BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c12926_g1_i1 len=1302 path=[1330:0-1301]

Length=1302
                                                                      Score     E

ref|XP_004229443.1|  PREDICTED: uncharacterized protein LOC101258...    360   2e-114   
ref|XP_009616894.1|  PREDICTED: uncharacterized protein LOC104109336    358   2e-113   
ref|XP_006339406.1|  PREDICTED: uncharacterized protein LOC102598761    357   4e-113   
ref|XP_009758626.1|  PREDICTED: uncharacterized protein LOC104211286    356   9e-113   
ref|XP_010322696.1|  PREDICTED: uncharacterized protein LOC101258...    355   2e-112   
ref|XP_009778776.1|  PREDICTED: uncharacterized protein LOC104228073    351   7e-111   
ref|XP_009608678.1|  PREDICTED: uncharacterized protein LOC104102622    351   8e-111   
gb|EYU41540.1|  hypothetical protein MIMGU_mgv1a003502mg                339   1e-106   
ref|XP_006339765.1|  PREDICTED: uncharacterized protein LOC102599208    335   4e-105   
ref|XP_011090802.1|  PREDICTED: uncharacterized protein LOC105171...    335   8e-105   
ref|XP_011071538.1|  PREDICTED: uncharacterized protein LOC105156965    332   1e-103   
emb|CDO98992.1|  unnamed protein product                                325   1e-100   
ref|XP_004229442.1|  PREDICTED: uncharacterized protein LOC101257893    316   7e-98    
ref|XP_011090803.1|  PREDICTED: uncharacterized protein LOC105171...    315   3e-97    
gb|EPS59401.1|  hypothetical protein M569_15407                         286   1e-86    
gb|EYU45615.1|  hypothetical protein MIMGU_mgv1a004493mg                280   1e-84    
gb|EPS66992.1|  hypothetical protein M569_07783                         280   6e-84    
ref|XP_007034600.1|  F28L1.9 protein                                    273   4e-81    
ref|XP_010255883.1|  PREDICTED: uncharacterized protein LOC104596427    273   6e-81    
ref|XP_010278419.1|  PREDICTED: uncharacterized protein LOC104612625    268   4e-79    
ref|XP_004168006.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    268   4e-79    
gb|EYU43834.1|  hypothetical protein MIMGU_mgv1a026962mg                263   9e-79    
ref|XP_008438725.1|  PREDICTED: uncharacterized protein LOC103483748    266   1e-78    
gb|KGN57028.1|  hypothetical protein Csa_3G150080                       266   1e-78    
ref|XP_010693916.1|  PREDICTED: uncharacterized protein LOC104906799    266   5e-78    
ref|XP_004134459.1|  PREDICTED: uncharacterized protein LOC101204185    264   8e-78    
ref|XP_004296945.1|  PREDICTED: uncharacterized protein LOC101292108    264   1e-77    
ref|XP_010524790.1|  PREDICTED: uncharacterized protein LOC104802744    264   1e-77    
ref|XP_006489298.1|  PREDICTED: uncharacterized protein LOC102628678    260   6e-76    
ref|XP_006419812.1|  hypothetical protein CICLE_v10006522mg             260   6e-76    
ref|XP_002314409.2|  hypothetical protein POPTR_0010s03200g             260   7e-76    Populus trichocarpa [western balsam poplar]
ref|XP_007154129.1|  hypothetical protein PHAVU_003G092800g             258   7e-76    
ref|XP_011013027.1|  PREDICTED: uncharacterized protein LOC105117158    259   1e-75    
ref|XP_010548780.1|  PREDICTED: uncharacterized protein LOC104820105    259   2e-75    
ref|XP_006400461.1|  hypothetical protein EUTSA_v10013116mg             257   2e-75    
ref|XP_002277614.1|  PREDICTED: uncharacterized protein LOC100244329    258   2e-75    Vitis vinifera
ref|XP_004508371.1|  PREDICTED: uncharacterized protein LOC101497658    256   4e-75    
ref|XP_003541632.1|  PREDICTED: uncharacterized protein LOC100811844    258   5e-75    
gb|KHN37568.1|  hypothetical protein glysoja_007271                     257   5e-75    
ref|XP_007147773.1|  hypothetical protein PHAVU_006G154000g             256   1e-74    
ref|XP_010024421.1|  PREDICTED: uncharacterized protein LOC104414900    255   2e-74    
ref|XP_009120923.1|  PREDICTED: uncharacterized protein LOC103845788    254   3e-74    
emb|CDY13947.1|  BnaC09g38790D                                          253   4e-74    
emb|CDX92561.1|  BnaA10g16000D                                          251   4e-73    
gb|KHN03046.1|  hypothetical protein glysoja_009912                     251   6e-73    
ref|XP_003547239.1|  PREDICTED: uncharacterized protein LOC100785350    252   7e-73    
ref|NP_187266.1|  uncharacterized protein                               249   2e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003528671.2|  PREDICTED: uncharacterized protein LOC100783018    251   3e-72    
gb|KDP40102.1|  hypothetical protein JCGZ_02100                         249   5e-72    
ref|XP_002517153.1|  conserved hypothetical protein                     249   8e-72    Ricinus communis
gb|KDO74818.1|  hypothetical protein CISIN_1g035961mg                   248   3e-71    
ref|XP_011012798.1|  PREDICTED: uncharacterized protein LOC105116...    246   4e-71    
ref|XP_002884562.1|  hypothetical protein ARALYDRAFT_477918             246   7e-71    
ref|XP_002311830.2|  hypothetical protein POPTR_0008s20680g             247   9e-71    Populus trichocarpa [western balsam poplar]
ref|XP_008390827.1|  PREDICTED: uncharacterized protein LOC103453071    246   1e-70    
ref|XP_009365805.1|  PREDICTED: uncharacterized protein LOC103955630    246   2e-70    
ref|XP_011012795.1|  PREDICTED: uncharacterized protein LOC105116...    246   2e-70    
ref|XP_006297256.1|  hypothetical protein CARUB_v10013262mg             245   2e-70    
ref|XP_011012800.1|  PREDICTED: uncharacterized protein LOC105116975    246   2e-70    
ref|XP_009418064.1|  PREDICTED: uncharacterized protein LOC103998340    244   2e-70    
ref|XP_008223009.1|  PREDICTED: uncharacterized protein LOC103322845    244   5e-70    
ref|XP_002871856.1|  hypothetical protein ARALYDRAFT_488789             243   5e-70    
ref|XP_009351016.1|  PREDICTED: uncharacterized protein LOC103942554    244   7e-70    
ref|XP_006407975.1|  hypothetical protein EUTSA_v10020342mg             243   8e-70    
ref|XP_008361980.1|  PREDICTED: uncharacterized protein LOC103425671    244   9e-70    
ref|XP_002311829.1|  hypothetical protein POPTR_0008s20670g             244   1e-69    Populus trichocarpa [western balsam poplar]
ref|XP_007222053.1|  hypothetical protein PRUPE_ppa003123mg             242   2e-69    
ref|XP_006287487.1|  hypothetical protein CARUB_v10000698mg             240   3e-69    
ref|XP_010492946.1|  PREDICTED: uncharacterized protein LOC104770243    241   3e-69    
ref|XP_010103427.1|  hypothetical protein L484_010028                   246   6e-69    
ref|XP_009342170.1|  PREDICTED: uncharacterized protein LOC103934167    242   7e-69    
ref|XP_010464183.1|  PREDICTED: uncharacterized protein LOC104744780    240   1e-68    
ref|XP_003550508.1|  PREDICTED: uncharacterized protein LOC100777897    239   2e-68    
ref|XP_010938779.1|  PREDICTED: uncharacterized protein LOC105057781    239   2e-68    
ref|XP_010436508.1|  PREDICTED: uncharacterized protein LOC104720241    239   3e-68    
ref|XP_010486106.1|  PREDICTED: uncharacterized protein LOC104764302    239   4e-68    
emb|CDY58341.1|  BnaA03g57420D                                          236   3e-67    
emb|CBI26182.3|  unnamed protein product                                234   3e-67    
ref|XP_009134876.1|  PREDICTED: uncharacterized protein LOC103859142    236   3e-67    
ref|NP_197407.1|  uncharacterized protein                               235   4e-67    Arabidopsis thaliana [mouse-ear cress]
emb|CDY24713.1|  BnaA05g31120D                                          232   9e-66    
emb|CDY08065.1|  BnaC03g34580D                                          231   1e-65    
ref|XP_009129647.1|  PREDICTED: uncharacterized protein LOC103854...    232   2e-65    
emb|CDY05239.1|  BnaC05g45640D                                          231   2e-65    
gb|KEH32201.1|  cytochrome P450 family protein, putative                230   3e-65    
gb|KEH32202.1|  cytochrome P450 family protein, putative                226   1e-63    
ref|XP_006655293.1|  PREDICTED: uncharacterized protein LOC102707496    204   1e-55    
ref|NP_001055465.1|  Os05g0396900                                       203   7e-55    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003568515.1|  PREDICTED: uncharacterized protein LOC100828689    200   5e-54    
gb|AFW77905.1|  putative cytochrome P450 superfamily protein            193   2e-53    
ref|XP_004962168.1|  PREDICTED: uncharacterized protein LOC101776175    197   5e-53    
ref|XP_002441055.1|  hypothetical protein SORBIDRAFT_09g019540          195   4e-52    Sorghum bicolor [broomcorn]
dbj|BAJ91521.1|  predicted protein                                      193   2e-51    
ref|NP_001146060.1|  uncharacterized protein LOC100279591               192   3e-51    Zea mays [maize]
gb|ACG28702.1|  hypothetical protein                                    192   3e-51    Zea mays [maize]
ref|XP_006850778.1|  hypothetical protein AMTR_s00025p00090990          167   8e-42    
ref|XP_001754754.1|  predicted protein                                  133   7e-31    
gb|AFW58040.1|  hypothetical protein ZEAMMB73_117608                    121   1e-27    
ref|XP_002983520.1|  hypothetical protein SELMODRAFT_43079              122   3e-27    
ref|XP_002973868.1|  hypothetical protein SELMODRAFT_52537              120   8e-27    
ref|XP_002970347.1|  hypothetical protein SELMODRAFT_171524             121   9e-27    
ref|XP_002968112.1|  hypothetical protein SELMODRAFT_89928              119   7e-26    
ref|XP_001784260.1|  predicted protein                                  117   4e-25    
ref|XP_002974062.1|  hypothetical protein SELMODRAFT_100752             115   2e-24    
ref|XP_002990909.1|  hypothetical protein SELMODRAFT_132583             114   2e-24    
ref|XP_002973867.1|  hypothetical protein SELMODRAFT_442281             113   3e-24    
ref|XP_002982758.1|  hypothetical protein SELMODRAFT_117058             114   3e-24    
ref|XP_002983521.1|  hypothetical protein SELMODRAFT_422715             111   1e-23    
ref|XP_002990014.1|  hypothetical protein SELMODRAFT_428507             109   2e-22    
ref|XP_002968966.1|  hypothetical protein SELMODRAFT_409717             108   3e-22    
gb|EMT03338.1|  hypothetical protein F775_08489                       88.2    2e-15    
gb|AEN81784.1|  AT3G06150-like protein                                64.3    1e-08    
gb|AEN81790.1|  AT3G06150-like protein                                62.0    7e-08    
gb|AFG55779.1|  hypothetical protein 0_10113_01                       50.8    2e-04    
gb|AFG55770.1|  hypothetical protein 0_10113_01                       50.8    3e-04    
gb|AFG55781.1|  hypothetical protein 0_10113_01                       50.8    3e-04    
gb|AFG55768.1|  hypothetical protein 0_10113_01                       50.8    3e-04    



>ref|XP_004229443.1| PREDICTED: uncharacterized protein LOC101258185 isoform X1 [Solanum 
lycopersicum]
Length=620

 Score =   360 bits (925),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 183/342 (54%), Positives = 226/342 (66%), Gaps = 58/342 (17%)
 Frame = -3

Query  862  SSQMSEKGGSF-----RANPRVHWWFKLVVLGACLVILILWGIHSVNLSVINAPKDFVIL  698
            SSQM EK G+F       NP+V WWFKL+ +G  L ILI+WGI  V  SV +  +DFV+L
Sbjct  3    SSQMPEKAGNFGWGMRSNNPKVQWWFKLLTMGVFLGILIVWGIDGV--SVGSFQRDFVLL  60

Query  697  KFNGSSKEFRPEFKDFGYSNLQLPPQD---------------------------------  617
            K N SS++F P FKDF ++N+ L P                                   
Sbjct  61   KVN-SSRKFSPGFKDFSFTNISLRPHSVNTQQNLNRDFARKNLAPKVEPQPVNLTGNQGN  119

Query  616  -----------------EPSGSRIGNWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGI  488
                             E S   +  W+ AELE NYSS LL  WL PGGEPC+DSR+V +
Sbjct  120  APDFSLEMVSNKELEWVEDSRPGVFRWISAELEANYSSNLLTKWLAPGGEPCRDSRTVDV  179

Query  487  RVPGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGN  308
            ++P LD RE +ELSTGDIHEFVF A+D+ G+ HCLGGDY+E D+SGE WKSRPP KD GN
Sbjct  180  KIPALDGRENIELSTGDIHEFVFHALDDSGKPHCLGGDYYETDISGETWKSRPPMKDFGN  239

Query  307  GTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPE  128
            GTY+F LQVHPDF GDYN+TIILLF+H+EG++FSP RFAFD+VLRV P+KF+KS  +LPE
Sbjct  240  GTYQFSLQVHPDFAGDYNLTIILLFRHHEGLKFSPVRFAFDKVLRVIPIKFSKSSVDLPE  299

Query  127  ISQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
            ISQC +SDL R+VWSGRWTRHAKND+C +   GR+ CQ+P+F
Sbjct  300  ISQCKKSDLVRDVWSGRWTRHAKNDSCPISRDGRYRCQEPNF  341



>ref|XP_009616894.1| PREDICTED: uncharacterized protein LOC104109336 [Nicotiana tomentosiformis]
Length=622

 Score =   358 bits (919),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 179/345 (52%), Positives = 224/345 (65%), Gaps = 61/345 (18%)
 Frame = -3

Query  862  SSQMSEKGGSF-----RANPRVHWWFKLVVLGACLVILILWGIHSVNLSVINAPKDFVIL  698
            +SQM EKG +F       NP+V WWFKL+ +G  L ILI+WGI  +N+      +DFV+L
Sbjct  3    TSQMPEKGPNFGWVMRSNNPKVQWWFKLLTMGVFLGILIVWGIDGLNVGSFQ--RDFVLL  60

Query  697  KFNGSSKEFRPEFKDFGYSNLQLPPQD---------------------------------  617
            K N S K F P FKDF ++N+ L P                                   
Sbjct  61   KVNSSGK-FSPTFKDFSFTNISLRPHSVNTHQNLNQDFARKNLAPKVAPQQINLTENQGN  119

Query  616  --------------------EPSGSRIGNWVLAELEDNYSSKLLEGWLTPGGEPCKDSRS  497
                                E S  R+  W+ AELE NYSS LL  WL PGGEPC++SR+
Sbjct  120  APDFSLEMVTNVSHKEPELVEVSRPRVHRWISAELEANYSSNLLTNWLAPGGEPCRESRT  179

Query  496  VGIRVPGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKD  317
            V + +P LD RE +ELSTGDIHEFVF A+D+ G+ HCLGGDYFE DL+GE WKSRPP KD
Sbjct  180  VDVNIPALDGRENVELSTGDIHEFVFHALDDSGKPHCLGGDYFETDLAGETWKSRPPVKD  239

Query  316  LGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAE  137
            LGNG+Y+F LQVHP F GDYN+T+ILLF+HYEG++FSP+RFA+D+VLRV PVKF+K   E
Sbjct  240  LGNGSYQFSLQVHPHFSGDYNLTVILLFRHYEGLKFSPERFAYDKVLRVIPVKFSKFSVE  299

Query  136  LPEISQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
            LPE+SQC +SDL R+VWSGRWTRHAKN++C + N GR+ CQ+P+F
Sbjct  300  LPELSQCKKSDLVRDVWSGRWTRHAKNNSCPISNDGRYRCQEPNF  344



>ref|XP_006339406.1| PREDICTED: uncharacterized protein LOC102598761 [Solanum tuberosum]
Length=620

 Score =   357 bits (916),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 181/342 (53%), Positives = 225/342 (66%), Gaps = 58/342 (17%)
 Frame = -3

Query  862  SSQMSEKGGSF-----RANPRVHWWFKLVVLGACLVILILWGIHSVNLSVINAPKDFVIL  698
            SSQM EK G+F       NP+V WWFKL+ +G  L ILI+WGI  V  SV +  +DFV+L
Sbjct  3    SSQMPEKAGNFGWGMRSNNPKVQWWFKLLTMGVFLGILIVWGIDGV--SVGSFQRDFVLL  60

Query  697  KFNGSSKEFRPEFKDFGYSNLQLPPQD---------------------------------  617
            K N SS++F P FKDF ++N+ L P                                   
Sbjct  61   KVN-SSRKFSPGFKDFSFTNISLRPHSVNTQQNLNRDFTRKNLAPKVEPQPVNLTENQGN  119

Query  616  -----------------EPSGSRIGNWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGI  488
                             E S   +  W+ AELE NYSS LL  WL PGGEPC++SR+V +
Sbjct  120  APDFSLEMVSNKELERVEDSRPGVFRWISAELEANYSSNLLRKWLAPGGEPCRESRTVDV  179

Query  487  RVPGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGN  308
             +P LD RE +ELSTGDIHEFVF A+D+ G+ HCLGGDY+E D+SGE WKSRPP KD GN
Sbjct  180  NIPALDGRENIELSTGDIHEFVFHALDDSGKPHCLGGDYYETDISGETWKSRPPIKDFGN  239

Query  307  GTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPE  128
            GTY+F LQVHPDF GDYN+TIILLF+H+EG++FSP RFAFD+VLRV P++F+KS  +LPE
Sbjct  240  GTYQFSLQVHPDFAGDYNLTIILLFRHHEGLKFSPVRFAFDKVLRVIPIRFSKSSVDLPE  299

Query  127  ISQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
            ISQC +SDL R+VWSGRWTRHAKND+C +   GR+ CQ+P+F
Sbjct  300  ISQCKKSDLVRDVWSGRWTRHAKNDSCPISRDGRYRCQEPNF  341



>ref|XP_009758626.1| PREDICTED: uncharacterized protein LOC104211286 [Nicotiana sylvestris]
Length=623

 Score =   356 bits (914),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 177/345 (51%), Positives = 226/345 (66%), Gaps = 61/345 (18%)
 Frame = -3

Query  862  SSQMSEKGGSF-----RANPRVHWWFKLVVLGACLVILILWGIHSVNLSVINAPKDFVIL  698
            S++M EKG +        NP+V WWFK++ +   L  LI+W  + VN+   +  +DFV+L
Sbjct  3    SAEMPEKGATIGWVMRSNNPKVQWWFKILTMALLLRFLIVWSFYGVNVG--DFQRDFVLL  60

Query  697  KFNGSSKEFRPEFKDFGYSNLQL--------------------PPQDEP-----------  611
            K N S K F P FK+F ++N+ L                    PP+ EP           
Sbjct  61   KVNSSGK-FSPTFKNFSFTNISLRPHSVNTNQNLNQDFVRETLPPKVEPQKIILTENQGN  119

Query  610  ----------------------SGSRIGNWVLAELEDNYSSKLLEGWLTPGGEPCKDSRS  497
                                  S  R+  W+ AELE NYSS LL  WL PGGEPC++SR+
Sbjct  120  APDFSLEIVTNVSHTEPELVEVSRPRVHRWISAELEANYSSNLLTNWLAPGGEPCRESRT  179

Query  496  VGIRVPGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKD  317
            V +++P LD RE +ELSTGDIHEFVF A+D+ G+ HCLGGDYFE DL+GE WKSRP  KD
Sbjct  180  VDVKIPALDGRENVELSTGDIHEFVFHALDDSGKPHCLGGDYFETDLAGETWKSRPTLKD  239

Query  316  LGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAE  137
            LGNGTY+F LQVHPDF GDYN+T+ILLF+HYEG++FSP+RFAFD+VLRV PVKF+KS  E
Sbjct  240  LGNGTYQFSLQVHPDFAGDYNLTVILLFRHYEGLKFSPERFAFDKVLRVIPVKFSKSSVE  299

Query  136  LPEISQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
            LPEISQC +SDL R+VWSGRWTRHAKN++C + N GR+ C++P+F
Sbjct  300  LPEISQCKKSDLVRDVWSGRWTRHAKNNSCPISNDGRYRCEEPNF  344



>ref|XP_010322696.1| PREDICTED: uncharacterized protein LOC101258185 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010322698.1| PREDICTED: uncharacterized protein LOC101258185 isoform X2 [Solanum 
lycopersicum]
Length=615

 Score =   355 bits (910),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 180/339 (53%), Positives = 223/339 (66%), Gaps = 58/339 (17%)
 Frame = -3

Query  853  MSEKGGSF-----RANPRVHWWFKLVVLGACLVILILWGIHSVNLSVINAPKDFVILKFN  689
            M EK G+F       NP+V WWFKL+ +G  L ILI+WGI  V  SV +  +DFV+LK N
Sbjct  1    MPEKAGNFGWGMRSNNPKVQWWFKLLTMGVFLGILIVWGIDGV--SVGSFQRDFVLLKVN  58

Query  688  GSSKEFRPEFKDFGYSNLQLPPQD------------------------------------  617
             SS++F P FKDF ++N+ L P                                      
Sbjct  59   -SSRKFSPGFKDFSFTNISLRPHSVNTQQNLNRDFARKNLAPKVEPQPVNLTGNQGNAPD  117

Query  616  --------------EPSGSRIGNWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVP  479
                          E S   +  W+ AELE NYSS LL  WL PGGEPC+DSR+V +++P
Sbjct  118  FSLEMVSNKELEWVEDSRPGVFRWISAELEANYSSNLLTKWLAPGGEPCRDSRTVDVKIP  177

Query  478  GLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTY  299
             LD RE +ELSTGDIHEFVF A+D+ G+ HCLGGDY+E D+SGE WKSRPP KD GNGTY
Sbjct  178  ALDGRENIELSTGDIHEFVFHALDDSGKPHCLGGDYYETDISGETWKSRPPMKDFGNGTY  237

Query  298  RFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQ  119
            +F LQVHPDF GDYN+TIILLF+H+EG++FSP RFAFD+VLRV P+KF+KS  +LPEISQ
Sbjct  238  QFSLQVHPDFAGDYNLTIILLFRHHEGLKFSPVRFAFDKVLRVIPIKFSKSSVDLPEISQ  297

Query  118  CVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
            C +SDL R+VWSGRWTRHAKND+C +   GR+ CQ+P+F
Sbjct  298  CKKSDLVRDVWSGRWTRHAKNDSCPISRDGRYRCQEPNF  336



>ref|XP_009778776.1| PREDICTED: uncharacterized protein LOC104228073 [Nicotiana sylvestris]
Length=615

 Score =   351 bits (900),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 177/345 (51%), Positives = 221/345 (64%), Gaps = 68/345 (20%)
 Frame = -3

Query  862  SSQMSEKGGSF-----RANPRVHWWFKLVVLGACLVILILWGIHSVNLSVINAPKDFVIL  698
            +SQM EKG +        NP+V WWFKL+ +G  L ILI+WGI  +N+      +DFV+L
Sbjct  3    TSQMPEKGANIGWVMRSNNPKVQWWFKLLTMGVFLGILIVWGIDGLNVGSFQ--RDFVLL  60

Query  697  KFNGSSKEFRPEFKDFGYSNLQLPPQD---------------------------------  617
            K N         FKDF ++N+ L P                                   
Sbjct  61   KVN--------TFKDFSFTNISLRPHSVNTHQNLNQDFSRKNLAPKVEPQQINLTENQGN  112

Query  616  --------------------EPSGSRIGNWVLAELEDNYSSKLLEGWLTPGGEPCKDSRS  497
                                E S  R+  W+ AELE NYSS LL  WL PGGEPC++SR+
Sbjct  113  APDFSLEIVKNVSHKEPELVEVSRPRVHRWISAELEANYSSNLLTNWLAPGGEPCRESRT  172

Query  496  VGIRVPGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKD  317
            V +++P LD R+ +ELSTGDIHEFVF A+D+ G+ HCLGGDYFE DL+GE WKSRP  KD
Sbjct  173  VDVKIPALDGRKNVELSTGDIHEFVFHALDDSGKPHCLGGDYFETDLAGETWKSRPTLKD  232

Query  316  LGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAE  137
            LGNGTY+F LQVHPDF GDYN+T+ILLF+HYEG++FSP+RFAFD+VLRV PVKF+KS  E
Sbjct  233  LGNGTYQFSLQVHPDFAGDYNLTVILLFRHYEGLKFSPERFAFDKVLRVIPVKFSKSSVE  292

Query  136  LPEISQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
            LPEISQC +SDL R+VWSGRWTRHAKN++C + N GR+ CQ+P+F
Sbjct  293  LPEISQCKKSDLVRDVWSGRWTRHAKNNSCPISNDGRYRCQEPNF  337



>ref|XP_009608678.1| PREDICTED: uncharacterized protein LOC104102622 [Nicotiana tomentosiformis]
Length=624

 Score =   351 bits (901),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 171/327 (52%), Positives = 213/327 (65%), Gaps = 55/327 (17%)
 Frame = -3

Query  823  NPRVHWWFKLVVLGACLVILILWGIHSVNLSVINAPKDFVILKFNGSSKEFRPEFKDFGY  644
            NP+V WWFK++ +   L  LI+W  + VN+   N  +D V+LK N SS +F P FKDF +
Sbjct  21   NPKVQWWFKILTMALLLRFLIVWSFYGVNVG--NFQRDLVLLKVNNSSGKFSPTFKDFSF  78

Query  643  SNL--------------------QLPPQDEP-----------------------------  611
            +N+                     L P+ EP                             
Sbjct  79   TNISLRLHSVNTHQNLNQDLARKNLAPKVEPQLINLTENQGNAPDFSLEMVTNVSHKELE  138

Query  610  ----SGSRIGNWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELST  443
                S  R+  W+ AELE NYSS LL  WL PGGEPC++SR+V +++P LD RE +ELS 
Sbjct  139  LVEVSRPRVHRWISAELEANYSSNLLTNWLAPGGEPCRESRTVDVKIPALDGRENVELSA  198

Query  442  GDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHG  263
            GDIHEFVF A+D  G+ HCLGGDYFE DL+GE WKSRPP KDLGNGTY F LQVHPDF G
Sbjct  199  GDIHEFVFHALDYSGKPHCLGGDYFETDLAGETWKSRPPLKDLGNGTYHFSLQVHPDFAG  258

Query  262  DYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWS  83
            DYN+ +ILLF+HYEG+ FSP+RFA+D+VLRV PVKF+KS  ELPEISQC +SDL R+VWS
Sbjct  259  DYNLMVILLFRHYEGLTFSPERFAYDKVLRVIPVKFSKSSVELPEISQCKKSDLVRDVWS  318

Query  82   GRWTRHAKNDTCLVDNGGRFICQDPSF  2
            GRWTRHAKN++C + N GR+ CQ+P+F
Sbjct  319  GRWTRHAKNNSCSISNDGRYRCQEPNF  345



>gb|EYU41540.1| hypothetical protein MIMGU_mgv1a003502mg [Erythranthe guttata]
Length=581

 Score =   339 bits (869),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 166/304 (55%), Positives = 212/304 (70%), Gaps = 22/304 (7%)
 Frame = -3

Query  853  MSEKGGSFR------ANPRVHWWFKLVVLGACLVILILWGIHSVNLSVINAPKDFVILKF  692
            M EK  +F        NP VHWWFK ++ GA L ILI WGI  +N++     KDFV++K 
Sbjct  1    MPEKAPNFAWFFRPPTNPMVHWWFKFMIFGAFLGILIFWGIDGLNINTFQ--KDFVVVKL  58

Query  691  NGSSKEFRPEFKDFGYSNL-------------QLPPQDEPSGSRIGNWVLAELEDNYSSK  551
            N +S+      KD  ++                 P   E       +W+L+ELE NYSS 
Sbjct  59   NNNSETLSQSNKDSNFTTTTPSFPTRQKNISNSTPQVSENYTKDHSSWILSELEANYSSN  118

Query  550  LLEGWLTPGGEPCKDSRSVGIRVPGLD-DREGLELSTGDIHEFVFQAVDEKGQAHCLGGD  374
            LL  WLTPGGEPCKDSR+V I+VP  D + + +ELSTG+IHEFVF A+D+ G  HCLGGD
Sbjct  119  LLSKWLTPGGEPCKDSRTVEIKVPSFDGNDKDIELSTGEIHEFVFHALDDSGAPHCLGGD  178

Query  373  YFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRF  194
            YFEIDLSGEKWKSRPP KD+GNGT+ F LQVHPDF GDYN+TIILLF+HYEG++FSP+RF
Sbjct  179  YFEIDLSGEKWKSRPPVKDVGNGTHAFSLQVHPDFSGDYNLTIILLFRHYEGLKFSPERF  238

Query  193  AFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQ  14
            AFD++LRV P++F KS ++LP I+QC   D +++VWSGRWTRH+KND+C + + GR+ CQ
Sbjct  239  AFDKILRVIPIRFLKSESQLPAINQCRSFDYSKDVWSGRWTRHSKNDSCPISDDGRYRCQ  298

Query  13   DPSF  2
            +P F
Sbjct  299  EPGF  302



>ref|XP_006339765.1| PREDICTED: uncharacterized protein LOC102599208 [Solanum tuberosum]
Length=577

 Score =   335 bits (859),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 167/313 (53%), Positives = 211/313 (67%), Gaps = 44/313 (14%)
 Frame = -3

Query  853  MSEKGGSF----RAN-PRVHWWFKLVVLGACLVILILWGIHSVNLSVINAPKDFVILKFN  689
            MSEK  +F    R+N  ++ WWFKL+ +   L ILI+W I SV++               
Sbjct  1    MSEKSANFGWVMRSNSTKIQWWFKLLTMSVFLGILIVWEIDSVSV---------------  45

Query  688  GSSKEFRPEFKDFGYSNL------------------------QLPPQDEPSGSRIGNWVL  581
            GSS +F P FKDF ++N+                         L  +++ S +R+  W+ 
Sbjct  46   GSSGKFSPTFKDFSFTNIIEYCNFWLNTYQNLAPDFSLEMVTNLSNKEQTSSTRVCRWIS  105

Query  580  AELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQAVDEK  401
            AELE NYSS LL   L PGGE CK SR+V +++P LD RE +ELSTGDIHEFVF A+ + 
Sbjct  106  AELEANYSSNLLTKLLAPGGELCKGSRTVDVKIPALDGRENVELSTGDIHEFVFHALYDS  165

Query  400  GQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQHYE  221
            G+  C GGDYFE D++GE WKSRPP KDLGNG+Y F LQVHPDF GDYN+TIILLF+HYE
Sbjct  166  GKPRCSGGDYFETDITGETWKSRPPIKDLGNGSYLFSLQVHPDFSGDYNLTIILLFRHYE  225

Query  220  GMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAKNDTCLV  41
            G+RF P+RFAFD+VLRV P+KF+KS  ELPEISQC + DL R+VWSGRWTRH KND+CL+
Sbjct  226  GLRFWPERFAFDKVLRVIPIKFSKSAVELPEISQCKKLDLVRDVWSGRWTRHVKNDSCLI  285

Query  40   DNGGRFICQDPSF  2
             N GR+ CQ+P+F
Sbjct  286  SNDGRYRCQEPNF  298



>ref|XP_011090802.1| PREDICTED: uncharacterized protein LOC105171399 isoform X1 [Sesamum 
indicum]
Length=608

 Score =   335 bits (859),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 173/331 (52%), Positives = 215/331 (65%), Gaps = 44/331 (13%)
 Frame = -3

Query  868  IKSSQMSEKGGSF----RANPRVHWWFKLVVLGACLVILILWGIHSVNLSVINA------  719
            + SSQM EK  +F    R+NP V  WFK++++   L ILI+W I   N ++         
Sbjct  1    MSSSQMPEKAANFAWVLRSNPIVLGWFKILMVATFLGILIVWRIDGFNTNIFQKDFLALK  60

Query  718  PKDFVILKFNGSSK-------------------------EFRPEFKDFGYSNLQLP----  626
             KD  IL     SK                         + +P   +   ++ Q+P    
Sbjct  61   SKDTEILSLQADSKLTHQSSGKTHVNLDSNCAPDPINLAQCQPS--NVSNASPQVPENLT  118

Query  625  ---PQDEPSGSRIGNWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGL  455
                 D PS   +  W+ AE E NYSS LL  WLTPGGEPCKDSR+V IRVP LD    +
Sbjct  119  KNQASDSPSTPIVLPWISAEFETNYSSNLLARWLTPGGEPCKDSRTVDIRVPDLDGNTNI  178

Query  454  ELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHP  275
            ELSTGD+HEFVFQA+D+ G  HCLGGDYFE DLSGEKWK+RPP +DLGNGTY F LQVHP
Sbjct  179  ELSTGDVHEFVFQALDDSGMRHCLGGDYFETDLSGEKWKARPPIRDLGNGTYTFSLQVHP  238

Query  274  DFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLAR  95
            DF GDYN+TIILLF+HYEG++FSP RFAFDRVLRV P+KF KS ++LPEI QC +SD ++
Sbjct  239  DFAGDYNLTIILLFRHYEGLKFSPARFAFDRVLRVVPIKFHKSASQLPEIRQCKKSDYSK  298

Query  94   NVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
            +VWSGRWTRHA+ND+C + + GR+ CQ+PSF
Sbjct  299  DVWSGRWTRHARNDSCPISDDGRYRCQEPSF  329



>ref|XP_011071538.1| PREDICTED: uncharacterized protein LOC105156965 [Sesamum indicum]
Length=615

 Score =   332 bits (852),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 167/337 (50%), Positives = 213/337 (63%), Gaps = 56/337 (17%)
 Frame = -3

Query  853  MSEKGGSFR--ANPRVHWWFKLVVLGACLVILILWGIHSVNLSVINAPKDFVILKFNGSS  680
            M EK  +    ++P VHWWFK++V+G     L++WGI   N+S  +  KDFV+ K NGS 
Sbjct  1    MPEKAANLVIGSSPAVHWWFKILVVGVLFGFLVVWGIDGFNMSSFH--KDFVVFKPNGSE  58

Query  679  KEFRPEFKDFGYSNLQLPPQDE--------------------------------------  614
               +P F+D  + NL L P+ E                                      
Sbjct  59   ILPQP-FEDLSFRNLSLEPRVEIPQKIDLDHSHQSLARTVENLDPGIQNQSQDVSNSSPQ  117

Query  613  -------------PSGSRIGNWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGL  473
                         PS   I  W+ +ELE NYS+ LL  WL PGGEPCKDSR+V IR+PGL
Sbjct  118  VSEDLTKEQTVNIPSTPEILPWISSELEANYSANLLAKWLAPGGEPCKDSRTVDIRMPGL  177

Query  472  DDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRF  293
            +    LELSTG++HEFVFQA+D+ G+  CLGGDY E DLSGE+WK+RPP KD+GNG+Y F
Sbjct  178  EGNMDLELSTGEMHEFVFQALDDSGRPRCLGGDYLETDLSGERWKARPPVKDMGNGSYAF  237

Query  292  HLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCV  113
             LQVHPDF GDYN+TIILLF+HYEG+++SP RF FDRVLRV P+KF +S ++LPEI  C 
Sbjct  238  SLQVHPDFAGDYNLTIILLFRHYEGLKYSPARFVFDRVLRVVPIKFIRSESQLPEIRHCK  297

Query  112  RSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
            +SD  ++VWSGRWTRHA+ND+C + N GR+ CQ PSF
Sbjct  298  KSDYTKDVWSGRWTRHARNDSCPISNDGRYRCQKPSF  334



>emb|CDO98992.1| unnamed protein product [Coffea canephora]
Length=627

 Score =   325 bits (833),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 174/350 (50%), Positives = 208/350 (59%), Gaps = 63/350 (18%)
 Frame = -3

Query  868  IKSSQMSEKGGSFR-ANPRVHWWFKLVVLGACLVILILWGIHSVNLSVINAPKDFVILKF  692
            + S  M EK G+F    P VHW FK++++   L +LI   +  + +  +   ++FV LK 
Sbjct  1    MMSPHMPEKVGNFAWIYPTVHWGFKILLMAVFLGMLIFCSMDGIYMGGLQ--RNFVTLKI  58

Query  691  NGSSKEFRPEFKDFG--------------YSNLQ------------LPPQDEPSGSRIGN  590
            N SS       +D                Y NL             L P   P  + +  
Sbjct  59   NNSSTNLTKSLQDLNITDVSQLQPYIRQHYLNLNHTLRNLTKIHEILAPDVAPEPANLAE  118

Query  589  ----------------------------------WVLAELEDNYSSKLLEGWLTPGGEPC  512
                                              WVLAELE NYSSKLL GWL PGGEPC
Sbjct  119  KGVNDTRFDPQALPLFSARKDENLEDTVKPMIIPWVLAELEANYSSKLLSGWLAPGGEPC  178

Query  511  KDSRSVGIRVPGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSR  332
            KDSR+ GI VP LD +E +ELSTGDIHEF  QA+D  G+ HCLGGDYFEIDLSGE WKSR
Sbjct  179  KDSRTEGISVPSLDGQESIELSTGDIHEFRIQALDGFGKHHCLGGDYFEIDLSGENWKSR  238

Query  331  PPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFT  152
            PP  D+GNGTY F LQVHPDF G YN+TIILLF+HYEG++FSP RFA DRVLRVFP+KF 
Sbjct  239  PPITDMGNGTYTFRLQVHPDFEGRYNLTIILLFRHYEGLKFSPARFAIDRVLRVFPIKFQ  298

Query  151  KSRAELPEISQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
            KS A+LPEI QCV+SD  R+VWSGRWTRHAKND+C +   GR+ CQ+P F
Sbjct  299  KSSAQLPEICQCVKSDFVRDVWSGRWTRHAKNDSCPISYDGRYRCQEPLF  348



>ref|XP_004229442.1| PREDICTED: uncharacterized protein LOC101257893 [Solanum lycopersicum]
Length=571

 Score =   316 bits (809),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 157/294 (53%), Positives = 203/294 (69%), Gaps = 12/294 (4%)
 Frame = -3

Query  853  MSEKGGSF----RAN-PRVHWWFKLVVLGACLVILILWGIHSV-----NLSVINAPKDFV  704
            M EK  +F    R+N P++ WWFK++ +     ILI+W I S      +    N  + + 
Sbjct  1    MFEKSANFGWVIRSNSPKIRWWFKILAMILFFGILIVWEIDSSGKFSPDFKFTNVIEYYS  60

Query  703  ILKFNGSSKEFRPEFKDFGYSNLQLPPQDEPSGSRIGNWVLAELEDNYSSKLLEGWLTPG  524
                   ++   P+F     +NL    +++ S +R+  W+ AELE NYSS L++  L PG
Sbjct  61   FWLNTYQNQVHAPDFSLEMVTNLS--NKEQTSSTRVFRWISAELEANYSSSLVKKLLAPG  118

Query  523  GEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEK  344
            GE C+ SR+V + +P LD RE +ELSTGDIHEFVF A+ + G+  C GGDYFE D++GE 
Sbjct  119  GELCRGSRAVDVIIPALDGRENVELSTGDIHEFVFHALYDSGKPRCSGGDYFETDIAGET  178

Query  343  WKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFP  164
            WKSRPP KD GNGTY F LQVHPDF GDYN+TIILLF+HYEG+RF P+RFAFD+VLRV P
Sbjct  179  WKSRPPVKDFGNGTYLFSLQVHPDFSGDYNLTIILLFRHYEGLRFWPERFAFDKVLRVIP  238

Query  163  VKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
            +KF+KS  ELPEISQC +SDL R+VWSGRWTRH KND+CL+ N GR+ CQ P+F
Sbjct  239  IKFSKSLVELPEISQCNKSDLVRDVWSGRWTRHVKNDSCLISNDGRYRCQKPNF  292



>ref|XP_011090803.1| PREDICTED: uncharacterized protein LOC105171399 isoform X2 [Sesamum 
indicum]
Length=578

 Score =   315 bits (806),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 169/206 (82%), Gaps = 0/206 (0%)
 Frame = -3

Query  619  DEPSGSRIGNWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTG  440
            D PS   +  W+ AE E NYSS LL  WLTPGGEPCKDSR+V IRVP LD    +ELSTG
Sbjct  94   DSPSTPIVLPWISAEFETNYSSNLLARWLTPGGEPCKDSRTVDIRVPDLDGNTNIELSTG  153

Query  439  DIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGD  260
            D+HEFVFQA+D+ G  HCLGGDYFE DLSGEKWK+RPP +DLGNGTY F LQVHPDF GD
Sbjct  154  DVHEFVFQALDDSGMRHCLGGDYFETDLSGEKWKARPPIRDLGNGTYTFSLQVHPDFAGD  213

Query  259  YNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSG  80
            YN+TIILLF+HYEG++FSP RFAFDRVLRV P+KF KS ++LPEI QC +SD +++VWSG
Sbjct  214  YNLTIILLFRHYEGLKFSPARFAFDRVLRVVPIKFHKSASQLPEIRQCKKSDYSKDVWSG  273

Query  79   RWTRHAKNDTCLVDNGGRFICQDPSF  2
            RWTRHA+ND+C + + GR+ CQ+PSF
Sbjct  274  RWTRHARNDSCPISDDGRYRCQEPSF  299



>gb|EPS59401.1| hypothetical protein M569_15407, partial [Genlisea aurea]
Length=553

 Score =   286 bits (732),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/282 (51%), Positives = 193/282 (68%), Gaps = 19/282 (7%)
 Frame = -3

Query  829  RANPRVHWWFKLVVLGACLVILILWGIHSVNLSVINAPKDFVILKFNGSSKEFRPEFKDF  650
            R++  V+WWF+++VLG+ +  + +WG+ + +        +FVILK   S      E    
Sbjct  8    RSHSMVNWWFRILVLGSFVAFMTVWGLKTGSFR-----NEFVILKVRDS------EILSN  56

Query  649  GYSNLQLPPQDEPSGSRIGN----WVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRV  482
             Y +L LP  D  + +R  N    W+ +  E NYS  LL  WLTPGGEPCKDS +  I V
Sbjct  57   SYKDLTLP--DFLNFTRYYNQRTHWISSGFEANYSDNLLAKWLTPGGEPCKDSSTAEIVV  114

Query  481  PGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGT  302
            PGLD+   +ELSTGD+H+FVFQA+DE G+ HCLGGDYFE DLS + WKSRPP KDLGNG+
Sbjct  115  PGLDNEFHVELSTGDVHDFVFQALDESGKPHCLGGDYFETDLSSDGWKSRPPVKDLGNGS  174

Query  301  YRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAE-LPEI  125
            YR  LQVHPDF G++N T+ILLF+HYEG++FSP+RF+ D++LRV P++F+ S +  LPE+
Sbjct  175  YRVSLQVHPDFAGEFNFTVILLFRHYEGLKFSPERFSVDKILRVIPIRFSASSSHSLPEL  234

Query  124  SQCVR-SDLARNVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
             QC   SD   +VWSGRWTR A+ND+C +   GR+ CQ+  F
Sbjct  235  RQCRSGSDYLNDVWSGRWTRLARNDSCSISPDGRYRCQEADF  276



>gb|EYU45615.1| hypothetical protein MIMGU_mgv1a004493mg [Erythranthe guttata]
Length=524

 Score =   280 bits (717),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 146/289 (51%), Positives = 180/289 (62%), Gaps = 49/289 (17%)
 Frame = -3

Query  853  MSEKGGSFR-ANPRVHWWFKLVVLGACLVILILWGIHSVNLSVINAPKDFVILKFNGSSK  677
            M EK  +F  +NPRVH WFK++ +   L ILIL G                         
Sbjct  1    MPEKAANFAWSNPRVHQWFKILTIAVFLGILILCG------------------------S  36

Query  676  EFRPEFKDFGYSNLQLPPQDEPSGSRIGNWVLAELEDNYSSKLLEGWLTPGGEPCKDSRS  497
            +  P F      NL              +WV  ELE NYSS LL  WLTPGG PCKDSR+
Sbjct  37   DENPRF------NL--------------SWVSPELEVNYSSNLLTKWLTPGGVPCKDSRT  76

Query  496  VGIRVPGLDDRE--GLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPT  323
            V I++  LD      +ELS G++HEFVFQA+D  G+ HCLGGDYFE DLSG  WKSRPP 
Sbjct  77   VDIKIQSLDSDSDSTIELSAGEVHEFVFQAIDGSGEPHCLGGDYFETDLSGGNWKSRPPI  136

Query  322  KDLGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKF--TK  149
            KD GNGTY   LQ+HPDF G+YN TIILL++H+EG++FSP RF FD+VLRV P+KF  + 
Sbjct  137  KDFGNGTYVVSLQIHPDFAGNYNFTIILLYRHFEGLKFSPARFVFDKVLRVIPIKFVNSN  196

Query  148  SRAELPEISQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
            S + LPE+ QC + D  ++VWSGRWTRHA+N+ C + N GR+ CQ PSF
Sbjct  197  SNSHLPEVEQCKKFDFTKDVWSGRWTRHARNENCRISNDGRYRCQKPSF  245



>gb|EPS66992.1| hypothetical protein M569_07783 [Genlisea aurea]
Length=576

 Score =   280 bits (715),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 152/299 (51%), Positives = 191/299 (64%), Gaps = 16/299 (5%)
 Frame = -3

Query  877  GFKIKSSQMSEKGGSFRANPRVHWW---FK-LVVLGACLVILILWGIHSVNLSVINAPKD  710
            GF  K  Q++  G + R    VHWW   FK L+V G  L +L LW +   ++S      D
Sbjct  3    GFSAK--QVAGGGNTRRNAAAVHWWAAGFKILMVGGVSLGLLALWAVKLRDISA----DD  56

Query  709  FVILKFNGSSKEFRPEF-KDFGYSNLQLPPQDEPSGSRIGNWVLAELEDNYSSKLLEGWL  533
            F  +  N +     P   +DF  S  +     E +GS    W+ A+LE NYSS+LL  WL
Sbjct  57   FDFVVMNVNVSVVVPRRNRDFRNSFTREQQAAEMAGSERLPWISADLEANYSSRLLNSWL  116

Query  532  TPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLS  353
             P   PCK SR+V IRVP +D   G+ELST +IH+FV QAVD+ G+  C GGDYFEIDLS
Sbjct  117  APKDAPCKISRTVDIRVPIVD---GIELSTSEIHDFVIQAVDDSGEPRCSGGDYFEIDLS  173

Query  352  GEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLR  173
            GE WKSRPP KDLGNG Y   L VHPDF GDYN+TIILL++ +EG++FSP RF FDR LR
Sbjct  174  GESWKSRPPVKDLGNGNYTVSLSVHPDFSGDYNLTIILLYRDFEGLKFSPSRFVFDRTLR  233

Query  172  VFPVKFT--KSRAELPEISQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
            V P+KF       +LPE+ +C  +D AR+ WSGRWTRHA+ND+C +   GRF CQ+PSF
Sbjct  234  VIPIKFAPLDPSPQLPELKRCREADFARDAWSGRWTRHARNDSCPISGDGRFRCQEPSF  292



>ref|XP_007034600.1| F28L1.9 protein [Theobroma cacao]
 gb|EOY05526.1| F28L1.9 protein [Theobroma cacao]
Length=626

 Score =   273 bits (699),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 151/196 (77%), Gaps = 0/196 (0%)
 Frame = -3

Query  589  WVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQAV  410
            WV AELE NY+S LL  WL PGGEPCKDS++V I++PGLD    +ELS G+IHEF+FQAV
Sbjct  152  WVSAELEQNYTSNLLARWLAPGGEPCKDSQTVEIKIPGLDGESLVELSAGEIHEFMFQAV  211

Query  409  DEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQ  230
            DE G A CLGGDYFE DLSGE WKSRPP KD GNG+Y   LQVHPDF G+YN+T+ILLF+
Sbjct  212  DESGNARCLGGDYFEADLSGESWKSRPPVKDFGNGSYSVSLQVHPDFAGEYNLTVILLFR  271

Query  229  HYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAKNDT  50
            H++G++FSP RFA+DR LR   ++F +++A L E+  C +SD +++VWSGRWTRH KND 
Sbjct  272  HFQGLKFSPARFAYDRQLRHIGIRFYRTKARLTELPSCQKSDFSKDVWSGRWTRHGKNDD  331

Query  49   CLVDNGGRFICQDPSF  2
            C + N GR+ C    F
Sbjct  332  CQISNDGRYRCLAADF  347



>ref|XP_010255883.1| PREDICTED: uncharacterized protein LOC104596427 [Nelumbo nucifera]
 ref|XP_010255884.1| PREDICTED: uncharacterized protein LOC104596427 [Nelumbo nucifera]
Length=619

 Score =   273 bits (698),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 154/197 (78%), Gaps = 0/197 (0%)
 Frame = -3

Query  592  NWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQA  413
            +W+  ++E N +S LL  WL PGGEPC+DSR+V IR+PGLDD++ +ELS G IHEFV QA
Sbjct  144  SWISVQVEPNLTSNLLSRWLDPGGEPCRDSRTVDIRIPGLDDQKPVELSAGKIHEFVIQA  203

Query  412  VDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLF  233
            +D+ G+  CLGGDYFE DLSGE WK+RPP +DLGNG+Y   LQVHP+F G+YN+T+ILLF
Sbjct  204  LDQSGKPRCLGGDYFETDLSGESWKTRPPVRDLGNGSYSLSLQVHPNFTGEYNLTVILLF  263

Query  232  QHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAKND  53
            +H+EG++FSP RFA+DR LR  PVKF +S A LP+I  C +SD +R+VWSGRWTRH KND
Sbjct  264  RHFEGLKFSPHRFAYDRELRRIPVKFYRSNATLPQIRTCRKSDFSRDVWSGRWTRHGKND  323

Query  52   TCLVDNGGRFICQDPSF  2
             C + N GR+ C +  F
Sbjct  324  DCKISNDGRYRCLNLDF  340



>ref|XP_010278419.1| PREDICTED: uncharacterized protein LOC104612625 [Nelumbo nucifera]
Length=605

 Score =   268 bits (685),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 159/213 (75%), Gaps = 4/213 (2%)
 Frame = -3

Query  637  LQLPPQDEPSGSRIGNWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDR-E  461
            + L     P G R   W+ AELE N++S LL  W   G E C+DS++VGIR+PGLDDR  
Sbjct  117  MSLTQSPAPLGIR---WISAELEPNFTSNLLSRWSASGRETCQDSQTVGIRIPGLDDRNS  173

Query  460  GLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQV  281
             +ELS G+IHEFV QA+DE G+  C+GGDYFE DLSGE WKSRPP +DLGNG+Y F +QV
Sbjct  174  AVELSAGEIHEFVIQALDESGKPRCVGGDYFETDLSGELWKSRPPVRDLGNGSYSFSIQV  233

Query  280  HPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDL  101
            HP + G+YN+T+ILLF+H+EG+RFSP RFA+DR +R  P+KF + +A+L E+  C +SD 
Sbjct  234  HPKYTGEYNLTVILLFRHFEGLRFSPARFAYDRQIRRIPIKFYRRKAQLSELRACEKSDF  293

Query  100  ARNVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
            +R+VWSGRWTRH KNDTC + + GR+ C +P F
Sbjct  294  SRDVWSGRWTRHGKNDTCEISDDGRYRCLNPDF  326



>ref|XP_004168006.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101204185, 
partial [Cucumis sativus]
Length=598

 Score =   268 bits (684),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 139/319 (44%), Positives = 187/319 (59%), Gaps = 34/319 (11%)
 Frame = -3

Query  856  QMSEKG--------GSFRANPRVHWWFKLVVLGACLVILILWGIHSVNLSVI----NAPK  713
            QM EKG           R++P VH  F ++       +L +W I   ++ +     ++P+
Sbjct  2    QMQEKGLLPVTSNPWLLRSSPLVHSRFGVLTALILFSMLAIWSIDGGHIKIFIKAWSSPQ  61

Query  712  DFVILKFNGSSKE---------FRPEFK-DFGYSNLQLPPQDEPSGSR------------  599
            DFV +  N +            ++PE        N  +PPQ+ P   R            
Sbjct  62   DFVSVSSNFTDTHDFNFTPVISYKPEINYQESVLNEPVPPQNAPVEPRRKQSKPAVRHDS  121

Query  598  IGNWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVF  419
              +W  AELE N++S LL  WL PGGEPC+D ++  I + G++    + LSTGD+HEF F
Sbjct  122  FSDWFSAELEPNFTSHLLAQWLAPGGEPCRDLKTTDIAISGMESPAMVTLSTGDVHEFRF  181

Query  418  QAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIIL  239
            QA+DE G   CLGGDYFE DLSG  WKSRP  KD GNGTY F LQVHPDF GDYN+T+IL
Sbjct  182  QALDESGNPRCLGGDYFETDLSGNLWKSRPFVKDFGNGTYSFWLQVHPDFAGDYNLTVIL  241

Query  238  LFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAK  59
            LF+H+EG+RFSP RFA+DR LR   V+F K+   LP+I  C  SD +R++W+GRWTRH +
Sbjct  242  LFRHFEGLRFSPTRFAYDRELRRIKVRFVKNSVVLPKIKMCRSSDFSRDIWTGRWTRHGR  301

Query  58   NDTCLVDNGGRFICQDPSF  2
            ND C + + GR+ C  P +
Sbjct  302  NDRCKISDDGRYRCFAPDY  320



>gb|EYU43834.1| hypothetical protein MIMGU_mgv1a026962mg, partial [Erythranthe 
guttata]
Length=454

 Score =   263 bits (671),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 149/175 (85%), Gaps = 1/175 (1%)
 Frame = -3

Query  523  GEPCKDSRSVGIRVPGLD-DREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGE  347
            GEPCKDSR+V I+VP  D + +G+ELSTG+IHEFVF A+D+ G  HCLGGDYFEIDLSGE
Sbjct  1    GEPCKDSRTVEIKVPSFDGNNKGIELSTGEIHEFVFHALDDSGAPHCLGGDYFEIDLSGE  60

Query  346  KWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVF  167
            KWKSRPP KD+GNGT+ F LQVHPDF G+YN+TIILLF+HYEG++FSP+RFAFD++LRV 
Sbjct  61   KWKSRPPVKDVGNGTHAFSLQVHPDFSGNYNLTIILLFRHYEGLKFSPERFAFDKILRVI  120

Query  166  PVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
            P++F KS ++LP I+QC   D +++VWSGRWTRH+KND+C + + GR+ CQ+P F
Sbjct  121  PIRFLKSESQLPAINQCRSFDYSKDVWSGRWTRHSKNDSCPISDDGRYRCQEPGF  175



>ref|XP_008438725.1| PREDICTED: uncharacterized protein LOC103483748 [Cucumis melo]
Length=600

 Score =   266 bits (681),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 138/308 (45%), Positives = 192/308 (62%), Gaps = 32/308 (10%)
 Frame = -3

Query  832  FRANPRVHWWFKLVVLGACLVILILWGIHSVNLSVI----NAPKDFVILKFNGSSK----  677
             R++P VH  F ++     L ++ +W I   N++ +     +P+DFV +  N ++     
Sbjct  16   LRSSPLVHSRFGVLTALILLSMVAIWSIDGSNINTVIEAWRSPQDFVSVSSNFTNTNTHD  75

Query  676  -------EFRPEFKDFGYSNLQ--LPPQD---EPSGSR---------IGNWVLAELEDNY  560
                    ++PE  +F  S L   +PPQ+   EP  ++         + +W  AELE N+
Sbjct  76   SNFTPVISYKPEI-NFSESVLSEPVPPQNALVEPRRNQSKPAVHHDSVSDWFSAELEPNF  134

Query  559  SSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDRE--GLELSTGDIHEFVFQAVDEKGQAHC  386
            +S LL  WL PGGEPC+D ++  I + G++ +    + LSTGD+HEF FQA+DE G   C
Sbjct  135  TSHLLALWLAPGGEPCRDLKTTDIAISGMESQSPAMVTLSTGDVHEFRFQALDESGNPRC  194

Query  385  LGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFS  206
            LGGDYFE DLSG+ WKSRP  KD GNGTY F LQVHPDF GDYN+T+ILLF+H+EG+RFS
Sbjct  195  LGGDYFETDLSGDLWKSRPFVKDFGNGTYSFWLQVHPDFAGDYNLTVILLFRHFEGLRFS  254

Query  205  PQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGR  26
            P RFA+DR LR   V+F K+   LPEI  C  SD +R++W+GRWTRH +ND C + + GR
Sbjct  255  PTRFAYDRELRRIKVRFVKNSVVLPEIKMCRSSDFSRDIWTGRWTRHGQNDQCEISDDGR  314

Query  25   FICQDPSF  2
            + C  P +
Sbjct  315  YRCFAPDY  322



>gb|KGN57028.1| hypothetical protein Csa_3G150080 [Cucumis sativus]
Length=596

 Score =   266 bits (680),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 134/303 (44%), Positives = 182/303 (60%), Gaps = 26/303 (9%)
 Frame = -3

Query  832  FRANPRVHWWFKLVVLGACLVILILWGIHSVNLSVI----NAPKDFVILKFNGSSKE---  674
             R++P VH  F ++       +L +W I   ++ +     ++P+DFV +  N +      
Sbjct  16   LRSSPLVHSRFGVLTALILFSMLAIWSIDGGHIKIFIKAWSSPQDFVSVSSNFTDTHDFN  75

Query  673  ------FRPEFK-DFGYSNLQLPPQDEPSGSR------------IGNWVLAELEDNYSSK  551
                  ++PE        N  +PPQ+ P   R              +W  AELE N++S 
Sbjct  76   FTPVISYKPEINYQESVLNEPVPPQNAPVEPRRKQSKPAVRHDSFSDWFSAELEPNFTSH  135

Query  550  LLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDY  371
            LL  WL PGGEPC+D ++  I + G++    + LSTGD+HEF FQA+DE G   CLGGDY
Sbjct  136  LLAQWLAPGGEPCRDLKTTDIAISGMESPAIVTLSTGDVHEFRFQALDESGNPRCLGGDY  195

Query  370  FEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFA  191
            FE DLSG  WKSRP  KD GNGTY F LQVHPDF GDYN+T+ILLF+H+EG+RFSP RFA
Sbjct  196  FETDLSGNLWKSRPFVKDFGNGTYSFWLQVHPDFAGDYNLTVILLFRHFEGLRFSPTRFA  255

Query  190  FDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQD  11
            +DR LR   V+F K+   LP+I  C  SD +R++W+GRWTRH +ND C + + GR+ C  
Sbjct  256  YDRELRRIKVRFVKNSVVLPKIKMCRSSDFSRDIWTGRWTRHGRNDRCKISDDGRYRCFA  315

Query  10   PSF  2
            P +
Sbjct  316  PDY  318



>ref|XP_010693916.1| PREDICTED: uncharacterized protein LOC104906799 [Beta vulgaris 
subsp. vulgaris]
Length=637

 Score =   266 bits (679),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 153/212 (72%), Gaps = 1/212 (0%)
 Frame = -3

Query  634  QLPPQDEPSGSRIG-NWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREG  458
            ++ P+DE +    G +WV  ELE N+SS LL  WLTPGGEPCKDSR+V I     DD + 
Sbjct  145  EIDPKDEITNRTYGLDWVSVELEQNFSSNLLSRWLTPGGEPCKDSRTVDIEFVNFDDEKP  204

Query  457  LELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVH  278
              LSTG+ HE VF+A+DE G   CLG DYFEIDLS E WKSRPPTKDLGNGTY   LQVH
Sbjct  205  PVLSTGNAHEVVFRALDESGNPRCLGDDYFEIDLSSELWKSRPPTKDLGNGTYSVTLQVH  264

Query  277  PDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLA  98
            PDF G YN+TI LLF+H++G+++S  RF +D+ LR  PV F+KS A LPE+  C +SD  
Sbjct  265  PDFAGTYNLTIFLLFRHFDGLKYSTARFGYDKQLRQIPVTFSKSEATLPELHVCRKSDFD  324

Query  97   RNVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
            R+VW+GRWTRHAKND C + N GR+ C +P +
Sbjct  325  RDVWTGRWTRHAKNDACEISNDGRYRCLEPDY  356



>ref|XP_004134459.1| PREDICTED: uncharacterized protein LOC101204185 [Cucumis sativus]
Length=589

 Score =   264 bits (675),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 133/301 (44%), Positives = 181/301 (60%), Gaps = 26/301 (9%)
 Frame = -3

Query  826  ANPRVHWWFKLVVLGACLVILILWGIHSVNLSVI----NAPKDFVILKFNGSSKE-----  674
            ++P VH  F ++       +L +W I   ++ +     ++P+DFV +  N +        
Sbjct  11   SSPLVHSRFGVLTALILFSMLAIWSIDGGHIKIFIKAWSSPQDFVSVSSNFTDTHDFNFT  70

Query  673  ----FRPEFK-DFGYSNLQLPPQDEPSGSR------------IGNWVLAELEDNYSSKLL  545
                ++PE        N  +PPQ+ P   R              +W  AELE N++S LL
Sbjct  71   PVISYKPEINYQESVLNEPVPPQNAPVEPRRKQSKPAVRHDSFSDWFSAELEPNFTSHLL  130

Query  544  EGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFE  365
              WL PGGEPC+D ++  I + G++    + LSTGD+HEF FQA+DE G   CLGGDYFE
Sbjct  131  AQWLAPGGEPCRDLKTTDIAISGMESPAIVTLSTGDVHEFRFQALDESGNPRCLGGDYFE  190

Query  364  IDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFD  185
             DLSG  WKSRP  KD GNGTY F LQVHPDF GDYN+T+ILLF+H+EG+RFSP RFA+D
Sbjct  191  TDLSGNLWKSRPFVKDFGNGTYSFWLQVHPDFAGDYNLTVILLFRHFEGLRFSPTRFAYD  250

Query  184  RVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQDPS  5
            R LR   V+F K+   LP+I  C  SD +R++W+GRWTRH +ND C + + GR+ C  P 
Sbjct  251  RELRRIKVRFVKNSVVLPKIKMCRSSDFSRDIWTGRWTRHGRNDRCKISDDGRYRCFAPD  310

Query  4    F  2
            +
Sbjct  311  Y  311



>ref|XP_004296945.1| PREDICTED: uncharacterized protein LOC101292108 [Fragaria vesca 
subsp. vesca]
Length=610

 Score =   264 bits (675),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 148/197 (75%), Gaps = 0/197 (0%)
 Frame = -3

Query  592  NWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQA  413
            +WV A++E N +  LL  WL PGGEPC+D+++V I +PGLD ++ +ELS G+I+EF FQA
Sbjct  134  DWVTAKIEPNVTKNLLAKWLAPGGEPCRDAKTVEIAIPGLDGKDLIELSAGEIYEFGFQA  193

Query  412  VDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLF  233
            +DE  Q  CLGGDYFE DLSGE WKSRP  KD GNG+Y   LQVHPDF G YN+TIILLF
Sbjct  194  LDESKQPRCLGGDYFETDLSGESWKSRPVVKDFGNGSYSVSLQVHPDFVGSYNLTIILLF  253

Query  232  QHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAKND  53
            +H+EG++FSP RFA+DR +R  P++F K  A+LPE+  C  SD  R+VWSGRWTRH KND
Sbjct  254  RHFEGLKFSPSRFAYDREIRRIPIRFYKGSAQLPELQVCKESDFGRDVWSGRWTRHGKND  313

Query  52   TCLVDNGGRFICQDPSF  2
             C + + GR+ C  PSF
Sbjct  314  ECEISHDGRYRCLSPSF  330



>ref|XP_010524790.1| PREDICTED: uncharacterized protein LOC104802744 [Tarenaya hassleriana]
 ref|XP_010524791.1| PREDICTED: uncharacterized protein LOC104802744 [Tarenaya hassleriana]
Length=598

 Score =   264 bits (674),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 138/319 (43%), Positives = 183/319 (57%), Gaps = 35/319 (11%)
 Frame = -3

Query  853  MSEKGGSF----------RANPRVHWWFKLVVLGACLVILILWGIHSVNLSVINAPK--D  710
            M EKGG            R +P   W F  +      +++++W I    +     P   +
Sbjct  1    MPEKGGVLSPATSQVTILRPSPLHQWRFGALTALVFFLMVVVWSIDGCTIKGFIEPWRWN  60

Query  709  FVILKFNGSSKEF--------RPEFKDFGYSNLQLPP----QDEPSGSRIGN--------  590
               ++ + SS            P F    + NL        + EP  +R  N        
Sbjct  61   SYSMRVDASSSSNVTKNHHLQDPTFNTTHHQNLTSDTAHSRKPEPGTTRQQNLPSNLNRG  120

Query  589  ---WVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVF  419
               WV AELE N+++ LL  WL PGGEPC+++R+V I VP +D R+ +EL+TG+IHEF F
Sbjct  121  QLKWVSAELEPNFTANLLGKWLAPGGEPCREARTVEISVPSIDGRDSVELTTGEIHEFYF  180

Query  418  QAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIIL  239
            QA+D+ G+  C+GGDYFE DLSGE WKSRP  KD GNGTY   LQVHPDF GDYN+T+IL
Sbjct  181  QALDDSGKPVCIGGDYFETDLSGENWKSRPLVKDFGNGTYSVSLQVHPDFAGDYNLTVIL  240

Query  238  LFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAK  59
            LF+H+EG++FSP RFAFD+ LR   ++F K+   LPE+  C  SD  R+ WSGRWTRH K
Sbjct  241  LFRHFEGLKFSPTRFAFDKTLRNIRIRFAKADVTLPELRACEASDFTRDAWSGRWTRHGK  300

Query  58   NDTCLVDNGGRFICQDPSF  2
            ND C + N GR+ C    F
Sbjct  301  NDDCQISNDGRYRCLPADF  319



>ref|XP_006489298.1| PREDICTED: uncharacterized protein LOC102628678 [Citrus sinensis]
Length=636

 Score =   260 bits (665),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 123/216 (57%), Positives = 151/216 (70%), Gaps = 10/216 (5%)
 Frame = -3

Query  634  QLPPQDEPSGSRIG----------NWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIR  485
            Q P Q +PSG+              WV  +LE N S+ LL  WL PGGEPC+DSR+V I 
Sbjct  136  QNPLQQKPSGALPNRSESPVLESLKWVSVDLEPNLSTNLLARWLAPGGEPCRDSRTVEIA  195

Query  484  VPGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNG  305
            + GLD  + +ELS GDIHEF FQA+ E G   C+GGDYFE DLSGE WKSRP  KD GNG
Sbjct  196  IHGLDGGKLMELSAGDIHEFHFQALGESGNPRCVGGDYFETDLSGESWKSRPVVKDFGNG  255

Query  304  TYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEI  125
            TY   LQVHPDF GDYN+T+ILLF+H+EG++FSP RF +DR LR  P++F +S+A+LPEI
Sbjct  256  TYLLSLQVHPDFVGDYNLTVILLFRHFEGLKFSPVRFVYDRELRHIPIRFFRSKAQLPEI  315

Query  124  SQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFIC  17
              C +SD  R++WSGRWTRH KND C +   GR+ C
Sbjct  316  KVCQKSDFNRDIWSGRWTRHGKNDDCQISADGRYRC  351



>ref|XP_006419812.1| hypothetical protein CICLE_v10006522mg [Citrus clementina]
 gb|ESR33052.1| hypothetical protein CICLE_v10006522mg [Citrus clementina]
Length=635

 Score =   260 bits (664),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 152/221 (69%), Gaps = 10/221 (5%)
 Frame = -3

Query  634  QLPPQDEPSGSRIG----------NWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIR  485
            Q P Q +PSG+              WV  +LE N S+ LL  WL PGGEPC+DSR+V I 
Sbjct  171  QNPLQQKPSGALPNRSESPVLESLKWVSVDLEPNLSTNLLARWLAPGGEPCRDSRTVEIA  230

Query  484  VPGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNG  305
            + GLD  + +ELS GDIHEF FQA+ E G   C+GGDYFE DLSGE WKSRP  KD GNG
Sbjct  231  IHGLDGGKLMELSAGDIHEFHFQALGESGNPRCVGGDYFETDLSGESWKSRPIVKDFGNG  290

Query  304  TYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEI  125
            TY   LQVHPDF GDYN+T+ILLF+H+EG++FSP RF +DR LR  P++F +S+A+LPEI
Sbjct  291  TYSLSLQVHPDFVGDYNLTVILLFRHFEGLKFSPVRFVYDRELRHIPIRFFRSKAQLPEI  350

Query  124  SQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
              C +SD  R++WSGRWTRH KND C +   GR    D ++
Sbjct  351  KVCQKSDFNRDIWSGRWTRHGKNDDCQISADGRMFSADSAW  391



>ref|XP_002314409.2| hypothetical protein POPTR_0010s03200g [Populus trichocarpa]
 gb|EEF00580.2| hypothetical protein POPTR_0010s03200g [Populus trichocarpa]
Length=625

 Score =   260 bits (664),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 162/249 (65%), Gaps = 3/249 (1%)
 Frame = -3

Query  748  HSVNLSVINAPKDFVILKFNGSSKEFRPEFKDFGYSNLQLPPQDEPSGSRIGNWVLAELE  569
               N +  +AP  F ++  N  S  F     D    N    P    SG  +  WVL ELE
Sbjct  101  QETNNNNTSAPPRFNMVLNNDKSVSFPQNHSDGVLENP--APGRHQSGGNV-KWVLTELE  157

Query  568  DNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQAVDEKGQAH  389
             N ++ LL  WL  GGEPC++SR+V I +PGLDD++ +EL+ GD HEF FQA+DE     
Sbjct  158  PNLTAYLLSRWLASGGEPCRESRTVEIVIPGLDDKDLIELTAGDRHEFGFQALDESNNLV  217

Query  388  CLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRF  209
            CLGGDYFE DLSGE WKSRP  +D GNG+Y   LQVHPDF GDYN+T+ILL++H+EG++F
Sbjct  218  CLGGDYFETDLSGETWKSRPLVRDFGNGSYSISLQVHPDFAGDYNLTVILLYRHFEGLKF  277

Query  208  SPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAKNDTCLVDNGG  29
            SP RFAFD+ LR F +KF K   +LP+I  C +SD  R++W GRWTR+ KND C + N G
Sbjct  278  SPWRFAFDKQLRKFQIKFVKGHTQLPKIKTCQKSDFIRDLWLGRWTRYGKNDGCQISNDG  337

Query  28   RFICQDPSF  2
            R+ C  P F
Sbjct  338  RYRCLAPDF  346



>ref|XP_007154129.1| hypothetical protein PHAVU_003G092800g [Phaseolus vulgaris]
 gb|ESW26123.1| hypothetical protein PHAVU_003G092800g [Phaseolus vulgaris]
Length=572

 Score =   258 bits (660),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 122/277 (44%), Positives = 172/277 (62%), Gaps = 4/277 (1%)
 Frame = -3

Query  820  PRVHWWFKLVVLGACLVILILWGIHSVNLSVI----NAPKDFVILKFNGSSKEFRPEFKD  653
            P +HW   L+     + ++++W I    +  I       +D++ ++F+  +      +  
Sbjct  17   PMLHWRVGLLTALVLVGMVVIWSIDGCTIKSIIQVWRYQQDYLAVRFHTPNLTLVSPYSP  76

Query  652  FGYSNLQLPPQDEPSGSRIGNWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGL  473
              ++  + P        R  +W+ +ELE N++S L+  W   GG PCKDS++V I VPGL
Sbjct  77   VNFTLYEKPGNKSLLLERHTSWISSELEPNFTSNLIARWSARGGVPCKDSKAVEIAVPGL  136

Query  472  DDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRF  293
            D  E +ELS GD+HEF FQA+D+ G   CLGGDYFE DLSGE WKSRP  KD  NG+Y  
Sbjct  137  DGGEVIELSAGDVHEFGFQALDDSGNPRCLGGDYFEADLSGESWKSRPLVKDFSNGSYSI  196

Query  292  HLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCV  113
             +QVHPDF G YN+TIILL++H+EG++F+P RF++DR+LR   ++F K   +LPE+  C 
Sbjct  197  LVQVHPDFDGVYNLTIILLYRHFEGLKFTPWRFSYDRMLRNVAIRFYKISVQLPELQACK  256

Query  112  RSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
             SD  R+VWSGRWTRH KND C + N GR+ C    F
Sbjct  257  ASDFGRDVWSGRWTRHGKNDDCAIGNDGRYRCLGSDF  293



>ref|XP_011013027.1| PREDICTED: uncharacterized protein LOC105117158 [Populus euphratica]
 ref|XP_011015140.1| PREDICTED: uncharacterized protein LOC105118796 [Populus euphratica]
Length=629

 Score =   259 bits (662),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/249 (51%), Positives = 162/249 (65%), Gaps = 3/249 (1%)
 Frame = -3

Query  748  HSVNLSVINAPKDFVILKFNGSSKEFRPEFKDFGYSNLQLPPQDEPSGSRIGNWVLAELE  569
               N +  +AP  F ++  N  +  F     D    N    P    SG  +  WVL ELE
Sbjct  105  QETNNNNTSAPPRFNMVLNNDKNVSFPQNHSDGVLENP--APGRHQSGGNV-KWVLTELE  161

Query  568  DNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQAVDEKGQAH  389
             N ++ LL  WL  GGEPC++SR+V I +PGLDD++ +EL+ GD HEF FQA+DE     
Sbjct  162  PNLTAYLLSRWLASGGEPCRESRTVEIVIPGLDDKDSIELTAGDRHEFGFQALDESKNLV  221

Query  388  CLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRF  209
            CLGGDYFE DLSGE WKSRP  +D GNG+Y   LQVHPDF GDYN+T+ILL++H+EG++F
Sbjct  222  CLGGDYFETDLSGETWKSRPLVRDFGNGSYSISLQVHPDFAGDYNLTVILLYRHFEGLKF  281

Query  208  SPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAKNDTCLVDNGG  29
            SP RFAFD+ LR F +KF K   +LP+I  C +SD  R++W GRWTR+ KND C + N G
Sbjct  282  SPWRFAFDKQLRKFQIKFVKGHTQLPKIKTCQKSDFIRDLWLGRWTRYGKNDGCQISNDG  341

Query  28   RFICQDPSF  2
            R+ C  P F
Sbjct  342  RYRCLAPDF  350



>ref|XP_010548780.1| PREDICTED: uncharacterized protein LOC104820105 [Tarenaya hassleriana]
Length=642

 Score =   259 bits (662),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/312 (42%), Positives = 180/312 (58%), Gaps = 29/312 (9%)
 Frame = -3

Query  853  MSEKGGS------FRANPRVHWWFKLVVLGACLVILILWGIHSVNLSVINAPKDFVILKF  692
            M EKG         R +P  HW F  +      +++++W I    +     P  + +   
Sbjct  1    MPEKGAIPSPAAILRPSPLHHWRFGALTALVFFLMVVVWSIDGCTIRGFIQPWRWNVDSM  60

Query  691  NGSSKEFR----------PEFKDFGYSNL------------QLPPQDEPSGSRIGNWVLA  578
              ++  F           P F    + NL             L  + +PS +++  WVL 
Sbjct  61   RANASSFSSVIVKNHLQDPTFNTTRHRNLTPDTTHSATRQRNLTSKSKPSPTQL-KWVLP  119

Query  577  ELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQAVDEKG  398
            ELE N+++ LL+ WL PGG+PC+++R+V I VP +D ++ +EL+ G+IHE  FQA+D+ G
Sbjct  120  ELEQNFTTNLLKKWLAPGGQPCREARTVEISVPDIDGKDLVELTAGEIHELNFQALDDSG  179

Query  397  QAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEG  218
               CLGGDYFE DLSGE WKSRPP KD GNGTY   LQVHPDF GDYN+T+ILLF+H+EG
Sbjct  180  TPVCLGGDYFETDLSGENWKSRPPVKDFGNGTYSVSLQVHPDFAGDYNLTVILLFRHFEG  239

Query  217  MRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAKNDTCLVD  38
            ++FS  RFAFD+ LR   ++F K+   LPE+  C  SD  R+ WSGRWTRH  N  C + 
Sbjct  240  LKFSSSRFAFDKKLRNTRIRFAKAEVTLPELMACGPSDFTRDAWSGRWTRHGSNGECQIS  299

Query  37   NGGRFICQDPSF  2
            + GR+ C    F
Sbjct  300  DDGRYRCLAADF  311



>ref|XP_006400461.1| hypothetical protein EUTSA_v10013116mg [Eutrema salsugineum]
 gb|ESQ41914.1| hypothetical protein EUTSA_v10013116mg [Eutrema salsugineum]
Length=569

 Score =   257 bits (657),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/296 (43%), Positives = 179/296 (60%), Gaps = 20/296 (7%)
 Frame = -3

Query  868  IKSSQMSEKGGSFRANPRVHWWFKLVVLGACLVILILWGIHSVNLSV------INAPKDF  707
            I S  +S+   + R +P   W F  +      ++++LW I    +        +NA   +
Sbjct  7    IPSPALSQVMNNHRLSPLHQWRFGALTSLVFFLMILLWSIDGCTIKSFVESWRLNA---Y  63

Query  706  VILKFNGSSKEFRPEFKDFGYSNLQLPPQDEPSGSRIGNWVLAELEDNYSSKLLEGWLTP  527
             +     SS   +P          + P  D  +     +W+  E+E N+++ LL  WL P
Sbjct  64   SMRVTASSSSSLKP----------KTPSLDLDTTRVKFDWISVEMEQNFTANLLRNWLAP  113

Query  526  GGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGE  347
            GG+ C+++++V I VP +D ++ +EL+ G IHEF FQ+VDE G+  C+GGDYFE DLSGE
Sbjct  114  GGDNCREAKTVEIFVPSIDGKDSVELTAGKIHEFSFQSVDESGKPVCIGGDYFETDLSGE  173

Query  346  KWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVF  167
             WKSRPP KDL NGTY F LQ+HPDF GDYN+T++LLF+H++G++ SP RFAFDR LR F
Sbjct  174  NWKSRPPVKDLNNGTYSFSLQIHPDFAGDYNLTVVLLFRHFQGLKLSPARFAFDRELRRF  233

Query  166  PVKFTKS-RAELPEISQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
             ++F K     LPE+ +C RSD  RNVWSGRWTR  KND C++   GR+ C    F
Sbjct  234  KLRFVKKPDVVLPELRKCDRSDFVRNVWSGRWTRLVKNDKCVISYDGRYRCLAADF  289



>ref|XP_002277614.1| PREDICTED: uncharacterized protein LOC100244329 [Vitis vinifera]
Length=629

 Score =   258 bits (660),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 143/192 (74%), Gaps = 0/192 (0%)
 Frame = -3

Query  592  NWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQA  413
            +W+  ELE N +S LL  WL PGGEPC+D RSV I +PGLD R+ +ELS  ++HEFVF A
Sbjct  155  SWISVELEPNLTSNLLARWLAPGGEPCRDIRSVEIAIPGLDGRQSIELSAAEVHEFVFHA  214

Query  412  VDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLF  233
            +D+ G+  CLGGDYFE DLSGE WKSRP  KD GNG+Y   LQVHPDF G+YN++I LLF
Sbjct  215  LDDAGKPLCLGGDYFETDLSGEIWKSRPVVKDFGNGSYSLSLQVHPDFAGNYNLSITLLF  274

Query  232  QHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAKND  53
            +H+EG++ SP RFA+DR LR  P+KF  + A+LPE+  C +SD  R VWSGRWTRH +ND
Sbjct  275  RHFEGLKLSPGRFAYDRELRRIPIKFYNTTAQLPELQTCRKSDFTREVWSGRWTRHGRND  334

Query  52   TCLVDNGGRFIC  17
             C + N GR+ C
Sbjct  335  DCQISNDGRYRC  346



>ref|XP_004508371.1| PREDICTED: uncharacterized protein LOC101497658 [Cicer arietinum]
Length=573

 Score =   256 bits (655),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 126/283 (45%), Positives = 171/283 (60%), Gaps = 12/283 (4%)
 Frame = -3

Query  814  VHWWFKLVVLGACLVILILWGIHSVNLSVI------NAP------KDFVILKFNGSSKEF  671
            +HW   L+ +     + I+W I+  N+  +      ++P      ++   L  + +    
Sbjct  12   LHWRVGLLTVFFLFGMFIVWSINGCNVKNVFQVYLPHSPNFTISHQNLFTLSLDQNQSNI  71

Query  670  RPEFKDFGYSNLQLPPQDEPSGSRIGNWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVG  491
                     +     P+      R  +W+ +ELE N SS LL  WL  GGEPC+DS++V 
Sbjct  72   NRTHVSVNITLSDKKPKSFDLVKRSSSWISSELEVNLSSNLLARWLARGGEPCRDSKTVE  131

Query  490  IRVPGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLG  311
            I +PGLD    +ELS+GDIHEF FQA+D+ G+  CLGGDYFE DLSGE WKSRP  KD  
Sbjct  132  IEIPGLDGGNLIELSSGDIHEFTFQALDDSGKPRCLGGDYFETDLSGESWKSRPLVKDFS  191

Query  310  NGTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELP  131
            NG+Y   LQVHPDF G YN+TIILL++H+EG++F+P RF +DRVLR F ++F KS   +P
Sbjct  192  NGSYSISLQVHPDFVGVYNLTIILLYRHFEGLKFTPWRFVYDRVLRSFAIRFYKSDVRIP  251

Query  130  EISQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
            E+  C  +D +R+VW GRWTRH KND C V N GR+ C    F
Sbjct  252  ELQTCKAADFSRDVWCGRWTRHGKNDECSVGNDGRYRCLASDF  294



>ref|XP_003541632.1| PREDICTED: uncharacterized protein LOC100811844 [Glycine max]
Length=621

 Score =   258 bits (658),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 123/253 (49%), Positives = 168/253 (66%), Gaps = 6/253 (2%)
 Frame = -3

Query  748  HSVNLSVINAPKDFVILKFNGSSKEFRPE-FKDFGYSN---LQLPPQDEPSGSRIGNWVL  581
            +  N + +  P + V +  +  S+    + +   G S+    + P + E  G     W+ 
Sbjct  92   NQTNATTLFGPHNLVNITLSEHSETVSAKNYSSSGVSDKLDTKTPLKPEVKGH--STWLS  149

Query  580  AELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQAVDEK  401
            +ELE N +S LL  WL PGGEPCKDS++VGI +PGLDD + +ELS G++HEF FQA+D+ 
Sbjct  150  SELEPNLTSSLLARWLAPGGEPCKDSKTVGISIPGLDDGKLIELSAGEVHEFGFQALDDL  209

Query  400  GQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQHYE  221
            G+  CLGGDYFE DL+GE WKSRP  KD  NG+Y   LQVHPDF G YN+T+ILL++H+E
Sbjct  210  GKPRCLGGDYFETDLAGESWKSRPLVKDFSNGSYSISLQVHPDFVGVYNLTVILLYRHFE  269

Query  220  GMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAKNDTCLV  41
            G++F+P RF +DRV+    ++F KS A+LPE+  C  SD  ++VW GRWTRHAKND C +
Sbjct  270  GLKFTPWRFVYDRVVWNVAIRFYKSSAQLPELETCKASDFGKDVWCGRWTRHAKNDGCQI  329

Query  40   DNGGRFICQDPSF  2
             N GR+ C  P F
Sbjct  330  GNDGRYRCLAPDF  342



>gb|KHN37568.1| hypothetical protein glysoja_007271 [Glycine soja]
Length=621

 Score =   257 bits (657),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 123/253 (49%), Positives = 168/253 (66%), Gaps = 6/253 (2%)
 Frame = -3

Query  748  HSVNLSVINAPKDFVILKFNGSSKEFRPE-FKDFGYSN---LQLPPQDEPSGSRIGNWVL  581
            +  N + +  P + V +  +  S+    + +   G S+    + P + E  G     W+ 
Sbjct  92   NQTNATTLFGPHNLVNITLSEHSETVSAKNYSSSGVSDKLDTKTPLKPEVKGH--STWLS  149

Query  580  AELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQAVDEK  401
            +ELE N +S LL  WL PGGEPCKDS++VGI +PGLDD + +ELS G++HEF FQA+D+ 
Sbjct  150  SELEPNLTSSLLARWLAPGGEPCKDSKTVGISIPGLDDGKLIELSAGEVHEFGFQALDDL  209

Query  400  GQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQHYE  221
            G+  CLGGDYFE DL+GE WKSRP  KD  NG+Y   LQVHPDF G YN+T+ILL++H+E
Sbjct  210  GKPRCLGGDYFETDLAGESWKSRPLVKDFSNGSYSISLQVHPDFVGVYNLTVILLYRHFE  269

Query  220  GMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAKNDTCLV  41
            G++F+P RF +DRV+    ++F KS A+LPE+  C  SD  ++VW GRWTRHAKND C +
Sbjct  270  GLKFTPWRFVYDRVVWNVAIRFYKSSAQLPELETCKASDFGKDVWCGRWTRHAKNDGCQI  329

Query  40   DNGGRFICQDPSF  2
             N GR+ C  P F
Sbjct  330  GNDGRYRCLAPDF  342



>ref|XP_007147773.1| hypothetical protein PHAVU_006G154000g [Phaseolus vulgaris]
 gb|ESW19767.1| hypothetical protein PHAVU_006G154000g [Phaseolus vulgaris]
Length=618

 Score =   256 bits (655),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 149/205 (73%), Gaps = 0/205 (0%)
 Frame = -3

Query  616  EPSGSRIGNWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGD  437
            +P  + +  W+ +ELE N +S LL  WL PGGEPCKDS++V I +PGLDD + +ELS G+
Sbjct  135  KPELNGLSTWLSSELEPNLTSSLLARWLAPGGEPCKDSKTVRISMPGLDDGKLIELSAGE  194

Query  436  IHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDY  257
            +HEF FQA+D+ G+  CLGGDYFE DLSG+ WKSRPP KD  NG+Y   LQVHPDF G Y
Sbjct  195  VHEFFFQALDDSGKPRCLGGDYFETDLSGDSWKSRPPVKDFSNGSYSISLQVHPDFVGVY  254

Query  256  NVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGR  77
            N+T+ILL++H+EG++F+P RF +DRV+    + F  S A+LPE+  C  SD  ++VWSGR
Sbjct  255  NLTVILLYRHFEGLKFTPWRFVYDRVVWSVAIGFYSSIAQLPELETCKASDFGKDVWSGR  314

Query  76   WTRHAKNDTCLVDNGGRFICQDPSF  2
            WTRH KND C + N GR+ C  P F
Sbjct  315  WTRHGKNDDCKIGNDGRYRCLAPDF  339



>ref|XP_010024421.1| PREDICTED: uncharacterized protein LOC104414900 [Eucalyptus grandis]
 gb|KCW60865.1| hypothetical protein EUGRSUZ_H03601 [Eucalyptus grandis]
Length=618

 Score =   255 bits (652),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 147/199 (74%), Gaps = 0/199 (0%)
 Frame = -3

Query  598  IGNWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVF  419
            + +WV ++LE N+SS LL  WL PGGEPC+DSR+  I +PG+D +  +ELS G +HEF F
Sbjct  141  VQDWVSSQLEPNFSSNLLARWLAPGGEPCRDSRTEEIAIPGIDGKGLIELSAGPVHEFSF  200

Query  418  QAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIIL  239
             A+D  G + CLGGDYFE DLSGE WKSRP  KD  NG+Y   LQVHPDF GDYN+TIIL
Sbjct  201  AALDGAGNSRCLGGDYFETDLSGESWKSRPLVKDFSNGSYTVSLQVHPDFVGDYNLTIIL  260

Query  238  LFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAK  59
            L++H+EG+RFSP RF FDR LR   ++F KS+A+LPE+  C +SD +++VW GRWTRH K
Sbjct  261  LYRHFEGLRFSPGRFVFDRELRKVSIRFYKSKAKLPELHLCGKSDFSKDVWFGRWTRHGK  320

Query  58   NDTCLVDNGGRFICQDPSF  2
            ND C + N GR+ C  P +
Sbjct  321  NDDCQISNDGRYRCLPPDY  339



>ref|XP_009120923.1| PREDICTED: uncharacterized protein LOC103845788 [Brassica rapa]
Length=565

 Score =   254 bits (649),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/283 (43%), Positives = 179/283 (63%), Gaps = 20/283 (7%)
 Frame = -3

Query  829  RANPRVHWWFKLVVLGACLVILILWGIHSVNLSV------INAPKDFVILKFNGSSKEFR  668
            R +P   W F ++      +++I+W I    +        +NA     +   + S+K  +
Sbjct  16   RPSPLHQWRFSVLTSLVFFLMVIVWSIDGCTIKTFIDSWRLNASYSMRVTASSPSAKP-K  74

Query  667  PEFKDFGYSNLQLPPQDEPSGSRIGNWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGI  488
            P   D   + ++             NW+ +E+E N+++ LL+ W  PGGE C+++++V I
Sbjct  75   PHSLDLDTTQVKF------------NWISSEMEQNFTANLLKNWSAPGGEKCREAKTVEI  122

Query  487  RVPGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGN  308
             VP LD ++ + L+ G+IHEF FQ++DE G+  C+GGDYFE DLSGE WKSRPP KDL N
Sbjct  123  SVPNLDGKDPVHLTAGEIHEFRFQSLDETGKPVCVGGDYFETDLSGENWKSRPPVKDLTN  182

Query  307  GTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFT-KSRAELP  131
            GTY   LQ+HP+F GDYN+T+ILLF+H++G++ SP RFAF+R LR F ++F  K+   LP
Sbjct  183  GTYSVSLQIHPEFAGDYNLTVILLFRHFQGLKLSPARFAFNRKLRSFKLRFVEKNDVVLP  242

Query  130  EISQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
            ++ QCV+SD AR VWSGRWTR  KN+ C + N GR+ C D +F
Sbjct  243  DLRQCVKSDFAREVWSGRWTRLGKNNECKISNDGRYRCLDDNF  285



>emb|CDY13947.1| BnaC09g38790D [Brassica napus]
Length=560

 Score =   253 bits (647),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 121/280 (43%), Positives = 177/280 (63%), Gaps = 14/280 (5%)
 Frame = -3

Query  835  SFRANPRVHWWFKLVVLGACLVILILWGIHSVNL-SVINAPKDFVILKFNGSSKEFRPEF  659
            S R +P   W F ++      +++I+W I    + + I++ +         ++ + +P  
Sbjct  13   SHRPSPLHQWRFSVLTSLVFFLMVIVWSIDGCTIKTFIDSWRLNASYSMRVTAAKPKPHS  72

Query  658  KDFGYSNLQLPPQDEPSGSRIGNWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVP  479
             D   + ++             +W+  E+E N+++ LL+ W  PGGE C+++++V I VP
Sbjct  73   LDLDTTRVKF------------DWISTEMEQNFTANLLKNWSAPGGEKCREAKTVEISVP  120

Query  478  GLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTY  299
              D ++ + L+ G+IHEF FQ++DE G+  C+GGDYFE DLSGE WKSRPP KDL NGTY
Sbjct  121  NFDGKDPVHLTAGEIHEFRFQSLDESGKPVCVGGDYFETDLSGENWKSRPPVKDLTNGTY  180

Query  298  RFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSR-AELPEIS  122
               LQ+HP+F GDYN+T+ILLF+H++G++ SP RFAF+R LR F ++F K     LPE+ 
Sbjct  181  SVSLQIHPEFAGDYNLTVILLFRHFQGLKLSPARFAFNRKLRNFKLRFVKKNDVVLPELR  240

Query  121  QCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
            QCVRSD AR+VWSGRWTR  KND C + N GR+ C D  F
Sbjct  241  QCVRSDFARDVWSGRWTRLGKNDECKISNDGRYRCLDDDF  280



>emb|CDX92561.1| BnaA10g16000D [Brassica napus]
Length=565

 Score =   251 bits (641),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 121/283 (43%), Positives = 178/283 (63%), Gaps = 20/283 (7%)
 Frame = -3

Query  829  RANPRVHWWFKLVVLGACLVILILWGIHSVNLSV------INAPKDFVILKFNGSSKEFR  668
            R +P   W F ++      +++I+W I    +        +NA     +   + S+K  +
Sbjct  16   RPSPLHQWRFSVLTSLVFFLMVIVWSIDGCTIKTFIDSWRLNASYSMRVTASSPSAKP-K  74

Query  667  PEFKDFGYSNLQLPPQDEPSGSRIGNWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGI  488
            P   D   + ++             NW+ +E+E N+++ LL+ W  PGGE C+++++V I
Sbjct  75   PHSLDLDTTQVKF------------NWISSEMEQNFTANLLKNWSAPGGEKCREAKTVEI  122

Query  487  RVPGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGN  308
             VP LD ++ + L+ G+IHEF FQ++DE G+  C+GGDYFE DLSG  WKSRPP KDL N
Sbjct  123  SVPNLDGKDPVHLTAGEIHEFRFQSLDETGKPVCVGGDYFETDLSGGNWKSRPPVKDLTN  182

Query  307  GTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFT-KSRAELP  131
            GTY   LQ+HP+F GDYN+T+ILLF+H++G++ SP RFAF+R LR F ++F  K+   LP
Sbjct  183  GTYSVSLQIHPEFAGDYNLTVILLFRHFQGLKLSPARFAFNRKLRSFKLRFVEKNDVVLP  242

Query  130  EISQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
            E+ QCV+SD  R+VWSGRWTR  KND C + + GR+ C D +F
Sbjct  243  ELRQCVKSDFGRDVWSGRWTRLGKNDECKISDDGRYRCLDDNF  285



>gb|KHN03046.1| hypothetical protein glysoja_009912 [Glycine soja]
Length=569

 Score =   251 bits (640),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 123/277 (44%), Positives = 175/277 (63%), Gaps = 7/277 (3%)
 Frame = -3

Query  820  PRVHWWFKLVVLGACLVILILWGIHSVNL-SVINA---PKDFVILKFNGSSKEFRPEFKD  653
            P +HW   L+     + ++++W I    + ++I A    +D++ +K +  +  F   +  
Sbjct  17   PMLHWRVGLLTALVMVGMVVVWSIDGCTVKNIIQAWRYQQDYLAVKSHTPNLTFVSPYSP  76

Query  652  FGYSNLQLPPQDEPSGSRIGNWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGL  473
              ++     P      +   +WV +ELE N +S L+  W   GGEPCKDS++V I +PGL
Sbjct  77   VNFTVYGKKPLLVKGHA---SWVSSELEPNLTSNLIARWSARGGEPCKDSKAVEIAIPGL  133

Query  472  DDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRF  293
            D  E +ELS GD+HEF FQA+D+ G+  C+GGDYFE DLSG+ WKSRP  KD  NG+Y  
Sbjct  134  DGGEVIELSAGDVHEFGFQALDDSGKPLCVGGDYFETDLSGDSWKSRPLVKDFSNGSYLI  193

Query  292  HLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCV  113
             LQVHPDF G YN+TIILL++H+EG++F+P RF++D++LR   ++F KS   LPE+  C 
Sbjct  194  SLQVHPDFDGVYNLTIILLYRHFEGLKFTPWRFSYDQMLRSVAIRFYKSSVRLPELQGCK  253

Query  112  RSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
             SD  R+VW GRWTRH KND C + N GR+ C  P F
Sbjct  254  ASDFDRDVWIGRWTRHGKNDDCTIGNDGRYRCLAPDF  290



>ref|XP_003547239.1| PREDICTED: uncharacterized protein LOC100785350 [Glycine max]
 gb|KHN33066.1| hypothetical protein glysoja_010057 [Glycine soja]
Length=621

 Score =   252 bits (643),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 145/197 (74%), Gaps = 0/197 (0%)
 Frame = -3

Query  592  NWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQA  413
             W+  ELE + +S LL  WL PGGEPCKDS++VGI +PGLD  + +ELS GD+HEF FQA
Sbjct  146  TWLSRELEPDLTSNLLARWLAPGGEPCKDSKTVGISIPGLDGGKLIELSAGDVHEFGFQA  205

Query  412  VDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLF  233
            +D+ G+ HCLGGDYFE DLSG+ WKSRP  KD  NG+Y   LQVHPDF G YN+TIILL+
Sbjct  206  LDDSGKPHCLGGDYFETDLSGDAWKSRPLVKDFCNGSYSISLQVHPDFVGVYNLTIILLY  265

Query  232  QHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAKND  53
            +H+EG++F+P RF +DRV+    ++F KS A+L E+  C  SD  ++VW GRWTRH +ND
Sbjct  266  RHFEGLKFTPWRFVYDRVVWNVAIRFYKSSAQLLELETCKASDFGKDVWCGRWTRHGRND  325

Query  52   TCLVDNGGRFICQDPSF  2
             C + N GR+ C  PSF
Sbjct  326  DCQIGNDGRYRCLAPSF  342



>ref|NP_187266.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF30308.1|AC018907_8 unknown protein [Arabidopsis thaliana]
 gb|AEE74353.1| uncharacterized protein AT3G06150 [Arabidopsis thaliana]
Length=594

 Score =   249 bits (637),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/250 (47%), Positives = 161/250 (64%), Gaps = 23/250 (9%)
 Frame = -3

Query  748  HSVNLSVINAPKDFVILKFNGSSKEFRPEFKDFGYSNLQLPPQDEPSGSRIGNWVLAELE  569
            H  NL+++ AP++ V  K N +S   R +F+                      W+ A  +
Sbjct  86   HRQNLTLMMAPRNLVPKKTNLTSNSTRVQFE----------------------WITAGSQ  123

Query  568  DNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQAVDEKGQAH  389
             N+++ L+ GWL PGG PC+++++V I VPG+D  + +EL+ G+IHEF FQA+DE G+  
Sbjct  124  KNFTANLMRGWLAPGGAPCREAKTVEISVPGVDGIDSVELTAGEIHEFKFQAIDESGKNV  183

Query  388  CLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRF  209
            C+GGDYFE D+SGE WKSRPP KD GNGTY F LQVHP+F GD+N+T+ILLF+HY+G++F
Sbjct  184  CIGGDYFETDISGENWKSRPPVKDFGNGTYSFSLQVHPEFAGDFNLTVILLFRHYQGLKF  243

Query  208  SPQRFAFDRVLRVFPVKFTKS-RAELPEISQCVRSDLARNVWSGRWTRHAKNDTCLVDNG  32
            S  R  FDR LR   ++F K+    LPE+  C +SD  R+ WSGRWTR  KND C + N 
Sbjct  244  STSRLGFDRKLRNVRLRFVKTPDVTLPELRSCKKSDFNRDAWSGRWTRLGKNDECQISND  303

Query  31   GRFICQDPSF  2
            GR+ C    F
Sbjct  304  GRYRCLAADF  313



>ref|XP_003528671.2| PREDICTED: uncharacterized protein LOC100783018 [Glycine max]
Length=668

 Score =   251 bits (641),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/277 (44%), Positives = 175/277 (63%), Gaps = 7/277 (3%)
 Frame = -3

Query  820  PRVHWWFKLVVLGACLVILILWGIHSVNL-SVINA---PKDFVILKFNGSSKEFRPEFKD  653
            P +HW   L+     + ++++W I    + ++I A    +D++ +K +  +  F   +  
Sbjct  116  PMLHWRVGLLTALVMVGMVVVWSIDGCTVKNIIQAWRYQQDYLAVKSHTPNLTFVSPYSP  175

Query  652  FGYSNLQLPPQDEPSGSRIGNWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGL  473
              ++     P      +   +WV +ELE N +S L+  W   GGEPCKDS++V I +PGL
Sbjct  176  VNFTVYGKKPLLVKGHA---SWVSSELEPNLTSNLIARWSARGGEPCKDSKAVEIAIPGL  232

Query  472  DDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRF  293
            D  E +ELS GD+HEF FQA+D+ G+  C+GGDYFE DLSG+ WKSRP  KD  NG+Y  
Sbjct  233  DGGEVIELSAGDVHEFGFQALDDSGKPLCVGGDYFETDLSGDSWKSRPLVKDFSNGSYLI  292

Query  292  HLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCV  113
             LQVHPDF G YN+TIILL++H+EG++F+P RF++D++LR   ++F KS   LPE+  C 
Sbjct  293  SLQVHPDFDGVYNLTIILLYRHFEGLKFTPWRFSYDQMLRSVAIRFYKSSVRLPELQGCK  352

Query  112  RSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
             SD  R+VW GRWTRH KND C + N GR+ C  P F
Sbjct  353  ASDFDRDVWIGRWTRHGKNDDCTIGNDGRYRCLAPDF  389



>gb|KDP40102.1| hypothetical protein JCGZ_02100 [Jatropha curcas]
Length=611

 Score =   249 bits (636),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 146/208 (70%), Gaps = 0/208 (0%)
 Frame = -3

Query  625  PQDEPSGSRIGNWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELS  446
            P ++ S      W+  +L+ N +S LL  WL PGGEPC+DSR+  I +PGL+ R+ +EL+
Sbjct  125  PSEKESQEANMEWLSTDLDPNLTSNLLSQWLAPGGEPCRDSRTAEIVIPGLNGRDSIELT  184

Query  445  TGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFH  266
             G++HEF F+AVDE     CLGGDYFE DLSGE WKSRP  KD GNG+Y   LQVHPDF 
Sbjct  185  AGNVHEFGFEAVDESKNPRCLGGDYFESDLSGEAWKSRPLIKDFGNGSYSISLQVHPDFA  244

Query  265  GDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVW  86
            GDYN+T+ILLF+H+EG++FS  RF +D+ LR   ++F K+  ELP++  C RSD  +N+W
Sbjct  245  GDYNLTVILLFRHFEGLKFSTSRFVYDKELRKVKIRFVKAHYELPQLQLCERSDFNKNLW  304

Query  85   SGRWTRHAKNDTCLVDNGGRFICQDPSF  2
             GRWTRH +ND C + N GR+ C   +F
Sbjct  305  IGRWTRHGRNDGCEISNDGRYRCLPSNF  332



>ref|XP_002517153.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45316.1| conserved hypothetical protein [Ricinus communis]
Length=638

 Score =   249 bits (636),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 142/196 (72%), Gaps = 0/196 (0%)
 Frame = -3

Query  589  WVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQAV  410
            WV A LE + +  LL  WL PGGEPCKDSR+V I +PGLD R  +EL+ G+ HEF+FQAV
Sbjct  165  WVSAILEPDLTPNLLSRWLAPGGEPCKDSRTVDIVIPGLDGRNLIELTAGNSHEFIFQAV  224

Query  409  DEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQ  230
            DE     CLGGDYFE DLSGE+WKSRP  +D GNG+Y   LQVHPDF GDYN+T+ILLF+
Sbjct  225  DEFKNPLCLGGDYFETDLSGEEWKSRPLVRDFGNGSYSISLQVHPDFVGDYNLTVILLFR  284

Query  229  HYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAKNDT  50
            H+EG++FSP RF +DR LR   ++F K+  +LPE+  C +SD  +++W GRWTRH KND 
Sbjct  285  HFEGLKFSPSRFVYDRELRKVQIRFVKAHYKLPELQICQKSDFTKDLWLGRWTRHGKNDG  344

Query  49   CLVDNGGRFICQDPSF  2
            C + N GR+ C    F
Sbjct  345  CEISNDGRYRCLPSDF  360



>gb|KDO74818.1| hypothetical protein CISIN_1g035961mg [Citrus sinensis]
Length=630

 Score =   248 bits (632),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/216 (55%), Positives = 148/216 (69%), Gaps = 16/216 (7%)
 Frame = -3

Query  634  QLPPQDEPSGSRIG----------NWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIR  485
            Q P Q +PSG+              WV  +LE N S+ LL  WL PGGEPC+DSR+V I 
Sbjct  136  QNPLQQKPSGALPNRSESPVLESLKWVSVDLEPNLSTNLLARWLAPGGEPCRDSRTVEIA  195

Query  484  VPGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNG  305
            + GLD  + +ELS GDIHEF   ++       C+GGDYFE DLSGE WKSRP  KD GNG
Sbjct  196  IHGLDGGKLMELSAGDIHEFSLSSIG------CVGGDYFETDLSGESWKSRPVVKDFGNG  249

Query  304  TYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEI  125
            TY   LQVHPDF GDYN+T+ILLF+H+EG++FSP RF +DR LR  P++F +S+A+LPEI
Sbjct  250  TYSLSLQVHPDFVGDYNLTVILLFRHFEGLKFSPVRFVYDRELRHIPIRFFRSKAQLPEI  309

Query  124  SQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFIC  17
              C +SD  R++WSGRWTRH KND C ++  GR+ C
Sbjct  310  KVCQKSDFNRDIWSGRWTRHGKNDDCQINADGRYRC  345



>ref|XP_011012798.1| PREDICTED: uncharacterized protein LOC105116974 isoform X2 [Populus 
euphratica]
Length=586

 Score =   246 bits (629),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 122/239 (51%), Positives = 157/239 (66%), Gaps = 4/239 (2%)
 Frame = -3

Query  718  PKDFVILKFNGSSKEFRPEFKDFGYSNLQLPPQDEPSGSRIGNWVLAELEDNYSSKLLEG  539
            P   ++LK N  +  F  ++ D    NL    ++   GS    WV  ELE N +  LL  
Sbjct  149  PSSNIVLK-NDENVSFAQKYSDGVLENLA-SRRNGSDGSV--KWVSPELEPNLTENLLSR  204

Query  538  WLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEID  359
            WL P GEPC+ SR+V I +PGLD ++ +EL+ GD HEF FQA+DE     C GGDYFE D
Sbjct  205  WLAPEGEPCRGSRTVEIVIPGLDGKDLIELTAGDSHEFGFQALDESKNLVCSGGDYFETD  264

Query  358  LSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRV  179
            LSGE WKSRP  +D GNG+Y   LQVHPDF GDYN+T+ILL++H++G++FSP RF FD+ 
Sbjct  265  LSGEAWKSRPLVRDFGNGSYSILLQVHPDFSGDYNLTLILLYRHFQGLKFSPWRFVFDKQ  324

Query  178  LRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
            LR F +KF K  A+LP+I  C +SD  R++W GRWTR AKND C + N GR+ C  P F
Sbjct  325  LRKFRIKFVKGGAQLPKIETCEKSDFNRDLWLGRWTRQAKNDGCQISNDGRYRCLAPDF  383



>ref|XP_002884562.1| hypothetical protein ARALYDRAFT_477918 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60821.1| hypothetical protein ARALYDRAFT_477918 [Arabidopsis lyrata subsp. 
lyrata]
Length=596

 Score =   246 bits (627),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 121/303 (40%), Positives = 169/303 (56%), Gaps = 31/303 (10%)
 Frame = -3

Query  832  FRANPRVHWWFKLVVLGACLVILILWGIHSVNLSVINAPKDFVILKFNGSSKEF------  671
             R +P + W    +      ++L++W I   ++     P      +FN  S         
Sbjct  18   LRPSPLLQWRLGALTALVFFLMLVVWSIDGCSIQSFVEP-----WRFNAYSVRISPSPSP  72

Query  670  -----------RPEFKDFGYSNLQLPPQDEPSGSRIGN--------WVLAELEDNYSSKL  548
                       +P  ++       +P    P  + + +        W+ AEL+ N+++ L
Sbjct  73   LMSPKPNLVSEKPHRQNLTLKTTMVPRNLVPKKTNLTSNLTRVQFGWIAAELQKNFTANL  132

Query  547  LEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYF  368
            +  WL PGGEPC+++++V I V G+D  + +EL+ G+IHEF  QA+DE G+  C+GGDYF
Sbjct  133  MRNWLAPGGEPCREAKTVEISVAGVDGNDSVELTAGEIHEFKIQAIDESGKHVCIGGDYF  192

Query  367  EIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAF  188
            E DLSGE WKSRPP KD GNGTY F LQVHP+F GDYN T+ILLF+HY+G++FS  R  F
Sbjct  193  ETDLSGENWKSRPPVKDFGNGTYSFSLQVHPEFAGDYNFTVILLFRHYQGLKFSTSRLGF  252

Query  187  DRVLRVFPVKFTKS-RAELPEISQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQD  11
            DR LR   ++F K     LPE+  C +SD  R  WSGRWTR  KND C + N GR+ C  
Sbjct  253  DRKLRNVKLRFVKKPDVTLPELRSCKKSDFNRAAWSGRWTRLGKNDECQISNDGRYRCLA  312

Query  10   PSF  2
              F
Sbjct  313  ADF  315



>ref|XP_002311830.2| hypothetical protein POPTR_0008s20680g [Populus trichocarpa]
 gb|EEE89197.2| hypothetical protein POPTR_0008s20680g [Populus trichocarpa]
Length=662

 Score =   247 bits (630),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 122/239 (51%), Positives = 157/239 (66%), Gaps = 4/239 (2%)
 Frame = -3

Query  718  PKDFVILKFNGSSKEFRPEFKDFGYSNLQLPPQDEPSGSRIGNWVLAELEDNYSSKLLEG  539
            P   ++LK N  +  F  ++ D    NL    ++   GS    WV  ELE N +  LL  
Sbjct  149  PSSNIVLK-NNENVSFAQKYSDGVLENLA-SRRNGSDGSV--KWVSTELEPNLTENLLSR  204

Query  538  WLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEID  359
            WL P GEPC+ SR+VGI +PGLD ++ +EL+ GD HEF FQA+DE     C  GDYFE D
Sbjct  205  WLAPEGEPCRGSRTVGIVIPGLDGKDLIELTAGDSHEFGFQALDESKNLVCSVGDYFETD  264

Query  358  LSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRV  179
            LSGE WKSRP  +D GNG+Y   LQVHPDF GDYN+T+ILL++H++G++FSP RF FD+ 
Sbjct  265  LSGEAWKSRPLVRDFGNGSYSILLQVHPDFAGDYNLTLILLYRHFQGLKFSPWRFVFDKQ  324

Query  178  LRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
            LR F +KF K  A+LP+I  C +SD  R++W GRWTR AKND C + N GR+ C  P F
Sbjct  325  LRKFRIKFVKGGAQLPKIETCEKSDFNRDLWLGRWTRQAKNDGCQISNDGRYRCLAPDF  383



>ref|XP_008390827.1| PREDICTED: uncharacterized protein LOC103453071 [Malus domestica]
Length=649

 Score =   246 bits (628),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 139/196 (71%), Gaps = 0/196 (0%)
 Frame = -3

Query  604  SRIGNWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEF  425
            S   +WV+AELE N++  LL  WL PGGEPCK SR+V I +  LD ++ +ELS G+I+EF
Sbjct  163  SGTSSWVVAELEPNFTKSLLARWLAPGGEPCKVSRTVEIAILDLDGKDLIELSAGEIYEF  222

Query  424  VFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTI  245
             F A+ E     CLGGDYFE DLSGE WKSRP   D GNG+Y   LQVHPDF G YN T+
Sbjct  223  QFLALGEDKSPRCLGGDYFETDLSGESWKSRPLVTDFGNGSYSVKLQVHPDFVGLYNFTV  282

Query  244  ILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRH  65
            ILLF+H+EG+RFSP RF++DR LR  PV+F K  A+LPE+  C  SD  R +W+GRWTRH
Sbjct  283  ILLFRHFEGLRFSPARFSYDRELRKIPVRFVKGTAKLPELRTCEESDFGREIWAGRWTRH  342

Query  64   AKNDTCLVDNGGRFIC  17
             KND C + N GR+ C
Sbjct  343  GKNDGCEISNDGRYRC  358



>ref|XP_009365805.1| PREDICTED: uncharacterized protein LOC103955630 [Pyrus x bretschneideri]
Length=653

 Score =   246 bits (628),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 138/192 (72%), Gaps = 0/192 (0%)
 Frame = -3

Query  592  NWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQA  413
            +WV+AELE N++  LL  WL PGGEPCK SR+V I +P LD ++ +ELS G+I+EF F A
Sbjct  171  SWVVAELEPNFTKSLLARWLAPGGEPCKVSRTVEIAIPDLDGKDLIELSAGEIYEFQFLA  230

Query  412  VDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLF  233
            + E     CLGGDYFE DLSGE WKSRP   D GNG+Y   LQVH DF G YN T+ILLF
Sbjct  231  LGEDKSPRCLGGDYFETDLSGESWKSRPLVTDFGNGSYSVKLQVHQDFVGLYNFTVILLF  290

Query  232  QHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAKND  53
            +H+EG+RFSP RF++DR LR  PV+F K  A+LPE+  C  SD  R +W+GRWTRH KND
Sbjct  291  RHFEGLRFSPARFSYDRELRKIPVRFVKGTAKLPELRTCEESDFGREIWAGRWTRHGKND  350

Query  52   TCLVDNGGRFIC  17
             C + N GR+ C
Sbjct  351  GCEISNDGRYRC  362



>ref|XP_011012795.1| PREDICTED: uncharacterized protein LOC105116974 isoform X1 [Populus 
euphratica]
 ref|XP_011012796.1| PREDICTED: uncharacterized protein LOC105116974 isoform X1 [Populus 
euphratica]
 ref|XP_011012797.1| PREDICTED: uncharacterized protein LOC105116974 isoform X1 [Populus 
euphratica]
Length=662

 Score =   246 bits (628),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/239 (51%), Positives = 157/239 (66%), Gaps = 4/239 (2%)
 Frame = -3

Query  718  PKDFVILKFNGSSKEFRPEFKDFGYSNLQLPPQDEPSGSRIGNWVLAELEDNYSSKLLEG  539
            P   ++LK N  +  F  ++ D    NL    ++   GS    WV  ELE N +  LL  
Sbjct  149  PSSNIVLK-NDENVSFAQKYSDGVLENLA-SRRNGSDGSV--KWVSPELEPNLTENLLSR  204

Query  538  WLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEID  359
            WL P GEPC+ SR+V I +PGLD ++ +EL+ GD HEF FQA+DE     C GGDYFE D
Sbjct  205  WLAPEGEPCRGSRTVEIVIPGLDGKDLIELTAGDSHEFGFQALDESKNLVCSGGDYFETD  264

Query  358  LSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRV  179
            LSGE WKSRP  +D GNG+Y   LQVHPDF GDYN+T+ILL++H++G++FSP RF FD+ 
Sbjct  265  LSGEAWKSRPLVRDFGNGSYSILLQVHPDFSGDYNLTLILLYRHFQGLKFSPWRFVFDKQ  324

Query  178  LRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
            LR F +KF K  A+LP+I  C +SD  R++W GRWTR AKND C + N GR+ C  P F
Sbjct  325  LRKFRIKFVKGGAQLPKIETCEKSDFNRDLWLGRWTRQAKNDGCQISNDGRYRCLAPDF  383



>ref|XP_006297256.1| hypothetical protein CARUB_v10013262mg [Capsella rubella]
 gb|EOA30154.1| hypothetical protein CARUB_v10013262mg [Capsella rubella]
Length=605

 Score =   245 bits (625),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 142/197 (72%), Gaps = 1/197 (1%)
 Frame = -3

Query  589  WVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQAV  410
            W+ AEL +N+++KL+  WL PGG PC+++++V I VPG+D  + LEL+ G+IHEF FQA+
Sbjct  130  WIAAELGNNFTAKLMRNWLAPGGAPCREAKTVEISVPGVDGVDSLELTAGEIHEFKFQAL  189

Query  409  DEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQ  230
            DE G+  C+GGDYFE DLSGE WKSRPP KD GNGTY F LQVHP+F G+YN+T+ILLF+
Sbjct  190  DESGKHVCIGGDYFETDLSGESWKSRPPVKDFGNGTYSFSLQVHPEFAGEYNLTVILLFR  249

Query  229  HYEGMRFSPQRFAFDRVLRVFPVKFTKSR-AELPEISQCVRSDLARNVWSGRWTRHAKND  53
            H++G++FS  R  FDR LR   ++F K     LP +  C RSD  R+ WSGRWTR  KND
Sbjct  250  HFQGLKFSTSRLGFDRKLRNVRLRFVKKHDVTLPALRACKRSDFNRDAWSGRWTRLGKND  309

Query  52   TCLVDNGGRFICQDPSF  2
             C + N GR+ C    F
Sbjct  310  ECQISNDGRYRCLAADF  326



>ref|XP_011012800.1| PREDICTED: uncharacterized protein LOC105116975 [Populus euphratica]
 ref|XP_011012801.1| PREDICTED: uncharacterized protein LOC105116975 [Populus euphratica]
Length=662

 Score =   246 bits (628),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 140/196 (71%), Gaps = 0/196 (0%)
 Frame = -3

Query  589  WVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQAV  410
            WV   LE N +  LL  WL P GEPC+ SR++ I +PGLD ++ +EL+ GD HEF FQA+
Sbjct  188  WVSTALEPNVTENLLSRWLAPEGEPCRGSRTMEIVIPGLDGKDLIELTAGDSHEFGFQAL  247

Query  409  DEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQ  230
            DE     CLGGDYFE DLSGE WKSRP  +D GNG+Y   LQVHPDF GDYN+T+ILLF+
Sbjct  248  DESKNLVCLGGDYFETDLSGEAWKSRPLVRDFGNGSYSILLQVHPDFSGDYNLTLILLFR  307

Query  229  HYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAKNDT  50
            H++G+++ PQR AFD+ LR F +KF K  A+LP+I  C +SD  R++W GRWTR AKND 
Sbjct  308  HFQGLKYYPQRVAFDKQLRKFRIKFVKGGAQLPKIETCEKSDFNRDLWLGRWTRQAKNDG  367

Query  49   CLVDNGGRFICQDPSF  2
            C + N GR+ C  P F
Sbjct  368  CQISNDGRYRCLAPDF  383



>ref|XP_009418064.1| PREDICTED: uncharacterized protein LOC103998340 [Musa acuminata 
subsp. malaccensis]
Length=567

 Score =   244 bits (622),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/289 (44%), Positives = 171/289 (59%), Gaps = 25/289 (9%)
 Frame = -3

Query  847  EKGGSFRANPRVHWWFKLVVLGACLVILILWGIHSVNLSVINAPKDFVILKFNGSSKEFR  668
            +KGG   A  R    FKLV      + L+LW + +++++   +    V L          
Sbjct  5    DKGGVSGATVRRWSLFKLVSF-TLAIALLLWTMDALSVTATTSSLIAVTLS---------  54

Query  667  PEFKDFGYSNLQLPPQDEPSGS--------RIGNWVLAELEDNYSSKLLEGWLTPGGEPC  512
                    + L  PP   P+ S        R+ +W+      N++S L+  WL PGGEPC
Sbjct  55   ------SLNVLSPPPTTAPARSAPNTRAVPRLRSWISVPATPNFTSTLVSWWLAPGGEPC  108

Query  511  KDSRSVGIRVPGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSR  332
             DSR+  I VP LD     ELS G IHEFV  A+D+ G+  CLGGDYFE DLSG  WKSR
Sbjct  109  GDSRTADIAVPDLDGGRTAELSCGQIHEFVLSALDDGGRPRCLGGDYFETDLSGPTWKSR  168

Query  331  PPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFT  152
            PP  D GNG+Y   LQVHPDF G+YN+T++LLF+ +EG++ SP+RF F R LR FP++F 
Sbjct  169  PPVVDHGNGSYSLRLQVHPDFAGEYNLTVVLLFRSFEGLKLSPERFKFRRELRRFPIRFH  228

Query  151  KSRAELPEISQCV-RSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQDP  8
            +S   LP +  C   +DL++ VWSGRWTRHA+ND+C VD+ GR+ C DP
Sbjct  229  RSNGTLPPLRLCHGVADLSKEVWSGRWTRHARNDSCGVDDEGRYRCLDP  277



>ref|XP_008223009.1| PREDICTED: uncharacterized protein LOC103322845 [Prunus mume]
Length=626

 Score =   244 bits (623),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 141/197 (72%), Gaps = 0/197 (0%)
 Frame = -3

Query  592  NWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQA  413
            +WV A LE N +  LL  WL PGGEPC+ S++V I +P LD R+ +EL  G+I+EF F+A
Sbjct  144  SWVSAGLEPNVTKNLLARWLAPGGEPCRASKTVEIAIPDLDGRDLIELPAGEIYEFGFRA  203

Query  412  VDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLF  233
            + +  +  CLGGDYFE DLSG+ WKSRP  KD GNG+Y    Q+HPDF G YN+TIILLF
Sbjct  204  LSDDKKPRCLGGDYFETDLSGDSWKSRPVVKDFGNGSYSVSFQIHPDFVGLYNLTIILLF  263

Query  232  QHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAKND  53
            +H+EG++ SP RF +DR LR  P++FTK  A+LPE+  C  SD  R++W+GRWTRHAKND
Sbjct  264  RHFEGLKLSPHRFVYDRELRKIPIRFTKGSAKLPELHTCKESDFGRDIWTGRWTRHAKND  323

Query  52   TCLVDNGGRFICQDPSF  2
             C +   GR+ C  P+F
Sbjct  324  ACEISEDGRYRCLAPNF  340



>ref|XP_002871856.1| hypothetical protein ARALYDRAFT_488789 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48115.1| hypothetical protein ARALYDRAFT_488789 [Arabidopsis lyrata subsp. 
lyrata]
Length=553

 Score =   243 bits (619),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 148/198 (75%), Gaps = 1/198 (1%)
 Frame = -3

Query  592  NWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQA  413
            +W+  E E N+++ +L+ WL PGGE C++ ++V I VPG+D ++ +EL+ G+IHEF FQ+
Sbjct  76   SWISVEQEQNFTANVLKNWLAPGGEKCREGKTVEIFVPGIDGKDLVELAAGEIHEFRFQS  135

Query  412  VDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLF  233
            +D+ G+  C+GGDYFE DLSGE WKSRPP KDLGNGTY   LQ+HPDF GDYN+T++LLF
Sbjct  136  LDDSGKRVCIGGDYFETDLSGENWKSRPPVKDLGNGTYSLSLQIHPDFAGDYNLTVVLLF  195

Query  232  QHYEGMRFSPQRFAFDRVLRVFPVKFTKS-RAELPEISQCVRSDLARNVWSGRWTRHAKN  56
            +H++G++FSP RFAF++ LR F ++F K+    LPE+ +C RSD  R+VWSGRW R  KN
Sbjct  196  RHFQGLKFSPARFAFNKKLRNFKLRFIKNPDVVLPELRRCDRSDFDRDVWSGRWIRLGKN  255

Query  55   DTCLVDNGGRFICQDPSF  2
            D C + N GR+ C    F
Sbjct  256  DECEISNDGRYRCLPDGF  273



>ref|XP_009351016.1| PREDICTED: uncharacterized protein LOC103942554 [Pyrus x bretschneideri]
Length=639

 Score =   244 bits (623),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 139/197 (71%), Gaps = 0/197 (0%)
 Frame = -3

Query  592  NWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQA  413
            +WV A LE N +  LL  WL PGGEPCKDS++V I +  LD R+ +ELS G+++EF F A
Sbjct  157  SWVAAGLEPNLTKNLLAQWLAPGGEPCKDSKTVEISILDLDGRDLIELSAGEVYEFQFLA  216

Query  412  VDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLF  233
            + E     CLGGDYFE DLSG+ WKSRP  +D GNG+Y   LQVH DF G YN TIILLF
Sbjct  217  LGEDKNPRCLGGDYFETDLSGDSWKSRPLVRDFGNGSYSVKLQVHQDFVGLYNFTIILLF  276

Query  232  QHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAKND  53
            +H+EG+RFSP RFA+DR LR  P++F K  A+LPE+  C  SD  R +W+GRWTRH KND
Sbjct  277  RHFEGLRFSPARFAYDRELRKIPIRFVKGSAKLPELRTCEESDFGREIWAGRWTRHGKND  336

Query  52   TCLVDNGGRFICQDPSF  2
             C + N GR+ C  P++
Sbjct  337  DCEISNDGRYRCLAPNY  353



>ref|XP_006407975.1| hypothetical protein EUTSA_v10020342mg [Eutrema salsugineum]
 gb|ESQ49428.1| hypothetical protein EUTSA_v10020342mg [Eutrema salsugineum]
Length=597

 Score =   243 bits (620),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 139/197 (71%), Gaps = 1/197 (1%)
 Frame = -3

Query  589  WVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQAV  410
            W+ AE E N+++ LL  WL PGG PC+++++V I VPGLD  + +EL+ G+IHEF FQA+
Sbjct  121  WITAESEKNFTANLLRNWLAPGGAPCREAKTVEISVPGLDGVDSVELTAGEIHEFKFQAL  180

Query  409  DEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQ  230
            DE  Q  C+GGDYFE DLSGE WKSRPP KD GNGTY   LQVHP+F G++N+T+ILLF+
Sbjct  181  DESKQPVCIGGDYFETDLSGESWKSRPPVKDFGNGTYSMSLQVHPEFAGEFNLTVILLFR  240

Query  229  HYEGMRFSPQRFAFDRVLRVFPVKFTKSR-AELPEISQCVRSDLARNVWSGRWTRHAKND  53
            HY+G++FS  R  FDR LR   ++F K     LPE+  C RSD  R+ WSGRWTR  KND
Sbjct  241  HYQGLKFSTARLGFDRKLRNIRLRFVKKPGVSLPELRSCKRSDFTRDAWSGRWTRLGKND  300

Query  52   TCLVDNGGRFICQDPSF  2
             C + N GR+ C    F
Sbjct  301  ECQISNDGRYRCLAADF  317



>ref|XP_008361980.1| PREDICTED: uncharacterized protein LOC103425671 [Malus domestica]
Length=640

 Score =   244 bits (622),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 139/197 (71%), Gaps = 0/197 (0%)
 Frame = -3

Query  592  NWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQA  413
            +WV A LE N +  LL  WL PGGEPCKDS++V I +  LD R+ +ELS G+++EF F A
Sbjct  158  SWVAAGLEPNLTKNLLARWLAPGGEPCKDSKTVEISILDLDGRDLIELSAGEVYEFQFLA  217

Query  412  VDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLF  233
            + E     CLGGDYFE DLSG+ WKSRP  +D GNG+Y   LQVH DF G YN T+ILLF
Sbjct  218  LGEDKNPRCLGGDYFETDLSGDSWKSRPLVRDFGNGSYSVKLQVHQDFMGLYNFTVILLF  277

Query  232  QHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAKND  53
            +H+EG+RFSP RFA+DR LR  P++F K  A+LPE+  C  SD  R +W+GRWTRH KND
Sbjct  278  RHFEGLRFSPARFAYDRELRKIPIRFVKGSAKLPELRTCEESDFGREIWAGRWTRHGKND  337

Query  52   TCLVDNGGRFICQDPSF  2
             C + N GR+ C  P++
Sbjct  338  DCEISNDGRYRCLAPNY  354



>ref|XP_002311829.1| hypothetical protein POPTR_0008s20670g [Populus trichocarpa]
 gb|EEE89196.1| hypothetical protein POPTR_0008s20670g [Populus trichocarpa]
Length=662

 Score =   244 bits (622),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 139/196 (71%), Gaps = 0/196 (0%)
 Frame = -3

Query  589  WVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQAV  410
            WV   LE N +  LL  WL P GEPC+ SR+V I +PGLD ++ +EL+ GD HEF FQA+
Sbjct  188  WVSTALEPNVTENLLSRWLAPEGEPCRGSRTVEIVIPGLDGKDLIELTAGDSHEFGFQAL  247

Query  409  DEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQ  230
            DE     C GGDYFE DLSGE WKSRP  +D GNG+Y   LQVHPDF GDYN+T+ILLF+
Sbjct  248  DESKNLVCSGGDYFETDLSGEAWKSRPLVRDFGNGSYSILLQVHPDFSGDYNLTLILLFR  307

Query  229  HYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAKNDT  50
            H++G+++ PQR AFD+ LR F +KF K  A+LP+I  C +SD  R++W GRWTR AKND 
Sbjct  308  HFQGLKYFPQRVAFDKQLRKFRIKFVKGGAQLPKIETCEKSDFNRDLWLGRWTRQAKNDG  367

Query  49   CLVDNGGRFICQDPSF  2
            C + N GR+ C  P F
Sbjct  368  CQISNDGRYRCLAPDF  383



>ref|XP_007222053.1| hypothetical protein PRUPE_ppa003123mg [Prunus persica]
 gb|EMJ23252.1| hypothetical protein PRUPE_ppa003123mg [Prunus persica]
Length=601

 Score =   242 bits (618),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 142/197 (72%), Gaps = 0/197 (0%)
 Frame = -3

Query  592  NWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQA  413
            +WV   LE N +  LL  WL PGG+PC+ S++V I +P LD R+ +EL  G+I+EF F+A
Sbjct  119  SWVSDGLEPNVTKNLLARWLAPGGQPCRASKTVEIAIPDLDGRDLIELPAGEIYEFGFRA  178

Query  412  VDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLF  233
            + +  +  CLGGDYFE DLSG+ WKSRP  KD GNG+Y   LQ+HPDF G YN+TIILLF
Sbjct  179  LSDDKKPRCLGGDYFETDLSGDSWKSRPVVKDFGNGSYSVSLQIHPDFVGLYNLTIILLF  238

Query  232  QHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAKND  53
            +H+EG++ SP RF +DR LR  P++FTK  A+LPE+  C  SD  R++W+GRWTRHAKND
Sbjct  239  RHFEGLKLSPHRFVYDRELRKIPIRFTKGSAKLPELHTCKESDFGRDIWTGRWTRHAKND  298

Query  52   TCLVDNGGRFICQDPSF  2
             C + + GR+ C  P+F
Sbjct  299  ACEISDDGRYRCLAPNF  315



>ref|XP_006287487.1| hypothetical protein CARUB_v10000698mg [Capsella rubella]
 gb|EOA20385.1| hypothetical protein CARUB_v10000698mg [Capsella rubella]
Length=528

 Score =   240 bits (612),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 143/198 (72%), Gaps = 1/198 (1%)
 Frame = -3

Query  592  NWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQA  413
            +W+  E E N+++  L  WL PGGE C+++ +V I+VPG+D  + +EL+ G IH+F FQ+
Sbjct  51   SWISVEQEQNFTANFLRNWLAPGGEKCREAETVEIQVPGIDGMDLVELTAGKIHDFRFQS  110

Query  412  VDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLF  233
            +D  G+  C+ GDYFE DLSGE WKSRPP KDLGNGTY   LQVHPDF GDYN+T++LLF
Sbjct  111  LDVYGKRVCISGDYFETDLSGENWKSRPPVKDLGNGTYSLSLQVHPDFAGDYNLTVVLLF  170

Query  232  QHYEGMRFSPQRFAFDRVLRVFPVKFTKS-RAELPEISQCVRSDLARNVWSGRWTRHAKN  56
            +H++G++ SP RFAFDR LR F ++F K     LPE+ +CVRSD  R+VWSGRW R  KN
Sbjct  171  RHFQGLKLSPARFAFDRKLRSFRLRFIKKPDVVLPELRRCVRSDFGRDVWSGRWVRLGKN  230

Query  55   DTCLVDNGGRFICQDPSF  2
            + C + N GR+ C   +F
Sbjct  231  EECEISNDGRYRCLPANF  248



>ref|XP_010492946.1| PREDICTED: uncharacterized protein LOC104770243 [Camelina sativa]
Length=558

 Score =   241 bits (614),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/262 (46%), Positives = 164/262 (63%), Gaps = 19/262 (7%)
 Frame = -3

Query  775  LVILILWGIHSVNLSVINAPKDFVILKFNGSSKEFRPEFKDFGYSNLQLPPQDEPSGSRI  596
             +++++W I S  L      K F+         E       +    L  PP  +   +R+
Sbjct  32   FLMVVVWTIDSCTL------KTFI---------ENSWRLNSYSMRRLTSPPSLDLDPTRV  76

Query  595  G--NWVLAELEDNYSSKLLEGWLTP-GGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEF  425
               +W+  E E N+++ +L  WL P GGE C+++++V I VPG+D R  +EL+ G IHEF
Sbjct  77   KKLSWISVEQEQNFTANVLRNWLAPPGGEKCREAKTVEISVPGIDGRGSVELTAGKIHEF  136

Query  424  VFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTI  245
             FQ++D+ G+  C+GGDYFE DLSGE WKSRPP KDLGNGTY   LQVHPDF GDYN+T+
Sbjct  137  KFQSLDDSGKRVCVGGDYFETDLSGENWKSRPPVKDLGNGTYSLSLQVHPDFAGDYNLTV  196

Query  244  ILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKS-RAELPEISQCVRSDLARNVWSGRWTR  68
            +LLF+ + G++ SP RFAFDR LR F ++F K     LPE+ +CVRSD  R+VWSGRW R
Sbjct  197  VLLFRRFHGLKLSPSRFAFDRKLRSFRLRFIKKPDVVLPELRRCVRSDFDRDVWSGRWVR  256

Query  67   HAKNDTCLVDNGGRFICQDPSF  2
              KN+ C + N GR+ C    F
Sbjct  257  LGKNEECEISNDGRYRCLPDGF  278



>ref|XP_010103427.1| hypothetical protein L484_010028 [Morus notabilis]
 gb|EXB95830.1| hypothetical protein L484_010028 [Morus notabilis]
Length=974

 Score =   246 bits (628),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 144/200 (72%), Gaps = 3/200 (2%)
 Frame = -3

Query  592  NWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGL-ELSTGDIHEFVFQ  416
            +WV A+LE N ++ LL  WL+PGG+PCKDS++  I +PGLD+ EGL +L  G+IHEF FQ
Sbjct  134  SWVSADLEPNVTTNLLSRWLSPGGQPCKDSKTAEISIPGLDNNEGLVQLPAGEIHEFGFQ  193

Query  415  AVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILL  236
            A+DE     CLGGDYFE DLSG  WKSRP  KD GNG+Y   LQVHPDF G Y++TIILL
Sbjct  194  ALDESRNPRCLGGDYFETDLSGGSWKSRPLVKDFGNGSYSVSLQVHPDFVGTYHLTIILL  253

Query  235  FQHYEGMRFSPQRFAFDRVLRVFPVKFTK--SRAELPEISQCVRSDLARNVWSGRWTRHA  62
            F+H++G++FSP RFAFDR LR   +KF +  S AELP +  C  SD  R++WSGRWTRH 
Sbjct  254  FRHFQGLKFSPSRFAFDRELRKIRIKFYRKESSAELPVLQFCKESDFGRDIWSGRWTRHG  313

Query  61   KNDTCLVDNGGRFICQDPSF  2
            KND C + N GR+ C    F
Sbjct  314  KNDDCKISNDGRYRCLATDF  333



>ref|XP_009342170.1| PREDICTED: uncharacterized protein LOC103934167 [Pyrus x bretschneideri]
Length=652

 Score =   242 bits (617),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 112/201 (56%), Positives = 139/201 (69%), Gaps = 0/201 (0%)
 Frame = -3

Query  604  SRIGNWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEF  425
            S   +WV+AELE N++  LL  WL PGGEPCK SR+V I +P LD ++ +ELS G+I+EF
Sbjct  166  SGTSSWVVAELEPNFTKSLLARWLAPGGEPCKVSRTVEIAIPDLDGKDLIELSAGEIYEF  225

Query  424  VFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTI  245
             F A+ E     CLGGDYFE DLSGE WKSRP   D GNG+Y   LQVH DF G YN T+
Sbjct  226  QFLALGEDKSPRCLGGDYFETDLSGESWKSRPVVTDYGNGSYSVKLQVHQDFVGLYNFTV  285

Query  244  ILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRH  65
            ILLF+H+ G+RFSP RF++D+ LR  PV+F K  A+LPE+  C  SD  R +W+GRWTRH
Sbjct  286  ILLFRHFGGLRFSPARFSYDQELRKIPVRFVKGTAKLPELRTCEESDFGREMWAGRWTRH  345

Query  64   AKNDTCLVDNGGRFICQDPSF  2
             KND C + N GR+ C    F
Sbjct  346  GKNDGCEISNDGRYRCLSRDF  366



>ref|XP_010464183.1| PREDICTED: uncharacterized protein LOC104744780 [Camelina sativa]
Length=601

 Score =   240 bits (612),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 138/192 (72%), Gaps = 1/192 (1%)
 Frame = -3

Query  589  WVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQAV  410
            W+ A+    +++ LL  WL PGG PC+++++V I V G+D  + LEL+ G+IHEF FQA+
Sbjct  126  WITADSGKGFTANLLRSWLAPGGAPCREAKTVEISVSGVDGNDSLELTAGEIHEFRFQAL  185

Query  409  DEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQ  230
            DE G+  C+GGDYFE DLSGE WKSRPP KD GNGTY F LQVHP+F GDYN+T+ILLF+
Sbjct  186  DESGKHVCIGGDYFETDLSGESWKSRPPVKDFGNGTYSFSLQVHPEFAGDYNLTVILLFR  245

Query  229  HYEGMRFSPQRFAFDRVLRVFPVKF-TKSRAELPEISQCVRSDLARNVWSGRWTRHAKND  53
            H++G++FS  R  FDR LR  P++F  K    LPE+  C RSD  R+ WSGRWTR  KND
Sbjct  246  HFQGLKFSTSRLGFDRKLRNVPLRFINKPDVTLPELKSCKRSDFNRDAWSGRWTRLGKND  305

Query  52   TCLVDNGGRFIC  17
             C + N GR+ C
Sbjct  306  ECEISNDGRYRC  317



>ref|XP_003550508.1| PREDICTED: uncharacterized protein LOC100777897 [Glycine max]
 gb|KHN03443.1| hypothetical protein glysoja_004469 [Glycine soja]
Length=567

 Score =   239 bits (609),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 141/198 (71%), Gaps = 0/198 (0%)
 Frame = -3

Query  595  GNWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQ  416
             +WV  ELE N +S L+  W   GGEPCKDS++V I +P LD  E ++LS G +HEF FQ
Sbjct  91   ASWVSNELEPNLTSNLIARWSARGGEPCKDSKAVEIAIPWLDGGEVVDLSAGYVHEFGFQ  150

Query  415  AVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILL  236
            A+D+  +  C+GGDYFE DLSGE WKSRP  KD  NG+Y   LQVHPDF G YN+TIILL
Sbjct  151  ALDDSEKPLCVGGDYFEADLSGESWKSRPLVKDFSNGSYSISLQVHPDFDGVYNLTIILL  210

Query  235  FQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAKN  56
            ++H+EG++F+P +F++DR+LR   ++F KS  +LPE+  C  SD  R+VW GRWTRH KN
Sbjct  211  YRHFEGLKFTPWKFSYDRMLRNVAIRFYKSSVQLPELQACKASDFVRDVWIGRWTRHGKN  270

Query  55   DTCLVDNGGRFICQDPSF  2
            D C ++N GR+ C  P F
Sbjct  271  DDCSIENDGRYRCLAPDF  288



>ref|XP_010938779.1| PREDICTED: uncharacterized protein LOC105057781 [Elaeis guineensis]
Length=582

 Score =   239 bits (609),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 141/208 (68%), Gaps = 3/208 (1%)
 Frame = -3

Query  616  EPSGSRIGN---WVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELS  446
            EP+ +  G+   W+   +  N++S LL  W  PGGE C+DSR+  I VP LD    +EL 
Sbjct  93   EPTSAATGHNVSWLSVTMLGNFTSTLLSRWRAPGGELCRDSRTANISVPALDGARPIELP  152

Query  445  TGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFH  266
             G+IHEF   A+D+ G+  CLGGDYFE DLSG  WKSRPP  D GNG+Y F LQVHP F 
Sbjct  153  AGEIHEFAISALDDAGRYRCLGGDYFETDLSGTSWKSRPPIVDHGNGSYTFKLQVHPQFA  212

Query  265  GDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVW  86
            GDYN+ I+LLF+ +EG+++SP+RF F R LR F +KF KS A LP++  C  +D +R +W
Sbjct  213  GDYNLRIVLLFRSFEGLKYSPERFKFRRELRSFQIKFLKSNASLPDLRICSSADFSRKIW  272

Query  85   SGRWTRHAKNDTCLVDNGGRFICQDPSF  2
            SGRWTRH KN+ C VDN GR+ C   SF
Sbjct  273  SGRWTRHGKNEKCRVDNDGRYRCLGHSF  300



>ref|XP_010436508.1| PREDICTED: uncharacterized protein LOC104720241 [Camelina sativa]
Length=605

 Score =   239 bits (610),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 144/212 (68%), Gaps = 2/212 (1%)
 Frame = -3

Query  631  LPPQDEPSGSRIG-NWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGL  455
            L P    + +R+   W+ A     +++ L+  WL PGG PC+++++V I V G+D  + L
Sbjct  115  LDPNITSNSTRVQFGWITAASGKGFTANLMRSWLAPGGAPCREAKTVEISVSGVDGIDSL  174

Query  454  ELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHP  275
            EL+ G+IHEF FQA+DE G+  C+GGDYFE DLSGE WKSRPP KD GNGTY F LQVHP
Sbjct  175  ELTAGEIHEFRFQALDESGKHVCIGGDYFETDLSGESWKSRPPVKDFGNGTYSFSLQVHP  234

Query  274  DFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKS-RAELPEISQCVRSDLA  98
            +F GDYN+T+ILLF+H++G++FS  R  FDR LR  P++F K     LPE+  C RSD  
Sbjct  235  EFAGDYNLTVILLFRHFQGLKFSTSRLGFDRKLRNVPLRFIKKPDVTLPELRSCQRSDFN  294

Query  97   RNVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
            R+ WSGRWTR  KND C + N GR+ C    F
Sbjct  295  RDAWSGRWTRLGKNDECEISNDGRYRCLAADF  326



>ref|XP_010486106.1| PREDICTED: uncharacterized protein LOC104764302 [Camelina sativa]
Length=607

 Score =   239 bits (609),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 138/197 (70%), Gaps = 1/197 (1%)
 Frame = -3

Query  589  WVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQAV  410
            W+ A     +++ L+  WL PGG PC+++++V I V G+D  + LEL+ G+IHEF FQA+
Sbjct  132  WIAAASGKGFTANLMRSWLAPGGAPCREAKTVEISVSGVDGIDSLELTAGEIHEFRFQAL  191

Query  409  DEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQ  230
            DE G+  C+GGDYFE DLSGE WKSRPP KD GNGTY F LQVHP+F GDYN+T+ILLF+
Sbjct  192  DESGKHVCIGGDYFETDLSGESWKSRPPVKDFGNGTYSFSLQVHPEFAGDYNLTVILLFR  251

Query  229  HYEGMRFSPQRFAFDRVLRVFPVKFTKS-RAELPEISQCVRSDLARNVWSGRWTRHAKND  53
            H++G++FS  R  FDR LR  P++F K     LPE+  C RSD  R+ WSGRWTR  KND
Sbjct  252  HFQGLKFSTSRLGFDRKLRNVPLRFIKKPDVTLPELRSCKRSDFNRDAWSGRWTRLGKND  311

Query  52   TCLVDNGGRFICQDPSF  2
             C + N GR+ C    F
Sbjct  312  ECQISNDGRYRCLAADF  328



>emb|CDY58341.1| BnaA03g57420D [Brassica napus]
Length=586

 Score =   236 bits (602),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 117/289 (40%), Positives = 162/289 (56%), Gaps = 13/289 (4%)
 Frame = -3

Query  829  RANPRVHWWFKLVVLGACLVILILWGIHSVNLSVINAPKDFVILKFNGSSKE--------  674
            R++P + W F  +      ++L +W I   ++     P          S           
Sbjct  19   RSSPLLQWRFGALTALVFFLMLFVWSIDGFSIQTFAEPWRLSAYSIRVSFSPSPSPSPSP  78

Query  673  ----FRPEFKDFGYSNLQLPPQDEPSGSRIGNWVLAELEDNYSSKLLEGWLTPGGEPCKD  506
                  P+    G  NL    +     S    W+ AE   NY++ L++ WL PG  PC +
Sbjct  79   KPPLIEPQKPTTGPRNLNAKKKKTNLTSNPTRWIAAEWGKNYTANLIKNWLAPGVAPCSE  138

Query  505  SRSVGIRVPGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPP  326
            +++V I +PG+D  +  EL+ G+IHEF FQA+DE   A C+GGDYFE DLSGE WKSRPP
Sbjct  139  AKTVEISLPGVDGIDTAELTAGEIHEFKFQALDESNNAVCVGGDYFETDLSGESWKSRPP  198

Query  325  TKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKS  146
             KD GNG+Y   LQVHPDF G++N+T+ILLF+HY+G++ SP R   DR LR   ++F K 
Sbjct  199  VKDHGNGSYSMSLQVHPDFAGEFNLTVILLFRHYQGLKLSPARLGVDRKLRNVRLRFVKK  258

Query  145  -RAELPEISQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
                LPE+ +C RSD  R+ WSGRWTR  KN++C + N GR+ C    F
Sbjct  259  PDVALPELRRCKRSDFTRDAWSGRWTRLGKNESCQISNDGRYRCLPADF  307



>emb|CBI26182.3| unnamed protein product [Vitis vinifera]
Length=510

 Score =   234 bits (597),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 119/250 (48%), Positives = 159/250 (64%), Gaps = 17/250 (7%)
 Frame = -3

Query  829  RANPRVHWWFKLVVLGACLVILILWGIHSVNLSVINAPKDFVILKFNGSSKEFRPEFKDF  650
            R+N  +HW F  +     L ++ +W I   N+      K FV       +  FR E+   
Sbjct  18   RSNLFLHWRFGALTTVVFLAMVAVWTIDGCNV------KSFV------EAWRFRREY--L  63

Query  649  GYSNLQLPPQDEPSGSRIGNWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLD  470
             +++L L   DE   +   +W+  ELE N +S LL  WL PGGEPC+D RSV I +PGLD
Sbjct  64   THAHLNLTHNDE---NVTPSWISVELEPNLTSNLLARWLAPGGEPCRDIRSVEIAIPGLD  120

Query  469  DREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFH  290
             R+ +ELS  ++HEFVF A+D+ G+  CLGGDYFE DLSGE WKSRP  KD GNG+Y   
Sbjct  121  GRQSIELSAAEVHEFVFHALDDAGKPLCLGGDYFETDLSGEIWKSRPVVKDFGNGSYSLS  180

Query  289  LQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVR  110
            LQVHPDF G+YN++I LLF+H+EG++ SP RFA+DR LR  P+KF  + A+LPE+  C +
Sbjct  181  LQVHPDFAGNYNLSITLLFRHFEGLKLSPGRFAYDRELRRIPIKFYNTTAQLPELQTCRK  240

Query  109  SDLARNVWSG  80
            SD  R V +G
Sbjct  241  SDFTREVCNG  250



>ref|XP_009134876.1| PREDICTED: uncharacterized protein LOC103859142 [Brassica rapa]
Length=586

 Score =   236 bits (602),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 117/289 (40%), Positives = 162/289 (56%), Gaps = 13/289 (4%)
 Frame = -3

Query  829  RANPRVHWWFKLVVLGACLVILILWGIHSVNLSVINAPKDFVILKFNGSSKE--------  674
            R++P + W F  +      ++L +W I   ++     P          S           
Sbjct  19   RSSPLLQWRFGALTALVFFLMLFVWSIDGFSIQTFAEPWRLSAYSIRVSFSPSPSPSPSP  78

Query  673  ----FRPEFKDFGYSNLQLPPQDEPSGSRIGNWVLAELEDNYSSKLLEGWLTPGGEPCKD  506
                  P+    G  NL    +     S    W+ AE   NY++ L++ WL PG  PC +
Sbjct  79   KPPLIEPQKPTTGPRNLNAKKKKTNLTSNPTRWIAAEWGKNYTANLIKNWLAPGVAPCSE  138

Query  505  SRSVGIRVPGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPP  326
            +++V I +PG+D  +  EL+ G+IHEF FQA+DE   A C+GGDYFE DLSGE WKSRPP
Sbjct  139  AKTVEISLPGVDGIDTAELTAGEIHEFKFQALDESNNAVCVGGDYFETDLSGESWKSRPP  198

Query  325  TKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKS  146
             KD GNG+Y   LQVHPDF G++N+T+ILLF+HY+G++ SP R   DR LR   ++F K 
Sbjct  199  VKDHGNGSYSMSLQVHPDFAGEFNLTVILLFRHYQGLKLSPARLGVDRKLRNVRLRFVKK  258

Query  145  -RAELPEISQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
                LPE+ +C RSD  R+ WSGRWTR  KN++C + N GR+ C    F
Sbjct  259  PDVALPELRRCKRSDFTRDAWSGRWTRLGKNESCQISNDGRYRCLPADF  307



>ref|NP_197407.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAU44553.1| hypothetical protein AT5G19060 [Arabidopsis thaliana]
 gb|ABE65556.1| unknown [Arabidopsis thaliana]
 gb|AED92647.1| uncharacterized protein AT5G19060 [Arabidopsis thaliana]
Length=551

 Score =   235 bits (599),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 115/276 (42%), Positives = 168/276 (61%), Gaps = 21/276 (8%)
 Frame = -3

Query  835  SFRANPRVHWWFKLVVLGACLVILILWGIHSVNLSVINAPKDFVILKFNGSSKEFRPEFK  656
            S   +P   W    +      +I+++W I S ++                  + F   ++
Sbjct  9    SLAMSPLHQWRLSALTSLVFFLIVVVWSIDSCSI------------------RSFIKSWR  50

Query  655  DFGYS-NLQLPPQDEPSGSRIG-NWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRV  482
               YS  L  PP  +   +R+   W+  E E N+++ +L+ WL PGGE C+++ +V I V
Sbjct  51   FNSYSIRLTSPPSLDLDPTRVKLAWISVEQEQNFTANVLKNWLAPGGEKCREANTVEISV  110

Query  481  PGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGT  302
            PG++ +  +EL+ G+IHEF F ++D+ G+  C+GGDYFE DLSGE WKSRPP KDLGNGT
Sbjct  111  PGIEGKGLVELTAGEIHEFRFHSLDDSGERVCIGGDYFETDLSGENWKSRPPVKDLGNGT  170

Query  301  YRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKS-RAELPEI  125
            Y   LQ+HPDF GDY++T++LLF+ ++G++ SP RFAF+R LR F ++F K     LPE+
Sbjct  171  YSLSLQIHPDFAGDYDLTVVLLFRRFQGLKLSPARFAFNRTLRNFKLRFIKKPHVVLPEL  230

Query  124  SQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFIC  17
             +C  SD  R+VWSGRW R  KND C + N GR+ C
Sbjct  231  RRCELSDFDRDVWSGRWIRLGKNDECEISNDGRYRC  266



>emb|CDY24713.1| BnaA05g31120D [Brassica napus]
Length=602

 Score =   232 bits (592),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 136/197 (69%), Gaps = 1/197 (1%)
 Frame = -3

Query  589  WVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQAV  410
            W+ AE E N+++ L+  WL PGG PC+++++V I +PG+D  + + L+ G+IH F FQA+
Sbjct  126  WITAEPEKNFTANLMRNWLAPGGAPCREAKTVEISLPGVDGVDPVVLTAGEIHVFTFQAL  185

Query  409  DEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQ  230
            DE   A C+GGDYFE DLSGE WKSRPP KD GNGTY   LQVHP+F G++N+T+ILLF+
Sbjct  186  DESKAAVCIGGDYFETDLSGENWKSRPPVKDFGNGTYSMSLQVHPEFAGEFNLTVILLFR  245

Query  229  HYEGMRFSPQRFAFDRVLRVFPVKFTKS-RAELPEISQCVRSDLARNVWSGRWTRHAKND  53
            HYEG++FS  R  FD+ LR   ++F K     LPE+  C RSD  R+ WSGRW R  KND
Sbjct  246  HYEGLKFSTARLGFDKKLRNVRLRFVKKPDVSLPELRSCKRSDFTRDAWSGRWIRLGKND  305

Query  52   TCLVDNGGRFICQDPSF  2
             C + N GR+ C    F
Sbjct  306  NCQISNDGRYRCLPAGF  322



>emb|CDY08065.1| BnaC03g34580D [Brassica napus]
Length=585

 Score =   231 bits (590),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 115/290 (40%), Positives = 164/290 (57%), Gaps = 16/290 (6%)
 Frame = -3

Query  829  RANPRVHWWFKLVVLGACLVILILWGIHSVNLSVINAPKDFVILKFNGSSKEFRPEFKDF  650
            R++P + W F  +      ++L  W I   ++     P  + +  ++             
Sbjct  19   RSSPLLQWRFGALTALVFFLMLFFWSIDGFSIQTFAEP--WRLSAYSIGVSFSPSPSPSP  76

Query  649  GYSNLQLPPQDEPSGSRIGN-------------WVLAELEDNYSSKLLEGWLTPGGEPCK  509
                  + PQ   +G R  N             W+ AE   NY++ L++ WL PGG PC 
Sbjct  77   SPKPPLIEPQKPTTGPRNLNSKKKINLTSNSTRWIAAESGKNYTANLIKNWLAPGGAPCS  136

Query  508  DSRSVGIRVPGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRP  329
            ++++V I +PG+D  + +EL+ G+IHEF FQA+DE   A C+GGDYFE DLSGE WKSRP
Sbjct  137  EAKTVEISLPGVDGIDTVELTAGEIHEFKFQALDETNNALCVGGDYFETDLSGENWKSRP  196

Query  328  PTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTK  149
            P KD GNGTY   LQVHPDF G++N+T+ILLF+HY+G++ SP R   DR LR   ++F K
Sbjct  197  PVKDHGNGTYSMSLQVHPDFAGEFNLTVILLFRHYQGLKLSPARLGVDRNLRNVRLRFVK  256

Query  148  S-RAELPEISQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQDPSF  2
                 L E+  C +SD  R+ WSGRWTR  KN++C + + GR+ C    F
Sbjct  257  KPDVALLELRTCKKSDFTRDAWSGRWTRLGKNESCQISDDGRYRCLPADF  306



>ref|XP_009129647.1| PREDICTED: uncharacterized protein LOC103854459 isoform X1 [Brassica 
rapa]
 ref|XP_009129648.1| PREDICTED: uncharacterized protein LOC103854459 isoform X2 [Brassica 
rapa]
Length=616

 Score =   232 bits (591),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 136/197 (69%), Gaps = 1/197 (1%)
 Frame = -3

Query  589  WVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQAV  410
            W+ AE E N+++ L+  WL PGG PC+++++V I +PG+D  + + L+ G+IH F FQA+
Sbjct  140  WITAEPEKNFTANLMRNWLAPGGAPCREAKTVEISLPGVDGVDPVVLTAGEIHVFTFQAL  199

Query  409  DEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQ  230
            DE   A C+GGDYFE DLSGE WKSRPP KD GNGTY   LQVHP+F G++N+T+ILLF+
Sbjct  200  DESKAAVCIGGDYFETDLSGENWKSRPPVKDFGNGTYSMSLQVHPEFAGEFNLTVILLFR  259

Query  229  HYEGMRFSPQRFAFDRVLRVFPVKFTKS-RAELPEISQCVRSDLARNVWSGRWTRHAKND  53
            HYEG++FS  R  FD+ LR   ++F K     LPE+  C RSD  R+ WSGRW R  KND
Sbjct  260  HYEGLKFSTARLGFDKKLRNVRLRFVKKPDVSLPELRSCKRSDFTRDAWSGRWIRLGKND  319

Query  52   TCLVDNGGRFICQDPSF  2
             C + N GR+ C    F
Sbjct  320  DCQISNDGRYRCLPAGF  336



>emb|CDY05239.1| BnaC05g45640D [Brassica napus]
Length=601

 Score =   231 bits (590),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 137/197 (70%), Gaps = 1/197 (1%)
 Frame = -3

Query  589  WVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQAV  410
            W+ AE E N+++ L+  WL PGG PC+++++V I +PG+D  + + L+ G+IH F FQA+
Sbjct  125  WITAEPEKNFTANLMRNWLAPGGAPCREAKTVEISLPGVDGVDPVVLTAGEIHVFTFQAL  184

Query  409  DEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQ  230
            DE   A C+GGDYFE DLSGE WKSRPP KD GNGTY   LQVHP+F G++N+T+ILLF+
Sbjct  185  DESKAAVCIGGDYFETDLSGENWKSRPPVKDFGNGTYSMSLQVHPEFAGEFNLTVILLFR  244

Query  229  HYEGMRFSPQRFAFDRVLRVFPVKFTKS-RAELPEISQCVRSDLARNVWSGRWTRHAKND  53
            HY+G++FS  R  FD+ LR   ++F K     LPE+  C RSD  R+ WSGRW R  KND
Sbjct  245  HYQGLKFSTARLGFDKKLRDVRLRFVKKPDVSLPELRSCKRSDFTRDAWSGRWIRLGKND  304

Query  52   TCLVDNGGRFICQDPSF  2
            +C + N GR+ C    F
Sbjct  305  SCQISNDGRYRCLPAGF  321



>gb|KEH32201.1| cytochrome P450 family protein, putative [Medicago truncatula]
Length=582

 Score =   230 bits (587),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 141/205 (69%), Gaps = 4/205 (2%)
 Frame = -3

Query  604  SRIGNWVLAELEDNYSSKLL--EGWL--TPGGEPCKDSRSVGIRVPGLDDREGLELSTGD  437
            + + +WV +ELE N +S LL    WL    GGEPCKDS++V I +PGLD    ++LS GD
Sbjct  99   NNVASWVKSELEVNLTSNLLARSRWLKLNKGGEPCKDSKAVDISIPGLDGGNMVDLSAGD  158

Query  436  IHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDY  257
            IHEFVFQA+D+  +A CLGGDYFE DLSGE WKSRP  KD  NG+Y   LQVHPDF G Y
Sbjct  159  IHEFVFQALDDSRKARCLGGDYFETDLSGESWKSRPLVKDFSNGSYSISLQVHPDFVGVY  218

Query  256  NVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGR  77
            N+TI LL++  EG++ +P ++ +DR++R   ++F K+   +PE+  C  +D  R+VW GR
Sbjct  219  NLTIFLLYRQLEGLKLTPWKYVYDRMVRSIAIRFYKNEVLIPELQTCKAADFERDVWCGR  278

Query  76   WTRHAKNDTCLVDNGGRFICQDPSF  2
            WTRH KND C + + GR+ C  P F
Sbjct  279  WTRHGKNDDCSIGDDGRYRCLAPDF  303



>gb|KEH32202.1| cytochrome P450 family protein, putative [Medicago truncatula]
Length=595

 Score =   226 bits (577),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 142/198 (72%), Gaps = 2/198 (1%)
 Frame = -3

Query  604  SRIGNWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREG--LELSTGDIH  431
            + +  WV +ELE N ++ LL  WL  GGEPCKDS++V I +PGLD   G  +ELS GDIH
Sbjct  114  NNVATWVQSELELNLTTNLLARWLAKGGEPCKDSKTVEISIPGLDLDGGNLIELSAGDIH  173

Query  430  EFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNV  251
            EF FQA+D+ G++ CLGGDYFE  LSGE WKSRP  KD  NG+Y   LQVHPDF G YN+
Sbjct  174  EFGFQALDDSGKSRCLGGDYFETSLSGESWKSRPLVKDFSNGSYSISLQVHPDFVGVYNL  233

Query  250  TIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWT  71
            TIILL++H+EG++F+P RF +DR++R   ++F K    +PE+  C  +D  R+VW GRWT
Sbjct  234  TIILLYRHFEGLKFTPWRFVYDRMVRSIAIRFYKDDILIPELQSCKAADFERDVWCGRWT  293

Query  70   RHAKNDTCLVDNGGRFIC  17
            RH +ND C++ N GR+ C
Sbjct  294  RHGRNDDCVIGNDGRYRC  311



>ref|XP_006655293.1| PREDICTED: uncharacterized protein LOC102707496 [Oryza brachyantha]
Length=570

 Score =   204 bits (519),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 135/202 (67%), Gaps = 8/202 (4%)
 Frame = -3

Query  589  WVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDR----EGLELSTGDIHEFV  422
            W+      N++ +LL  WLTPGG PC+DSR+  I +P LDD     E   L + +IHEF 
Sbjct  86   WLSVPDPSNFTEELLARWLTPGGSPCRDSRTANISIPVLDDDAAAGEVTALGSAEIHEFT  145

Query  421  FQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDF-HGDYNVTI  245
            F A+D+ GQ  CLGGD+FEIDLSG++WKSRPP  D G+G+Y F LQV P F  GD+++TI
Sbjct  146  FWALDDAGQRRCLGGDFFEIDLSGDEWKSRPPVVDHGDGSYSFRLQVPPRFAEGDFHLTI  205

Query  244  ILLFQHYEGMRFSPQRFAFDRVLRVFPVKF--TKSRAELPEISQCVRSDLARNVWSGRWT  71
            ILLF+ +EG++FS  RF +   +R  P+ F  + S   LP +  C  +D AR+VWSGRWT
Sbjct  206  ILLFRSFEGLKFSSLRFKYRAEMRRIPLLFRPSNSSLSLPALETCRAADFARDVWSGRWT  265

Query  70   RHAKNDTC-LVDNGGRFICQDP  8
            R AKND C  VD+ GR+ C +P
Sbjct  266  RLAKNDNCEEVDDAGRYRCLEP  287



>ref|NP_001055465.1| Os05g0396900 [Oryza sativa Japonica Group]
 gb|AAT07640.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17379.1| Os05g0396900 [Oryza sativa Japonica Group]
 dbj|BAG91538.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94481.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63636.1| hypothetical protein OsJ_18453 [Oryza sativa Japonica Group]
Length=601

 Score =   203 bits (516),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 136/202 (67%), Gaps = 8/202 (4%)
 Frame = -3

Query  589  WVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDR----EGLELSTGDIHEFV  422
            W+      N++ +L++ WLTPGG PC+DSR+  I +P LDD     E   L + +IHEF 
Sbjct  117  WLSVPDPSNFTEELIDRWLTPGGTPCRDSRTANISIPVLDDAAAAGEVTTLGSAEIHEFT  176

Query  421  FQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDF-HGDYNVTI  245
            F A+D+ GQ  CLGGD+FEIDL+G++WKSRPP  D G+G+Y F LQV P F  GD+ +TI
Sbjct  177  FWALDDAGQRRCLGGDFFEIDLAGDEWKSRPPVVDHGDGSYSFRLQVAPRFAEGDFRLTI  236

Query  244  ILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAE--LPEISQCVRSDLARNVWSGRWT  71
            ILLF+ +EG++FS  RF +   +R  P+ F  S +   LP +  C  +D AR+VWSGRWT
Sbjct  237  ILLFRSFEGLKFSSLRFKYHAEMRRIPLLFGPSNSTRFLPALETCRAADFARDVWSGRWT  296

Query  70   RHAKNDTC-LVDNGGRFICQDP  8
            R AKND+C  VD+ GR+ C +P
Sbjct  297  RLAKNDSCEEVDDAGRYRCLEP  318



>ref|XP_003568515.1| PREDICTED: uncharacterized protein LOC100828689 [Brachypodium 
distachyon]
Length=587

 Score =   200 bits (509),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 107/266 (40%), Positives = 157/266 (59%), Gaps = 19/266 (7%)
 Frame = -3

Query  793  VVLGACLVILILWGIHSVNLSVINAPKDFVILKFNGSSKEFRPEFKDFGYSNLQLPPQDE  614
            + LG+ L +++L+   +V++S+  A          G+ +  R +++ +         +  
Sbjct  58   LALGSFLGVVVLF---AVDVSLTGA----------GADQRLRHQYQHYLGGGGGGRAEGA  104

Query  613  PSGSRIGNWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDI  434
            P+     +W+      N++  LL  WLTPGG PC+D+R+  I +P LDD    +LS  +I
Sbjct  105  PAPP---SWLSVPNPSNFTGDLLSRWLTPGGSPCRDARTTNISIPVLDDAV-TKLSATEI  160

Query  433  HEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHG-DY  257
            HEF F A+D+ G   CLGGD+FEIDLSG  WKSRPP  D G+G+Y F LQV P F   ++
Sbjct  161  HEFTFWALDDTGLRRCLGGDFFEIDLSGSAWKSRPPVVDHGDGSYTFRLQVAPRFATEEF  220

Query  256  NVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGR  77
            ++TI+LLF+ +EG++FS  RF +   LR  P+ F    A LP +  C  +D  R+VWSGR
Sbjct  221  HLTIVLLFRSFEGLKFSSARFKYRAELRRIPLFFRPGNASLPALETCRAADFGRDVWSGR  280

Query  76   WTRHAKNDTC-LVDNGGRFICQDPSF  2
            WTR AKND C  VD  GR+ C +P +
Sbjct  281  WTRLAKNDNCDDVDGAGRYRCLEPEY  306



>gb|AFW77905.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=344

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 127/199 (64%), Gaps = 7/199 (4%)
 Frame = -3

Query  592  NWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDR----EGLELSTGDIHEF  425
            +W+      N++  LL  WL PGG PC+D+R+  I V  LDD     E   L  G+IHE 
Sbjct  102  SWLSVPDRPNFTDDLLARWLAPGGSPCRDARTANISVEVLDDAAARGEATTLGAGEIHEV  161

Query  424  VFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDF-HGDYNVT  248
             F A+DE GQ  CLGGDYFE+DLSG+ WKSRPP  D G+G+Y F LQV P F  G++ +T
Sbjct  162  TFWALDEAGQRRCLGGDYFEVDLSGDAWKSRPPIVDHGDGSYSFRLQVAPRFAAGEFRLT  221

Query  247  IILLFQHYEGMRFSPQRFAFDRVLRVFPVKF-TKSRAELPEISQCVRSDLARNVWSGRWT  71
            ++LLF+ +EG++FS  RF +   LR  P+ F   + A LP +  C  +D +R+ WSGRWT
Sbjct  222  VVLLFRSWEGLKFSSSRFKYRAELRRIPLLFRPDNNASLPALETCRAADFSRDAWSGRWT  281

Query  70   RHAKNDTCL-VDNGGRFIC  17
            R AKND+C  VD  GR+ C
Sbjct  282  RLAKNDSCEDVDAAGRYRC  300



>ref|XP_004962168.1| PREDICTED: uncharacterized protein LOC101776175 [Setaria italica]
Length=590

 Score =   197 bits (502),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 128/201 (64%), Gaps = 7/201 (3%)
 Frame = -3

Query  589  WVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDR----EGLELSTGDIHEFV  422
            W+      N++  LL  WL PGG PC+D+R+  I VP LD      E  EL  G+IHEF 
Sbjct  107  WLSVPDRPNFTDDLLARWLAPGGTPCRDARTANISVPVLDGAAARVEATELRAGEIHEFT  166

Query  421  FQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDF-HGDYNVTI  245
            F A+D+ G+  CLGGDYFE+DLSG+ WKSRPP  D G+G+Y F LQV P F  G++ +T+
Sbjct  167  FWALDDAGKRRCLGGDYFEVDLSGDAWKSRPPVVDRGDGSYSFRLQVAPRFAAGEFRLTV  226

Query  244  ILLFQHYEGMRFSPQRFAFDRVLRVFPVKFT-KSRAELPEISQCVRSDLARNVWSGRWTR  68
            +LLF+ +EG++FS  RF +   LR  P+ F   S   LP +  C  +D AR+ WSGRWTR
Sbjct  227  VLLFRSWEGLKFSSARFKYRAELRRIPLLFRPDSNVSLPALETCRAADFARDAWSGRWTR  286

Query  67   HAKNDTC-LVDNGGRFICQDP  8
             AKND C  VD  GR+ C +P
Sbjct  287  LAKNDDCEEVDAAGRYRCLEP  307



>ref|XP_002441055.1| hypothetical protein SORBIDRAFT_09g019540 [Sorghum bicolor]
 gb|EES19485.1| hypothetical protein SORBIDRAFT_09g019540 [Sorghum bicolor]
Length=589

 Score =   195 bits (495),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 128/202 (63%), Gaps = 7/202 (3%)
 Frame = -3

Query  592  NWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDR----EGLELSTGDIHEF  425
            +W+      N++  LL  WL PGG PC+D+R+  I V  LDD     E   L  G IHE 
Sbjct  105  SWLSVPDHPNFTDDLLARWLEPGGSPCRDARTANISVGVLDDAAASGEATTLGAGQIHEV  164

Query  424  VFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFH-GDYNVT  248
             F A+DE GQ  CLGGDYFE+DLSG+ WKSRPP  D G+G+Y F LQV P F  G++ +T
Sbjct  165  TFWALDEAGQRRCLGGDYFEVDLSGDAWKSRPPIVDHGDGSYSFRLQVAPRFAVGEFRLT  224

Query  247  IILLFQHYEGMRFSPQRFAFDRVLRVFPVKFT-KSRAELPEISQCVRSDLARNVWSGRWT  71
            ++LLF+ +EG++FS  RF +   LR  P+ F     A LP +  C  +D +R+VWSGRWT
Sbjct  225  VVLLFRSFEGLKFSSSRFKYRAELRRIPLLFRPDDNASLPALETCRAADFSRDVWSGRWT  284

Query  70   RHAKNDTCL-VDNGGRFICQDP  8
            R AKND+C  VD  GR+ C +P
Sbjct  285  RLAKNDSCEDVDAAGRYRCLEP  306



>dbj|BAJ91521.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=599

 Score =   193 bits (491),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 127/201 (63%), Gaps = 6/201 (3%)
 Frame = -3

Query  592  NWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREG----LELSTGDIHEF  425
            +W+      N++  LL  WLTPGG PC+D+R+  I +P LD         ELS  +I+ F
Sbjct  116  SWLSVPNPTNFTDDLLARWLTPGGSPCRDARTANISLPALDGAAAAGGVTELSAAEIYVF  175

Query  424  VFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFH-GDYNVT  248
             F A+D  G   CLGGD+FEIDLSG  WKSRPP  D G+G+Y F LQV P F  G++ +T
Sbjct  176  TFWALDGTGLRRCLGGDFFEIDLSGAAWKSRPPVVDNGDGSYTFRLQVAPRFAAGEFRLT  235

Query  247  IILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTR  68
            I+LLF+ +EG++FS  RF +   LR  P+ F    A LP +  C  +D AR++WSGRWTR
Sbjct  236  IVLLFRSFEGLKFSSARFKYRAELRRLPLLFRPGNASLPALETCRAADFARDLWSGRWTR  295

Query  67   HAKNDTCL-VDNGGRFICQDP  8
             A+ND C  VD+ GR+ C +P
Sbjct  296  LARNDKCEDVDDAGRYRCLEP  316



>ref|NP_001146060.1| uncharacterized protein LOC100279591 [Zea mays]
 gb|ACL53135.1| unknown [Zea mays]
 gb|AFW77906.1| LOW QUALITY PROTEIN: putative cytochrome P450 superfamily protein 
[Zea mays]
Length=586

 Score =   192 bits (489),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 127/199 (64%), Gaps = 7/199 (4%)
 Frame = -3

Query  592  NWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDR----EGLELSTGDIHEF  425
            +W+      N++  LL  WL PGG PC+D+R+  I V  LDD     E   L  G+IHE 
Sbjct  102  SWLSVPDRPNFTDDLLARWLAPGGSPCRDARTANISVEVLDDAAARGEATTLGAGEIHEV  161

Query  424  VFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDF-HGDYNVT  248
             F A+DE GQ  CLGGDYFE+DLSG+ WKSRPP  D G+G+Y F LQV P F  G++ +T
Sbjct  162  TFWALDEAGQRRCLGGDYFEVDLSGDAWKSRPPIVDHGDGSYSFRLQVAPRFAAGEFRLT  221

Query  247  IILLFQHYEGMRFSPQRFAFDRVLRVFPVKFT-KSRAELPEISQCVRSDLARNVWSGRWT  71
            ++LLF+ +EG++FS  RF +   LR  P+ F   + A LP +  C  +D +R+ WSGRWT
Sbjct  222  VVLLFRSWEGLKFSSSRFKYRAELRRIPLLFRPDNNASLPALETCRAADFSRDAWSGRWT  281

Query  70   RHAKNDTCL-VDNGGRFIC  17
            R AKND+C  VD  GR+ C
Sbjct  282  RLAKNDSCEDVDAAGRYRC  300



>gb|ACG28702.1| hypothetical protein [Zea mays]
Length=590

 Score =   192 bits (489),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 127/199 (64%), Gaps = 7/199 (4%)
 Frame = -3

Query  592  NWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDR----EGLELSTGDIHEF  425
            +W+      N++  LL  WL PGG PC+D+R+  I V  LDD     E   L  G+IHE 
Sbjct  106  SWLSVPDRPNFTDDLLARWLAPGGSPCRDARTANISVEVLDDAAARGEATTLGAGEIHEV  165

Query  424  VFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDF-HGDYNVT  248
             F A+DE GQ  CLGGDYFE+DLSG+ WKSRPP  D G+G+Y F LQV P F  G++ +T
Sbjct  166  TFWALDEAGQRRCLGGDYFEVDLSGDAWKSRPPIVDHGDGSYSFRLQVAPRFAAGEFRLT  225

Query  247  IILLFQHYEGMRFSPQRFAFDRVLRVFPVKFT-KSRAELPEISQCVRSDLARNVWSGRWT  71
            ++LLF+ +EG++FS  RF +   LR  P+ F   + A LP +  C  +D +R+ WSGRWT
Sbjct  226  VVLLFRSWEGLKFSSSRFKYRAELRRIPLLFRPDNNASLPALETCRAADFSRDAWSGRWT  285

Query  70   RHAKNDTCL-VDNGGRFIC  17
            R AKND+C  VD  GR+ C
Sbjct  286  RLAKNDSCEDVDAAGRYRC  304



>ref|XP_006850778.1| hypothetical protein AMTR_s00025p00090990 [Amborella trichopoda]
 gb|ERN12359.1| hypothetical protein AMTR_s00025p00090990 [Amborella trichopoda]
Length=718

 Score =   167 bits (422),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 91/224 (41%), Positives = 131/224 (58%), Gaps = 17/224 (8%)
 Frame = -3

Query  640  NLQLPP-----QDEPSGSRIGNWVLAELEDNYSSKLLEGWLTPGGEP--CKDSRSVGIRV  482
            NL LP      + E +G  +  W+    E+N +++ LE  ++    P  C+D+++  + V
Sbjct  225  NLTLPASVLAKKAEENG--VFEWISFPEENNVTARFLES-MSGATAPAFCRDTKTESVTV  281

Query  481  PGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGT  302
             GL+    L L+ G IH F   A D  G+  C GGDYFE DLSG  WKSRPP +D GNG+
Sbjct  282  SGLEVAGKLRLTAGKIHTFAVSAYDIAGKPRCSGGDYFETDLSGASWKSRPPLQDNGNGS  341

Query  301  YRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFA-----FDRVLRVFPVKFTKSRAE  137
            Y   LQVHPDF GD+ ++I+LLF++Y+GM+  P+R+A     F++ LR     F  +  E
Sbjct  342  YTLSLQVHPDFAGDHVLSIVLLFRNYQGMKRFPERWAVRKEVFNKTLRFENNGFRNNGPE  401

Query  136  LPEISQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFICQDPS  5
               +  C + D  R +WSGRWTR A+++ C +D  GRF C  PS
Sbjct  402  --ALKTCGKEDFRRGLWSGRWTRLARSEPCEIDASGRFRCLRPS  443



>ref|XP_001754754.1| predicted protein [Physcomitrella patens]
 gb|EDQ80208.1| predicted protein [Physcomitrella patens]
Length=468

 Score =   133 bits (334),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 104/187 (56%), Gaps = 12/187 (6%)
 Frame = -3

Query  526  GGEPCKDSRSVGIRVPGL-DDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSG  350
            G  PC D  +   +V GL +  + + L T  +H F  Q+++  GQA C GGDY+E+DLS 
Sbjct  10   GSGPCYDEHTNRTKVIGLPETADVIFLPTNVVHRFWLQSLNSAGQARCAGGDYYEVDLSN  69

Query  349  EKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRV  170
              W+SRPPTKD+ NGTY+    V   F G YN+T+ILL+  Y G+ F  +++  ++    
Sbjct  70   SLWRSRPPTKDMQNGTYQVEFLVSDAFAGQYNLTVILLYDAYHGVDFDGEKWFINKQTVF  129

Query  169  FPVKFTKS--RAELPEISQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRF---------  23
              + FT +     L  + +C  +D     WSGRWTR   ND+CL D+ GR+         
Sbjct  130  LHLHFTPTTDTDNLANLKRCGPTDFVSPEWSGRWTRPMDNDSCLPDHIGRYKHCFSDSSI  189

Query  22   ICQDPSF  2
             C++PS+
Sbjct  190  SCRNPSW  196



>gb|AFW58040.1| hypothetical protein ZEAMMB73_117608 [Zea mays]
Length=307

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 88/138 (64%), Gaps = 6/138 (4%)
 Frame = -3

Query  424  VFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHG-DYNVT  248
            VF    EK  + CL GDYFE DLSG+ WKSRPP  D  +G+Y F LQV P F   ++++T
Sbjct  126  VFHQSPEK--SCCLIGDYFEFDLSGDAWKSRPPIVDHSDGSYSFRLQVAPRFAAREFHLT  183

Query  247  IILLFQHYEGMRFSPQRFAFDRVLRVFPVKFT-KSRAELPEISQCVRSDLARNVWSGRWT  71
            ++LLF+ +EG++FS  RF +   L   P+ F   + A LP +  C  +D +R+ WSGRWT
Sbjct  184  VVLLFRSWEGLKFS-SRFKYRAELHRIPLLFRLDNNAALPALETCRAADFSRDAWSGRWT  242

Query  70   RHAKNDTCL-VDNGGRFI  20
            R AKND C  VD  GR+I
Sbjct  243  RLAKNDNCEDVDAAGRYI  260



>ref|XP_002983520.1| hypothetical protein SELMODRAFT_43079, partial [Selaginella moellendorffii]
 gb|EFJ15421.1| hypothetical protein SELMODRAFT_43079, partial [Selaginella moellendorffii]
Length=436

 Score =   122 bits (305),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 89/157 (57%), Gaps = 1/157 (1%)
 Frame = -3

Query  484  VPGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNG  305
            +P  ++   + LST  +H+    +    G   C GGD++E DLS  +WKSRPP  D+G+G
Sbjct  1    LPRAENGGEITLSTDVLHKIWIVSYAASGNRRCFGGDFYETDLSSPQWKSRPPITDVGDG  60

Query  304  TYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEI  125
            +Y   L+V  +F G+Y   +ILL+ ++ G+   P  +A  + +    ++FT SR   P +
Sbjct  61   SYLVELKVDEEFAGNYTFKVILLYSNFRGLEHQPDPWALTKEMLTVQIRFTTSRKRNPHL  120

Query  124  SQCVRSD-LARNVWSGRWTRHAKNDTCLVDNGGRFIC  17
            + C   D ++   WSG+WTR   N++C +D  GR+ C
Sbjct  121  ATCTSHDFMSATTWSGKWTRTKFNESCQLDKEGRYRC  157



>ref|XP_002973868.1| hypothetical protein SELMODRAFT_52537, partial [Selaginella moellendorffii]
 gb|EFJ24823.1| hypothetical protein SELMODRAFT_52537, partial [Selaginella moellendorffii]
Length=436

 Score =   120 bits (302),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 89/157 (57%), Gaps = 1/157 (1%)
 Frame = -3

Query  484  VPGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNG  305
            +P  ++   + LST  +H+    +    G   C GGD++E DLS  +WKSRPP  D+G+G
Sbjct  1    LPRAENGGEITLSTDVLHKIWIVSYAASGNRRCFGGDFYETDLSSPQWKSRPPITDVGDG  60

Query  304  TYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEI  125
            +Y   L+V  +F G+Y   +ILL+ ++ G+   P  +A  + +    ++FT SR   P +
Sbjct  61   SYLVELKVDEEFAGNYTFKVILLYSNFRGLEHQPGPWALTKEMLTVQIRFTTSRKRNPHL  120

Query  124  SQCVRSD-LARNVWSGRWTRHAKNDTCLVDNGGRFIC  17
            + C   D ++   WSG+WTR   N++C +D  GR+ C
Sbjct  121  ATCTSHDFVSATTWSGKWTRTKFNESCQLDKEGRYRC  157



>ref|XP_002970347.1| hypothetical protein SELMODRAFT_171524 [Selaginella moellendorffii]
 gb|EFJ28477.1| hypothetical protein SELMODRAFT_171524 [Selaginella moellendorffii]
Length=524

 Score =   121 bits (304),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 62/183 (34%), Positives = 98/183 (54%), Gaps = 7/183 (4%)
 Frame = -3

Query  532  TPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLS  353
            T G      + +V   +P  +D   + L+  ++H+F   +    G   C GGD++E D+S
Sbjct  67   TQGCHNVSTAAAVLFGIPRAEDGGEITLAADEVHKFWIVSYAADGSRRCSGGDFYETDIS  126

Query  352  -GEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVL  176
             G  WKSRPP  DLG+G+Y   L+V+ DF G YN T+ L++ ++ G+   P ++AF + +
Sbjct  127  AGPTWKSRPPVTDLGDGSYLVELKVNGDFAGSYNFTVSLVYTNFHGLDHLPGKWAFKKEM  186

Query  175  RVFPVKFTK-SRAELPEISQCVRSDLARNV-----WSGRWTRHAKNDTCLVDNGGRFICQ  14
                + FT  SR    ++  C  SDL         W GRW+R   N +C +D  GR++C 
Sbjct  187  FRLLINFTAGSRRRKHQLHTCAASDLRSTTSPPSQWQGRWSRTKFNSSCQLDKNGRYLCL  246

Query  13   DPS  5
            DP+
Sbjct  247  DPA  249



>ref|XP_002968112.1| hypothetical protein SELMODRAFT_89928 [Selaginella moellendorffii]
 gb|EFJ30366.1| hypothetical protein SELMODRAFT_89928 [Selaginella moellendorffii]
Length=524

 Score =   119 bits (297),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 96/183 (52%), Gaps = 7/183 (4%)
 Frame = -3

Query  532  TPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLS  353
            T G      + +V   +P  +D   + L+  ++H+F   +    G   C GGD++E D+S
Sbjct  67   TQGCHNVSTAAAVLFGIPRAEDGGEITLAADEVHKFWIVSYAADGSRRCSGGDFYETDIS  126

Query  352  -GEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVL  176
             G  WKSRPP  DLG+G Y   L+V+ DF   YN T+ L++ ++ G+   P ++AF + +
Sbjct  127  AGPTWKSRPPVTDLGDGAYLVELKVNGDFARSYNFTVSLVYTNFHGLDHVPNKWAFKKEM  186

Query  175  RVFPVKFTK-SRAELPEISQCVRSDLARNV-----WSGRWTRHAKNDTCLVDNGGRFICQ  14
                + FT  SR    ++  C  SDL         W GRW+R   N +C +D  GR++C 
Sbjct  187  FRLLINFTAGSRRRKHQLHTCAASDLRSTTSPPSQWQGRWSRTKFNSSCQLDKNGRYLCL  246

Query  13   DPS  5
            DP+
Sbjct  247  DPA  249



>ref|XP_001784260.1| predicted protein [Physcomitrella patens]
 gb|EDQ50909.1| predicted protein [Physcomitrella patens]
Length=593

 Score =   117 bits (293),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/192 (34%), Positives = 95/192 (49%), Gaps = 7/192 (4%)
 Frame = -3

Query  565  NYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLD---DREGLELSTGDIHEFVFQAVDEKGQ  395
            N S  +L+       EPC   R+   +V GL    D E ++L TG IHE +  + +E G+
Sbjct  105  NESVSILQQITENNTEPCYRQRTYTAQVFGLPKPVDGEPIQLQTGKIHELLIVSYEESGR  164

Query  394  AHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEGM  215
              C GGD+FE DLS + WK+RP   D  +G+Y     V   F G +   ++LLF ++  +
Sbjct  165  RRCAGGDFFETDLSSDNWKARPTILDNRDGSYAVKFMVDSRFAGLFVFKVMLLFANFHAL  224

Query  214  RFSP----QRFAFDRVLRVFPVKFTKSRAELPEISQCVRSDLARNVWSGRWTRHAKNDTC  47
              S      R      + +  V     +  LP++ +C   D +   WSGRW RH  N TC
Sbjct  225  DASNCTEWSRLEDILTVEIEFVAPDPQQESLPDLRRCTDDDFSLKAWSGRWNRHTWNQTC  284

Query  46   LVDNGGRFICQD  11
             + + GRFIC D
Sbjct  285  EIRDDGRFICID  296



>ref|XP_002974062.1| hypothetical protein SELMODRAFT_100752 [Selaginella moellendorffii]
 gb|EFJ25017.1| hypothetical protein SELMODRAFT_100752 [Selaginella moellendorffii]
Length=508

 Score =   115 bits (287),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 98/187 (52%), Gaps = 8/187 (4%)
 Frame = -3

Query  550  LLEGWLTPGGEPCKDSRSVGIRVPGLDDREG---LELSTGDIHEFVFQAVDEKGQAHCLG  380
            LL+     G   C +  +    + GL   E    + LSTG +H+    +    G   C G
Sbjct  44   LLQRLSENGTRECHNVSTAAAILFGLPRAENEGEVTLSTGVLHKLWIVSYAGDGSRRCFG  103

Query  379  GDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQ  200
            GD+FE DLSG  WKSRPP  D+G+G+Y   L+V  +F G Y    ILLF ++ G+   P 
Sbjct  104  GDFFETDLSGPNWKSRPPVTDVGDGSYLVELKVDDEFAGPYTFKAILLFPNFHGLDQQPD  163

Query  199  RFAFDRVLRVFPVKFTKSRAELPE---ISQCVRSDLARNV-WSGRWTRHAKNDTCLVDNG  32
            ++A  + + +  ++F  SR+ + +   +  C  SD   N  WSG+WTR   N++C +D  
Sbjct  164  KWALKKQMFLLKIRFA-SRSSIFKSRPLPICSSSDFRSNTRWSGKWTRTKFNESCKLDKE  222

Query  31   GRFICQD  11
            GR+ C D
Sbjct  223  GRYRCLD  229



>ref|XP_002990909.1| hypothetical protein SELMODRAFT_132583 [Selaginella moellendorffii]
 gb|EFJ07953.1| hypothetical protein SELMODRAFT_132583 [Selaginella moellendorffii]
Length=493

 Score =   114 bits (286),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 92/162 (57%), Gaps = 6/162 (4%)
 Frame = -3

Query  493  GIRVPGLDDREG-LELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKD  317
            G+ +PG    EG + +STG +H+F   +    G+  C GGD++E DLSG KWKSRPP  D
Sbjct  53   GLPMPG---NEGPITMSTGVVHKFWIVSYAADGRRRCTGGDFYETDLSGHKWKSRPPITD  109

Query  316  LGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAE  137
             GNG+Y   L+V   F G+Y +  ILL+ ++ GM  +P+ +A +  +    + F  ++ +
Sbjct  110  YGNGSYLVELKVDKGFEGNYTLKAILLYSNFHGMDKNPEPWALETQVFQLQIHFVNNKIQ  169

Query  136  LPE-ISQCVRSDL-ARNVWSGRWTRHAKNDTCLVDNGGRFIC  17
             P  +  C    L +   W G+WTR   +++C +D  GR+ C
Sbjct  170  RPSPLPLCTSKSLKSAKTWLGKWTRMKFDESCKLDEEGRYRC  211



>ref|XP_002973867.1| hypothetical protein SELMODRAFT_442281 [Selaginella moellendorffii]
 gb|EFJ24822.1| hypothetical protein SELMODRAFT_442281 [Selaginella moellendorffii]
Length=431

 Score =   113 bits (283),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 103/209 (49%), Gaps = 25/209 (12%)
 Frame = -3

Query  613  PSGSRIGNWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGL----DDREGLELS  446
            P+ SR    +L  + +N            G  PC +  +      GL    +  E + LS
Sbjct  48   PASSRDAQVILQRVSEN------------GTRPCHNISTEAAYFFGLPMEGNGEEMITLS  95

Query  445  TGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRFHLQVHPDFH  266
            T   H+F   +    G   C GGD++EIDLSG +WKSRP   DLG+G+Y   L+V  +F 
Sbjct  96   TEVSHKFWIVSYAADGSRRCHGGDFYEIDLSGHQWKSRPSVTDLGDGSYLVELRVDGEFT  155

Query  265  GDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKS-----RAELPEISQCVRSDL  101
            G Y +  ILL+ ++ GM  S   +A D+ +    + FT S     R  LP    C  SD 
Sbjct  156  GIYTLRAILLYSNFHGMDHSATEWAVDKEVFRLQIHFTSSTGGSTRTTLP---LCTSSDF  212

Query  100  -ARNVWSGRWTRHAKNDTCLVDNGGRFIC  17
             ++  W G+WTR   +++C +D  GR++C
Sbjct  213  TSKKPWLGKWTRTKFDESCALDEDGRYLC  241



>ref|XP_002982758.1| hypothetical protein SELMODRAFT_117058 [Selaginella moellendorffii]
 gb|EFJ16003.1| hypothetical protein SELMODRAFT_117058 [Selaginella moellendorffii]
Length=493

 Score =   114 bits (284),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 92/162 (57%), Gaps = 6/162 (4%)
 Frame = -3

Query  493  GIRVPGLDDREG-LELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKD  317
            G+ +PG    EG + +STG +H+F   +    G+  C GGD++E DLSG KWKSRPP  D
Sbjct  53   GLPMPG---NEGPITMSTGVVHKFWIVSYAADGRRRCRGGDFYETDLSGHKWKSRPPITD  109

Query  316  LGNGTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAE  137
             GNG+Y   L+V   F G+Y +  ILL+ ++ GM  +P+ +A +  +    + F  ++ +
Sbjct  110  YGNGSYLVELKVDKGFEGNYTLKAILLYSNFHGMDKNPEPWALETQVFQLQIHFVNNKIQ  169

Query  136  LPE-ISQCVRSDL-ARNVWSGRWTRHAKNDTCLVDNGGRFIC  17
             P  +  C    L +   W G+WTR   +++C +D  GR+ C
Sbjct  170  RPSPLPLCTSKSLKSAKTWLGKWTRMKFDESCKLDEEGRYRC  211



>ref|XP_002983521.1| hypothetical protein SELMODRAFT_422715 [Selaginella moellendorffii]
 gb|EFJ15422.1| hypothetical protein SELMODRAFT_422715 [Selaginella moellendorffii]
Length=438

 Score =   111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 88/158 (56%), Gaps = 9/158 (6%)
 Frame = -3

Query  472  DDREGLELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGNGTYRF  293
            ++ E + LST   H+F   +    G   C GGD++EIDLSG +WKSRP   DLG+G+Y  
Sbjct  4    NEEEMITLSTEVSHKFWIVSYAADGSRRCHGGDFYEIDLSGHQWKSRPSVTDLGDGSYLV  63

Query  292  HLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKS-----RAELPE  128
             L+V  +F G Y +  ILL+ ++ GM  S   +A D+ +    + FT S     R  LP 
Sbjct  64   ELKVDGEFTGIYTLRAILLYSNFHGMDHSATEWAVDKEVFRLQIHFTSSTGGSTRTTLP-  122

Query  127  ISQCVRSDL-ARNVWSGRWTRHAKNDTCLVDNGGRFIC  17
               C  SD  ++  W G+WTR   +++C +D  GR++C
Sbjct  123  --LCTSSDFTSKKPWLGKWTRTKFDESCALDEDGRYLC  158



>ref|XP_002990014.1| hypothetical protein SELMODRAFT_428507 [Selaginella moellendorffii]
 gb|EFJ09027.1| hypothetical protein SELMODRAFT_428507 [Selaginella moellendorffii]
Length=527

 Score =   109 bits (272),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 89/166 (54%), Gaps = 8/166 (5%)
 Frame = -3

Query  484  VPGLDDREGL-ELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGN  308
            VP  ++  G+  LST  +H F   +    G   C GGD++E DLSG KWKSRPPT D G+
Sbjct  84   VPRPEESSGIITLSTDQVHRFWIVSFAADGSKRCFGGDFYETDLSGPKWKSRPPTTDFGD  143

Query  307  GTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKS--RAEL  134
            G+Y   L+V  DF G Y+   ILLF +  GM   P+R+   +   V  + FT S      
Sbjct  144  GSYLVELKVDGDFAGIYSFKAILLFANLHGMDSHPERWFRGQEQFVLQINFTSSGEHHRS  203

Query  133  PEISQCVRSDL---ARNVWSGRWTRH--AKNDTCLVDNGGRFICQD  11
              +  C  +DL   A   W G+WTR   +  ++C +D+ GR++C D
Sbjct  204  RPLPVCTSNDLKSSAPTKWWGQWTRSLTSNENSCELDHDGRYLCLD  249



>ref|XP_002968966.1| hypothetical protein SELMODRAFT_409717 [Selaginella moellendorffii]
 gb|EFJ30082.1| hypothetical protein SELMODRAFT_409717 [Selaginella moellendorffii]
Length=527

 Score =   108 bits (270),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 89/166 (54%), Gaps = 8/166 (5%)
 Frame = -3

Query  484  VPGLDDREGL-ELSTGDIHEFVFQAVDEKGQAHCLGGDYFEIDLSGEKWKSRPPTKDLGN  308
            VP  ++  G+  LST  +H F   +    G   C GGD++E DLSG KWKSRPPT D G+
Sbjct  84   VPRPEESSGIITLSTDQVHRFWIVSFAADGSKRCFGGDFYETDLSGPKWKSRPPTTDFGD  143

Query  307  GTYRFHLQVHPDFHGDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKS--RAEL  134
            G+Y   L+V  DF G Y+   ILLF +  GM   P+R+   +   V  + FT S      
Sbjct  144  GSYLVELKVDGDFAGIYSFKAILLFANLHGMDSHPERWFRGQEQFVLQINFTSSGEHHRS  203

Query  133  PEISQCVRSDL---ARNVWSGRWTRHAKND--TCLVDNGGRFICQD  11
              +  C  +DL   A   W G+WTR   ++  +C +D+ GR++C D
Sbjct  204  RPLPVCTSNDLKSSAPTKWWGQWTRSLTSNEKSCELDHDGRYLCLD  249



>gb|EMT03338.1| hypothetical protein F775_08489 [Aegilops tauschii]
Length=454

 Score = 88.2 bits (217),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 63/96 (66%), Gaps = 2/96 (2%)
 Frame = -3

Query  289  LQVHPDFH-GDYNVTIILLFQHYEGMRFSPQRFAFDRVLRVFPVKFTKSRAELPEISQCV  113
            + V P F  G++++TI+LLF+ +EG++FS  RF +   LR  P+ F    A LP +  C 
Sbjct  1    MSVAPRFAAGEFHLTIVLLFRSFEGLKFSSARFKYRVELRRIPLLFRPGNASLPALETCR  60

Query  112  RSDLARNVWSGRWTRHAKNDTCL-VDNGGRFICQDP  8
             +D AR+V SGRWTR A+ND C+ VD+ GR+ C +P
Sbjct  61   AADFARDVCSGRWTRLARNDRCVDVDDAGRYRCLEP  96



>gb|AEN81784.1| AT3G06150-like protein, partial [Capsella grandiflora]
 gb|AEN81785.1| AT3G06150-like protein, partial [Capsella grandiflora]
 gb|AEN81786.1| AT3G06150-like protein, partial [Capsella grandiflora]
 gb|AEN81787.1| AT3G06150-like protein, partial [Capsella grandiflora]
 gb|AEN81788.1| AT3G06150-like protein, partial [Capsella grandiflora]
 gb|AEN81789.1| AT3G06150-like protein, partial [Capsella grandiflora]
Length=185

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 37/66 (56%), Gaps = 1/66 (2%)
 Frame = -3

Query  196  FAFDRVLRVFPVKFTKSR-AELPEISQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFI  20
              FDR LR   ++F K     LPE+  C RSD  R+ WSGRWTR  KND C + N GR+ 
Sbjct  1    LGFDRKLRNVRLRFVKKHDVTLPELRACKRSDFNRDAWSGRWTRLGKNDECQISNDGRYR  60

Query  19   CQDPSF  2
            C    F
Sbjct  61   CLAADF  66



>gb|AEN81790.1| AT3G06150-like protein, partial [Capsella rubella]
 gb|AEN81791.1| AT3G06150-like protein, partial [Capsella rubella]
 gb|AEN81792.1| AT3G06150-like protein, partial [Capsella rubella]
 gb|AEN81793.1| AT3G06150-like protein, partial [Capsella rubella]
 gb|AEN81794.1| AT3G06150-like protein, partial [Capsella rubella]
 gb|AEN81795.1| AT3G06150-like protein, partial [Capsella rubella]
 gb|AEN81796.1| AT3G06150-like protein, partial [Capsella rubella]
 gb|AEN81797.1| AT3G06150-like protein, partial [Capsella rubella]
Length=185

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 36/66 (55%), Gaps = 1/66 (2%)
 Frame = -3

Query  196  FAFDRVLRVFPVKFTKSR-AELPEISQCVRSDLARNVWSGRWTRHAKNDTCLVDNGGRFI  20
              FDR LR   ++F K     LP +  C RSD  R+ WSGRWTR  KND C + N GR+ 
Sbjct  1    LGFDRKLRNVRLRFVKKHDVTLPALRACKRSDFNRDAWSGRWTRLGKNDECQISNDGRYR  60

Query  19   CQDPSF  2
            C    F
Sbjct  61   CLAADF  66



>gb|AFG55779.1| hypothetical protein 0_10113_01, partial [Pinus taeda]
Length=139

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 36/76 (47%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  NWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQA  413
             W+    ++  +  LL      G +PC  + +  I   G      LEL  G +H F F A
Sbjct  63   EWIRFPDQEKETETLLRRLAENGTKPCHAAATARIVGLGFGLERPLELQAGIVHRFAFTA  122

Query  412  VDEKGQAHCLGGDYFE  365
             DEKG+  C GGDYFE
Sbjct  123  YDEKGEPRCSGGDYFE  138



>gb|AFG55770.1| hypothetical protein 0_10113_01, partial [Pinus taeda]
 gb|AFG55771.1| hypothetical protein 0_10113_01, partial [Pinus taeda]
 gb|AFG55778.1| hypothetical protein 0_10113_01, partial [Pinus taeda]
Length=139

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 36/76 (47%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  NWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQA  413
             W+    ++  +  LL      G +PC  + +  I   G      LEL  G +H F F A
Sbjct  63   EWIRFPDQEKETETLLRRLAENGTKPCHAAATARIVGLGFGLERPLELQAGIVHRFAFTA  122

Query  412  VDEKGQAHCLGGDYFE  365
             DEKG+  C GGDYFE
Sbjct  123  YDEKGEPRCSGGDYFE  138



>gb|AFG55781.1| hypothetical protein 0_10113_01, partial [Pinus taeda]
Length=139

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 36/76 (47%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  NWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQA  413
             W+    ++  +  LL      G +PC  + +  I   G      LEL  G +H F F A
Sbjct  63   EWIRFPDQEKETETLLRRLAENGTKPCHAAATARIVGLGFGLERPLELQAGIVHRFAFTA  122

Query  412  VDEKGQAHCLGGDYFE  365
             DEKG+  C GGDYFE
Sbjct  123  YDEKGEPRCSGGDYFE  138



>gb|AFG55768.1| hypothetical protein 0_10113_01, partial [Pinus taeda]
 gb|AFG55769.1| hypothetical protein 0_10113_01, partial [Pinus taeda]
 gb|AFG55772.1| hypothetical protein 0_10113_01, partial [Pinus taeda]
 gb|AFG55773.1| hypothetical protein 0_10113_01, partial [Pinus taeda]
 gb|AFG55774.1| hypothetical protein 0_10113_01, partial [Pinus taeda]
 gb|AFG55775.1| hypothetical protein 0_10113_01, partial [Pinus taeda]
 gb|AFG55776.1| hypothetical protein 0_10113_01, partial [Pinus taeda]
 gb|AFG55777.1| hypothetical protein 0_10113_01, partial [Pinus taeda]
 gb|AFG55780.1| hypothetical protein 0_10113_01, partial [Pinus taeda]
 gb|AFG55782.1| hypothetical protein 0_10113_01, partial [Pinus taeda]
Length=139

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 36/76 (47%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  NWVLAELEDNYSSKLLEGWLTPGGEPCKDSRSVGIRVPGLDDREGLELSTGDIHEFVFQA  413
             W+    ++  +  LL      G +PC  + +  I   G      LEL  G +H F F A
Sbjct  63   EWIRFPDQEKETETLLRRLAENGTKPCHAAATARIVGLGFGLERPLELQAGIVHRFAFTA  122

Query  412  VDEKGQAHCLGGDYFE  365
             DEKG+  C GGDYFE
Sbjct  123  YDEKGEPRCSGGDYFE  138



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3368954703288