215



>ref|XP_004248274.1| PREDICTED: WD repeat-containing protein 44-like [Solanum lycopersicum]
Length=884

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++P+R+VVDW D  +MV+A CY PDG+ 
Sbjct  568  FISGSLDAKVRIWSIPERQVVDWNDLHEMVTAACYTPDGQG  608



>ref|XP_006348232.1| PREDICTED: WD repeat-containing protein 44-like [Solanum tuberosum]
Length=928

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++P+R+VVDW D  +MV+A CY PDG+ 
Sbjct  611  FISGSLDAKVRIWSIPERQVVDWNDLHEMVTAACYTPDGQG  651



>ref|XP_004244209.1| PREDICTED: uncharacterized protein LOC101249662 isoform X1 [Solanum 
lycopersicum]
Length=928

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++P+R+VVDW D  +MV+A CY PDG+ 
Sbjct  611  FISGSLDAKVRIWSIPERQVVDWNDLHEMVTAACYTPDGQG  651



>gb|ACF81100.1| unknown [Zea mays]
Length=341

 Score = 67.4 bits (163),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW++P R++VDW+D  +MV+A CY PDG+ 
Sbjct  38   FISGSLDEKVRIWSIPKREIVDWVDLHEMVTAACYTPDGKG  78



>ref|XP_011095202.1| PREDICTED: WD repeat-containing protein 44-like [Sesamum indicum]
Length=930

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIWN+P RKVVDW D  +MV+A  Y PDG+ 
Sbjct  573  FISGSLDAKVRIWNIPKRKVVDWTDVPEMVTAASYTPDGQG  613



>ref|XP_006451928.1| hypothetical protein CICLE_v10007384mg [Citrus clementina]
 ref|XP_006451929.1| hypothetical protein CICLE_v10007384mg [Citrus clementina]
 gb|ESR65168.1| hypothetical protein CICLE_v10007384mg [Citrus clementina]
 gb|ESR65169.1| hypothetical protein CICLE_v10007384mg [Citrus clementina]
 gb|KDO74134.1| hypothetical protein CISIN_1g002407mg [Citrus sinensis]
Length=927

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++P+R+VVDW D  +MV+A CY PDG+ 
Sbjct  623  FISGSLDAKVRIWSIPERQVVDWNDLHEMVTAACYTPDGQG  663



>emb|CDY55551.1| BnaA03g54840D [Brassica napus]
Length=876

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAK+RIWN+ +R+VV+W D  +MV+A+CY PDG+A
Sbjct  547  FISGSLDAKIRIWNISNRQVVEWTDLNEMVTAVCYTPDGQA  587



>ref|XP_006464715.1| PREDICTED: WD repeat-containing protein 44-like [Citrus sinensis]
Length=927

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++P+R+VVDW D  +MV+A CY PDG+ 
Sbjct  623  FISGSLDAKVRIWSIPERQVVDWNDLHEMVTAACYTPDGQG  663



>ref|XP_009617547.1| PREDICTED: uncharacterized protein LOC104109879 [Nicotiana tomentosiformis]
Length=943

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++P+R+VVDW D  +MV+A CY PDG+ 
Sbjct  626  FISGSLDAKVRIWSIPERQVVDWNDLHEMVTAACYTPDGQG  666



>ref|NP_001174023.1| Os04g0529400 [Oryza sativa Japonica Group]
 dbj|BAH92751.1| Os04g0529400, partial [Oryza sativa Japonica Group]
Length=150

 Score = 65.1 bits (157),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGE  5
            FISGSLD KVRIW++P R++VDW D  +MV+A CY PDG+
Sbjct  16   FISGSLDEKVRIWSIPGREIVDWNDLHEMVTAACYTPDGQ  55



>ref|XP_006362948.1| PREDICTED: WD repeat-containing protein 44-like [Solanum tuberosum]
Length=883

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++P+R+VVDW D  +MV+A CY PDG+ 
Sbjct  567  FISGSLDAKVRIWSIPERQVVDWNDLHEMVTAACYTPDGQG  607



>ref|XP_002452509.1| hypothetical protein SORBIDRAFT_04g027190 [Sorghum bicolor]
 gb|EES05485.1| hypothetical protein SORBIDRAFT_04g027190 [Sorghum bicolor]
Length=798

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW++P+R++VDW+D  +MV+A CY PDG+ 
Sbjct  492  FISGSLDEKVRIWSIPNREIVDWVDLHEMVTAACYTPDGKG  532



>emb|CBI30564.3| unnamed protein product [Vitis vinifera]
Length=346

 Score = 67.0 bits (162),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A  Y PDG+ 
Sbjct  92   FISGSLDAKVRIWSIPDRQVVDWTDLHEMVTAASYTPDGQG  132



>ref|XP_010932998.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat-containing protein 
44-like [Elaeis guineensis]
Length=800

 Score = 68.2 bits (165),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW++PDR++VDW D  +MV+A CY PDG+ 
Sbjct  503  FISGSLDEKVRIWSIPDREIVDWNDLHEMVTAACYTPDGQG  543



>gb|EEE51781.1| hypothetical protein OsJ_33233 [Oryza sativa Japonica Group]
Length=947

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD+KVRIW+V +R+VVDW D  DMV+A CY PDG+A
Sbjct  644  FISGSLDSKVRIWSVAERQVVDWSDLDDMVTAACYTPDGQA  684



>ref|XP_009146242.1| PREDICTED: WD repeat-containing protein 44 [Brassica rapa]
Length=845

 Score = 68.2 bits (165),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVR+W++PDR+VVDW D  +MV++ CY PDG+ 
Sbjct  537  FISGSLDAKVRVWSIPDRQVVDWYDLHEMVTSACYTPDGQG  577



>ref|XP_003569955.1| PREDICTED: WD repeat-containing protein 44 [Brachypodium distachyon]
Length=796

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIWN+P R++VDW+D  +M++A CY PDG+ 
Sbjct  490  FISGSLDEKVRIWNIPKREIVDWVDLHEMITAACYTPDGKG  530



>ref|XP_006370296.1| hypothetical protein POPTR_0001s41390g [Populus trichocarpa]
 gb|ERP66865.1| hypothetical protein POPTR_0001s41390g [Populus trichocarpa]
Length=913

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  ++V+A CY PDG+ 
Sbjct  600  FISGSLDAKVRIWSIPDRQVVDWNDLHEIVTAACYTPDGQG  640



>gb|KHN37131.1| WD repeat-containing protein 44, partial [Glycine soja]
Length=941

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIWN+P+R+VV+W D  +M++A+ Y PDG+ 
Sbjct  556  FISGSLDAKVRIWNIPERQVVNWTDIHEMITAVSYTPDGQG  596



>gb|KFK27037.1| hypothetical protein AALP_AA8G325800 [Arabis alpina]
Length=855

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PD +VVDW D  +MV+A CY PDG+ 
Sbjct  555  FISGSLDAKVRIWSIPDHQVVDWNDLHEMVTAACYTPDGQG  595



>emb|CDY56822.1| BnaC05g37770D [Brassica napus]
Length=773

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVR+W++PDR+VVDW D  +MV++ CY PDG+ 
Sbjct  485  FISGSLDAKVRVWSIPDRQVVDWYDLHEMVTSACYTPDGQG  525



>ref|XP_006576622.1| PREDICTED: WD repeat-containing protein 44-like [Glycine max]
Length=938

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIWN+P+R+VV+W D  +M++A+ Y PDG+ 
Sbjct  553  FISGSLDAKVRIWNIPERQVVNWTDIHEMITAVSYTPDGQG  593



>ref|XP_008790501.1| PREDICTED: WD repeat-containing protein 44-like [Phoenix dactylifera]
Length=862

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW++PDR++VDW D  +MV+A CY PDG+ 
Sbjct  565  FISGSLDEKVRIWSIPDRQIVDWNDLHEMVTAACYTPDGQG  605



>ref|XP_008366762.1| PREDICTED: WD repeat-containing protein 44-like [Malus domestica]
Length=877

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PD +VVDW D  +MV+A CY PDG+ 
Sbjct  569  FISGSLDAKVRIWSIPDHQVVDWNDLHEMVTAACYTPDGQG  609



>ref|XP_009378485.1| PREDICTED: WD repeat-containing protein 44 [Pyrus x bretschneideri]
Length=875

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PD +VVDW D  +MV+A CY PDG+ 
Sbjct  568  FISGSLDAKVRIWSIPDHQVVDWNDLHEMVTAACYTPDGQG  608



>gb|EEE52865.1| hypothetical protein OsJ_35420 [Oryza sativa Japonica Group]
Length=1557

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124   FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
             FISGSLDAKVR+W++PDR+VVDW D  +MV+A  Y PDG+ 
Sbjct  1260  FISGSLDAKVRLWSIPDRQVVDWTDLNEMVTAASYTPDGQG  1300



>gb|KHG15000.1| WD repeat-containing 44 [Gossypium arboreum]
Length=928

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDRKVV W D  +MV+A CY PDG+ 
Sbjct  611  FISGSLDAKVRIWSIPDRKVVAWNDLHEMVTAACYTPDGQG  651



>ref|XP_009774676.1| PREDICTED: WD repeat-containing protein 44-like [Nicotiana sylvestris]
Length=872

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD+KVRIW++P+R+VVDW D  +MV+A CY PDG+ 
Sbjct  556  FISGSLDSKVRIWSIPERQVVDWNDLHEMVTAACYTPDGQG  596



>ref|XP_004142205.1| PREDICTED: uncharacterized protein LOC101206616 [Cucumis sativus]
 ref|XP_004161695.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101206616 
[Cucumis sativus]
Length=934

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISG+LDAKVRIWN+PDR VVDW D  +MV+A  Y PDG+ 
Sbjct  565  FISGALDAKVRIWNIPDRYVVDWTDLHEMVTAASYTPDGQG  605



>gb|KGN54248.1| hypothetical protein Csa_4G295520 [Cucumis sativus]
Length=946

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISG+LDAKVRIWN+PDR VVDW D  +MV+A  Y PDG+ 
Sbjct  577  FISGALDAKVRIWNIPDRYVVDWTDLHEMVTAASYTPDGQG  617



>gb|AAX96348.1| hypothetical protein LOC_Os11g08400 [Oryza sativa Japonica Group]
 gb|ABA91822.1| expressed protein [Oryza sativa Japonica Group]
Length=892

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD+KVRIW+V +R+VVDW D  DMV+A CY PDG+A
Sbjct  589  FISGSLDSKVRIWSVAERQVVDWSDLDDMVTAACYTPDGQA  629



>ref|XP_008802503.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Phoenix 
dactylifera]
Length=668

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW+VPDR+VVDW D  +MV+A C+ PDG+ 
Sbjct  550  FISGSLDEKVRIWSVPDRQVVDWNDLHEMVTAACFTPDGQG  590



>ref|XP_007134029.1| hypothetical protein PHAVU_010G013300g [Phaseolus vulgaris]
 gb|ESW06023.1| hypothetical protein PHAVU_010G013300g [Phaseolus vulgaris]
Length=936

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++P+R+VVDWID  +MV+A+ + PDG+ 
Sbjct  564  FISGSLDAKVRIWSIPERQVVDWIDIHEMVTAVSFTPDGQG  604



>ref|XP_008447805.1| PREDICTED: WD repeat-containing protein 44 [Cucumis melo]
Length=950

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISG+LDAKVRIWN+PDR VVDW D  +MV+A  Y PDG+ 
Sbjct  576  FISGALDAKVRIWNIPDRYVVDWTDLHEMVTAATYTPDGQG  616



>dbj|BAD25345.1| WD-40 repeat protein-like [Oryza sativa Japonica Group]
 dbj|BAD25900.1| WD-40 repeat protein-like [Oryza sativa Japonica Group]
Length=329

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW++ +RK+VDWID  +M++A CY PDG+ 
Sbjct  38   FISGSLDKKVRIWSIQERKIVDWIDLHEMITAACYTPDGQG  78



>ref|XP_004305208.1| PREDICTED: WD repeat-containing protein 44-like [Fragaria vesca 
subsp. vesca]
Length=937

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            F+SGSLDAK+R+W++P RKVVDW D  +MV+A CY PDG+A
Sbjct  584  FLSGSLDAKLRLWDIPARKVVDWTDLHEMVTAACYTPDGQA  624



>ref|XP_002270206.1| PREDICTED: WD repeat-containing protein 44-like [Vitis vinifera]
 ref|XP_010654294.1| PREDICTED: WD repeat-containing protein 44-like [Vitis vinifera]
 ref|XP_010654295.1| PREDICTED: WD repeat-containing protein 44-like [Vitis vinifera]
Length=912

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A  Y PDG+ 
Sbjct  572  FISGSLDAKVRIWSIPDRQVVDWTDLHEMVTAASYTPDGQG  612



>ref|XP_009401808.1| PREDICTED: WD repeat-containing protein 44-like [Musa acuminata 
subsp. malaccensis]
Length=835

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW++PDR++VDW D  +MV+A CY PDG+ 
Sbjct  528  FISGSLDEKVRIWSIPDRQIVDWNDLHEMVTAACYTPDGQG  568



>gb|EMT10680.1| hypothetical protein F775_16978 [Aegilops tauschii]
Length=653

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW++P R++VDW+D  +M++A CY+PDG++
Sbjct  345  FISGSLDEKVRIWSIPKREIVDWVDLHEMITAACYSPDGQS  385



>ref|XP_003522540.1| PREDICTED: WD repeat-containing protein 44-like [Glycine max]
Length=703

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGS+D KVRIW +PD  VVDWID KD+V+A+CY PDG+ 
Sbjct  413  FISGSIDGKVRIWAIPDCHVVDWIDIKDIVTAVCYRPDGQG  453



>ref|XP_008802494.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Phoenix 
dactylifera]
Length=857

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW+VPDR+VVDW D  +MV+A C+ PDG+ 
Sbjct  550  FISGSLDEKVRIWSVPDRQVVDWNDLHEMVTAACFTPDGQG  590



>ref|XP_009125445.1| PREDICTED: WD repeat-containing protein 44-like [Brassica rapa]
Length=870

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAK+RIWN+ +R+VV+W D  +MV+A+CY PDG+A
Sbjct  546  FISGSLDAKIRIWNISNRQVVEWNDLNEMVTAVCYTPDGQA  586



>ref|XP_010245315.1| PREDICTED: WD repeat-containing protein 44-like [Nelumbo nucifera]
Length=928

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVR+W++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  614  FISGSLDNKVRMWSIPDRQVVDWKDLHEMVTAACYTPDGQG  654



>emb|CDY18310.1| BnaC09g30600D [Brassica napus]
Length=790

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PD +VVDW D  +MV+A CY PDG+ 
Sbjct  516  FISGSLDAKVRIWSIPDHQVVDWNDLHEMVTAACYTPDGQG  556



>gb|KHN19514.1| WD repeat-containing protein 44 [Glycine soja]
Length=703

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGS+D KVRIW +PD  VVDWID KD+V+A+CY PDG+ 
Sbjct  413  FISGSIDGKVRIWAIPDCHVVDWIDIKDIVTAVCYRPDGQG  453



>ref|XP_008776164.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Phoenix 
dactylifera]
Length=748

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW++PDR++VDW D  +MV+A CY PDG+ 
Sbjct  514  FISGSLDEKVRIWSIPDRQIVDWNDLHEMVTAACYTPDGQG  554



>ref|XP_007021341.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
 gb|EOY12866.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
Length=937

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PD +VVDW D  +MV+A CY PDG+ 
Sbjct  623  FISGSLDAKVRIWSIPDHQVVDWNDLHEMVTAACYTPDGQG  663



>ref|XP_009601332.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Nicotiana 
tomentosiformis]
Length=866

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD+KVRIW++P+R+VVDW D  +MV+A CY PDG+ 
Sbjct  549  FISGSLDSKVRIWSIPERQVVDWNDLHEMVTAACYTPDGQG  589



>ref|XP_006279997.1| hypothetical protein CARUB_v10025868mg [Capsella rubella]
 gb|EOA12895.1| hypothetical protein CARUB_v10025868mg [Capsella rubella]
Length=864

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PD +VVDW D  +MV+A CY PDG+ 
Sbjct  564  FISGSLDAKVRIWSIPDHQVVDWNDLHEMVTAACYTPDGQG  604



>emb|CDY48097.1| BnaC02g03540D [Brassica napus]
Length=873

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAK+RIWN+ +R+VV+W D  +MV+A+CY PDG+A
Sbjct  549  FISGSLDAKIRIWNISNRQVVEWNDLNEMVTAVCYTPDGQA  589



>ref|XP_009601333.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Nicotiana 
tomentosiformis]
Length=670

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD+KVRIW++P+R+VVDW D  +MV+A CY PDG+ 
Sbjct  549  FISGSLDSKVRIWSIPERQVVDWNDLHEMVTAACYTPDGQG  589



>dbj|BAK00713.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=782

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW++P R++VDW+D  +M++A CY+PDG++
Sbjct  486  FISGSLDEKVRIWSIPKREIVDWVDLHEMITAACYSPDGQS  526



>ref|XP_008681193.1| PREDICTED: signal transducer isoform X1 [Zea mays]
 gb|AFW72506.1| hypothetical protein ZEAMMB73_355079 [Zea mays]
Length=783

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW++P R++VDW+D  +MV+A CY PDG+ 
Sbjct  480  FISGSLDEKVRIWSIPKREIVDWVDLHEMVTAACYTPDGKG  520



>ref|XP_006429072.1| hypothetical protein CICLE_v10013628mg, partial [Citrus clementina]
 gb|ESR42312.1| hypothetical protein CICLE_v10013628mg, partial [Citrus clementina]
Length=919

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGE  5
            FISGSLDAKVRIW++ DR VVDW D  +MV+A CY PDG+
Sbjct  605  FISGSLDAKVRIWSISDRLVVDWTDLHEMVTAACYTPDGQ  644



>ref|XP_010482829.1| PREDICTED: WD repeat-containing protein 44-like [Camelina sativa]
Length=856

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PD +VVDW D  +MV+A CY PDG+ 
Sbjct  556  FISGSLDAKVRIWSIPDHQVVDWNDLHEMVTAACYTPDGQG  596



>ref|XP_010446663.1| PREDICTED: WD repeat-containing protein 44-like [Camelina sativa]
Length=851

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PD +VVDW D  +MV+A CY PDG+ 
Sbjct  551  FISGSLDAKVRIWSIPDHQVVDWNDLHEMVTAACYTPDGQG  591



>ref|XP_009119955.1| PREDICTED: WD repeat-containing protein 44 [Brassica rapa]
Length=810

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PD +VVDW D  +MV+A CY PDG+ 
Sbjct  512  FISGSLDAKVRIWSIPDHQVVDWNDLHEMVTAACYTPDGQG  552



>ref|XP_003527990.1| PREDICTED: WD repeat-containing protein 44-like [Glycine max]
Length=701

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGS+D KVRIW +PD  VVDWID KD+V+A+CY PDG+ 
Sbjct  411  FISGSIDGKVRIWAIPDCHVVDWIDIKDIVTAVCYRPDGQG  451



>gb|KDO47180.1| hypothetical protein CISIN_1g002086mg [Citrus sinensis]
Length=969

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGE  5
            FISGSLDAKVRIW++ DR VVDW D  +MV+A CY PDG+
Sbjct  610  FISGSLDAKVRIWSISDRLVVDWTDLHEMVTAACYTPDGQ  649



>emb|CDY04852.1| BnaAnng00340D [Brassica napus]
Length=874

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAK+RIWN+ +R+VV+W D  +MV+A+CY PDG+A
Sbjct  551  FISGSLDAKIRIWNISNRQVVEWNDLNEMVTAVCYTPDGQA  591



>ref|XP_010442997.1| PREDICTED: WD repeat-containing protein 44-like [Camelina sativa]
Length=859

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PD +VVDW D  +MV+A CY PDG+ 
Sbjct  559  FISGSLDAKVRIWSIPDHQVVDWNDLHEMVTAACYTPDGQG  599



>ref|NP_001132305.1| signal transducer [Zea mays]
 gb|ACG45443.1| signal transducer [Zea mays]
 gb|AFW72507.1| signal transducer [Zea mays]
Length=780

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW++P R++VDW+D  +MV+A CY PDG+ 
Sbjct  477  FISGSLDEKVRIWSIPKREIVDWVDLHEMVTAACYTPDGKG  517



>emb|CDY43837.1| BnaC03g14700D [Brassica napus]
Length=1176

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGE  5
            FISGSLDAKVRIW++PD +VVDW D  +MV+A CY PDG+
Sbjct  489  FISGSLDAKVRIWSIPDHQVVDWKDLHEMVTAACYTPDGQ  528



>ref|XP_002866029.1| WD-40 repeat family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42288.1| WD-40 repeat family protein [Arabidopsis lyrata subsp. lyrata]
Length=830

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PD +VVDW D  +MV+A CY PDG+ 
Sbjct  529  FISGSLDAKVRIWSIPDHQVVDWNDLHEMVTAACYTPDGQG  569



>ref|XP_010487372.1| PREDICTED: WD repeat-containing protein 44-like [Camelina sativa]
Length=901

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDA VR+W++PDR+VVDW D  +MV++ CY PDG+ 
Sbjct  581  FISGSLDANVRVWSIPDRQVVDWYDLHEMVTSACYTPDGQG  621



>gb|EYU26402.1| hypothetical protein MIMGU_mgv1a001267mg [Erythranthe guttata]
Length=849

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PD +V+DW D  +MV+A CY PDG+ 
Sbjct  568  FISGSLDAKVRIWSIPDHQVIDWNDLHEMVTAACYTPDGQG  608



>emb|CDY43049.1| BnaA03g11960D [Brassica napus]
Length=742

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PD +VVDW D  +MV+A CY PDG+ 
Sbjct  468  FISGSLDAKVRIWSIPDHQVVDWKDLHEMVTAACYTPDGQG  508



>ref|NP_001047535.1| Os02g0638900 [Oryza sativa Japonica Group]
 dbj|BAD25344.1| WD-40 repeat protein-like [Oryza sativa Japonica Group]
 dbj|BAD25899.1| WD-40 repeat protein-like [Oryza sativa Japonica Group]
 dbj|BAF09449.1| Os02g0638900 [Oryza sativa Japonica Group]
Length=479

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW++ +RK+VDWID  +M++A CY PDG+ 
Sbjct  402  FISGSLDKKVRIWSIQERKIVDWIDLHEMITAACYTPDGQG  442



>gb|KFK24743.1| hypothetical protein AALP_AA8G018700 [Arabis alpina]
Length=856

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAK+RIWN+ +R+VV+W D  +MV+A+CY PDG+A
Sbjct  521  FISGSLDAKIRIWNISNRQVVEWNDLNEMVTAVCYTPDGQA  561



>ref|XP_009132448.1| PREDICTED: WD repeat-containing protein 44-like [Brassica rapa]
Length=787

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PD +VVDW D  +MV+A CY PDG+ 
Sbjct  489  FISGSLDAKVRIWSIPDHQVVDWKDLHEMVTAACYTPDGQG  529



>ref|XP_010537008.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat-containing protein 
44 [Tarenaya hassleriana]
Length=884

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDG  8
            FISGSLDAKVRIW++PD +VVDW D  +MV+A CY PDG
Sbjct  586  FISGSLDAKVRIWSIPDHQVVDWNDLHEMVTAACYTPDG  624



>ref|XP_010935623.1| PREDICTED: WD repeat-containing protein 44-like [Elaeis guineensis]
Length=857

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW++PDR+VVDW D  +MV+A C+ PDG+ 
Sbjct  550  FISGSLDEKVRIWSIPDRQVVDWNDLHEMVTAACFTPDGQG  590



>ref|XP_009408732.1| PREDICTED: WD repeat-containing protein 44-like [Musa acuminata 
subsp. malaccensis]
Length=940

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD+KVRIW+VP+R+VVDW D  +MV+A CY PDG+ 
Sbjct  596  FISGSLDSKVRIWSVPERQVVDWNDLHEMVTAACYTPDGQG  636



>ref|XP_006480802.1| PREDICTED: WD repeat-containing protein 44-like [Citrus sinensis]
Length=967

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGE  5
            FISGSLDAKVRIW++ DR VVDW D  +MV+A CY PDG+
Sbjct  608  FISGSLDAKVRIWSISDRLVVDWTDLHEMVTAACYTPDGQ  647



>emb|CAN65559.1| hypothetical protein VITISV_034983 [Vitis vinifera]
Length=1068

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PDR+VVDW D  +MV+A  Y PDG+ 
Sbjct  545  FISGSLDAKVRIWSIPDRQVVDWTDLHEMVTAASYTPDGQG  585



>ref|XP_010242005.1| PREDICTED: uncharacterized protein LOC104586456 [Nelumbo nucifera]
Length=923

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVR+W++PDR+VVDW D  +MV+A CY PDG+ 
Sbjct  609  FISGSLDNKVRMWSIPDRQVVDWKDLHEMVTAACYTPDGQG  649



>gb|EMS48390.1| WD repeat-containing protein 44 [Triticum urartu]
Length=795

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW++P R++VDW+D  +M++A CY+PDG++
Sbjct  499  FISGSLDEKVRIWSIPKREIVDWVDLHEMITAACYSPDGQS  539



>ref|XP_009379832.1| PREDICTED: 2-deoxy-glucose resistant protein 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009379833.1| PREDICTED: 2-deoxy-glucose resistant protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=704

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGS+D KVRIW +P+ +V DW+D KD+V+A+CY PDG+ 
Sbjct  407  FISGSIDGKVRIWEIPENRVTDWVDTKDIVTAICYQPDGKG  447



>emb|CDY14324.1| BnaA10g07310D [Brassica napus]
Length=760

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PD +VVDW D  +MV+A CY PDG+ 
Sbjct  486  FISGSLDAKVRIWSIPDHQVVDWNDLHEMVTAACYTPDGQG  526



>ref|XP_008678863.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Zea 
mays]
 gb|AFW63148.1| hypothetical protein ZEAMMB73_083259 [Zea mays]
Length=793

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW++P R++VDW+D  +MV+A CY PDG+ 
Sbjct  488  FISGSLDEKVRIWSIPKREIVDWVDLHEMVTAACYTPDGKG  528



>ref|NP_001176393.1| Os11g0187000 [Oryza sativa Japonica Group]
 dbj|BAH95121.1| Os11g0187000 [Oryza sativa Japonica Group]
Length=1391

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD+KVRIW+V +R+VVDW D  DMV+A CY PDG+A
Sbjct  589  FISGSLDSKVRIWSVAERQVVDWSDLDDMVTAACYTPDGQA  629



>ref|XP_008678862.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Zea 
mays]
Length=797

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGE  5
            FISGSLD KVRIW++P R++VDW+D  +MV+A CY PDG+
Sbjct  488  FISGSLDEKVRIWSIPKREIVDWVDLHEMVTAACYTPDGK  527



>ref|XP_004141232.1| PREDICTED: WD repeat-containing protein 44-like [Cucumis sativus]
 ref|XP_004160597.1| PREDICTED: WD repeat-containing protein 44-like [Cucumis sativus]
 gb|KGN55147.1| hypothetical protein Csa_4G638360 [Cucumis sativus]
Length=918

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PD +VVDW D  +MV+A CY PDG+ 
Sbjct  603  FISGSLDAKVRIWSIPDHQVVDWSDLHEMVTAACYTPDGKG  643



>ref|NP_200231.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
 dbj|BAB11582.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96466.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
Length=825

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PD +VVDW D  +MV+A CY PDG+ 
Sbjct  524  FISGSLDAKVRIWSIPDHQVVDWNDLHEMVTAACYTPDGQG  564



>ref|XP_008452481.1| PREDICTED: WD repeat-containing protein 44 isoform X2 [Cucumis 
melo]
Length=886

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PD +VVDW D  +MV+A CY PDG+ 
Sbjct  571  FISGSLDAKVRIWSIPDHQVVDWSDLHEMVTAACYTPDGKG  611



>gb|EMT31099.1| hypothetical protein F775_09133 [Aegilops tauschii]
Length=623

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGE  5
            FISGSLD KVRIWNV DRK+ DW D  +MV+A CY+PDG+
Sbjct  289  FISGSLDEKVRIWNVHDRKIEDWNDLHEMVTAACYSPDGQ  328



>emb|CDY55888.1| BnaA04g29100D [Brassica napus]
Length=835

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAK+RIW++ +R+VVDW D  +MV+A CY PDG+ 
Sbjct  554  FISGSLDAKIRIWSIQNRQVVDWSDLHEMVTAACYTPDGQG  594



>ref|XP_008776093.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Phoenix 
dactylifera]
Length=807

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW++PDR++VDW D  +MV+A CY PDG+ 
Sbjct  514  FISGSLDEKVRIWSIPDRQIVDWNDLHEMVTAACYTPDGQG  554



>ref|XP_004953234.1| PREDICTED: WD repeat-containing protein 44-like [Setaria italica]
Length=783

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW++P R++VDW+D  +MV+A CY PDG+ 
Sbjct  480  FISGSLDEKVRIWSIPKREIVDWVDLHEMVTAACYTPDGKG  520



>gb|EEE57449.1| hypothetical protein OsJ_07666 [Oryza sativa Japonica Group]
Length=749

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW++ +RK+VDWID  +M++A CY PDG+ 
Sbjct  458  FISGSLDKKVRIWSIQERKIVDWIDLHEMITAACYTPDGQG  498



>gb|KHN16217.1| WD repeat-containing protein 44 [Glycine soja]
Length=704

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FI+GSLDAKVR+WN+P R VVDWID  +MV+A+ Y PDG+ 
Sbjct  328  FITGSLDAKVRMWNIPARLVVDWIDIHEMVTAVSYTPDGQG  368



>gb|EMS47953.1| WD repeat-containing protein 44 [Triticum urartu]
Length=602

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGE  5
            FISGSLD KVRIWNV DRK+ DW D  +MV+A CY+PDG+
Sbjct  290  FISGSLDEKVRIWNVHDRKIEDWNDLHEMVTAACYSPDGQ  329



>ref|XP_009382122.1| PREDICTED: WD repeat-containing protein 44-like [Musa acuminata 
subsp. malaccensis]
Length=854

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW++PDR++VDW D  +MV+A CY PDG+ 
Sbjct  546  FISGSLDEKVRIWSIPDRQIVDWNDLHEMVTAACYTPDGQG  586



>ref|XP_008452480.1| PREDICTED: WD repeat-containing protein 44 isoform X1 [Cucumis 
melo]
Length=918

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++PD +VVDW D  +MV+A CY PDG+ 
Sbjct  603  FISGSLDAKVRIWSIPDHQVVDWSDLHEMVTAACYTPDGKG  643



>gb|EEC73670.1| hypothetical protein OsI_08217 [Oryza sativa Indica Group]
Length=772

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW++ +RK+VDWID  +M++A CY PDG+ 
Sbjct  481  FISGSLDKKVRIWSIQERKIVDWIDLHEMITAACYTPDGQG  521



>ref|XP_006602578.1| PREDICTED: WD repeat-containing protein 44-like [Glycine max]
Length=929

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FI+GSLDAKVR+WN+P R VVDWID  +MV+A+ Y PDG+ 
Sbjct  553  FITGSLDAKVRMWNIPARLVVDWIDIHEMVTAVSYTPDGQG  593



>ref|XP_009141680.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat-containing protein 
44 [Brassica rapa]
Length=898

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAK+RIW++ +R+VVDW D  +MV+A CY PDG+ 
Sbjct  554  FISGSLDAKIRIWSIQNRQVVDWSDLHEMVTAACYTPDGQG  594



>ref|XP_003579484.1| PREDICTED: WD repeat-containing protein 44-like [Brachypodium 
distachyon]
Length=794

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGE  5
            FISGSLD KVRIWNV DRK+ DW D  +MV+A CY+PDG+
Sbjct  486  FISGSLDEKVRIWNVHDRKIEDWNDLHEMVTAACYSPDGQ  525



>ref|XP_009398403.1| PREDICTED: WD repeat-containing protein 44-like [Musa acuminata 
subsp. malaccensis]
Length=870

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW++PDR++VDW D  +MV+A C+ P+G+A
Sbjct  564  FISGSLDEKVRIWSIPDRQIVDWNDLHEMVTAACFTPNGQA  604



>gb|EMS49362.1| WD repeat-containing protein 44 [Triticum urartu]
Length=752

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVR+W++P+R+VVDW D  +MV+A  Y+PDG+A
Sbjct  479  FISGSLDAKVRLWSIPNRQVVDWTDVNEMVTAASYSPDGQA  519



>emb|CDX93358.1| BnaC04g45380D [Brassica napus]
Length=853

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAK+RIW++ +R+VVDW D  +MV+A CY PDG+ 
Sbjct  548  FISGSLDAKIRIWSIQNRQVVDWSDLHEMVTAACYTPDGQG  588



>gb|EEC67823.1| hypothetical protein OsI_35405 [Oryza sativa Indica Group]
Length=477

 Score = 65.5 bits (158),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD+KVRIW+V +R+VVDW D  DMV+A CY PDG+A
Sbjct  174  FISGSLDSKVRIWSVAERQVVDWSDLDDMVTAACYTPDGQA  214



>ref|NP_001176818.1| Os12g0178633 [Oryza sativa Japonica Group]
 dbj|BAH95546.1| Os12g0178633 [Oryza sativa Japonica Group]
Length=627

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVR+W++PDR+VVDW D  +MV+A  Y PDG+ 
Sbjct  367  FISGSLDAKVRLWSIPDRQVVDWTDLNEMVTAASYTPDGQG  407



>gb|EEC78257.1| hypothetical protein OsI_17932 [Oryza sativa Indica Group]
Length=816

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGE  5
            FISGSLD KVRIWNV DRK+ DW D  +MV+A CY+PDG+
Sbjct  507  FISGSLDEKVRIWNVHDRKIEDWNDLHEMVTAACYSPDGQ  546



>ref|NP_001054272.1| Os04g0678300 [Oryza sativa Japonica Group]
 emb|CAE54549.1| OSJNBa0064G10.23 [Oryza sativa Japonica Group]
 dbj|BAF16186.1| Os04g0678300 [Oryza sativa Japonica Group]
 gb|EEE61909.1| hypothetical protein OsJ_16633 [Oryza sativa Japonica Group]
Length=819

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGE  5
            FISGSLD KVRIWNV DRK+ DW D  +MV+A CY+PDG+
Sbjct  510  FISGSLDEKVRIWNVHDRKIEDWNDLHEMVTAACYSPDGQ  549



>ref|XP_002441919.1| hypothetical protein SORBIDRAFT_08g004850 [Sorghum bicolor]
 gb|EES15757.1| hypothetical protein SORBIDRAFT_08g004850 [Sorghum bicolor]
Length=782

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVR+W++PDR+VVDW D  +MV+A  Y PDG+ 
Sbjct  506  FISGSLDAKVRLWSIPDRQVVDWTDLNEMVTAASYTPDGQG  546



>ref|XP_006663266.1| PREDICTED: WD repeat-containing protein 44-like [Oryza brachyantha]
Length=746

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD+KVRIW+V +R+VVDW D  DMV+A CY PDG+A
Sbjct  612  FISGSLDSKVRIWSVAERQVVDWSDLDDMVTAACYTPDGQA  652



>ref|XP_001780848.1| predicted protein [Physcomitrella patens]
 gb|EDQ54327.1| predicted protein [Physcomitrella patens]
Length=635

 Score = 65.5 bits (158),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGE  5
            FISGSLD KVRIW +PD  VVDW D ++MV+A+CYAPDG+
Sbjct  318  FISGSLDDKVRIWCIPDHHVVDWSDLQEMVTAVCYAPDGK  357



>ref|XP_007048298.1| Transducin/WD40 repeat-like superfamily protein, putative isoform 
2 [Theobroma cacao]
 gb|EOX92455.1| Transducin/WD40 repeat-like superfamily protein, putative isoform 
2 [Theobroma cacao]
Length=445

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGE  5
            FISGS+D KVRIW V +++VVDW+D +D+++A+CY PDG+
Sbjct  361  FISGSIDGKVRIWGVSEKRVVDWVDVRDIITAICYRPDGK  400



>ref|XP_009385247.1| PREDICTED: WD repeat-containing protein 44-like [Musa acuminata 
subsp. malaccensis]
Length=797

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW++PD +VVDW D  +MV+A C++PDG+A
Sbjct  497  FISGSLDEKVRIWSIPDPQVVDWNDLHEMVTAACFSPDGQA  537



>ref|XP_008776130.1| PREDICTED: uncharacterized protein LOC103696321 isoform X2 [Phoenix 
dactylifera]
Length=705

 Score = 65.5 bits (158),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGS+D KVRIW VP+ +VVDW+D +D+V+A+CY PDG+ 
Sbjct  407  FISGSIDGKVRIWGVPENRVVDWVDLRDIVTAICYRPDGKG  447



>ref|XP_008776128.1| PREDICTED: POC1 centriolar protein homolog B-like isoform X1 
[Phoenix dactylifera]
 ref|XP_008776129.1| PREDICTED: POC1 centriolar protein homolog B-like isoform X1 
[Phoenix dactylifera]
Length=706

 Score = 65.5 bits (158),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGS+D KVRIW VP+ +VVDW+D +D+V+A+CY PDG+ 
Sbjct  408  FISGSIDGKVRIWGVPENRVVDWVDLRDIVTAICYRPDGKG  448



>ref|XP_006653031.1| PREDICTED: WD repeat-containing protein 44-like [Oryza brachyantha]
Length=594

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGE  5
            FISGSLD KVRIWNV DRK+ DW D  +MV+A CY+PDG+
Sbjct  286  FISGSLDEKVRIWNVHDRKIEDWNDLHEMVTAACYSPDGQ  325



>ref|XP_004960064.1| PREDICTED: WD repeat-containing protein 44-like [Setaria italica]
Length=796

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGE  5
            FISGSLD KVRIWNV DRK+ DW D  +MV+A CY+PDG+
Sbjct  486  FISGSLDEKVRIWNVRDRKIEDWNDLHEMVTAACYSPDGQ  525



>ref|XP_009386077.1| PREDICTED: WD repeat-containing protein 44-like [Musa acuminata 
subsp. malaccensis]
Length=832

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW++P+R+VVDW D  +MV+A CY PDG+ 
Sbjct  524  FISGSLDEKVRIWSIPERQVVDWNDLHEMVTAACYTPDGQG  564



>ref|XP_010529833.1| PREDICTED: uncharacterized protein LOC104806565 [Tarenaya hassleriana]
Length=906

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAK+RIWN+ +R VV+W D  +MV+A CY PDG+ 
Sbjct  582  FISGSLDAKIRIWNISERHVVEWSDLHEMVTAACYTPDGQG  622



>emb|CAJ86375.1| OSIGBa0155K17.2 [Oryza sativa Indica Group]
Length=778

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGE  5
            FISGSLD KVRIW++P R++VDW D  +MV+A CY PDG+
Sbjct  483  FISGSLDEKVRIWSIPGREIVDWNDLHEMVTAACYTPDGQ  522



>ref|XP_008662533.1| PREDICTED: uncharacterized protein LOC103640850 isoform X1 [Zea 
mays]
 gb|AFW56226.1| hypothetical protein ZEAMMB73_120927 [Zea mays]
Length=877

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVR+W++PDR+VVDW D  +MV+A  Y PDG+ 
Sbjct  584  FISGSLDAKVRLWSIPDRQVVDWTDLNEMVTAASYTPDGQG  624



>ref|XP_008662535.1| PREDICTED: uncharacterized protein LOC103640850 isoform X2 [Zea 
mays]
Length=876

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVR+W++PDR+VVDW D  +MV+A  Y PDG+ 
Sbjct  583  FISGSLDAKVRLWSIPDRQVVDWTDLNEMVTAASYTPDGQG  623



>ref|XP_004978305.1| PREDICTED: WD repeat-containing protein 44-like [Setaria italica]
Length=858

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVR+W++PDR+VVDW D  +MV+A  Y PDG+ 
Sbjct  579  FISGSLDAKVRLWSIPDRQVVDWTDLNEMVTAASYTPDGQG  619



>gb|EEC68951.1| hypothetical protein OsI_37676 [Oryza sativa Indica Group]
Length=727

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVR+W++PDR+VVDW D  +MV+A  Y PDG+ 
Sbjct  430  FISGSLDAKVRLWSIPDRQVVDWTDLNEMVTAASYTPDGQG  470



>ref|XP_007140294.1| hypothetical protein PHAVU_008G100100g [Phaseolus vulgaris]
 gb|ESW12288.1| hypothetical protein PHAVU_008G100100g [Phaseolus vulgaris]
Length=950

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAK+R+WN+P R VVDW D  +MV+A+ Y PDG+ 
Sbjct  566  FISGSLDAKIRMWNIPARLVVDWTDIHEMVTAVSYTPDGQG  606



>gb|KHN23344.1| WD repeat-containing protein 44 [Glycine soja]
Length=708

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGS+D KVRIW +PD  VVDWID KD+V+A+CY PDG+ 
Sbjct  411  FISGSIDGKVRIWAIPDCHVVDWIDIKDIVTAVCYRPDGQG  451



>ref|XP_004516656.1| PREDICTED: WD repeat-containing protein 44-like [Cicer arietinum]
Length=976

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVR+WN+P R VVDW D  +MV+A+ Y PDG+ 
Sbjct  594  FISGSLDAKVRMWNIPARLVVDWTDIHEMVTAVSYTPDGQG  634



>ref|XP_007048297.1| Transducin/WD40 repeat-like superfamily protein, putative isoform 
1 [Theobroma cacao]
 gb|EOX92454.1| Transducin/WD40 repeat-like superfamily protein, putative isoform 
1 [Theobroma cacao]
Length=660

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGE  5
            FISGS+D KVRIW V +++VVDW+D +D+++A+CY PDG+
Sbjct  361  FISGSIDGKVRIWGVSEKRVVDWVDVRDIITAICYRPDGK  400



>dbj|BAJ95842.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=784

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD KVRIW++P R++VDW D  +MV+A CY PDG++
Sbjct  476  FISGSLDEKVRIWSIPKREIVDWHDLHEMVTAACYTPDGQS  516



>ref|XP_010677871.1| PREDICTED: WD repeat-containing protein 44 [Beta vulgaris subsp. 
vulgaris]
Length=1033

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW+VP R+VVDW D  +MV+A  Y PDG+ 
Sbjct  640  FISGSLDAKVRIWSVPGRRVVDWTDLHEMVTAASYTPDGQG  680



>ref|XP_010237874.1| PREDICTED: WD repeat-containing protein 44-like [Brachypodium 
distachyon]
Length=534

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLD +VRIW+V +R+VVDW D  DMV+A CY PDG+A
Sbjct  239  FISGSLDCRVRIWSVAERQVVDWSDLNDMVTAACYTPDGQA  279



>gb|KFK36654.1| hypothetical protein AALP_AA4G152800 [Arabis alpina]
Length=923

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAK+RIW++ DR VV+W D  +MV+A CY PDG+ 
Sbjct  575  FISGSLDAKIRIWSIQDRHVVEWSDLHEMVTAACYTPDGQG  615



>gb|KEH35471.1| transducin/WD40 repeat protein [Medicago truncatula]
Length=702

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGS+D KVRIW +PD +VVDW D +D+V+A+CY PDG+ 
Sbjct  408  FISGSIDGKVRIWTIPDSQVVDWTDVRDIVTAVCYRPDGQG  448



>ref|XP_010247261.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Nelumbo 
nucifera]
Length=638

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGS+D KVRIW V D +VVDW D +D+V+A+CY PDG+ 
Sbjct  346  FISGSIDGKVRIWGVSDGRVVDWADMRDIVTAICYQPDGQG  386



>ref|XP_002447325.1| hypothetical protein SORBIDRAFT_06g033000 [Sorghum bicolor]
 gb|EES11653.1| hypothetical protein SORBIDRAFT_06g033000 [Sorghum bicolor]
Length=802

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGE  5
            FISGSLD KVRIWNV DRK+ DW D  +MV+A CY+PDG+
Sbjct  492  FISGSLDEKVRIWNVRDRKIEDWNDLHEMVTAACYSPDGQ  531



>ref|XP_004293101.1| PREDICTED: WD repeat-containing protein 44-like [Fragaria vesca 
subsp. vesca]
Length=878

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVRIW++ D +VVDW D  +MV+A CY PDG+ 
Sbjct  565  FISGSLDAKVRIWSILDHQVVDWNDTHEMVTAACYTPDGQG  605



>ref|XP_004253336.1| PREDICTED: POC1 centriolar protein homolog B-like [Solanum lycopersicum]
Length=624

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            F+SGSLDAK+RIW++ DR VV+W D  +MV+A CY PDG+ 
Sbjct  283  FLSGSLDAKIRIWSIQDRHVVEWSDLHEMVTAACYTPDGQG  323



>ref|XP_003530889.2| PREDICTED: uncharacterized protein LOC100793299 [Glycine max]
Length=908

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            F++GSLDAKVR+WN+P R VVDWID  +MV+A+ Y PDG+ 
Sbjct  533  FLTGSLDAKVRMWNIPARLVVDWIDIHEMVTAVSYTPDGQG  573



>emb|CDY38748.1| BnaC03g15010D [Brassica napus]
Length=608

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            F+SGS+D KVRIWN+P   VVDW D KD++SA+CY PDG+ 
Sbjct  343  FMSGSVDGKVRIWNIPGCNVVDWADVKDIISAVCYRPDGQG  383



>ref|XP_006653617.1| PREDICTED: WD repeat-containing protein 44-like [Oryza brachyantha]
Length=786

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGE  5
            FISGSLD KVRIW++P R++VDW D  +MV+A CY PDG+
Sbjct  484  FISGSLDEKVRIWSIPRREIVDWNDLHEMVTAACYTPDGQ  523



>dbj|BAK00277.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=870

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVR+W++P+R+VVDW D  +MV+A  Y+PDG+ 
Sbjct  565  FISGSLDAKVRLWSIPNRQVVDWTDVNEMVTATSYSPDGQG  605



>emb|CBG76443.1| OO_Ba0013J05-OO_Ba0033A15.30 [Oryza officinalis]
Length=748

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGE  5
            FISGSLD KVRIW++P R++VDW D  +MV+A CY PDG+
Sbjct  486  FISGSLDEKVRIWSIPGREIVDWNDLHEMVTAACYTPDGQ  525



>ref|XP_009130702.1| PREDICTED: WD repeat-containing protein 44-like [Brassica rapa]
Length=876

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAK+RIWN+ +R+VV+W D  +MV+A+CY  DG+A
Sbjct  547  FISGSLDAKIRIWNISNRQVVEWTDLNEMVTAVCYTRDGQA  587



>ref|XP_008369885.1| PREDICTED: WD repeat-containing protein 44 [Malus domestica]
Length=972

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAK+R+WNV  R+VVDWID  +MV+A  Y PDG+A
Sbjct  616  FISGSLDAKIRLWNVAVRQVVDWIDLYEMVTAASYTPDGQA  656



>gb|EYU26583.1| hypothetical protein MIMGU_mgv1a000854mg [Erythranthe guttata]
Length=959

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            F+SGSLD KVRIWN+P RKVVDW D  +MV+A  Y PDG+ 
Sbjct  598  FMSGSLDGKVRIWNIPARKVVDWTDLHEMVTAASYTPDGQG  638



>ref|XP_002321388.1| WD-40 repeat family protein [Populus trichocarpa]
 gb|EEF05515.1| WD-40 repeat family protein [Populus trichocarpa]
Length=726

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            F+SGS+D KVRIW V  R+VVDW D KDMV+A+CY PDG+ 
Sbjct  434  FMSGSIDGKVRIWAVNSRQVVDWTDIKDMVTAVCYRPDGQG  474



>ref|XP_010247260.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Nelumbo 
nucifera]
Length=699

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGS+D KVRIW V D +VVDW D +D+V+A+CY PDG+ 
Sbjct  407  FISGSIDGKVRIWGVSDGRVVDWADMRDIVTAICYQPDGQG  447



>ref|XP_006410958.1| hypothetical protein EUTSA_v10016206mg [Eutrema salsugineum]
 gb|ESQ52411.1| hypothetical protein EUTSA_v10016206mg [Eutrema salsugineum]
Length=920

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAK+RIW++ DR VV+W D  +MV+A CY PDG+ 
Sbjct  573  FISGSLDAKIRIWSIQDRHVVEWSDLHEMVTAACYTPDGQG  613



>ref|XP_006280149.1| hypothetical protein CARUB_v10026048mg [Capsella rubella]
 gb|EOA13047.1| hypothetical protein CARUB_v10026048mg [Capsella rubella]
Length=657

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            F+SGS+D KVRIWN+  R V+DW D KD++SA+CY PDG+ 
Sbjct  375  FMSGSIDGKVRIWNISGRNVIDWADLKDIISAVCYRPDGQG  415



>gb|EEC77683.1| hypothetical protein OsI_16737 [Oryza sativa Indica Group]
Length=770

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGE  5
            FISGSLD KVRIW++P R++VDW D  +MV+A CY PDG+
Sbjct  483  FISGSLDEKVRIWSIPGREIVDWNDLHEMVTAACYTPDGQ  522



>ref|XP_010238654.1| PREDICTED: uncharacterized protein LOC100842788 [Brachypodium 
distachyon]
Length=907

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVR+W++P+R+VVDW D  +MV+A  Y+PDG+ 
Sbjct  606  FISGSLDAKVRLWSIPNRQVVDWTDVNEMVTAASYSPDGQG  646



>gb|EEE61382.1| hypothetical protein OsJ_15550 [Oryza sativa Japonica Group]
Length=751

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGE  5
            FISGSLD KVRIW++P R++VDW D  +MV+A CY PDG+
Sbjct  464  FISGSLDEKVRIWSIPGREIVDWNDLHEMVTAACYTPDGQ  503



>gb|EMT02449.1| hypothetical protein F775_13429 [Aegilops tauschii]
Length=492

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGE  5
            FISGSLD KVRIW++P R++VDW D  +MV+A CY PDG+
Sbjct  269  FISGSLDEKVRIWSIPKREIVDWHDLHEMVTAACYTPDGQ  308



>gb|EMT29791.1| hypothetical protein F775_11999 [Aegilops tauschii]
Length=796

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  FISGSLDAKVRIWNVPDRKVVDWIDQKDMVSALCYAPDGEA  2
            FISGSLDAKVR+W++P+R+VVDW D  +MV+A  Y+PDG+ 
Sbjct  495  FISGSLDAKVRLWSIPNRQVVDWTDVNEMVTAASYSPDGQT  535



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 516678285084


  Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF
excluding environmental samples from WGS projects
    Posted date:  Jan 17, 2015  1:43 AM
  Number of letters in database: 20,740,007,484
  Number of sequences in database:  57,851,050



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 12
Window for multiple hits: 40
BLASTX 2.2.30+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF
excluding environmental samples from WGS projects
           57,851,050 sequences; 20,740,007,484 total letters