BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c129344_g1_i1 len=172 path=[1:0-171]

Length=172
                                                                      Score     E

ref|XP_001424170.1|  hypothetical protein                             77.8    5e-16   Paramecium tetraurelia strain d4-2
ref|XP_001448310.1|  hypothetical protein                             77.8    7e-16   Paramecium tetraurelia strain d4-2
ref|XP_001439373.1|  hypothetical protein                             75.5    2e-15   Paramecium tetraurelia strain d4-2
ref|XP_001444878.1|  hypothetical protein                             76.3    2e-15   Paramecium tetraurelia strain d4-2
ref|XP_001447792.1|  hypothetical protein                             74.3    1e-14   Paramecium tetraurelia strain d4-2
ref|XP_001437362.1|  hypothetical protein                             73.9    2e-14   Paramecium tetraurelia strain d4-2
ref|XP_001428896.1|  hypothetical protein                             73.6    2e-14   Paramecium tetraurelia strain d4-2
ref|XP_001447480.1|  hypothetical protein                             72.8    3e-14   Paramecium tetraurelia strain d4-2
ref|XP_004035060.1|  ribosomal protein, putative                      64.3    4e-11   
ref|XP_004029748.1|  s7e ribosomal protein, putative                  63.9    5e-11   
ref|XP_001032999.2|  hypothetical protein TTHERM_00471090             60.1    1e-09   Tetrahymena thermophila



>ref|XP_001424170.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK56772.1| unnamed protein product [Paramecium tetraurelia]
Length=200

 Score = 77.8 bits (190),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    VLIVYVPYASLRLLYRVHPKLVPELEKRLKTTVLVVAKRTIQSKWIKSHRSQQRP  170
            V +VY+P+  L +  +V  KL+PELEKRLK T+LVVAKRTI+SKW+KSHRSQ RP
Sbjct  54   VYLVYIPHPCLSVFNKVSSKLLPELEKRLKATILVVAKRTIESKWVKSHRSQTRP  108



>ref|XP_001448310.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK80913.1| unnamed protein product [Paramecium tetraurelia]
Length=231

 Score = 77.8 bits (190),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    VLIVYVPYASLRLLYRVHPKLVPELEKRLKTTVLVVAKRTIQSKWIKSHRSQQRP  170
            V +VY+P+  L +  +V  KL+PELEKRLK T+LVVAKRTI+SKW+KSHRSQ RP
Sbjct  85   VYLVYIPHPCLSVFNKVSSKLLPELEKRLKATILVVAKRTIESKWVKSHRSQTRP  139



>ref|XP_001439373.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK71976.1| unnamed protein product [Paramecium tetraurelia]
Length=151

 Score = 75.5 bits (184),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    VLIVYVPYASLRLLYRVHPKLVPELEKRLKTTVLVVAKRTIQSKWIKSHRSQQRP  170
            V +V++P+  L +  +V  KL+PELEKRLK T+LVVAKRTI+SKW+KSHRSQ RP
Sbjct  6    VYLVFIPHPCLSIYNKVSSKLLPELEKRLKATILVVAKRTIESKWVKSHRSQTRP  60



>ref|XP_001444878.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK77481.1| unnamed protein product [Paramecium tetraurelia]
Length=199

 Score = 76.3 bits (186),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    VLIVYVPYASLRLLYRVHPKLVPELEKRLKTTVLVVAKRTIQSKWIKSHRSQQRP  170
            V +V++P+  L +  +V  KL+PELEKRLK T+LVVAKRTI+SKW+KSHRSQ RP
Sbjct  54   VYLVFIPHPCLSIYNKVSSKLLPELEKRLKATILVVAKRTIESKWVKSHRSQTRP  108



>ref|XP_001447792.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK80395.1| unnamed protein product [Paramecium tetraurelia]
Length=198

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    VLIVYVPYASLRLLYRVHPKLVPELEKRLKTTVLVVAKRTIQSKWIKSHRSQQRP  170
            V +V +PY  L +  R+  KL+PELEKR+K T+LV AKRTI+SKW+KSHRSQ RP
Sbjct  54   VYLVLIPYPCLSIYNRISSKLLPELEKRVKATILVAAKRTIESKWVKSHRSQTRP  108



>ref|XP_001437362.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK69965.1| unnamed protein product [Paramecium tetraurelia]
Length=265

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    VLIVYVPYASLRLLYRVHPKLVPELEKRLKTTVLVVAKRTIQSKWIKSHRSQQRP  170
            V +V +PY  L +  R+  KL+PELEKR+K T+LV AKRTI+SKW+KSHRSQ RP
Sbjct  121  VYLVLIPYPCLSIYNRISSKLLPELEKRVKATILVAAKRTIESKWVKSHRSQTRP  175



>ref|XP_001428896.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK61498.1| unnamed protein product [Paramecium tetraurelia]
Length=198

 Score = 73.6 bits (179),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    VLIVYVPYASLRLLYRVHPKLVPELEKRLKTTVLVVAKRTIQSKWIKSHRSQQRP  170
            V +V++PY  L +  ++  KL+PELEKR+K T+LV AKRTI+SKW+K+HRSQ RP
Sbjct  54   VYLVFIPYPCLTIYNKISQKLLPELEKRVKATILVAAKRTIESKWVKNHRSQTRP  108



>ref|XP_001447480.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK80083.1| unnamed protein product [Paramecium tetraurelia]
Length=198

 Score = 72.8 bits (177),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    VLIVYVPYASLRLLYRVHPKLVPELEKRLKTTVLVVAKRTIQSKWIKSHRSQQRP  170
            V +V++PY  L +  ++  KL+PELEKR+K T+LV AKRTI+SKW+K HRSQ RP
Sbjct  54   VYLVFIPYPCLSIYNKISQKLLPELEKRVKATILVAAKRTIESKWVKKHRSQTRP  108



>ref|XP_004035060.1| ribosomal protein, putative [Ichthyophthirius multifiliis]
 gb|EGR31574.1| ribosomal protein, putative [Ichthyophthirius multifiliis]
Length=197

 Score = 64.3 bits (155),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    NVLIVYVPYASLRLLYRVHPKLVPELEKRLKTTVLVVAKRTIQSKWIKSHRSQQRP  170
            + L+VYV + S +++  +  KL+ ELEK+LK  V   AKRTI+SKW+K H+SQQRP
Sbjct  59   SALLVYVHFQSYKVVQAISRKLIIELEKKLKQNVFFTAKRTIESKWVKEHKSQQRP  114



>ref|XP_004029748.1| s7e ribosomal protein, putative [Ichthyophthirius multifiliis]
 gb|EGR28512.1| s7e ribosomal protein, putative [Ichthyophthirius multifiliis]
Length=197

 Score = 63.9 bits (154),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    VLIVYVPYASLRLLYRVHPKLVPELEKRLKTTVLVVAKRTIQSKWIKSHRSQQRP  170
             L+VYV + S +++  +  KL+ ELEK+LK  V   AKRTI+SKW+K H+SQQRP
Sbjct  60   ALLVYVHFQSYKVVQAIARKLIIELEKKLKQNVFFTAKRTIESKWVKEHKSQQRP  114



>ref|XP_001032999.2| hypothetical protein TTHERM_00471090 [Tetrahymena thermophila]
 pdb|2XZM|3 Chain 3, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit 
In Complex With Initiation Factor 1. This File Contains 
The 40s Subunit And Initiation Factor For Molecule 1
 pdb|2XZN|3 Chain 3, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit 
In Complex With Initiation Factor 1. This File Contains 
The 40s Subunit And Initiation Factor For Molecule 2
 pdb|4BPE|3 Chain 3, The Crystal Structure Of The Eukaryotic 40s Ribosomal 
Subunit In Complex With Eif1 And Eif1a - Complex 1
 pdb|4BPN|3 Chain 3, The Crystal Structure Of The Eukaryotic 40s Ribosomal 
Subunit In Complex With Eif1 And Eif1a - Complex 2
 pdb|4BPO|3 Chain 3, The Crystal Structure Of The Eukaryotic 40s Ribosomal 
Subunit In Complex With Eif1 And Eif1a - Complex 3
 pdb|4BPP|3 Chain 3, The Crystal Structure Of The Eukaryotic 40s Ribosomal 
Subunit In Complex With Eif1 And Eif1a - Complex 4
 gb|EAR85336.2| 40S ribosomal protein S7 [Tetrahymena thermophila SB210]
 tpg|DAA33971.1| TPA_exp: 40S ribosomal protein rpS7e [Tetrahymena thermophila]
Length=197

 Score = 60.1 bits (144),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    NVLIVYVPYASLRLLYRVHPKLVPELEKRLKTTVLVVAKRTIQSKWIKSHRSQQRP  170
            + +++YV + S R+L     KL+ ELEK+LK  V   A+R I+SKW+K H+SQQRP
Sbjct  59   SAVLIYVHFQSYRVLLSAARKLIIELEKKLKQIVFFTAQRKIESKWVKEHKSQQRP  114



Lambda      K        H        a         alpha
   0.306    0.118    0.313    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 513120851568


  Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF
excluding environmental samples from WGS projects
    Posted date:  Jan 17, 2015  1:43 AM
  Number of letters in database: 20,740,007,484
  Number of sequences in database:  57,851,050



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 12
Window for multiple hits: 40
BLASTX 2.2.30+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF
excluding environmental samples from WGS projects
           57,851,050 sequences; 20,740,007,484 total letters