BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c12923_g1_i2 len=1361 path=[1:0-399 401:400-1360]

Length=1361
                                                                      Score     E

ref|XP_010270742.1|  PREDICTED: uncharacterized protein LOC104606...    351   4e-114   
ref|XP_002285300.1|  PREDICTED: uncharacterized protein LOC100267955    345   7e-112   Vitis vinifera
ref|XP_009784026.1|  PREDICTED: uncharacterized protein LOC104232...    342   5e-111   
ref|XP_002521883.1|  conserved hypothetical protein                     342   1e-110   Ricinus communis
ref|XP_006420712.1|  hypothetical protein CICLE_v10005401mg             341   2e-110   
ref|XP_006350721.1|  PREDICTED: uncharacterized protein LOC102578...    340   5e-110   
gb|KDP38205.1|  hypothetical protein JCGZ_04848                         337   2e-108   
emb|CDP05399.1|  unnamed protein product                                336   2e-108   
ref|XP_010066522.1|  PREDICTED: uncharacterized protein LOC104453...    335   9e-108   
gb|KCW64429.1|  hypothetical protein EUGRSUZ_G02045                     336   1e-107   
ref|XP_003555863.1|  PREDICTED: uncharacterized protein LOC100797...    333   2e-107   
gb|KHN11479.1|  hypothetical protein glysoja_015374                     332   6e-107   
ref|XP_004228339.1|  PREDICTED: uncharacterized protein LOC101253921    327   3e-105   
ref|XP_009610209.1|  PREDICTED: uncharacterized protein LOC104103...    327   8e-105   
ref|XP_011021696.1|  PREDICTED: uncharacterized protein LOC105123...    327   1e-104   
ref|XP_007222640.1|  hypothetical protein PRUPE_ppa008534mg             326   1e-104   
ref|XP_011021695.1|  PREDICTED: uncharacterized protein LOC105123...    327   2e-104   
ref|XP_008220976.1|  PREDICTED: uncharacterized protein LOC103321010    323   2e-103   
ref|XP_010680050.1|  PREDICTED: uncharacterized protein LOC104895283    319   7e-102   
ref|XP_007045386.1|  Uncharacterized protein TCM_011165                 318   3e-101   
ref|XP_006470871.1|  PREDICTED: uncharacterized protein LOC102607912    315   2e-100   
gb|EEC73764.1|  hypothetical protein OsI_08432                          317   2e-100   Oryza sativa Indica Group [Indian rice]
ref|NP_001047705.1|  Os02g0672400                                       317   2e-100   Oryza sativa Japonica Group [Japonica rice]
ref|NP_172400.2|  uncharacterized protein                               314   1e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009382085.1|  PREDICTED: uncharacterized protein LOC103970148    313   2e-99    
gb|AAN41286.1|  unknown protein                                         313   4e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006647671.1|  PREDICTED: uncharacterized protein LOC102708409    313   4e-99    
dbj|BAI63590.1|  hypothetical protein                                   310   2e-98    Lotus japonicus
ref|XP_007142825.1|  hypothetical protein PHAVU_007G020000g             310   2e-98    
ref|XP_002892498.1|  hypothetical protein ARALYDRAFT_471019             310   6e-98    
ref|XP_003570077.1|  PREDICTED: uncharacterized protein LOC100839515    310   8e-98    
gb|AFK45566.1|  unknown                                                 310   9e-98    
ref|XP_010918331.1|  PREDICTED: uncharacterized protein LOC105042729    309   1e-97    
gb|EAZ24150.1|  hypothetical protein OsJ_07895                          308   4e-97    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004297793.1|  PREDICTED: uncharacterized protein LOC101308960    306   6e-97    
ref|XP_009110838.1|  PREDICTED: uncharacterized protein LOC103836345    305   2e-96    
gb|KEH44342.1|  hypothetical protein MTR_1g112360                       302   6e-96    
ref|XP_010489898.1|  PREDICTED: uncharacterized protein LOC104767591    304   7e-96    
ref|XP_010475760.1|  PREDICTED: uncharacterized protein LOC104755119    304   7e-96    
ref|XP_010458208.1|  PREDICTED: uncharacterized protein LOC104739520    304   8e-96    
gb|KFK43226.1|  hypothetical protein AALP_AA1G096700                    304   1e-95    
ref|XP_006605867.1|  PREDICTED: uncharacterized protein LOC100797...    301   2e-95    
emb|CDY31101.1|  BnaA08g26510D                                          302   4e-95    
emb|CDY32166.1|  BnaCnng06750D                                          301   5e-95    
ref|XP_006417587.1|  hypothetical protein EUTSA_v10008047mg             301   1e-94    
ref|XP_006305202.1|  hypothetical protein CARUB_v10009568mg             301   2e-94    
ref|XP_004157853.1|  PREDICTED: uncharacterized protein LOC101227649    297   4e-93    
ref|XP_004497171.1|  PREDICTED: uncharacterized protein LOC101495873    293   2e-92    
ref|XP_009351625.1|  PREDICTED: uncharacterized protein LOC103943...    292   3e-91    
gb|AFW72754.1|  hypothetical protein ZEAMMB73_044682                    292   5e-91    
ref|XP_009784027.1|  PREDICTED: uncharacterized protein LOC104232...    287   3e-90    
ref|XP_010541840.1|  PREDICTED: uncharacterized protein LOC104815221    290   3e-90    
ref|XP_008340526.1|  PREDICTED: uncharacterized protein LOC103403...    289   4e-90    
ref|NP_001136900.1|  uncharacterized protein LOC100217057               289   7e-90    Zea mays [maize]
ref|XP_009351626.1|  PREDICTED: uncharacterized protein LOC103943...    288   1e-89    
ref|XP_006855579.1|  hypothetical protein AMTR_s00044p00041520          287   1e-88    
ref|XP_008340527.1|  PREDICTED: uncharacterized protein LOC103403...    285   1e-88    
ref|XP_008460211.1|  PREDICTED: uncharacterized protein LOC103499095    284   2e-88    
ref|XP_008805048.1|  PREDICTED: uncharacterized protein LOC103718148    285   3e-88    
ref|XP_010093353.1|  hypothetical protein L484_022914                   281   5e-88    
dbj|BAJ91789.1|  predicted protein                                      280   2e-86    
ref|XP_009610210.1|  PREDICTED: uncharacterized protein LOC104103...    269   3e-83    
ref|XP_008681306.1|  PREDICTED: uncharacterized protein LOC100217...    266   2e-81    
gb|EMT17923.1|  hypothetical protein F775_08118                         266   1e-80    
ref|XP_002314748.2|  hypothetical protein POPTR_0010s10980g             265   2e-80    Populus trichocarpa [western balsam poplar]
ref|XP_010066523.1|  PREDICTED: uncharacterized protein LOC104453...    261   6e-80    
ref|XP_004955146.1|  PREDICTED: uncharacterized protein LOC101762499    255   2e-77    
ref|XP_007142824.1|  hypothetical protein PHAVU_007G020000g             249   5e-75    
gb|KDO53573.1|  hypothetical protein CISIN_1g0201161mg                  244   2e-74    
gb|KCW64431.1|  hypothetical protein EUGRSUZ_G02045                     243   5e-73    
emb|CAN65717.1|  hypothetical protein VITISV_023512                     242   1e-71    Vitis vinifera
gb|AFW72753.1|  hypothetical protein ZEAMMB73_044682                    231   3e-68    
gb|ACG33622.1|  hypothetical protein                                    231   4e-68    Zea mays [maize]
ref|XP_004140397.1|  PREDICTED: uncharacterized protein LOC101219243    215   1e-62    
gb|AFW72751.1|  hypothetical protein ZEAMMB73_044682                    205   1e-58    
ref|XP_010270743.1|  PREDICTED: uncharacterized protein LOC104606...    204   5e-58    
gb|AAD18100.1|  This gene is continued on the 5' end of BAC T12M14      194   3e-54    Arabidopsis thaliana [mouse-ear cress]
gb|AFW72749.1|  hypothetical protein ZEAMMB73_044682                    181   5e-51    
gb|KHN37405.1|  hypothetical protein glysoja_013620                     157   2e-40    
gb|AFK46098.1|  unknown                                                 132   2e-32    
gb|KDO53571.1|  hypothetical protein CISIN_1g0201162mg                  103   3e-23    
gb|KDO53570.1|  hypothetical protein CISIN_1g0201162mg                  103   6e-23    
gb|AFW72748.1|  hypothetical protein ZEAMMB73_044682                  88.2    8e-18    
gb|ACG24133.1|  hypothetical protein                                  83.6    9e-16    Zea mays [maize]
emb|CDP21747.1|  unnamed protein product                              83.6    1e-15    
emb|CDP20169.1|  unnamed protein product                              81.6    2e-15    
ref|XP_002970202.1|  hypothetical protein SELMODRAFT_441087           88.2    4e-15    
ref|XP_001767623.1|  predicted protein                                86.3    5e-15    
ref|XP_002978366.1|  hypothetical protein SELMODRAFT_443858           80.9    7e-13    
gb|AFW72750.1|  hypothetical protein ZEAMMB73_044682                  68.6    1e-10    
emb|CDP22246.1|  unnamed protein product                              63.5    7e-09    
ref|XP_004297811.1|  PREDICTED: uncharacterized protein LOC101314559  62.4    2e-08    
gb|EKC17198.1|  THUMP domain-containing protein 1                     54.7    9e-05    
gb|KDR11885.1|  THUMP domain-containing protein 1                     54.7    9e-05    
emb|CDP20332.1|  unnamed protein product                              51.2    1e-04    
gb|EZA52159.1|  THUMP domain-containing protein                       53.5    2e-04    



>ref|XP_010270742.1| PREDICTED: uncharacterized protein LOC104606974 isoform X1 [Nelumbo 
nucifera]
Length=341

 Score =   351 bits (900),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 187/325 (58%), Positives = 228/325 (70%), Gaps = 31/325 (10%)
 Frame = +1

Query  277   EIGMKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYI-  453
             E G+ PWEQH+AVI+IPRFDYNAPSS+L +SH GFL+TCPIKREKSATKEAI ILEK+I 
Sbjct  16    EEGLTPWEQHAAVINIPRFDYNAPSSLLEYSHSGFLITCPIKREKSATKEAISILEKFIV  75

Query  454   ---------------PKTAAKKRKVCPGAANGEYPDSFKNKDAGCKDDISDSDTCA----  576
                               AAK+RKVC    NG+  ++ ++   G  D I DSD  +    
Sbjct  76    SQSCGSSSECLEVLDANVAAKRRKVCIEERNGKGGNNLESTKDG--DTIRDSDGISKETS  133

Query  577   --------EKNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCH  732
                     E +  LSLVKLTRSGLLL T P   S   V+IL +I  SL+S+SL  P W H
Sbjct  134   SFSAKIGVEFSQVLSLVKLTRSGLLLLTIPRNSSYNTVDILSNIFCSLDSRSLKAPLWIH  193

Query  733   RIFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRK  912
             RI PIQ TC L+E +LR +VSKL  +F+ D QN +++PVKFAVGYNRRGIEETEMK  R 
Sbjct  194   RILPIQATCSLNEMDLRRVVSKLVQQFLDDKQNNVERPVKFAVGYNRRGIEETEMKTQRN  253

Query  913   NEYDPLS-TLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVG  1089
                D  S  LLDR+KCFSVVA A+KD++P+SVVDLK P++++L+ELLPLSG+P+GS VV 
Sbjct  254   TSKDSSSFNLLDREKCFSVVAGAVKDVLPDSVVDLKAPQLAILVELLPLSGVPNGSLVVA  313

Query  1090  VSVLPKALVSTKPRLSVKALVADIK  1164
             VSVLP  LVSTKPRL VKAL++DIK
Sbjct  314   VSVLPSNLVSTKPRLCVKALISDIK  338



>ref|XP_002285300.1| PREDICTED: uncharacterized protein LOC100267955 [Vitis vinifera]
 emb|CBI16846.3| unnamed protein product [Vitis vinifera]
Length=337

 Score =   345 bits (885),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 187/338 (55%), Positives = 231/338 (68%), Gaps = 30/338 (9%)
 Frame = +1

Query  259   VEKDKGEIGMKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICI  438
             + +++ E GMKPWEQHSAVISIPRFDYNAPSS+L HSH GFLVTC IKREKSATKEA+ I
Sbjct  1     MSEEEREEGMKPWEQHSAVISIPRFDYNAPSSLLDHSHSGFLVTCTIKREKSATKEAMPI  60

Query  439   LEKYI---------------PKTAAKKRKVCPGAANGEYPDSFKNKDA--GCKDD-----  552
             LEKY+                    K+RK+C    + E  +S +NK A   C +D     
Sbjct  61    LEKYVGSFSSCSSESLESSDANATTKRRKICTEEIDEECVNSVENKTASNNCGEDGGELS  120

Query  553   ------ISDSDTCAEKNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLN  714
                    ++ D   E  H LSLVKLTRSGLLLF FP   S   V+++  I+ SL+S S+ 
Sbjct  121   KDAGVSSANRDAIVENGHVLSLVKLTRSGLLLFVFPRNNSVDTVDVVSQIIRSLQSGSVK  180

Query  715   MPRWCHRIFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETE  894
              P WCHRIFPIQ TC LDEKEL  +V+KL  +F+ + QNK  +P+KFAVGYNRRGIEETE
Sbjct  181   PPLWCHRIFPIQATCRLDEKELHEVVTKLVVQFVNNEQNKFARPIKFAVGYNRRGIEETE  240

Query  895   MKNVRKNEYDPLS-TLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPD  1071
             MK  +    D  S  LLDR KCFSVVA+A+K  V +SVVDLK PE+SVL+ELLPLS +P+
Sbjct  241   MKIPKSTPRDCNSHALLDRKKCFSVVATAVKGAVSDSVVDLKSPELSVLVELLPLSRVPN  300

Query  1072  GSAVVGVSVLPKALVSTKPRLSVKALVADIKAKGGKRS  1185
             GS VV VSVLP+ L++TKPRL +KAL++D K  G ++S
Sbjct  301   GSMVVAVSVLPQNLITTKPRLCIKALLSDTKV-GNRKS  337



>ref|XP_009784026.1| PREDICTED: uncharacterized protein LOC104232500 isoform X1 [Nicotiana 
sylvestris]
Length=322

 Score =   342 bits (878),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 202/330 (61%), Positives = 248/330 (75%), Gaps = 11/330 (3%)
 Frame = +1

Query  199   MTEEGEKEKPESGTTEIEPSVEKDKGEIGMKPWEQHSAVISIPRFDYNAPSSILRHSHCG  378
             M E+  KE  E GTT +E + ++D+    MKPWEQHSAVISIPRFDY A SS+LRHSH  
Sbjct  1     MAEDERKE--EVGTTIVEATDKEDE----MKPWEQHSAVISIPRFDYKASSSLLRHSHSA  54

Query  379   FLVTCPIKREKSATKEAICILEKYIPKTA-AKKRKVCPGAANGEYPDSFKNKDAGCKDDI  555
             FL+TCPIKREKSATKEAI ILEKYI     AK+RK+C   AN E   S   + A  +   
Sbjct  55    FLITCPIKREKSATKEAIAILEKYIVSNPDAKRRKICMEDANEECNGS---EGAANEHVN  111

Query  556   SDSDTCAEKNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHR  735
             S+SDT  +K+  LSLVKLTRSGLLLFTFP GKSP +V+I+  I  SLES  L  P WC+R
Sbjct  112   SESDTSIKKSDILSLVKLTRSGLLLFTFPFGKSPAVVDIVSQIFQSLESGILKSPLWCNR  171

Query  736   IFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKN  915
             I PIQGTC L+EKEL+ +V++L  +F+I+   +    VKFAVGYNRRGIEETEMKN+RK 
Sbjct  172   ILPIQGTCPLEEKELKKIVTQLVDQFIINRPKETGNTVKFAVGYNRRGIEETEMKNLRKT  231

Query  916   EYDP-LSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGV  1092
               DP +  LLDR+KCFSVVA+A+K++VP+S VDLK PE+SVL+E+LPLS +PD +A+VGV
Sbjct  232   SSDPDVFALLDRNKCFSVVAAAVKEVVPDSTVDLKDPELSVLVEVLPLSRVPDKTAIVGV  291

Query  1093  SVLPKALVSTKPRLSVKALVADIKAKGGKR  1182
             SVLP+ LVSTKPRL +KALV+D K   GK+
Sbjct  292   SVLPRTLVSTKPRLCIKALVSDTKEMKGKK  321



>ref|XP_002521883.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40519.1| conserved hypothetical protein [Ricinus communis]
Length=336

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 185/337 (55%), Positives = 228/337 (68%), Gaps = 15/337 (4%)
 Frame = +1

Query  208   EGEKEKPESGTTEIEPSVEKDKGEIGMKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLV  387
             E E++K ES          K+K +  MKPWEQH+A+ISIPRFDYNAPS++L +SH GFL+
Sbjct  3     EDERKKLESVPKSEREEAVKEKEKESMKPWEQHAAIISIPRFDYNAPSALLHNSHSGFLI  62

Query  388   TCPIKREKSATKEAICILEKYIPK---------TAAKKRKVCPGAANGEYPDSFKNKDAG  540
             TC IKREKSATKE + ILEKYI              K+RK   G   G      ++KD  
Sbjct  63    TCSIKREKSATKEVMSILEKYIGSYTKDSSNGSQGIKRRKTLMG---GTCAQGMESKDVS  119

Query  541   CK-DDISD-SDTCAEKNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLN  714
                D +S+ + T  E    LSLVKLTRSGLLL  F    SP    I+ +I   +ES SL 
Sbjct  120   EDPDQVSEETHTVEETGFTLSLVKLTRSGLLLLNFVGENSPDATEIVSNIFQRIESGSLK  179

Query  715   MPRWCHRIFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETE  894
              P WCHRIFPIQ TC LDEKELRT+VSKL   F+ D  NK ++P+K+AVGYNRRGIEET+
Sbjct  180   SPLWCHRIFPIQATCCLDEKELRTVVSKLVLRFINDKANKFERPIKYAVGYNRRGIEETQ  239

Query  895   MKNVRKNEYD-PLSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPD  1071
              KNV+    D  L +LLDR+KCF VVASA+KD++ +S VDLK PE+S+L+ELLPLSG+P+
Sbjct  240   AKNVKDTSKDSALCSLLDRNKCFDVVASAVKDVISDSAVDLKSPELSILVELLPLSGVPN  299

Query  1072  GSAVVGVSVLPKALVSTKPRLSVKALVADIKAKGGKR  1182
             GS V  VSVLP+ LVS KPRL +K LV+D  AK G+R
Sbjct  300   GSLVAAVSVLPQNLVSVKPRLCIKPLVSDANAKKGRR  336



>ref|XP_006420712.1| hypothetical protein CICLE_v10005401mg [Citrus clementina]
 gb|ESR33952.1| hypothetical protein CICLE_v10005401mg [Citrus clementina]
Length=331

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 181/323 (56%), Positives = 224/323 (69%), Gaps = 27/323 (8%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYI----  453
             +KPWEQHS VISIPRFDYN+PSS+L+ SH GFL+TC IKREKSATKEAI IL KY+    
Sbjct  10    LKPWEQHSRVISIPRFDYNSPSSLLQRSHSGFLLTCTIKREKSATKEAISILHKYVGHNN  69

Query  454   ---------PKTA--AKKRKVCPGAANGEYPD-----SFKNKDAG------CKDDISDSD  567
                        TA  +K+RKVC     GE  D     S +   AG      C   +  +D
Sbjct  70    IENSQCLESSNTAGDSKRRKVCTDDTGGECADGAEINSIEEDSAGGLQKNECHSSVK-TD  128

Query  568   TCAEKNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPI  747
             T  E + ++SLVKLTR+GLLL TFP   SP  +NI+ +I  SL S SL  P WCHRIFPI
Sbjct  129   TNTETDFDMSLVKLTRNGLLLLTFPREHSPNTINIVSNIFQSLGSGSLKSPVWCHRIFPI  188

Query  748   QGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDP  927
             Q TCVL EKEL+  VSKL  +F+ D QNKL +PVKFAVGYNRRG EE + K  +  +   
Sbjct  189   QATCVLKEKELQATVSKLVLQFVNDEQNKLSRPVKFAVGYNRRGFEEKQNKIPKDTKDSD  248

Query  928   LSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPK  1107
             +S LLDR+KCF++VA+A+K++V +S VDLK PE+SVL+ELLP+SG+P  S VVGVSVLP+
Sbjct  249   VSALLDRNKCFTIVAAAVKEVVSDSAVDLKSPELSVLVELLPISGLPSESLVVGVSVLPQ  308

Query  1108  ALVSTKPRLSVKALVADIKAKGG  1176
              LV+TKPRLS++ALV+   AK G
Sbjct  309   KLVTTKPRLSIRALVSGTNAKNG  331



>ref|XP_006350721.1| PREDICTED: uncharacterized protein LOC102578326 isoform X1 [Solanum 
tuberosum]
Length=335

 Score =   340 bits (872),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 191/302 (63%), Positives = 232/302 (77%), Gaps = 6/302 (2%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYI-PKT  462
             MKPWEQHSAVISIPRFDYNA SS+LRHSH GFL+TCPIKREKSATKEAI ILEKYI    
Sbjct  36    MKPWEQHSAVISIPRFDYNASSSLLRHSHSGFLITCPIKREKSATKEAISILEKYILSNH  95

Query  463   AAKKRKVCPGAANGEYPDSFKNKDAGCKDDIS-DSDTCAEKNHELSLVKLTRSGLLLFTF  639
              AK+RK C   AN E   S   ++    + ++ +S T  EK+  LSLVKLTRSGL+LF F
Sbjct  96    DAKRRKTCMDDANAECKGS---REGAANEHVNLESGTSMEKSDILSLVKLTRSGLVLFKF  152

Query  640   PCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCVLDEKELRTLVSKLFSEFMI  819
             P  KSP +V+I+  I  SLES  L  P WC+RI PIQGTC LDEKEL+ +V+KL  +FM 
Sbjct  153   PFDKSPAVVDIVSQIFQSLESGILKSPLWCNRILPIQGTCCLDEKELKKIVTKLVEQFMN  212

Query  820   DNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDP-LSTLLDRDKCFSVVASAIKDIVP  996
             + Q +    VKFAVGYNRRGIEETEMKN+R    DP +  LLDR+KCFSVVA+A+K++VP
Sbjct  213   NRQKETGNTVKFAVGYNRRGIEETEMKNLRNTSSDPDIFALLDRNKCFSVVAAAVKEVVP  272

Query  997   NSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALVSTKPRLSVKALVADIKAKGG  1176
             +S+VDLK PE+ VL+E+LPLSG+PD +A+VGVSVLP+ALV+TKPRLS+KALV+D K    
Sbjct  273   DSIVDLKDPEICVLVEVLPLSGVPDRTAIVGVSVLPRALVTTKPRLSIKALVSDTKETNK  332

Query  1177  KR  1182
             K+
Sbjct  333   KK  334



>gb|KDP38205.1| hypothetical protein JCGZ_04848 [Jatropha curcas]
Length=361

 Score =   337 bits (864),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 180/324 (56%), Positives = 217/324 (67%), Gaps = 18/324 (6%)
 Frame = +1

Query  262   EKDKGEIGMKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICIL  441
             EKD     MKPWEQH+AVI++ RFDYNAPS+ L  SH GFLVTC IKREKSATKE + IL
Sbjct  37    EKDSETKTMKPWEQHAAVINLARFDYNAPSAFLNRSHSGFLVTCSIKREKSATKEVMSIL  96

Query  442   EKYIPK---------------TAAKKRKVCPGAANGEYPDSFKNKDAG-CKDDIS-DSDT  570
             EKYI                  + K+RK+      G   +  K K     KD ++ ++D+
Sbjct  97    EKYIASHNCGTPECLESCSASQSTKRRKISIDQIGGTCAEGKKGKSINDGKDGLAKETDS  156

Query  571   CAEKNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQ  750
               E++  LSLVKLTRSGLLL TF    SP  V+IL +I   L S SL  P WCHRI PIQ
Sbjct  157   MEERSFALSLVKLTRSGLLLLTFVGENSPSTVDILSNIFQRLNSGSLKSPLWCHRILPIQ  216

Query  751   GTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDP-  927
              TC LDEKELR +VSKL  +FM D  N L +PVKFAVGYNRRGIEET  K V+    D  
Sbjct  217   ATCHLDEKELRVVVSKLVLQFMNDKANNLARPVKFAVGYNRRGIEETTAKAVKDTSKDSN  276

Query  928   LSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPK  1107
             L +LLDR+KCF VVASA+KD+V +S VDLK PE+S+L+ELLPLSG+P+GS    V+VLP+
Sbjct  277   LCSLLDRNKCFEVVASAVKDVVADSYVDLKSPELSILVELLPLSGVPNGSLFAAVTVLPQ  336

Query  1108  ALVSTKPRLSVKALVADIKAKGGK  1179
              L+S KPRL +K LV+D  AK GK
Sbjct  337   NLISVKPRLCIKPLVSDANAKNGK  360



>emb|CDP05399.1| unnamed protein product [Coffea canephora]
Length=333

 Score =   336 bits (861),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 186/323 (58%), Positives = 229/323 (71%), Gaps = 37/323 (11%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYIP---  456
             +KPWEQHSAVI+IPRFDYNAPSS+L HSH GFL+TCPIKREKSATKEA+ ILEKY+    
Sbjct  11    LKPWEQHSAVITIPRFDYNAPSSLLSHSHSGFLITCPIKREKSATKEAMSILEKYVRSLS  70

Query  457   ------------KTAAKKRKVCPGAANGEYPDSFKNKDAGCKDDISDSDTCAEK------  582
                           +AKKR++   +   E  +S + KDA   DD  +   C E       
Sbjct  71    ILNAEGSESLDVNMSAKKRRISV-STEEELGNSLERKDAA--DDFGEPGKCTENSYSLLP  127

Query  583   ------------NHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRW  726
                         N+ LSLVKLTRSGLLLF FP G+ P IV+I+ +I+   ES SL   +W
Sbjct  128   DSVKHNISHTETNNTLSLVKLTRSGLLLFIFPKGEHPAIVDIVQNIIQLRESGSLKSAQW  187

Query  727   CHRIFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNV  906
             CHRIFPIQ TC LDEKE+ ++VSKL ++F+ D +NK+ QPVKFAVGYNRRGIEETEMK+V
Sbjct  188   CHRIFPIQATCRLDEKEVHSIVSKLVNQFLKDKKNKVTQPVKFAVGYNRRGIEETEMKDV  247

Query  907   R-KNEYDPLSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAV  1083
             R  +    +S LLDR KCFS+VA+A+KD VP+S+VDLK PE++VL+E+LPLSGIP+ S V
Sbjct  248   RVTSNGSKISALLDRGKCFSIVAAAVKDAVPDSIVDLKCPELAVLLEVLPLSGIPNESVV  307

Query  1084  VGVSVLPKALVSTKPRLSVKALV  1152
             VGVSVLP+ L S+KPRL VKALV
Sbjct  308   VGVSVLPQMLFSSKPRLCVKALV  330



>ref|XP_010066522.1| PREDICTED: uncharacterized protein LOC104453614 isoform X1 [Eucalyptus 
grandis]
 gb|KCW64430.1| hypothetical protein EUGRSUZ_G02045 [Eucalyptus grandis]
Length=355

 Score =   335 bits (859),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 179/324 (55%), Positives = 218/324 (67%), Gaps = 28/324 (9%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYI----  453
             M PWEQHSAVISIPRFDYNAPSS+LR SH GFL+TC IKREKSATKEA+C+LEK+     
Sbjct  31    MTPWEQHSAVISIPRFDYNAPSSLLRRSHSGFLITCTIKREKSATKEAMCLLEKFCGAFA  90

Query  454   -----------PKTAAKKRKVCP---------GAANGEYPDSFKNKDAGCKDDISDS---  564
                         K  AK+RKVCP         G  +G+  D    +D    +D+S     
Sbjct  91    ARESTKLELADAKLTAKRRKVCPEESDQEGADGDESGQITDQCCKEDGKLSEDVSSQTKE  150

Query  565   DTCAEKNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFP  744
             D  A K+  LSLVKLT SGLLLFTFP   S   + I+ DI+ SL S   + P+WCHRIFP
Sbjct  151   DIGANKSSALSLVKLTGSGLLLFTFPHEDSTDTIQIVSDIIDSLGSADSSSPQWCHRIFP  210

Query  745   IQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVR-KNEY  921
             IQ TC L+E +LRT+V KL  +F+ D Q+ L  P+KFAVGYNRRG+EE E+KN + K + 
Sbjct  211   IQATCSLNEPDLRTVVQKLVLKFVKDKQSTLASPIKFAVGYNRRGLEEMELKNSKDKPDG  270

Query  922   DPLSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVL  1101
               L  LLDR KCF VVA+A+KD + +SVVDLK+PE+SVL+ELLPL+ IP GS V  VSVL
Sbjct  271   SDLLPLLDRRKCFEVVAAAVKDAISDSVVDLKNPEISVLVELLPLAAIPSGSLVAAVSVL  330

Query  1102  PKALVSTKPRLSVKALVADIKAKG  1173
             P  +V+TKPRL VK LV   K+K 
Sbjct  331   PPKMVTTKPRLCVKVLVPQAKSKN  354



>gb|KCW64429.1| hypothetical protein EUGRSUZ_G02045 [Eucalyptus grandis]
Length=375

 Score =   336 bits (861),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 180/329 (55%), Positives = 219/329 (67%), Gaps = 28/329 (9%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYI----  453
             M PWEQHSAVISIPRFDYNAPSS+LR SH GFL+TC IKREKSATKEA+C+LEK+     
Sbjct  31    MTPWEQHSAVISIPRFDYNAPSSLLRRSHSGFLITCTIKREKSATKEAMCLLEKFCGAFA  90

Query  454   -----------PKTAAKKRKVCP---------GAANGEYPDSFKNKDAGCKDDISDS---  564
                         K  AK+RKVCP         G  +G+  D    +D    +D+S     
Sbjct  91    ARESTKLELADAKLTAKRRKVCPEESDQEGADGDESGQITDQCCKEDGKLSEDVSSQTKE  150

Query  565   DTCAEKNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFP  744
             D  A K+  LSLVKLT SGLLLFTFP   S   + I+ DI+ SL S   + P+WCHRIFP
Sbjct  151   DIGANKSSALSLVKLTGSGLLLFTFPHEDSTDTIQIVSDIIDSLGSADSSSPQWCHRIFP  210

Query  745   IQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVR-KNEY  921
             IQ TC L+E +LRT+V KL  +F+ D Q+ L  P+KFAVGYNRRG+EE E+KN + K + 
Sbjct  211   IQATCSLNEPDLRTVVQKLVLKFVKDKQSTLASPIKFAVGYNRRGLEEMELKNSKDKPDG  270

Query  922   DPLSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVL  1101
               L  LLDR KCF VVA+A+KD + +SVVDLK+PE+SVL+ELLPL+ IP GS V  VSVL
Sbjct  271   SDLLPLLDRRKCFEVVAAAVKDAISDSVVDLKNPEISVLVELLPLAAIPSGSLVAAVSVL  330

Query  1102  PKALVSTKPRLSVKALVADIKAKGGKRSQ  1188
             P  +V+TKPRL VK LV   K+K     Q
Sbjct  331   PPKMVTTKPRLCVKVLVPQAKSKNNMNRQ  359



>ref|XP_003555863.1| PREDICTED: uncharacterized protein LOC100797260 isoform X1 [Glycine 
max]
Length=320

 Score =   333 bits (854),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 173/312 (55%), Positives = 220/312 (71%), Gaps = 17/312 (5%)
 Frame = +1

Query  277   EIGMKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYIP  456
             E GM PWEQHSAVI +PRFDYNAPSS+LR+SH GFL+TC IKREKSATKEAI IL K++ 
Sbjct  4     EKGMSPWEQHSAVIKLPRFDYNAPSSLLRNSHSGFLITCTIKREKSATKEAISILHKFLG  63

Query  457   K-------------TAAKKRKVCPGAANGEYPDSFKNKDAGCKDDISDSDTC-AEKN--H  588
                           T +K+RK+C   A  E  D     ++G    +S      AEK+   
Sbjct  64    SGHYHTLNNPNEEDTTSKRRKICTQDAAEECFDESPTANSGADGKLSSPVKAEAEKDGIA  123

Query  589   ELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCVLD  768
              LSLVKLTR+GLLL TFP    P  V I+ +I+ +LES ++++P WCHRIFPIQ TC L+
Sbjct  124   NLSLVKLTRNGLLLLTFPINTHPDTVTIVSNIIQALESGTVSLPVWCHRIFPIQATCNLN  183

Query  769   EKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDPLSTLLDR  948
             EKEL+ +VS L  +F+ D Q+KL++P+KFAVG+NRRGIEET +     N+    S LLDR
Sbjct  184   EKELQEVVSMLVKKFLADKQDKLERPLKFAVGFNRRGIEETTLAKENSNDSKAFS-LLDR  242

Query  949   DKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALVSTKP  1128
             +KCF VVASA+  +V +SVVDL+ PE+SVL+ELLPLSG+PD S +V VSVLP+ LVSTKP
Sbjct  243   NKCFGVVASAVNHVVEDSVVDLRSPELSVLVELLPLSGVPDASIIVAVSVLPRNLVSTKP  302

Query  1129  RLSVKALVADIK  1164
             RL +KAL ++ K
Sbjct  303   RLCIKALNSNTK  314



>gb|KHN11479.1| hypothetical protein glysoja_015374 [Glycine soja]
Length=320

 Score =   332 bits (851),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 172/312 (55%), Positives = 220/312 (71%), Gaps = 17/312 (5%)
 Frame = +1

Query  277   EIGMKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYIP  456
             E GM PWEQHSAVI +PRFDYNAPSS+LR+SH GFL+TC IKREKSATKEAI IL K++ 
Sbjct  4     EKGMSPWEQHSAVIKLPRFDYNAPSSLLRNSHSGFLITCTIKREKSATKEAISILHKFLG  63

Query  457   K-------------TAAKKRKVCPGAANGEYPDSFKNKDAGCKDDISDSDTC-AEKN--H  588
                           T +K+RK+C   A  E  D     ++G    +S      AEK+   
Sbjct  64    SGHYHTLNNPNEEDTTSKRRKICTQDAAEECFDESPTANSGADGKLSSPVKAEAEKDGIA  123

Query  589   ELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCVLD  768
              LSLVKLTR+GLLL TFP    P  V I+ +I+ +LES ++++P WCHRIFPIQ TC L+
Sbjct  124   NLSLVKLTRNGLLLLTFPINTHPDTVTIVSNIIQALESGTVSLPVWCHRIFPIQATCNLN  183

Query  769   EKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDPLSTLLDR  948
             EKEL+ +VS L  +F+ D Q+KL++P+KFAVG+NRRGIEET +     N+    S LLDR
Sbjct  184   EKELQEVVSMLVKKFLADKQDKLERPLKFAVGFNRRGIEETTLAKENSNDSKAFS-LLDR  242

Query  949   DKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALVSTKP  1128
             +KCF VVASA+  +V +SVVDL+ PE+SVL+ELLPLSG+P+ S +V VSVLP+ LVSTKP
Sbjct  243   NKCFGVVASAVNHVVEDSVVDLRSPELSVLVELLPLSGVPNASIIVAVSVLPRNLVSTKP  302

Query  1129  RLSVKALVADIK  1164
             RL +KAL ++ K
Sbjct  303   RLCIKALNSNTK  314



>ref|XP_004228339.1| PREDICTED: uncharacterized protein LOC101253921 [Solanum lycopersicum]
Length=317

 Score =   327 bits (839),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 187/302 (62%), Positives = 229/302 (76%), Gaps = 7/302 (2%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYIPKTA  465
             MKPWEQHS+VISIPRFDYNA SS+LRHSH GFL+TCPIKREKSATKEAI ILEKYI    
Sbjct  19    MKPWEQHSSVISIPRFDYNASSSLLRHSHSGFLITCPIKREKSATKEAISILEKYIVSNH  78

Query  466   -AKKRKVCPGAANGEYPDSFKNKDAGCKDDI-SDSDTCAEKNHELSLVKLTRSGLLLFTF  639
              AK+RK C    N E   S   ++    + + S+S T  EK+  LSLVKLTRSGL+L   
Sbjct  79    DAKRRKTCVDDVNEECKGS---REGAANEHVNSESGTSMEKSDILSLVKLTRSGLVLLKL  135

Query  640   PCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCVLDEKELRTLVSKLFSEFMI  819
             P  KSP +V+I+  I  SLES  L  P WC+RI PIQGTC LDEKEL+ +V+KL  +FM 
Sbjct  136   PFDKSPAVVDIVSQIFQSLESGILKSPLWCNRILPIQGTCCLDEKELKKIVTKLVEQFM-  194

Query  820   DNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDP-LSTLLDRDKCFSVVASAIKDIVP  996
             +N+ +    VKFAVGYNRRGIEETEMKN+R    DP +  LLDR+KCFSVVA+A+K++VP
Sbjct  195   NNRQETGDTVKFAVGYNRRGIEETEMKNLRNTSSDPDIFALLDRNKCFSVVAAAVKEVVP  254

Query  997   NSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALVSTKPRLSVKALVADIKAKGG  1176
             +S+VDLK PE+ VL+E+LPLSG+PD +A+VGVSVLP+ALV+TKPRL +KALV+D K    
Sbjct  255   DSIVDLKDPEICVLVEVLPLSGVPDRTAIVGVSVLPRALVTTKPRLCIKALVSDTKETNK  314

Query  1177  KR  1182
             K+
Sbjct  315   KK  316



>ref|XP_009610209.1| PREDICTED: uncharacterized protein LOC104103942 isoform X1 [Nicotiana 
tomentosiformis]
Length=330

 Score =   327 bits (837),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 203/332 (61%), Positives = 245/332 (74%), Gaps = 16/332 (5%)
 Frame = +1

Query  199   MTEEGEKEKPESGTTEIE--------PSVEKDKGEIGMKPWEQHSAVISIPRFDYNAPSS  354
             M E+  KE  E GTT +E           EK++GE  MKPWEQHSAVISIPRFDY A SS
Sbjct  1     MAEDERKE--EVGTTIVEGRDKDDDDEQEEKEEGE-AMKPWEQHSAVISIPRFDYKASSS  57

Query  355   ILRHSHCGFLVTCPIKREKSATKEAICILEKYIPKTA-AKKRKVCPGAANGEYPDSFKNK  531
             +LRHSH  FL+TCPIKREKSATKEAI +LEKYI     AK+RK+C   AN E   S   +
Sbjct  58    LLRHSHSAFLITCPIKREKSATKEAIALLEKYIVSNPDAKRRKICMEDANEECNGS--GE  115

Query  532   DAGCKDDISDSDTCAEKNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSL  711
              A  +   S+S T  EK+  LSL+KLTRSGLLLFTFP GKSP +V+I+  I  SLES  L
Sbjct  116   GAVNEHVNSESGTSIEKSDILSLIKLTRSGLLLFTFPFGKSPAVVDIVSQIFQSLESGIL  175

Query  712   NMPRWCHRIFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEET  891
               P WC+RI PIQGTC L+EKEL+ +V++L  +FM + Q +    VKFAVGYNRRGIEET
Sbjct  176   KSPLWCNRILPIQGTCPLEEKELKKIVTQLVDQFMTNRQKETGNTVKFAVGYNRRGIEET  235

Query  892   EMKNVRKNEYDP-LSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIP  1068
             EMKN+RK   DP +  LLDR+KCFSVVA+A+K++VP+S+VDLK PE+SVL+E+LPLS +P
Sbjct  236   EMKNLRKACSDPDVFALLDRNKCFSVVAAAVKEVVPDSIVDLKEPELSVLVEVLPLSRVP  295

Query  1069  DGSAVVGVSVLPKALVSTKPRLSVKALVADIK  1164
             D  A+VGVSVLP+ LVSTKPRL VKALV+D K
Sbjct  296   D-KAIVGVSVLPRMLVSTKPRLCVKALVSDTK  326



>ref|XP_011021696.1| PREDICTED: uncharacterized protein LOC105123696 isoform X2 [Populus 
euphratica]
Length=354

 Score =   327 bits (839),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 175/323 (54%), Positives = 220/323 (68%), Gaps = 28/323 (9%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYIP---  456
             MKPWEQH+ VI++PRFDYNAPS++L HSH GFL+TC IKREKSATKEA+ ILEKY+    
Sbjct  31    MKPWEQHAGVINMPRFDYNAPSALLHHSHSGFLITCSIKREKSATKEAMSILEKYVESYN  90

Query  457   ------------KTAAKKRKVCPGAANGEYPDSFKNKD-------AGCKDD---ISDSDT  570
                           +AKKR++     + +  +  K++           KDD   +S +D 
Sbjct  91    SGSSESLERSDENISAKKRRILTDETSAKCDEDVKSESIIDEISGGPAKDDCHSLSIADA  150

Query  571   CAEKNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQ  750
               E+   LSLVKLT SGL+L TFP       V+++ +I   LES  L  P WCHRIFPIQ
Sbjct  151   PVERGFVLSLVKLTGSGLVLLTFPRENPSFTVDVISNIFQCLESGILKSPLWCHRIFPIQ  210

Query  751   GTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKN--EYD  924
              TC+L EKELR +VSKL  +F+ D QNKL +P+KFAVGYNRRGIEET MKN++ N  + D
Sbjct  211   ATCLLIEKELRAVVSKLVLQFINDKQNKLARPIKFAVGYNRRGIEETCMKNLKDNPKDSD  270

Query  925   PLSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLP  1104
             P+  +LDR KCF VVASAIKD +P S VDLK PE+SVL+ELLPLSG+P+GS V  VSVLP
Sbjct  271   PV-PMLDRSKCFDVVASAIKDAIPESAVDLKSPELSVLVELLPLSGVPNGSLVAAVSVLP  329

Query  1105  KALVSTKPRLSVKALVADIKAKG  1173
             + LVS KPRL +K L++D  A+ 
Sbjct  330   QNLVSVKPRLCIKPLISDANARN  352



>ref|XP_007222640.1| hypothetical protein PRUPE_ppa008534mg [Prunus persica]
 gb|EMJ23839.1| hypothetical protein PRUPE_ppa008534mg [Prunus persica]
Length=328

 Score =   326 bits (836),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 175/315 (56%), Positives = 217/315 (69%), Gaps = 24/315 (8%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYIP---  456
             M PWEQHS VISIPRFDYNAPSS+L+HSH GFL+TCPIKREKSATKEAI +L KY+    
Sbjct  20    MAPWEQHSTVISIPRFDYNAPSSLLQHSHSGFLITCPIKREKSATKEAISLLAKYVQCFN  79

Query  457   ------KTAAKKRKVCPGAANGEYPDSFKNKDAGCKDDISDS--------DTCAEKNHEL  594
                   +  +K+RK+     +GE   +         DD+ +         D   + +  L
Sbjct  80    RCSSEEEAVSKRRKLSKENTDGEEATA---NSGDAHDDVQEGPPLPPAKVDAEGDTSPLL  136

Query  595   SLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCVLDEK  774
             SLVKLT+SGLLLFTFP   SP +V+ +  I+HS+ES S   P WCHRIFPIQ TC L+EK
Sbjct  137   SLVKLTKSGLLLFTFPKSTSPDVVDTVSKIMHSVESGSCGSPLWCHRIFPIQATCSLNEK  196

Query  775   ELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDPLSTLLDRDK  954
             EL  +VSKL  +F+ +NQ KL +P+KFAVGYNRRG+E TE+   +  E      LLDRDK
Sbjct  197   ELHEVVSKLVLQFLNNNQ-KLARPIKFAVGYNRRGVE-TELNTSK--EASNAVVLLDRDK  252

Query  955   CFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALVSTKPRL  1134
             CF +VASA+  +V +SVVDLK PE++VLIELLPLSG+P  S VV VSVLP+ +VS KPRL
Sbjct  253   CFEIVASAVTGVVSDSVVDLKSPELAVLIELLPLSGVPKESLVVAVSVLPRNVVSVKPRL  312

Query  1135  SVKALVADIKAKGGK  1179
              +KALV+D K KG K
Sbjct  313   CIKALVSDTKTKGKK  327



>ref|XP_011021695.1| PREDICTED: uncharacterized protein LOC105123696 isoform X1 [Populus 
euphratica]
Length=356

 Score =   327 bits (838),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 175/325 (54%), Positives = 220/325 (68%), Gaps = 30/325 (9%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYIP---  456
             MKPWEQH+ VI++PRFDYNAPS++L HSH GFL+TC IKREKSATKEA+ ILEKY+    
Sbjct  31    MKPWEQHAGVINMPRFDYNAPSALLHHSHSGFLITCSIKREKSATKEAMSILEKYVESYN  90

Query  457   ------------KTAAKKRKVCPGAANGEYPDSFKNKD---------AGCKDD---ISDS  564
                           +AKKR++     + +  +  K++             KDD   +S +
Sbjct  91    SGSSESLERSDENISAKKRRILTDETSAKCDEDVKSESIIDEISVTGGPAKDDCHSLSIA  150

Query  565   DTCAEKNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFP  744
             D   E+   LSLVKLT SGL+L TFP       V+++ +I   LES  L  P WCHRIFP
Sbjct  151   DAPVERGFVLSLVKLTGSGLVLLTFPRENPSFTVDVISNIFQCLESGILKSPLWCHRIFP  210

Query  745   IQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKN--E  918
             IQ TC+L EKELR +VSKL  +F+ D QNKL +P+KFAVGYNRRGIEET MKN++ N  +
Sbjct  211   IQATCLLIEKELRAVVSKLVLQFINDKQNKLARPIKFAVGYNRRGIEETCMKNLKDNPKD  270

Query  919   YDPLSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSV  1098
              DP+  +LDR KCF VVASAIKD +P S VDLK PE+SVL+ELLPLSG+P+GS V  VSV
Sbjct  271   SDPV-PMLDRSKCFDVVASAIKDAIPESAVDLKSPELSVLVELLPLSGVPNGSLVAAVSV  329

Query  1099  LPKALVSTKPRLSVKALVADIKAKG  1173
             LP+ LVS KPRL +K L++D  A+ 
Sbjct  330   LPQNLVSVKPRLCIKPLISDANARN  354



>ref|XP_008220976.1| PREDICTED: uncharacterized protein LOC103321010 [Prunus mume]
Length=328

 Score =   323 bits (828),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 173/315 (55%), Positives = 217/315 (69%), Gaps = 24/315 (8%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYIP---  456
             M PWEQHS VISIPRFDYNAPSS+L+HSH GFL+TCPIKREKSATKEAI +L KY+    
Sbjct  20    MAPWEQHSTVISIPRFDYNAPSSLLQHSHSGFLITCPIKREKSATKEAISLLAKYVQCFN  79

Query  457   ------KTAAKKRKVCPGAANGEYPDSFKNKDAGCKDDISDS--------DTCAEKNHEL  594
                   +  +K+RK+     +GE   +         DD+ +         D   + +  L
Sbjct  80    RCSSEEEAVSKRRKLSKENTDGEEATA---NSGDAHDDVQEGPPLPPAKVDAEGDTSPLL  136

Query  595   SLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCVLDEK  774
             SLVKLT+SGLLLFTFP   SP +V+ +  I+HS+ES+S   P WCHRIFPIQ TC L+E+
Sbjct  137   SLVKLTKSGLLLFTFPKNTSPDVVDTVSKIMHSVESRSCGSPLWCHRIFPIQATCSLNEE  196

Query  775   ELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDPLSTLLDRDK  954
             EL  +VSKL  +F+ +NQ KL +P+KFAVGYNRRG+E TE+   +  E      LLDRDK
Sbjct  197   ELHEVVSKLVLQFLNNNQ-KLARPIKFAVGYNRRGVE-TELNTSK--EASNAVVLLDRDK  252

Query  955   CFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALVSTKPRL  1134
             CF +VASA+  +V +SVVDLK PE++VLIELLPLS +P  S VV VSVLP+ +VS KPRL
Sbjct  253   CFEIVASAVTGVVSDSVVDLKSPELAVLIELLPLSRVPKDSLVVAVSVLPQNVVSVKPRL  312

Query  1135  SVKALVADIKAKGGK  1179
              +KALV+D K KG K
Sbjct  313   CIKALVSDTKTKGKK  327



>ref|XP_010680050.1| PREDICTED: uncharacterized protein LOC104895283 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010680051.1| PREDICTED: uncharacterized protein LOC104895283 [Beta vulgaris 
subsp. vulgaris]
Length=339

 Score =   319 bits (818),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 181/311 (58%), Positives = 221/311 (71%), Gaps = 20/311 (6%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYIPKTA  465
             MKPWEQHSA+ISIPRFDYNAPSS+L+ SH GFL+TCPIKREKSATKEAI IL KYI  + 
Sbjct  29    MKPWEQHSAIISIPRFDYNAPSSLLQFSHSGFLITCPIKREKSATKEAISILAKYIDFSV  88

Query  466   ------------AKKRKVCPGAANGEYPDSFKNKDAGCKDD---ISDSDTCAEKNHELSL  600
                          K+RK+  G   G+   + K++    KDD      +D   ++   L L
Sbjct  89    SDSLGGSDSSENGKRRKL--GQTEGDSAVTIKSELV--KDDSQSFGATDDFGKQTPNLLL  144

Query  601   VKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCVLDEKEL  780
             VK+TRSGL+LFTFP G S   V+I+  I  SLES  L  P WCHRIFPIQ TC L+EKE+
Sbjct  145   VKVTRSGLVLFTFPKGSSSDPVSIVSHINQSLESGELKRPLWCHRIFPIQATCRLNEKEV  204

Query  781   RTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDP-LSTLLDRDKC  957
              T VS L  +++ D  NK   P+KFAVGYNRRGIEETEMK V+ N  DP + TLLDR+KC
Sbjct  205   STTVSSLVLKYVDDKSNKFSGPLKFAVGYNRRGIEETEMKTVKDNVSDPNMCTLLDRNKC  264

Query  958   FSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALVSTKPRLS  1137
             FSVVA+A+K++V +S VDLK PE+ +LIELLPLS +P+GS V  +SVL + LVSTKPRL 
Sbjct  265   FSVVAAAVKEVVSDSTVDLKSPELCILIELLPLSRVPNGSLVTAISVLSRELVSTKPRLC  324

Query  1138  VKALVADIKAK  1170
             VKALV+D+KAK
Sbjct  325   VKALVSDLKAK  335



>ref|XP_007045386.1| Uncharacterized protein TCM_011165 [Theobroma cacao]
 gb|EOY01218.1| Uncharacterized protein TCM_011165 [Theobroma cacao]
Length=344

 Score =   318 bits (815),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 173/315 (55%), Positives = 218/315 (69%), Gaps = 27/315 (9%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYI----  453
             M PWEQH+++ISIPRFDY APSS+L+ SH  FL+TC IKREKSATKEA+ I  KY+    
Sbjct  26    MTPWEQHASIISIPRFDYKAPSSLLQRSHSAFLITCTIKREKSATKEAMSIFSKYVGSFK  85

Query  454   -------PKTAAKKRKVCPGAANGEYPDSFKNKD-----AGCKDD----ISDSDTCAEKN  585
                        AK+RK+C    +    +S  + +      G ++D     + +D     +
Sbjct  86    SEISCSDANADAKRRKICTDEIDQNIANSVDSSEITEAAGGIQNDDHFSSAKTDKSGAPD  145

Query  586   HELSLVKLTRSGLLLFTFPCGKSP-PIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCV  762
               LSLVKLTRSGLLL TFP G++P   ++I+ DI   LES SL  P WCHRIFPIQ TC 
Sbjct  146   FVLSLVKLTRSGLLLLTFP-GENPLDTIDIVSDIFQDLESGSLKSPLWCHRIFPIQATCS  204

Query  763   LDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEM---KNVRKNEYDPLS  933
             L+EK L+ +VSKL   F+ D +NKL +P+KFAVG+NRRG EE+++   K+V KN    LS
Sbjct  205   LNEKGLQAVVSKLVLHFVNDKRNKLARPIKFAVGFNRRGTEESQVKIPKDVSKNS--DLS  262

Query  934   TLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKAL  1113
              LLDR KCFSVVA+A+K IV +SVVDLK PE+S+LIELLPLSG+P+GS VVGVSVLP+ L
Sbjct  263   VLLDRGKCFSVVAAAVKGIVSDSVVDLKSPELSILIELLPLSGVPNGSLVVGVSVLPQNL  322

Query  1114  VSTKPRLSVKALVAD  1158
             VSTKPRL +K LV D
Sbjct  323   VSTKPRLCIKPLVCD  337



>ref|XP_006470871.1| PREDICTED: uncharacterized protein LOC102607912 [Citrus sinensis]
Length=332

 Score =   315 bits (808),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 178/324 (55%), Positives = 223/324 (69%), Gaps = 28/324 (9%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYI----  453
             +KPWEQHS VISIPRFDYN+PSS+L+ SH GFL+TC IKREKSATKEAI IL KY+    
Sbjct  10    LKPWEQHSRVISIPRFDYNSPSSLLQRSHSGFLLTCTIKREKSATKEAISILHKYVGHNN  69

Query  454   ---------PKTA--AKKRKVCPG-----AANGEYPDSFKNKDAG-------CKDDISDS  564
                        TA  +K+RKVC        A+G   +S +   AG       C   +  +
Sbjct  70    IENSQRLESSNTAGDSKRRKVCTDDMGGKCADGAEINSIEEDSAGGGLQKNECHSSVKTA  129

Query  565   DTCAEKNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFP  744
              T AE + ++SLVKLTR+GLLL TFP   SP  +NI+ +I  SL S SL  P WCHRIFP
Sbjct  130   -TNAETDFDMSLVKLTRNGLLLLTFPREHSPNTINIVSNIFQSLGSGSLKSPVWCHRIFP  188

Query  745   IQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYD  924
             IQ TCVL EKEL+  VSKL  +F+ D QNKL +PVKFAVGYNRRG EE + K  +  +  
Sbjct  189   IQATCVLKEKELQATVSKLVLQFVNDEQNKLSRPVKFAVGYNRRGFEEKQNKIPKDTKDS  248

Query  925   PLSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLP  1104
              +  LLDR+KCF+VVA+A+K++V +S VDLK PE+SVL+ELLP+SG+P    VVGVS+LP
Sbjct  249   DVLALLDRNKCFTVVAAAVKEVVSDSAVDLKSPELSVLVELLPISGLPSELLVVGVSILP  308

Query  1105  KALVSTKPRLSVKALVADIKAKGG  1176
             + LV+TKPRLS++ALV+   AK G
Sbjct  309   QKLVTTKPRLSIRALVSGTNAKNG  332



>gb|EEC73764.1| hypothetical protein OsI_08432 [Oryza sativa Indica Group]
Length=366

 Score =   317 bits (811),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 172/327 (53%), Positives = 215/327 (66%), Gaps = 40/327 (12%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYI----  453
             ++PWEQH+AVI++PR+DY A  S+L  SH GFL+TCPIKREKSATKEAI ILE  I    
Sbjct  43    LQPWEQHAAVINLPRYDYRASGSLLLRSHSGFLITCPIKREKSATKEAISILENSIGHAN  102

Query  454   -----------PKTAAKKRKVCPGAANGEYPDSFKNKDAGC--KDDISDSDTCAEKNH--  588
                         + +AKKRK+C      E PD   + DA    K D S++    EK+   
Sbjct  103   NYSSEKSEPSDTEVSAKKRKIC-----SETPDIENSGDAVTYEKGDASETTGSVEKDSVS  157

Query  589   -------------ELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWC  729
                           LSLVKL+RSGLL F+FP G    +V +L  + HSL S  L  P+WC
Sbjct  158   PHSKTSKNVDDTSNLSLVKLSRSGLLFFSFPSG-GLRVVQMLTQMFHSLHSGKLKSPQWC  216

Query  730   HRIFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVR  909
             HRIFPIQ TCVL E EL T VSKLF +F+   +++ D+P+KFAVGYNRRGI+ETEMK  +
Sbjct  217   HRIFPIQETCVLSEAELHTTVSKLFLDFVKSKEDQ-DEPIKFAVGYNRRGIDETEMKGQK  275

Query  910   K-NEYDPLSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVV  1086
               NE     TL+DRD+CF VVA A+K +  NS+VDL+ PEV+VL+E+LP+SG+  GS+V 
Sbjct  276   NGNEGSKQQTLMDRDQCFKVVAGAVKSVAENSIVDLRSPEVAVLVEMLPISGVSLGSSVA  335

Query  1087  GVSVLPKALVSTKPRLSVKALVADIKA  1167
             GVSVLP  L+STKPRL VKALV D KA
Sbjct  336   GVSVLPSELISTKPRLCVKALVPDAKA  362



>ref|NP_001047705.1| Os02g0672400 [Oryza sativa Japonica Group]
 dbj|BAD27816.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD27858.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF09619.1| Os02g0672400 [Oryza sativa Japonica Group]
 dbj|BAG95255.1| unnamed protein product [Oryza sativa Japonica Group]
Length=366

 Score =   317 bits (811),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 172/327 (53%), Positives = 215/327 (66%), Gaps = 40/327 (12%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYI----  453
             ++PWEQH+AVI++PR+DY A  S+L  SH GFL+TCPIKREKSATKEAI ILE  I    
Sbjct  43    LQPWEQHAAVINLPRYDYRASGSLLLRSHSGFLITCPIKREKSATKEAISILENSIGHAN  102

Query  454   -----------PKTAAKKRKVCPGAANGEYPDSFKNKDAGC--KDDISDSDTCAEKNH--  588
                         + +AKKRK+C      E PD   + DA    K D S++    EK+   
Sbjct  103   SYSSEKSEPSDTEVSAKKRKIC-----SETPDIENSGDAVTYEKGDASETTGSVEKDSVS  157

Query  589   -------------ELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWC  729
                           LSLVKL+RSGLL F+FP G    +V +L  + HSL S  L  P+WC
Sbjct  158   PHSKTSKNVDDTSNLSLVKLSRSGLLFFSFPSG-GLRVVQMLTQMFHSLHSGKLKSPQWC  216

Query  730   HRIFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVR  909
             HRIFPIQ TCVL E EL T VSKLF +F+   +++ D+P+KFAVGYNRRGI+ETEMK  +
Sbjct  217   HRIFPIQETCVLSEAELHTTVSKLFLDFVKSKEDQ-DEPIKFAVGYNRRGIDETEMKGQK  275

Query  910   K-NEYDPLSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVV  1086
               NE     TL+DRD+CF VVA A+K +  NS+VDL+ PEV+VL+E+LP+SG+  GS+V 
Sbjct  276   NGNEGSKQQTLMDRDQCFKVVAGAVKSVAENSIVDLRSPEVAVLVEMLPISGVSLGSSVA  335

Query  1087  GVSVLPKALVSTKPRLSVKALVADIKA  1167
             GVSVLP  L+STKPRL VKALV D KA
Sbjct  336   GVSVLPSELISTKPRLCVKALVPDAKA  362



>ref|NP_172400.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK59659.1| unknown protein [Arabidopsis thaliana]
 gb|AEE28425.1| uncharacterized protein AT1G09290 [Arabidopsis thaliana]
Length=348

 Score =   314 bits (804),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 177/325 (54%), Positives = 214/325 (66%), Gaps = 22/325 (7%)
 Frame = +1

Query  265   KDKGEIG--MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICI  438
             +++GE    + PWEQHS++ISIPRFDY APSS+L HSH GFLVTC IKREKSATKE + I
Sbjct  23    RERGEEAETLTPWEQHSSIISIPRFDYKAPSSLLHHSHSGFLVTCNIKREKSATKEVMSI  82

Query  439   LEKYI-----------PKTAAKKRKVCPGAA--NGEYPDSFKN---KDAGCKDDISDSDT  570
             L KYI             TA+KK+KVC       GE     +N   ++ G   ++ D   
Sbjct  83    LGKYIGSMHEEKPEVLNSTASKKQKVCAQETEEGGEKTVPLENDALQETGENPNVEDLKL  142

Query  571   CAEKNHEL-SLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPI  747
               E+++ L SLVKLT+SGLLLFTFP   SP   NI+  +  S+ES +L  P WCHRIFP+
Sbjct  143   ANEEHNSLMSLVKLTKSGLLLFTFPVENSPNTTNIVSRVFQSMESGALKAPIWCHRIFPV  202

Query  748   QGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDP  927
             Q TC L EKELR  VSKL   F+ D  N L +PVKFA GY RRG EET+ K +RK+  D 
Sbjct  203   QATCGLTEKELRETVSKLVQRFVNDKDNTLSKPVKFAAGYQRRGAEETKGK-IRKDASDV  261

Query  928   LST--LLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVL  1101
             L    LLDR KCF  VA+ +KDIVP+SVVDLK PE+ VL+ELLPLS I  GS V  VSVL
Sbjct  262   LVQCPLLDRIKCFETVAAGVKDIVPDSVVDLKSPELCVLVELLPLSRISSGSFVAAVSVL  321

Query  1102  PKALVSTKPRLSVKALVADIKAKGG  1176
             P  LVSTKP+L +K LV + K K G
Sbjct  322   PHRLVSTKPKLCIKPLVPESKHKKG  346



>ref|XP_009382085.1| PREDICTED: uncharacterized protein LOC103970148 [Musa acuminata 
subsp. malaccensis]
Length=343

 Score =   313 bits (803),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 179/337 (53%), Positives = 226/337 (67%), Gaps = 24/337 (7%)
 Frame = +1

Query  202   TEEGEKEKPESGTTE-IEPSVEKDKGEIGMKPWEQHSAVISIPRFDYNAPSSILRHSHCG  378
             T E  +E  E G  E    S    K E GM PWEQH+AVI++PR+DY APSS+L  S  G
Sbjct  7     TREAAEESFEIGGAEDASGSAHGGKAEEGMTPWEQHAAVINLPRYDYAAPSSLLHESRSG  66

Query  379   FLVTCPIKREKSATKEAICILEKYIPKTA-----------AKKRKVCPGA----ANGEYP  513
             FL+TCPIKREKSATKEAI +LE+++  T+           AKKRK+  G     A  E  
Sbjct  67    FLITCPIKREKSATKEAISLLEEFVSCTSRSSETCSTEIPAKKRKLSTGVDPENAESEEK  126

Query  514   DSFKNKDAGCKDDISDSDTCAEKNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHS  693
             +   +      +D+  S+        LSL+KLTRSGLLLFTFP   S P+V ++ +I   
Sbjct  127   NGVNSVLEASGEDLKGSNI-------LSLMKLTRSGLLLFTFPNNISCPVVGVVSNIFQF  179

Query  694   LESKSLNMPRWCHRIFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNR  873
             L S  L  P WCHRIFPIQ TCVL+EK+L+ +VSKL  E++  +Q KL+Q +KFAVGYNR
Sbjct  180   LRSGKLKPPLWCHRIFPIQETCVLEEKDLQLVVSKLMREYLGKDQEKLEQTIKFAVGYNR  239

Query  874   RGIEETEMKNVRK-NEYDPLSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELL  1050
             RGI+ETEMK+ +  N+    STLL R+ CF VVA A+K +  NSVVDL+ PEV+VL+ELL
Sbjct  240   RGIDETEMKSQKHTNKGSVGSTLLGREACFKVVAGAVKAVAKNSVVDLRSPEVAVLVELL  299

Query  1051  PLSGIPDGSAVVGVSVLPKALVSTKPRLSVKALVADI  1161
             P+SG+P GS VVGVSVLP  +V+TKPRL VK+LVADI
Sbjct  300   PISGVPLGSLVVGVSVLPLEIVTTKPRLCVKSLVADI  336



>gb|AAN41286.1| unknown protein [Arabidopsis thaliana]
Length=373

 Score =   313 bits (803),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 177/325 (54%), Positives = 214/325 (66%), Gaps = 22/325 (7%)
 Frame = +1

Query  265   KDKGEIG--MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICI  438
             +++GE    + PWEQHS++ISIPRFDY APSS+L HSH GFLVTC IKREKSATKE + I
Sbjct  48    RERGEEAETLTPWEQHSSIISIPRFDYKAPSSLLHHSHSGFLVTCNIKREKSATKEVMSI  107

Query  439   LEKYIPK-----------TAAKKRKVCPGAA--NGEYPDSFKN---KDAGCKDDISDSDT  570
             L KYI             TA+KK+KVC       GE     +N   ++ G   ++ D   
Sbjct  108   LGKYIGSMHEEKPEVLNSTASKKQKVCAQETEEGGEKTVPLENDALQETGENPNVEDLKL  167

Query  571   CAEKNHEL-SLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPI  747
               E+++ L SLVKLT+SGLLLFTFP   SP   NI+  +  S+ES +L  P WCHRIFP+
Sbjct  168   ANEEHNSLMSLVKLTKSGLLLFTFPVENSPNTTNIVSRVFQSMESGALKAPIWCHRIFPV  227

Query  748   QGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDP  927
             Q TC L EKELR  VSKL   F+ D  N L +PVKFA GY RRG EET+ K +RK+  D 
Sbjct  228   QATCGLTEKELRETVSKLVQRFVNDKDNTLSKPVKFAAGYQRRGAEETKGK-IRKDASDV  286

Query  928   LST--LLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVL  1101
             L    LLDR KCF  VA+ +KDIVP+SVVDLK PE+ VL+ELLPLS I  GS V  VSVL
Sbjct  287   LVQCPLLDRIKCFETVAAGVKDIVPDSVVDLKSPELCVLVELLPLSRISSGSFVAAVSVL  346

Query  1102  PKALVSTKPRLSVKALVADIKAKGG  1176
             P  LVSTKP+L +K LV + K K G
Sbjct  347   PHRLVSTKPKLCIKPLVPESKHKKG  371



>ref|XP_006647671.1| PREDICTED: uncharacterized protein LOC102708409 [Oryza brachyantha]
Length=361

 Score =   313 bits (802),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 173/332 (52%), Positives = 217/332 (65%), Gaps = 42/332 (13%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYIP---  456
             ++PWEQH+AVI++PR+DY A  S+L   H GFL+TCPIKREKSATKEAI ILE  I    
Sbjct  38    LQPWEQHAAVINLPRYDYRASGSLLLRPHSGFLITCPIKREKSATKEAISILEDSIGHAS  97

Query  457   ------------KTAAKKRKVC---PGAANGEYPDSFKNKDAGCKDDISDSDTCAEK---  582
                         + AAKKRK+C   P   N E  D+ KN+    K D S++    EK   
Sbjct  98    SYSTKNSEPCDMQVAAKKRKICSETPDIENSE--DTVKNE----KCDASETTGSTEKELA  151

Query  583   ------------NHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRW  726
                            LSLVKL+RSGLL F+FP G    +V +L  + HSL+S  L  P+W
Sbjct  152   SPHSKTSENVDQTSNLSLVKLSRSGLLFFSFPTG-GLHVVQMLTQMFHSLQSGKLKSPQW  210

Query  727   CHRIFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNV  906
             CHRIFPIQ TCVL E EL   VSKLF +F+   +++ D+P+KFAVGYNRRGI+ETEMK  
Sbjct  211   CHRIFPIQETCVLSEAELHVTVSKLFLDFVKSKEDQ-DEPIKFAVGYNRRGIDETEMKGQ  269

Query  907   RK-NEYDPLSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAV  1083
             +  NE      L+DRD+CF VVA+A+K +  NS+VDL+ PEV+VL+E+LP+SG+P GS+V
Sbjct  270   KNDNEGSKQQILMDRDQCFKVVAAAVKSVTENSIVDLRSPEVAVLVEMLPISGVPLGSSV  329

Query  1084  VGVSVLPKALVSTKPRLSVKALVADIKAKGGK  1179
              GVSVLP  L+STKPRL VKALV D KA   K
Sbjct  330   AGVSVLPSELISTKPRLCVKALVPDKKAAKKK  361



>dbj|BAI63590.1| hypothetical protein [Lotus japonicus]
Length=336

 Score =   310 bits (795),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 163/293 (56%), Positives = 205/293 (70%), Gaps = 12/293 (4%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYIPKTA  465
             M PWEQHS VI + R+DYNAP+S+L HSH GFL+TC IKREKSATKEA+ ILEK      
Sbjct  50    MTPWEQHSGVIKLSRYDYNAPASLLLHSHSGFLITCTIKREKSATKEALSILEKNCRPGF  109

Query  466   AKKRKVCPGAANGEYPDSFKNKDAGCKDDISDSDTCAEKNHELSLVKLTRSGLLLFTFPC  645
              K+         G+     K  +A  KD ++D          LSLVKLTR+GLLLF +P 
Sbjct  110   IKQAWSWALMMAGKVLSPAK-AEAEDKDGVTD----------LSLVKLTRNGLLLFIYPN  158

Query  646   GKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCVLDEKELRTLVSKLFSEFMIDN  825
                P  VNI+ +I+ SLES S ++P WCHRIFPIQ TC L+EKEL+ +VS L  +F+   
Sbjct  159   NMFPDTVNIVSNIIQSLESGSTSLPVWCHRIFPIQATCRLNEKELQEVVSMLVKKFLASK  218

Query  826   QNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDPLSTLLDRDKCFSVVASAIKDIVPNSV  1005
             Q KL++P+KFAVGYNRRGIE+T+      N  +  S LLDR+KCFSVVASA+ D+V +SV
Sbjct  219   QGKLERPLKFAVGYNRRGIEDTKFAKENSNGSNAFS-LLDRNKCFSVVASAVNDVVEDSV  277

Query  1006  VDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALVSTKPRLSVKALVADIK  1164
             VDL+ PE+S+L+ELLPLS +P+GS VV VS LP+ LVSTKPRL VKAL ++ K
Sbjct  278   VDLRSPELSILVELLPLSRVPNGSLVVAVSALPRNLVSTKPRLCVKALTSNTK  330



>ref|XP_007142825.1| hypothetical protein PHAVU_007G020000g [Phaseolus vulgaris]
 gb|ESW14819.1| hypothetical protein PHAVU_007G020000g [Phaseolus vulgaris]
Length=330

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 164/312 (53%), Positives = 217/312 (70%), Gaps = 20/312 (6%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYIP---  456
             M PWEQHSAVI++PRFDYNAPSS+LR+SH GFL+TC IKREKSATKEAI IL K++    
Sbjct  14    MSPWEQHSAVINLPRFDYNAPSSLLRNSHTGFLITCTIKREKSATKEAITILRKFLEPGH  73

Query  457   ---------KTAAKKRKVCPGAANGEYPDSFKNKDAGCK--DDISDSDTCAEKNHE----  591
                       + +K++K+C   A  E  D  +N+ A     D    S   AE + +    
Sbjct  74    FDSSKNPNENSISKRQKLCSDDAGEECLDGKENESATANSGDGELSSAGKAEPDKDGVTG  133

Query  592   LSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCVLDE  771
             LSLVKLTR+GLLL TFP       VN++ +I+ + ES + +   WCHRIFPIQ TC L+E
Sbjct  134   LSLVKLTRNGLLLLTFPSHTQSDTVNVVSNIIQAFESGNGSSLAWCHRIFPIQATCSLNE  193

Query  772   KELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDPLS-TLLDR  948
             K+L+ +VS L  +F+  NQ+KL +P+KFAVG+NRRG EET   + ++N  D  + +LLDR
Sbjct  194   KKLQEVVSMLVKKFVAANQDKLQRPLKFAVGFNRRGTEETAT-SAKENSNDSKALSLLDR  252

Query  949   DKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALVSTKP  1128
             +KCF VVASA+  +V +SVVDL+ PE+SVL+ELLPLSG+P+GS +V VSV+P  LVSTKP
Sbjct  253   NKCFGVVASAVNHVVEDSVVDLRSPELSVLVELLPLSGVPNGSIIVAVSVVPSNLVSTKP  312

Query  1129  RLSVKALVADIK  1164
             RL +KAL ++ K
Sbjct  313   RLCIKALTSNTK  324



>ref|XP_002892498.1| hypothetical protein ARALYDRAFT_471019 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68757.1| hypothetical protein ARALYDRAFT_471019 [Arabidopsis lyrata subsp. 
lyrata]
Length=348

 Score =   310 bits (793),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 178/337 (53%), Positives = 220/337 (65%), Gaps = 25/337 (7%)
 Frame = +1

Query  238   TTEIEPSVEK----DKGEIGMKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKR  405
             T E EP  EK    D+ E  + PWEQHS++ISIPRFDY APSS+L HSH GFLVTC IKR
Sbjct  13    TIEEEPVSEKRERGDEAET-LPPWEQHSSIISIPRFDYKAPSSLLHHSHSGFLVTCTIKR  71

Query  406   EKSATKEAICILEKYI-------PK----TAAKKRKVCP-----GAANGEYPDSFKNKDA  537
             EKSATKE + IL K+I       P+    TA+KK+K+       G      P+    ++ 
Sbjct  72    EKSATKEVMSILAKFIGSMHEEKPQVLRSTASKKQKLSEQEIEVGEEKTVPPEDDALQET  131

Query  538   GCKDDISDSDTCAEKNHEL-SLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLN  714
             G   ++ D     E+++ L SLVKLT+SGLLLFTFP   SP   NI+  +  S+ES +L 
Sbjct  132   GGDPNVEDLKLANEEHNSLMSLVKLTKSGLLLFTFPIENSPDTTNIVSRVFQSMESGALK  191

Query  715   MPRWCHRIFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETE  894
              P WCHRIFP+Q TC L EKELR  VSKL   F+ +  N L +PVKFA GY RRG+EET+
Sbjct  192   APIWCHRIFPVQATCGLTEKELRETVSKLVQRFVDNKDNTLSKPVKFAAGYQRRGVEETK  251

Query  895   MKNVRKNEYDPLST--LLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIP  1068
              K ++K   + L    LLDR KCF  VA+ +KDIVP+SVVDLK PE+ VL+ELLPLS IP
Sbjct  252   GK-IQKEASEVLDQCPLLDRIKCFETVAAGVKDIVPDSVVDLKSPELCVLVELLPLSRIP  310

Query  1069  DGSAVVGVSVLPKALVSTKPRLSVKALVADIKAKGGK  1179
              GS V  VSVLP  LVSTKP+L +K LV + K K G+
Sbjct  311   SGSFVAAVSVLPHRLVSTKPKLCIKPLVPESKHKKGQ  347



>ref|XP_003570077.1| PREDICTED: uncharacterized protein LOC100839515 [Brachypodium 
distachyon]
Length=359

 Score =   310 bits (793),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 175/342 (51%), Positives = 222/342 (65%), Gaps = 45/342 (13%)
 Frame = +1

Query  250   EPSVEKDKGEIGMKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEA  429
             EP  +   G + ++PWEQH+AVI++PR+DY A  S+L  SH GFL+TCPIKREKSATKEA
Sbjct  26    EPVADAGGGRV-LQPWEQHAAVINLPRYDYRASRSLLLRSHSGFLITCPIKREKSATKEA  84

Query  430   ICILEKYIP---------------KTAAKKRKVCPGAANGEYP-DSFKNKDAGCKDDISD  561
             I IL +YI                + A+KKRK C  A+  E   D+  N     KDD S+
Sbjct  85    ISILGEYINPASSHSSENLEPCVIEVASKKRKTCSEASGIENSEDAVTNG----KDDASE  140

Query  562   SDTCAE---------------KNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSL  696
             S  C E               +   LSLVKL RSGLL F+F  G    +V +L ++ HSL
Sbjct  141   STGCIEVETSSLHSKTSEIIDRTSNLSLVKLARSGLLFFSFTSG-GLHVVQMLTEVFHSL  199

Query  697   ESKSLNMPRWCHRIFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQ--PVKFAVGYN  870
              S  L  P+WCHRIFPIQ TCVL E EL   VSKLF +F+   +NK DQ  P+KFAVGYN
Sbjct  200   RSGKLKSPQWCHRIFPIQETCVLSETELHATVSKLFLDFL---RNKEDQYEPIKFAVGYN  256

Query  871   RRGIEETEMKNVRKNEYDP--LSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIE  1044
             RRGI+ET  K  +KN+ D      ++DR+KCF VVA+AIK +  +++VDLK PEV+VL+E
Sbjct  257   RRGIDETVTKT-QKNDNDSSIQQAVMDREKCFKVVAAAIKSVAEDAIVDLKSPEVAVLVE  315

Query  1045  LLPLSGIPDGSAVVGVSVLPKALVSTKPRLSVKALVADIKAK  1170
             LLP+SG+P GS+V GVSVLP  LV+TKPRL ++ALV+D KAK
Sbjct  316   LLPISGVPIGSSVAGVSVLPAELVATKPRLCIRALVSDTKAK  357



>gb|AFK45566.1| unknown [Lotus japonicus]
Length=369

 Score =   310 bits (794),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 163/318 (51%), Positives = 212/318 (67%), Gaps = 29/318 (9%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYIPKTA  465
             M PWEQHS VI + R+DYN P+S+L HSH GFL+TC IKREKSATKEA+ ILEK++    
Sbjct  50    MTPWEQHSGVIKLSRYDYNTPASLLLHSHSGFLITCTIKREKSATKEALSILEKFVGAFN  109

Query  466   AKKRKVCPGAANGEYPDSFKNKDAGCKD------DISDSDTCAEKNHE------------  591
             A   +       GEY  SFK      +D      D+ ++++  + + +            
Sbjct  110   AGGFECSKNP--GEY-SSFKRMRVDTQDIGGECLDVKETESVTDNSGDGKVLSPAKAEAE  166

Query  592   -------LSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQ  750
                    LSLVKLTR+GLLLF +P    P  VNI+ +I+ SLES S ++P WCHRIFPIQ
Sbjct  167   DKDGVTDLSLVKLTRNGLLLFIYPNNMFPDTVNIVSNIIQSLESGSTSLPVWCHRIFPIQ  226

Query  751   GTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDPL  930
              TC L+EKE + +VS L  +F+   Q KL++P+KFAVGYNRRGIE+T+      N  +  
Sbjct  227   ATCRLNEKEFQEVVSMLVKKFLASKQGKLERPLKFAVGYNRRGIEDTKFAKENSNGSNAF  286

Query  931   STLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKA  1110
             S LLDR+KCFSVVASA+ D+V +SVVDL+ PE+S+L+ELLPLS +P+GS VV VS LP+ 
Sbjct  287   S-LLDRNKCFSVVASAVNDVVEDSVVDLRSPELSILVELLPLSRVPNGSLVVAVSALPRN  345

Query  1111  LVSTKPRLSVKALVADIK  1164
             LVSTKPRL VKAL ++ K
Sbjct  346   LVSTKPRLCVKALTSNTK  363



>ref|XP_010918331.1| PREDICTED: uncharacterized protein LOC105042729 [Elaeis guineensis]
 ref|XP_010918332.1| PREDICTED: uncharacterized protein LOC105042729 [Elaeis guineensis]
Length=359

 Score =   309 bits (792),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 183/350 (52%), Positives = 228/350 (65%), Gaps = 36/350 (10%)
 Frame = +1

Query  217   KEKPESGTTEIEPSVEKDKGEI----GMKPWEQHSAVISIPRFDYNAPSSILRHSHCGFL  384
             +EK + G   ++   E DKG      G+ PWEQHSAVIS+PR+DY APS++L  SH GFL
Sbjct  3     EEKEQRGLCPLKEEEEDDKGHREKGEGLTPWEQHSAVISLPRYDYAAPSALLESSHSGFL  62

Query  385   VTCPIKREKSATKEAICILEKYIPKTA---------------AKKRKVCP---GAANGEY  510
             +TCPIKREKSATKEAI +LE+Y+  T                AKKRK+C    G  N E 
Sbjct  63    ITCPIKREKSATKEAISLLEEYVGCTCSRDCERLEPCDTNVPAKKRKICSSEIGPRNVE-  121

Query  511   PDSFKNKDAG-----------CKDDISDSDTCAEKNHELSLVKLTRSGLLLFTFPCGKSP  657
              ++ +N D              +   S++    ++  +LSLVKLTRSGLLLFTFP     
Sbjct  122   -NAERNGDINVLEVSGKLEEEARLGSSETTENVKRRPDLSLVKLTRSGLLLFTFPSNNFH  180

Query  658   PIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKL  837
              +V+IL D+  SL S  L +P WCHRIFPIQ TC+L EK +  +VSKL  E++ + Q++L
Sbjct  181   HVVDILSDMFLSLGSGKLKLPLWCHRIFPIQETCLLTEKNVIVVVSKLVQEYLGNEQDRL  240

Query  838   DQPVKFAVGYNRRGIEETEMKNVRKNEYDPLS-TLLDRDKCFSVVASAIKDIVPNSVVDL  1014
             D P+KFAVGYNRRGI ETEMK  +    D    TLLDRD CF VVA A+K +  N+VVDL
Sbjct  241   DGPIKFAVGYNRRGIGETEMKIQKGTVEDSEGLTLLDRDTCFKVVAGAVKAVAKNAVVDL  300

Query  1015  KHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALVSTKPRLSVKALVADIK  1164
             K PEV+VL+ELLPLSG+P G  VVGVSVLP  LV+TKPRL VK+LVAD K
Sbjct  301   KSPEVAVLVELLPLSGVPHGMLVVGVSVLPVELVTTKPRLCVKSLVADTK  350



>gb|EAZ24150.1| hypothetical protein OsJ_07895 [Oryza sativa Japonica Group]
Length=376

 Score =   308 bits (790),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 172/337 (51%), Positives = 215/337 (64%), Gaps = 50/337 (15%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYI----  453
             ++PWEQH+AVI++PR+DY A  S+L  SH GFL+TCPIKREKSATKEAI ILE  I    
Sbjct  43    LQPWEQHAAVINLPRYDYRASGSLLLRSHSGFLITCPIKREKSATKEAISILENSIGHAN  102

Query  454   -----------PKTAAKKRKVCPGAANGEYPDSFKNKDAGC--KDDISDSDTCAEKN---  585
                         + +AKKRK+C      E PD   + DA    K D S++    EK+   
Sbjct  103   SYSSEKSEPSDTEVSAKKRKIC-----SETPDIENSGDAVTYEKGDASETTGSVEKDSVS  157

Query  586   ------------HELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWC  729
                           LSLVKL+RSGLL F+FP G    +V +L  + HSL S  L  P+WC
Sbjct  158   PHSKTSKNVDDTSNLSLVKLSRSGLLFFSFPSG-GLRVVQMLTQMFHSLHSGKLKSPQWC  216

Query  730   HRIFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVR  909
             HRIFPIQ TCVL E EL T VSKLF +F+   +++ D+P+KFAVGYNRRGI+ETEMK  +
Sbjct  217   HRIFPIQETCVLSEAELHTTVSKLFLDFVKSKEDQ-DEPIKFAVGYNRRGIDETEMKGQK  275

Query  910   K-NEYDPLSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPE----------VSVLIELLPL  1056
               NE     TL+DRD+CF VVA A+K +  NS+VDL+ PE          V+VL+E+LP+
Sbjct  276   NGNEGSKQQTLMDRDQCFKVVAGAVKSVAENSIVDLRSPEHVNFWMQQMSVAVLVEMLPI  335

Query  1057  SGIPDGSAVVGVSVLPKALVSTKPRLSVKALVADIKA  1167
             SG+  GS+V GVSVLP  L+STKPRL VKALV D KA
Sbjct  336   SGVSLGSSVAGVSVLPSELISTKPRLCVKALVPDAKA  372



>ref|XP_004297793.1| PREDICTED: uncharacterized protein LOC101308960 [Fragaria vesca 
subsp. vesca]
Length=321

 Score =   306 bits (784),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 180/308 (58%), Positives = 219/308 (71%), Gaps = 16/308 (5%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYIP---  456
             M PWEQHSAVISIPRFDYNAPSS+L HSH GFL+TCPIKREKSATKEAI +  KYI    
Sbjct  16    MTPWEQHSAVISIPRFDYNAPSSLLHHSHSGFLITCPIKREKSATKEAISLFAKYIQCGN  75

Query  457   ----KTAAKKRKVCPGAANGEYPDSFKNKD---AGCKDDISDSDTCAEKNHELSLVKLTR  615
                    +K+RK+     +G+  +  +  D     C     D+D   E+   L LVKLT+
Sbjct  76    STEENLVSKRRKISEENVDGDCVNGSEGGDVEEGACSTVKVDTD--GERGPLLKLVKLTK  133

Query  616   SGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCVLDEKELRTLVS  795
             SGLLLF F    SP +V I+  IV S+ES S     WC+RIFPIQ TC L+EKELR +VS
Sbjct  134   SGLLLFIFGKSVSPDVVGIVSRIVQSVESGSSGSLLWCNRIFPIQATCSLNEKELREVVS  193

Query  796   KLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDPLSTLLDRDKCFSVVAS  975
             KL  +F+ DNQ KL +P+KFA+GYNRRGIE TE+ N  K   + L  LLDR+KCF++VAS
Sbjct  194   KLVLQFVKDNQ-KLVRPIKFAIGYNRRGIE-TEL-NTPKETPNALE-LLDRNKCFALVAS  249

Query  976   AIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALVSTKPRLSVKALVA  1155
             A+KD+V +SVVDLK PE+SVLIELLPLSG+P GS VV VSVLP+ +VS KP+LS+KALV+
Sbjct  250   AVKDVVSDSVVDLKTPELSVLIELLPLSGVPKGSLVVAVSVLPRNVVSAKPKLSIKALVS  309

Query  1156  DIKAKGGK  1179
             D K KG K
Sbjct  310   DTKTKGEK  317



>ref|XP_009110838.1| PREDICTED: uncharacterized protein LOC103836345 [Brassica rapa]
Length=337

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 165/312 (53%), Positives = 205/312 (66%), Gaps = 21/312 (7%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYI----  453
             M PWEQH+++ISIPRFDY APSS+L HSH GFLVTC IKREKSATKE + IL K +    
Sbjct  32    MAPWEQHASIISIPRFDYTAPSSLLHHSHSGFLVTCSIKREKSATKEVMSILGKVLLPLG  91

Query  454   --------PKTAAKKRKVCPGAA--NGEYPDSFKNKDAGCKDDISDSDTCAEKNHELSLV  603
                        A+K+ K+C       GE P++   K A  K+ +S+     E+   +SLV
Sbjct  92    EEKGEVLKSSDASKRLKLCGQETEETGENPNAEDLKPA--KESVSE-----EQKSLMSLV  144

Query  604   KLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCVLDEKELR  783
             KLT+SGLLLFTFP   S    +I+  +   +ES +L  P WCHRIFP+Q TC L EKEL+
Sbjct  145   KLTKSGLLLFTFPVDNSTDTTDIVSRVFPFMESGALKAPVWCHRIFPVQATCALTEKELQ  204

Query  784   TLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDPLSTLLDRDKCFS  963
               VSKL   F+ D QN L  PVKFA GYNRRG+EE + K  + +E      LLDR KCF 
Sbjct  205   ETVSKLVQRFVDDKQNTLSTPVKFAAGYNRRGVEEAKGKIQKASEVLDQCPLLDRTKCFE  264

Query  964   VVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALVSTKPRLSVK  1143
              VA+ +K IVP+SVVDLK PE+ VL+ELLPLS IP+GS V  VSVLP  LVSTKP+L++K
Sbjct  265   TVAAGVKAIVPDSVVDLKSPELCVLVELLPLSRIPNGSYVAAVSVLPHRLVSTKPKLAIK  324

Query  1144  ALVADIKAKGGK  1179
              LV + K K G+
Sbjct  325   PLVPETKQKKGQ  336



>gb|KEH44342.1| hypothetical protein MTR_1g112360 [Medicago truncatula]
Length=283

 Score =   302 bits (774),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 157/299 (53%), Positives = 210/299 (70%), Gaps = 28/299 (9%)
 Frame = +1

Query  274   GEIGMKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYI  453
             GE  MKPWEQHS+VI +PRFDYNAPSS+L HSH  FL+TC IKREKSATKEAI +L  ++
Sbjct  5     GEEEMKPWEQHSSVIRLPRFDYNAPSSLLTHSHSAFLITCTIKREKSATKEAINLLHNFL  64

Query  454   PK--TAAKKRKVCPGAANGEYPDSFKNKDAGCKDDISDSDTCAEKNHELSLVKLTRSGLL  627
                  ++K+R++              NKD G  +  +D          LSLVKL R+GL+
Sbjct  65    LNDDVSSKRRRL-------------DNKDGGGGEVTTD----------LSLVKLIRNGLV  101

Query  628   LFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCVLDEKELRTLVSKLFS  807
             LF FP       V I+ +I+ +LES+ + +P WCHRI PIQ TC L+EKEL+ +VS L  
Sbjct  102   LFIFPQDTFHDTVPIVSNIIQALESRKITLPLWCHRILPIQATCSLNEKELQEVVSMLVK  161

Query  808   EFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDPLSTLLDRDKCFSVVASAIKD  987
             +F+  NQ++L +P+KFAVG+NRRGIEET  K+ ++N  +  ++LLDR+KCF +V +A+  
Sbjct  162   KFVDANQDQLGRPLKFAVGFNRRGIEET--KSAKEN-LNGSNSLLDRNKCFQIVGTAVNS  218

Query  988   IVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALVSTKPRLSVKALVADIK  1164
             +V +SVVDL+ PE+SV +E+LPLSG+P+GS VV VSVLP  LVSTKPRLSVKAL ++ K
Sbjct  219   VVKDSVVDLRSPELSVFVEVLPLSGVPNGSIVVAVSVLPSNLVSTKPRLSVKALNSNTK  277



>ref|XP_010489898.1| PREDICTED: uncharacterized protein LOC104767591 [Camelina sativa]
Length=349

 Score =   304 bits (779),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 171/312 (55%), Positives = 205/312 (66%), Gaps = 17/312 (5%)
 Frame = +1

Query  292   PWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYIPKT---  462
             PWEQHS +ISIPRFDY APSS+L HSH GFLVTC IKREKSATKE + IL KYI      
Sbjct  38    PWEQHSNIISIPRFDYKAPSSLLHHSHSGFLVTCTIKREKSATKEVMSILGKYIVSMHEE  97

Query  463   -----AAKKRKVCPGA-ANGEYPDSFKNKDA----GCKDDISDSDTCAEKNHEL-SLVKL  609
                   +KK+K+C      GE        DA    G   ++ D     E+++ L SLVKL
Sbjct  98    KSEVLKSKKQKLCAQEIEEGEEKTVPLENDALQETGGNPNVEDPKLANEEHNSLMSLVKL  157

Query  610   TRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCVLDEKELRTL  789
             T+SGLLLFTFP   SP   +I+  +  S+ES +L  P WCHRIFP+Q TC L EKELR  
Sbjct  158   TKSGLLLFTFPVENSPDTTSIVSRVFQSMESGALKAPIWCHRIFPVQATCGLTEKELRET  217

Query  790   VSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDPLST--LLDRDKCFS  963
             VSKL   F+ D  N L +PVKFA GY RRG+EET+ K ++K   + L    LLDR KCF 
Sbjct  218   VSKLVQRFVNDKDNTLSKPVKFAAGYQRRGVEETKGK-IQKEASEVLDQCPLLDRIKCFE  276

Query  964   VVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALVSTKPRLSVK  1143
              VA+ +KDIVP+SVVDLK PE+ VL+ELLPLS IP GS V  VSVLP  LVSTKP+L +K
Sbjct  277   AVAAGVKDIVPDSVVDLKAPELCVLVELLPLSRIPSGSIVAAVSVLPHRLVSTKPKLCIK  336

Query  1144  ALVADIKAKGGK  1179
              LV + K K G+
Sbjct  337   PLVPESKHKKGQ  348



>ref|XP_010475760.1| PREDICTED: uncharacterized protein LOC104755119 [Camelina sativa]
Length=348

 Score =   304 bits (779),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 169/314 (54%), Positives = 207/314 (66%), Gaps = 17/314 (5%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYIPKT-  462
             + PWEQHS +ISIPRFDY APSS+L HSH GFLVTC IKREKSATKE + IL KYI    
Sbjct  35    LTPWEQHSRIISIPRFDYKAPSSLLHHSHSGFLVTCTIKREKSATKEVMSILGKYIVSMP  94

Query  463   -------AAKKRKVCPGA--ANGEYPDSFKN---KDAGCKDDISDSDTCAEKNHEL-SLV  603
                     +KK+K+C        E     +N   ++ G   ++ D     E+++ L SLV
Sbjct  95    EEKSEVLKSKKQKLCAQEIEEGEEKTVPLENDGLQETGGNPNVEDPKLANEEHNSLMSLV  154

Query  604   KLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCVLDEKELR  783
             KLT+SGLLLFTFP   SP   +I+  +  S+ES +L  P WCHRIFP+Q TC L EKELR
Sbjct  155   KLTKSGLLLFTFPVENSPDTTSIVSRVFQSMESGALKAPIWCHRIFPVQATCGLTEKELR  214

Query  784   TLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDPLST--LLDRDKC  957
               VSKL   F+ D  N L +PVKFA GY RRG+EET+ K ++K   + L    LLDR KC
Sbjct  215   ETVSKLVQRFVNDKDNTLSKPVKFAAGYQRRGVEETKGK-IQKEASEVLDQCPLLDRIKC  273

Query  958   FSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALVSTKPRLS  1137
             F  VA+ +KDIVP+SVVDLK PE+ VL+ELLPLS IP GS V  VSVLP  LVSTKP+L 
Sbjct  274   FETVAAGVKDIVPDSVVDLKTPELCVLVELLPLSRIPSGSIVAAVSVLPHRLVSTKPKLC  333

Query  1138  VKALVADIKAKGGK  1179
             +K LV + K K G+
Sbjct  334   IKPLVPESKHKKGQ  347



>ref|XP_010458208.1| PREDICTED: uncharacterized protein LOC104739520 [Camelina sativa]
Length=347

 Score =   304 bits (778),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 168/313 (54%), Positives = 210/313 (67%), Gaps = 17/313 (5%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYIPKT-  462
             + PWEQHS++ISIPRFDY APSS++ HSH GFLVTC IKREKSATKE + IL KYI    
Sbjct  36    LTPWEQHSSIISIPRFDYKAPSSLIHHSHSGFLVTCTIKREKSATKEVMSILGKYIASMP  95

Query  463   -------AAKKRKVCPGAANGEYPDSFKN---KDAGCKDDISDSDTCAEKNHEL-SLVKL  609
                     +KK+K+C      E  D  +N   +  G   ++ D     E+++ L SLVKL
Sbjct  96    EEISEVLKSKKQKLCAHEIE-EGEDHLENDALQQTGENPNVEDLKLANEEHNSLMSLVKL  154

Query  610   TRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCVLDEKELRTL  789
             T+SGLLLFTFP   SP   +I+  +  S+ES +L  P WCHRIFP+Q TC L EKELR  
Sbjct  155   TKSGLLLFTFPVENSPDTTSIVSRVFQSMESGALKAPIWCHRIFPVQATCGLTEKELRET  214

Query  790   VSKLFSEFMID-NQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDPLS--TLLDRDKCF  960
             VSKL   F+ D + N L +PVKFA GY RRG+EET+ K ++K   + L   +LLDR KCF
Sbjct  215   VSKLVQRFVNDKDNNTLSKPVKFAAGYQRRGVEETKGK-IQKEASEVLDQCSLLDRIKCF  273

Query  961   SVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALVSTKPRLSV  1140
               +A+ +KDIVP+SVVDLK PE+ VL+ELLPLS IP GS V  VSVLP  LVSTKP+L +
Sbjct  274   ETLAAGVKDIVPDSVVDLKAPELCVLVELLPLSRIPSGSIVAAVSVLPHRLVSTKPKLCI  333

Query  1141  KALVADIKAKGGK  1179
             K LV + K K G+
Sbjct  334   KPLVPESKHKKGQ  346



>gb|KFK43226.1| hypothetical protein AALP_AA1G096700 [Arabis alpina]
Length=351

 Score =   304 bits (778),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 173/347 (50%), Positives = 220/347 (63%), Gaps = 32/347 (9%)
 Frame = +1

Query  229   ESGTT--EIEPSVEK-DKGEIGMKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPI  399
             E G T  E+E   EK ++GE  + PWEQH+ +I++PRFDY APSS+L HSH GFLVTC I
Sbjct  6     EVGNTIEEVETVCEKRERGET-LAPWEQHAGIINMPRFDYKAPSSLLHHSHSGFLVTCNI  64

Query  400   KREKSATKEAICILEKYIP---------------KTAAKKRKVCP-----GAANGEYPDS  519
             KREKSATKE + IL KY+                  A+K++K C      G    E   +
Sbjct  65    KREKSATKEVMSILGKYLGSIHEEKSEVIISSDMNVASKRQKFCAEEIEEGEGKTESLGN  124

Query  520   FKNKDAGCKDDISDSDTCAEKNHE-----LSLVKLTRSGLLLFTFPCGKSPPIVNILFDI  684
                ++ G   ++ +  +  E  +E     +SLVKLT+SGLLLFTFP   SP   +I+  I
Sbjct  125   DGLQETGNNPNVEELKSAKESINEEHNSLMSLVKLTKSGLLLFTFPVENSPDTTSIVSRI  184

Query  685   VHSLESKSLNMPRWCHRIFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVG  864
                +ES ++  P WCHRIFP+Q TC L EKELR  VSKL   F+ D  N L +PVKFA G
Sbjct  185   FQFMESGAMKAPVWCHRIFPVQATCGLTEKELRETVSKLVQRFVNDKHNTLSKPVKFAAG  244

Query  865   YNRRGIEETEMKNVRKNEYDPLST--LLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVL  1038
             YNRRG EET+ K ++K   + L    LLDR KCF  VA+ +KDIVP+SVVDLK PE+ VL
Sbjct  245   YNRRGGEETKGK-IQKEAPEVLDQCPLLDRSKCFETVAAGVKDIVPDSVVDLKSPELCVL  303

Query  1039  IELLPLSGIPDGSAVVGVSVLPKALVSTKPRLSVKALVADIKAKGGK  1179
             +ELLPLS IP+GS V  VSVLP  LVSTKP+L++K LV + K K G+
Sbjct  304   VELLPLSRIPNGSFVAAVSVLPHRLVSTKPKLAIKPLVPETKHKKGQ  350



>ref|XP_006605867.1| PREDICTED: uncharacterized protein LOC100797260 isoform X2 [Glycine 
max]
Length=307

 Score =   301 bits (772),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 163/312 (52%), Positives = 209/312 (67%), Gaps = 30/312 (10%)
 Frame = +1

Query  277   EIGMKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYIP  456
             E GM PWEQHSAVI +PRFDYNAPSS+L             +REKSATKEAI IL K++ 
Sbjct  4     EKGMSPWEQHSAVIKLPRFDYNAPSSLL-------------QREKSATKEAISILHKFLG  50

Query  457   K-------------TAAKKRKVCPGAANGEYPDSFKNKDAGCKDDISDSDTC-AEKN--H  588
                           T +K+RK+C   A  E  D     ++G    +S      AEK+   
Sbjct  51    SGHYHTLNNPNEEDTTSKRRKICTQDAAEECFDESPTANSGADGKLSSPVKAEAEKDGIA  110

Query  589   ELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCVLD  768
              LSLVKLTR+GLLL TFP    P  V I+ +I+ +LES ++++P WCHRIFPIQ TC L+
Sbjct  111   NLSLVKLTRNGLLLLTFPINTHPDTVTIVSNIIQALESGTVSLPVWCHRIFPIQATCNLN  170

Query  769   EKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDPLSTLLDR  948
             EKEL+ +VS L  +F+ D Q+KL++P+KFAVG+NRRGIEET +     N+    S LLDR
Sbjct  171   EKELQEVVSMLVKKFLADKQDKLERPLKFAVGFNRRGIEETTLAKENSNDSKAFS-LLDR  229

Query  949   DKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALVSTKP  1128
             +KCF VVASA+  +V +SVVDL+ PE+SVL+ELLPLSG+PD S +V VSVLP+ LVSTKP
Sbjct  230   NKCFGVVASAVNHVVEDSVVDLRSPELSVLVELLPLSGVPDASIIVAVSVLPRNLVSTKP  289

Query  1129  RLSVKALVADIK  1164
             RL +KAL ++ K
Sbjct  290   RLCIKALNSNTK  301



>emb|CDY31101.1| BnaA08g26510D [Brassica napus]
Length=339

 Score =   302 bits (773),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 164/312 (53%), Positives = 202/312 (65%), Gaps = 21/312 (7%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYI----  453
             M PWEQH+++ISIPRFDY APSS+L HSH GFLVTC IKREKSATKE + IL K +    
Sbjct  34    MAPWEQHASIISIPRFDYTAPSSLLHHSHSGFLVTCSIKREKSATKEVMSILGKVLLPLG  93

Query  454   --------PKTAAKKRKVCPGAA--NGEYPDSFKNKDAGCKDDISDSDTCAEKNHELSLV  603
                        A+K+ K+C       GE P+    K A  K+ +S+     E+   +SLV
Sbjct  94    EEKGEVLKSSDASKRPKLCGQETEETGENPNVEDLKPA--KESVSE-----EQKSLMSLV  146

Query  604   KLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCVLDEKELR  783
             KLT+SGLLLFTFP   S     I+  +   +ES +L  P WCHRI P+Q TC L EKEL+
Sbjct  147   KLTKSGLLLFTFPVDNSTDTTGIVSRMFQFMESGALKAPVWCHRILPVQATCALTEKELQ  206

Query  784   TLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDPLSTLLDRDKCFS  963
               VSKL   F+ D QN L  PVKFA GYNRRG+EE + K  + +E      LLDR KCF 
Sbjct  207   ETVSKLVQRFVNDKQNTLSTPVKFAAGYNRRGVEEAKGKIQKASEVLDQCPLLDRTKCFE  266

Query  964   VVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALVSTKPRLSVK  1143
              VA+ +K IVP+SVVDLK PE+ VL+ELLPLS IP+GS V  VSVLP  LVSTKP+L++K
Sbjct  267   TVAAGVKAIVPDSVVDLKSPELCVLVELLPLSRIPNGSYVAAVSVLPHRLVSTKPKLAIK  326

Query  1144  ALVADIKAKGGK  1179
              LV + K K G+
Sbjct  327   PLVPETKQKKGQ  338



>emb|CDY32166.1| BnaCnng06750D [Brassica napus]
Length=334

 Score =   301 bits (772),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 161/308 (52%), Positives = 205/308 (67%), Gaps = 17/308 (6%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYI----  453
             M PWEQH++VISIPRFDY APSS+L HSH GFLVTC IKREKSATKEA+ IL K +    
Sbjct  33    MAPWEQHASVISIPRFDYTAPSSLLHHSHSGFLVTCSIKREKSATKEAMSILGKVLLPLG  92

Query  454   ----PKTAAKKRKVCPGAANGEYPDSFKNKDAGCKDDISDSDTCAEKNHE--LSLVKLTR  615
                     +K+ K+C      E  ++ +N +A   +D+  +     + H+  +SLVKLT+
Sbjct  93    EVLKSSDESKRPKLC----AQETEETGENLNA---EDLKPAKESVNEEHKSLMSLVKLTK  145

Query  616   SGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCVLDEKELRTLVS  795
             SGLLLFTFP   S    +I+  +   ++S +L  P WCHRIFP+Q TC L EKEL+  VS
Sbjct  146   SGLLLFTFPVDNSTDTTDIVSRVFQCVKSGALKAPVWCHRIFPVQATCALTEKELQETVS  205

Query  796   KLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDPLSTLLDRDKCFSVVAS  975
             KL   F+ D QN L  PVKFA GYNRRG+EE + K  + +E      LLDR KCF  VA+
Sbjct  206   KLVQRFVDDKQNTLSTPVKFAAGYNRRGVEEAKGKIQKASEVLDQCPLLDRTKCFETVAA  265

Query  976   AIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALVSTKPRLSVKALVA  1155
              +K IVP+SVVDLK PE+ V++ELLPLS IP+GS V  VSVLP  LVSTKP+L++K LV 
Sbjct  266   GVKAIVPDSVVDLKSPELCVMVELLPLSRIPNGSYVAAVSVLPHKLVSTKPKLAIKPLVP  325

Query  1156  DIKAKGGK  1179
             + K K G+
Sbjct  326   ESKQKKGQ  333



>ref|XP_006417587.1| hypothetical protein EUTSA_v10008047mg [Eutrema salsugineum]
 gb|ESQ35940.1| hypothetical protein EUTSA_v10008047mg [Eutrema salsugineum]
Length=354

 Score =   301 bits (771),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 171/341 (50%), Positives = 214/341 (63%), Gaps = 30/341 (9%)
 Frame = +1

Query  238   TTEIEPSVEK----DKGEIGMKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKR  405
             + E EP  EK    D+ E  + PWEQH+++ISIPRFDY APSS+L HSH GFLVTC IKR
Sbjct  14    SIEEEPVTEKRERGDEAET-LTPWEQHASIISIPRFDYTAPSSLLHHSHSGFLVTCNIKR  72

Query  406   EKSATKEAICILEKYIP------------KTAAKKRKVC-----PGAANGEYPDSFKNKD  534
             EKSATKE + I  K +P              A K+RK+C      G    E  D+   ++
Sbjct  73    EKSATKEVMSIFGKVLPIGEENAEVLKSSSDAHKRRKLCVQEIEDGEGKTEPLDNDVLQE  132

Query  535   AGCKDDI-----SDSDTCAEKNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLE  699
              G   ++     +      E N  +SLVKLT+SGLLLFTFP   S    NI+  +   +E
Sbjct  133   TGENPNVEAFKSAKGSISEEHNSLMSLVKLTKSGLLLFTFPVDNSLDTTNIVSRVFQFIE  192

Query  700   SKSLNMPRWCHRIFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRG  879
             S SL  P WCHRIFP+Q TC L EKEL+  VSKL   F+ D  N L +PVKFA GYNRRG
Sbjct  193   SGSLKAPIWCHRIFPVQATCGLTEKELQETVSKLVQRFVDDKHNTLSKPVKFAAGYNRRG  252

Query  880   IEETEMKNVRKNEYDPLST--LLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLP  1053
             +EET+ K ++K   + L    LLDR KCF  VA+ +KDIVP+SVVDLK PE+ VL+ELLP
Sbjct  253   VEETKGK-IKKEASEVLDQCPLLDRSKCFETVAAGVKDIVPDSVVDLKSPELCVLVELLP  311

Query  1054  LSGIPDGSAVVGVSVLPKALVSTKPRLSVKALVADIKAKGG  1176
             LS IP+ S V  V+VLP  LVSTKP+L++K LV + K + G
Sbjct  312   LSRIPNDSFVAAVTVLPHRLVSTKPKLAIKPLVPETKQRKG  352



>ref|XP_006305202.1| hypothetical protein CARUB_v10009568mg [Capsella rubella]
 gb|EOA38100.1| hypothetical protein CARUB_v10009568mg [Capsella rubella]
Length=355

 Score =   301 bits (770),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 171/321 (53%), Positives = 205/321 (64%), Gaps = 24/321 (7%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYIP---  456
             + PWEQHS++ISIPRFDY APSS+L HSH GFLVTC IKREKSATKE + IL KYI    
Sbjct  35    LTPWEQHSSIISIPRFDYKAPSSLLHHSHAGFLVTCTIKREKSATKEVMSILGKYIGSMH  94

Query  457   ------------KTAAKKRKVC-PGAANGEYPDSFKNKDA--GCKDDISDSD---TCAEK  582
                           A+KK+K+C      GE        D     +++ S  D      E 
Sbjct  95    EEKPAVVESTDMNAASKKQKLCVQEIEEGEEKTVPLENDVLQETRENPSVEDPELADEEH  154

Query  583   NHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCV  762
             N  +SLVKLT+SGLLLFTFP  K P   NI+  +  S+ES +L  P WCHRIFP+Q TC 
Sbjct  155   NSLMSLVKLTKSGLLLFTFPVEKFPDTTNIVSRVFQSMESGALKAPIWCHRIFPVQATCG  214

Query  763   LDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDPLST--  936
             L EKELR  VSKL   F+ D  N L +PVKFA GY RRG+EET+ K ++K   + L    
Sbjct  215   LTEKELRETVSKLVQRFVNDKDNTLSKPVKFAAGYQRRGVEETKGK-IQKEASEVLDQCP  273

Query  937   LLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALV  1116
             LLDR KCF  VA+ + DIVP+SVVDLK PE+ VL+ELLPLS IP G+ V  VSVLP  LV
Sbjct  274   LLDRIKCFETVAAGVTDIVPDSVVDLKSPELCVLVELLPLSRIPSGAIVAAVSVLPHRLV  333

Query  1117  STKPRLSVKALVADIKAKGGK  1179
             STKP+L +K LV + K K GK
Sbjct  334   STKPKLCIKPLVPESKHKKGK  354



>ref|XP_004157853.1| PREDICTED: uncharacterized protein LOC101227649 [Cucumis sativus]
 gb|KGN50822.1| hypothetical protein Csa_5G273440 [Cucumis sativus]
Length=345

 Score =   297 bits (760),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 169/315 (54%), Positives = 211/315 (67%), Gaps = 22/315 (7%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYIP---  456
             M PWEQHSAVISIPRFDYNAPS++L     GFL+TC IKREKSATKEAI IL+KY+    
Sbjct  34    MTPWEQHSAVISIPRFDYNAPSALLHRCQTGFLITCTIKREKSATKEAISILQKYVQYFN  93

Query  457   ------------KTAAKKRKVCPG----AANGEYPDSFKNKDAGCKDDISDSDTCAEKNH  588
                            +K+RKV       +  GE       K+       + S+   EK  
Sbjct  94    SSMSETLVVSDENETSKRRKVSEDVDHRSVGGESSTDEHAKETSLIS--TKSEAKVEKCS  151

Query  589   ELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCVLD  768
              +SLVKLTRSGLLLFTF    SP  V I+ DI+ SLE+++L    WCHRIFPIQ TC L+
Sbjct  152   PISLVKLTRSGLLLFTFTKDISPDTVYIVKDIMQSLEARTLKSLAWCHRIFPIQATCSLN  211

Query  769   EKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDPLSTLLDR  948
             E +L+ +VSKL   FM D  N L  PVKFA+GYNRRGIEETEMK   ++    ++ +L R
Sbjct  212   ENDLQGVVSKLVLHFMNDKGNILSHPVKFAIGYNRRGIEETEMKKTFEDS-SGVNVILGR  270

Query  949   DKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALVSTKP  1128
             DKCFS+VA+A+K +V +++VDLK PE+ VL+ELLP+SG+P GS+VVGVSVL   LV+TKP
Sbjct  271   DKCFSIVAAAVKGVVSDAIVDLKSPELCVLVELLPVSGLPSGSSVVGVSVLSNNLVTTKP  330

Query  1129  RLSVKALVADIKAKG  1173
             RL +KAL +D KAK 
Sbjct  331   RLCIKALTSDTKAKS  345



>ref|XP_004497171.1| PREDICTED: uncharacterized protein LOC101495873 [Cicer arietinum]
Length=273

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 156/288 (54%), Positives = 197/288 (68%), Gaps = 42/288 (15%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYIPKTA  465
             MKPWEQHS+VI +PR+DYNAPSS+L HSH  FL+TC IKREKSATKEAI IL  ++    
Sbjct  16    MKPWEQHSSVIKLPRYDYNAPSSLLTHSHSAFLITCTIKREKSATKEAIHILHNFLA---  72

Query  466   AKKRKVCPGAANGEYPDSFKNKDAGCKDDISDSDTCAEKNHELSLVKLTRSGLLLFTFPC  645
                                         + +D+   A     LSLVKLTRSGL+LF FP 
Sbjct  73    ----------------------------NPTDTSLAA-----LSLVKLTRSGLILFIFPN  99

Query  646   GKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCVLDEKELRTLVSKLFSEFMIDN  825
                   ++I+ +I+ +LES++L  P WCHRI PIQ TC L EKEL+ +VS L  +F+   
Sbjct  100   NIFHDTLSIVSNIIQALESRNLTFPLWCHRILPIQATCSLKEKELQEVVSTLVKKFVDAK  159

Query  826   QNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDPLSTLLDRDKCFSVVASAIKDIVPNSV  1005
             Q+KL +P+KFAVG+NRRGIEET  K+V++N    L+ LLDR KCF +VASA+ ++V +SV
Sbjct  160   QDKLGRPLKFAVGFNRRGIEET--KSVKEN----LNALLDRSKCFEIVASAVNNVVKDSV  213

Query  1006  VDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALVSTKPRLSVKAL  1149
             VDL+ PE+SVL+E+LPLSGIP+GS VV VSVLP  LVSTKPRL VKAL
Sbjct  214   VDLRSPELSVLVEVLPLSGIPNGSIVVAVSVLPSNLVSTKPRLCVKAL  261



>ref|XP_009351625.1| PREDICTED: uncharacterized protein LOC103943143 isoform X1 [Pyrus 
x bretschneideri]
Length=347

 Score =   292 bits (748),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 176/336 (52%), Positives = 227/336 (68%), Gaps = 37/336 (11%)
 Frame = +1

Query  259   VEKDKGEIG----MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKE  426
             VE++K E      M PWEQHS VISIPRFDYNAPSS+L+ SH GFL+TCPIKREKSATKE
Sbjct  12    VEREKMESSKKEEMAPWEQHSTVISIPRFDYNAPSSLLQRSHSGFLITCPIKREKSATKE  71

Query  427   AICILEKYIP---------KTAAKKRKV---------CPGAANGEYPDSFKNKDAGCKDD  552
             AI +L KY+           T++K+RK+         C G+  GE  D+         DD
Sbjct  72    AISLLAKYVQCFNSCSSEDNTSSKRRKLSKEDIDGECCNGS--GETKDTATANSEEAHDD  129

Query  553   ISDS---------DTCAEKNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESK  705
             + +          D   + N  LSLVKLT+SGLLLFTF    SP +V+ +  I+ ++ESK
Sbjct  130   LQERTPRLSPAKVDAEGDANPLLSLVKLTKSGLLLFTFCRNTSPDVVDTVSKIIQAVESK  189

Query  706   SLNMPRWCHRIFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIE  885
             S+  P WC+RIFPIQ TC L EKEL  +VS+L  +F+ DNQ KL +P+KFA+ YNRRGIE
Sbjct  190   SVGSPLWCNRIFPIQATCSLKEKELHEVVSRLVLQFVNDNQ-KLVRPIKFAIAYNRRGIE  248

Query  886   ETEMKNVRKNEYDPLSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGI  1065
              TE+ N+ K   + +  +LDRDKCF+ VA+A+K +V +SVVDLK PE+ VL+ELLPLSG+
Sbjct  249   -TEL-NIPKESSNAID-MLDRDKCFAAVATAVKGVVSDSVVDLKSPELCVLLELLPLSGV  305

Query  1066  PDGSAVVGVSVLPKALVSTKPRLSVKALVADIKAKG  1173
             P  S VV VSVLP+ +V+ KP+LS+KALV+D K KG
Sbjct  306   PKESLVVAVSVLPRHIVNAKPKLSIKALVSDTKLKG  341



>gb|AFW72754.1| hypothetical protein ZEAMMB73_044682 [Zea mays]
Length=353

 Score =   292 bits (747),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 178/362 (49%), Positives = 228/362 (63%), Gaps = 46/362 (13%)
 Frame = +1

Query  172   AVIDIRSTKMTEEGEKEKPES-GTTEIEPSVEKDKGEIGMKPWEQHSAVISIPRFDYNAP  348
             AV   RS ++  E E + P S GT E             +KPWEQH+AVI++PR+DY A 
Sbjct  12    AVTPSRSYELPPESESDAPASTGTQE-------------LKPWEQHAAVINLPRYDYRAS  58

Query  349   SSILRHSHCGFLVTCPIKREKSATKEAICILEKYIP-------------KTAAKKRKVCP  489
              S+L  SH GFL+TCPIKREKSATKEAI ILE+Y               K A KKRK+C 
Sbjct  59    GSLLLRSHSGFLITCPIKREKSATKEAIPILEEYHANCCVSEHAEPCDVKNAIKKRKLC-  117

Query  490   GAANGEYPDSFKNKD-----------AGCKDDISDSDTCAEKNHELSLVKLTRSGLLLFT  636
               A+G   ++  N +                  S  +   ++   LSLVKL+RSGLL F 
Sbjct  118   SEASGSLEEAVTNGNSSSVSESIGSTGNTSSPQSKVNDNVDRASNLSLVKLSRSGLLFFK  177

Query  637   FPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCVLDEKELRTLVSKLFSEFM  816
             FP G    +V +L +I+HSL S  L  P+WCHRIFPIQ TC+L E++L   VSKLF +F 
Sbjct  178   FPSG-GVHVVEMLTEILHSLRSGKLKSPQWCHRIFPIQETCILSEEDLHATVSKLFLDFS  236

Query  817   IDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDPLSTLLDRDKCFSVVASAIKDIVP  996
                 N+ D+P+KFAV YNRRGI+ETE KN   NE     TL+DR++CF VVA+A+K +  
Sbjct  237   RSKTNE-DKPIKFAVAYNRRGIDETE-KN--SNEGSNQQTLMDREQCFKVVAAAVKSVAE  292

Query  997   NSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALVSTKPRLSVKALVADIKAKGG  1176
             NSVVDL+ PEV+VL+E+LP+SG+P GS+V GVSVLP  L+STKPRL V++LV D  AK G
Sbjct  293   NSVVDLRSPEVAVLVEMLPVSGVPLGSSVAGVSVLPAELISTKPRLCVRSLVPD--AKAG  350

Query  1177  KR  1182
             K+
Sbjct  351   KK  352



>ref|XP_009784027.1| PREDICTED: uncharacterized protein LOC104232500 isoform X2 [Nicotiana 
sylvestris]
Length=281

 Score =   287 bits (735),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 175/290 (60%), Positives = 214/290 (74%), Gaps = 11/290 (4%)
 Frame = +1

Query  199   MTEEGEKEKPESGTTEIEPSVEKDKGEIGMKPWEQHSAVISIPRFDYNAPSSILRHSHCG  378
             M E+  KE  E GTT +E + ++D+    MKPWEQHSAVISIPRFDY A SS+LRHSH  
Sbjct  1     MAEDERKE--EVGTTIVEATDKEDE----MKPWEQHSAVISIPRFDYKASSSLLRHSHSA  54

Query  379   FLVTCPIKREKSATKEAICILEKYIPKTA-AKKRKVCPGAANGEYPDSFKNKDAGCKDDI  555
             FL+TCPIKREKSATKEAI ILEKYI     AK+RK+C   AN E   S   + A  +   
Sbjct  55    FLITCPIKREKSATKEAIAILEKYIVSNPDAKRRKICMEDANEECNGS---EGAANEHVN  111

Query  556   SDSDTCAEKNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHR  735
             S+SDT  +K+  LSLVKLTRSGLLLFTFP GKSP +V+I+  I  SLES  L  P WC+R
Sbjct  112   SESDTSIKKSDILSLVKLTRSGLLLFTFPFGKSPAVVDIVSQIFQSLESGILKSPLWCNR  171

Query  736   IFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKN  915
             I PIQGTC L+EKEL+ +V++L  +F+I+   +    VKFAVGYNRRGIEETEMKN+RK 
Sbjct  172   ILPIQGTCPLEEKELKKIVTQLVDQFIINRPKETGNTVKFAVGYNRRGIEETEMKNLRKT  231

Query  916   EYDP-LSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSG  1062
               DP +  LLDR+KCFSVVA+A+K++VP+S VDLK PE+SVL+E+L  SG
Sbjct  232   SSDPDVFALLDRNKCFSVVAAAVKEVVPDSTVDLKDPELSVLVEVLARSG  281



>ref|XP_010541840.1| PREDICTED: uncharacterized protein LOC104815221 [Tarenaya hassleriana]
Length=347

 Score =   290 bits (741),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 158/313 (50%), Positives = 193/313 (62%), Gaps = 18/313 (6%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYI----  453
             M PWEQH++VISIPRFDY APSS+L  SH GFLVTC IKREKSATKE + IL KY+    
Sbjct  33    MAPWEQHASVISIPRFDYTAPSSLLHRSHSGFLVTCTIKREKSATKEVMSILGKYVGSKN  92

Query  454   -----------PKTAAKKRKVCPGAANGEYPDSFKNKDAGCKDDISDSDTCAEKNHELSL  600
                          TA K++K C    +GE        D+  +   +      E N  +SL
Sbjct  93    EAKSEVHRYSDENTAPKRQKFCAEEIDGEGKAVIPTNDSSEESGENSRKEGLEINLLMSL  152

Query  601   VKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCVLDEKEL  780
             VKLTRSGLLL T     SP    I+  I  SLES +L  P WCHRIFP+Q TC L EKEL
Sbjct  153   VKLTRSGLLLLTLSDESSPDTTEIVTTIFQSLESGALKSPVWCHRIFPVQATCGLAEKEL  212

Query  781   RTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDPLSTL--LDRDK  954
             +  VSKL   F+ D   KL  P+KFA GYNRRG+EE   K V K+  +    +  LDR K
Sbjct  213   QETVSKLVRRFLNDKSFKLSNPLKFAAGYNRRGMEEMGRK-VSKDSSEGREQIPVLDRGK  271

Query  955   CFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALVSTKPRL  1134
             CF  VA+ +K+IVP+S+VDL  PE+ VL+ELLP+SGI  GS +  VSVLP+ LV+TKP+L
Sbjct  272   CFEAVAAGVKEIVPDSIVDLNSPELCVLVELLPVSGIRSGSFIAAVSVLPQNLVTTKPKL  331

Query  1135  SVKALVADIKAKG  1173
              +K LV   K  G
Sbjct  332   CIKPLVPGTKQTG  344



>ref|XP_008340526.1| PREDICTED: uncharacterized protein LOC103403458 isoform X1 [Malus 
domestica]
Length=345

 Score =   289 bits (740),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 170/326 (52%), Positives = 222/326 (68%), Gaps = 33/326 (10%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYIP---  456
             M PWEQHS VISIPRFDYNAPSS+L+ SH GFL+TCPIKREKSATKEAI +L KY+    
Sbjct  26    MAPWEQHSTVISIPRFDYNAPSSLLQRSHSGFLITCPIKREKSATKEAISLLAKYVQCFN  85

Query  457   ------KTAAKKRKV---------CPGAANGEYPDSFKNKDAGCKDDISDS---------  564
                    T++K+RK+         C G   GE  D+        +DD+ +          
Sbjct  86    SCSSEDNTSSKRRKLSKEDIDSECCNGG--GESKDAATANSEDARDDLQERTPRLSPAKV  143

Query  565   DTCAEKNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFP  744
             D   + +  LSLVKLT+SGLLLFTF    SP +V+ +  I+ ++ESKS+  P WC+RIFP
Sbjct  144   DAEGDASPLLSLVKLTKSGLLLFTFRRNTSPDVVDTVSKIIQAVESKSVGSPLWCNRIFP  203

Query  745   IQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYD  924
             IQ TC L EKEL  +VS+L  +F+ DNQ KL +P+KFA+ YNRRGIE TE+ N+ K   +
Sbjct  204   IQATCSLKEKELHEVVSRLVLQFVNDNQ-KLVRPIKFAIAYNRRGIE-TEL-NIPKESSN  260

Query  925   PLSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLP  1104
              +  +LDRDKCF+ VA+A+K ++ +SVVDLK PE+ VL+ELLPLSG+P  S VV VSVLP
Sbjct  261   AID-MLDRDKCFAAVATAVKGVLSDSVVDLKSPELCVLLELLPLSGVPKESLVVAVSVLP  319

Query  1105  KALVSTKPRLSVKALVADIKAKGGKR  1182
             + +V+ KP+L +KALV+D K KG K+
Sbjct  320   RYIVNAKPKLCIKALVSDTKTKGKKQ  345



>ref|NP_001136900.1| uncharacterized protein LOC100217057 [Zea mays]
 gb|ACF82850.1| unknown [Zea mays]
Length=353

 Score =   289 bits (739),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 177/362 (49%), Positives = 227/362 (63%), Gaps = 46/362 (13%)
 Frame = +1

Query  172   AVIDIRSTKMTEEGEKEKPES-GTTEIEPSVEKDKGEIGMKPWEQHSAVISIPRFDYNAP  348
             AV   RS ++  E E + P S GT E             +KPWEQH+AVI++PR+DY A 
Sbjct  12    AVTPSRSYELPPESESDAPASTGTQE-------------LKPWEQHAAVINLPRYDYRAS  58

Query  349   SSILRHSHCGFLVTCPIKREKSATKEAICILEKYIP-------------KTAAKKRKVCP  489
              S+L  SH GFL+TCPIKREKSATKEAI ILE+Y               K A KKRK+C 
Sbjct  59    GSLLLRSHSGFLITCPIKREKSATKEAIPILEEYHANCCVSEHAEPCDVKNAIKKRKLC-  117

Query  490   GAANGEYPDSFKNKD-----------AGCKDDISDSDTCAEKNHELSLVKLTRSGLLLFT  636
               A+G   ++  N +                  S  +   ++   LSLVKL+RSGLL F 
Sbjct  118   SEASGSLEEAVTNGNSSSVSESIGSTGNTSSPQSKVNDNVDRASNLSLVKLSRSGLLFFK  177

Query  637   FPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCVLDEKELRTLVSKLFSEFM  816
             FP G    +V +L +I+HSL S  L  P+WCHRIFPIQ TC+L E++L   VSKLF +F 
Sbjct  178   FPSG-GVHVVEMLTEILHSLRSGKLKSPQWCHRIFPIQETCILSEEDLHATVSKLFLDFS  236

Query  817   IDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDPLSTLLDRDKCFSVVASAIKDIVP  996
                 N+ D+P+KFAV YNRRGI+ETE KN   NE     TL+DR++CF VVA+A+K +  
Sbjct  237   RSKTNE-DKPIKFAVAYNRRGIDETE-KN--SNEGSNQQTLMDREQCFKVVAAAVKSVAE  292

Query  997   NSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALVSTKPRLSVKALVADIKAKGG  1176
             NSVVDL+ PEV+VL+E+LP+SG+P GS+V GVSV P  L+STKPRL V++LV D  AK G
Sbjct  293   NSVVDLRSPEVAVLVEMLPVSGVPLGSSVAGVSVPPAELISTKPRLCVRSLVPD--AKAG  350

Query  1177  KR  1182
             K+
Sbjct  351   KK  352



>ref|XP_009351626.1| PREDICTED: uncharacterized protein LOC103943143 isoform X2 [Pyrus 
x bretschneideri]
Length=344

 Score =   288 bits (737),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 175/333 (53%), Positives = 225/333 (68%), Gaps = 34/333 (10%)
 Frame = +1

Query  259   VEKDKGEIG----MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKE  426
             VE++K E      M PWEQHS VISIPRFDYNAPSS+L+ SH GFL+TCPIKREKSATKE
Sbjct  12    VEREKMESSKKEEMAPWEQHSTVISIPRFDYNAPSSLLQRSHSGFLITCPIKREKSATKE  71

Query  427   AICILEKYI------PKTAAKKRKV---------CPGAANGEYPDSFKNKDAGCKDDISD  561
             AI +L K          T++K+RK+         C G+  GE  D+         DD+ +
Sbjct  72    AISLLAKCFNSCSSEDNTSSKRRKLSKEDIDGECCNGS--GETKDTATANSEEAHDDLQE  129

Query  562   S---------DTCAEKNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLN  714
                       D   + N  LSLVKLT+SGLLLFTF    SP +V+ +  I+ ++ESKS+ 
Sbjct  130   RTPRLSPAKVDAEGDANPLLSLVKLTKSGLLLFTFCRNTSPDVVDTVSKIIQAVESKSVG  189

Query  715   MPRWCHRIFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETE  894
              P WC+RIFPIQ TC L EKEL  +VS+L  +F+ DNQ KL +P+KFA+ YNRRGIE TE
Sbjct  190   SPLWCNRIFPIQATCSLKEKELHEVVSRLVLQFVNDNQ-KLVRPIKFAIAYNRRGIE-TE  247

Query  895   MKNVRKNEYDPLSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDG  1074
             + N+ K   + +  +LDRDKCF+ VA+A+K +V +SVVDLK PE+ VL+ELLPLSG+P  
Sbjct  248   L-NIPKESSNAID-MLDRDKCFAAVATAVKGVVSDSVVDLKSPELCVLLELLPLSGVPKE  305

Query  1075  SAVVGVSVLPKALVSTKPRLSVKALVADIKAKG  1173
             S VV VSVLP+ +V+ KP+LS+KALV+D K KG
Sbjct  306   SLVVAVSVLPRHIVNAKPKLSIKALVSDTKLKG  338



>ref|XP_006855579.1| hypothetical protein AMTR_s00044p00041520 [Amborella trichopoda]
 gb|ERN17046.1| hypothetical protein AMTR_s00044p00041520 [Amborella trichopoda]
Length=403

 Score =   287 bits (735),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 159/333 (48%), Positives = 212/333 (64%), Gaps = 27/333 (8%)
 Frame = +1

Query  262   EKDKGEIGMKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICIL  441
             EK++ +  + PW+QH +VI++ RFDYNAPS++L   H GFL+TCPIKREKSATKEAI IL
Sbjct  70    EKEEEKQELTPWDQHFSVINLRRFDYNAPSALLESPHSGFLITCPIKREKSATKEAIAIL  129

Query  442   EKYIPKTAAKK-RKVCPGAAN-----------GEYPDSFKNKDAGCKD-----------D  552
             EK+          +V P  AN            +  +    +D G +D            
Sbjct  130   EKFSGLFGEDDVERVAPNVANVAMNGIKKRKLSDTSEQLATEDLGSEDGSKSEGTLPSGS  189

Query  553   ISDSD---TCAEKNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPR  723
             IS SD   T  +++  LSLVKL +SGLLLF FP   S    +IL  I +SLES  L+ PR
Sbjct  190   ISSSDKTETIVKRSSILSLVKLNKSGLLLFAFPKNGSSLPDSILQKIFNSLESGDLSSPR  249

Query  724   WCHRIFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKN  903
             WCHRI PIQ TC+L EK +  +VSKL   F+ ++Q++ ++P+KFAV +NRRGIE+ ++K 
Sbjct  250   WCHRILPIQETCMLSEKNMHAVVSKLVQRFLSNSQDQPERPLKFAVAFNRRGIEDKKLKG  309

Query  904   VRKNEYDPLST-LLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSA  1080
              ++ E D     +LDRD+CF VVA A+KD+ P+SVVDLK P++ V +E+LP+ GIP GS 
Sbjct  310   KKEVEKDKSELPVLDRDQCFRVVAGAVKDVAPDSVVDLKFPKMVVFVEVLPIPGIPSGSI  369

Query  1081  VVGVSVLPKALVSTKPRLSVKALVADIKAKGGK  1179
             V  VSVLP  LV+TKPRL VK LV+  K   GK
Sbjct  370   VAAVSVLPHTLVNTKPRLIVKPLVSTTKTAEGK  402



>ref|XP_008340527.1| PREDICTED: uncharacterized protein LOC103403458 isoform X2 [Malus 
domestica]
Length=342

 Score =   285 bits (730),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 169/323 (52%), Positives = 220/323 (68%), Gaps = 30/323 (9%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYI----  453
             M PWEQHS VISIPRFDYNAPSS+L+ SH GFL+TCPIKREKSATKEAI +L K      
Sbjct  26    MAPWEQHSTVISIPRFDYNAPSSLLQRSHSGFLITCPIKREKSATKEAISLLAKCFNSCS  85

Query  454   --PKTAAKKRKV---------CPGAANGEYPDSFKNKDAGCKDDISDS---------DTC  573
                 T++K+RK+         C G   GE  D+        +DD+ +          D  
Sbjct  86    SEDNTSSKRRKLSKEDIDSECCNGG--GESKDAATANSEDARDDLQERTPRLSPAKVDAE  143

Query  574   AEKNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQG  753
              + +  LSLVKLT+SGLLLFTF    SP +V+ +  I+ ++ESKS+  P WC+RIFPIQ 
Sbjct  144   GDASPLLSLVKLTKSGLLLFTFRRNTSPDVVDTVSKIIQAVESKSVGSPLWCNRIFPIQA  203

Query  754   TCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDPLS  933
             TC L EKEL  +VS+L  +F+ DNQ KL +P+KFA+ YNRRGIE TE+ N+ K   + + 
Sbjct  204   TCSLKEKELHEVVSRLVLQFVNDNQ-KLVRPIKFAIAYNRRGIE-TEL-NIPKESSNAID  260

Query  934   TLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKAL  1113
              +LDRDKCF+ VA+A+K ++ +SVVDLK PE+ VL+ELLPLSG+P  S VV VSVLP+ +
Sbjct  261   -MLDRDKCFAAVATAVKGVLSDSVVDLKSPELCVLLELLPLSGVPKESLVVAVSVLPRYI  319

Query  1114  VSTKPRLSVKALVADIKAKGGKR  1182
             V+ KP+L +KALV+D K KG K+
Sbjct  320   VNAKPKLCIKALVSDTKTKGKKQ  342



>ref|XP_008460211.1| PREDICTED: uncharacterized protein LOC103499095 [Cucumis melo]
Length=327

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 168/318 (53%), Positives = 208/318 (65%), Gaps = 37/318 (12%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYIP---  456
             M PWEQHSAVIS+PRFDYNAPS++L     GFL+TC IKREKSATKEAI ILEKY+    
Sbjct  25    MTPWEQHSAVISLPRFDYNAPSALLHRCQSGFLITCTIKREKSATKEAIFILEKYVQYFS  84

Query  457   ------------KTAAKKRKVCPG----AANGEYPDSFKNKDAGCKDDI---SDSDTCAE  579
                            +K+RKV       +  GE     +N D   K+     + S+   E
Sbjct  85    SSMTETLVISDENETSKRRKVSEDIDHISVGGE-----RNTDEHAKETSLISTKSEAKVE  139

Query  580   KNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTC  759
             K   +SLVKLTRSGLLLFTF    SP  V I+ DI+ SLE+++L    WCHRIFPIQ TC
Sbjct  140   KCSPISLVKLTRSGLLLFTFTKDISPDTVYIVKDIMQSLEARTLKSLAWCHRIFPIQATC  199

Query  760   VLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDPLSTL  939
              L+E +L+ +VSKL   FM D  N L  PVKFAVGYNRRG+E++   NV          +
Sbjct  200   SLNENDLQGVVSKLVLHFMKDKGNILSHPVKFAVGYNRRGMEDSSGANV----------I  249

Query  940   LDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALVS  1119
             L RDKCFS+VA+A+K +V + +VDLK PE+ VL+ELLP+SG+P GS+VVGVSVL   LV+
Sbjct  250   LGRDKCFSIVAAAVKGVVSDVIVDLKSPELCVLVELLPVSGLPPGSSVVGVSVLSNNLVT  309

Query  1120  TKPRLSVKALVADIKAKG  1173
             TKPRL +KAL +D KAK 
Sbjct  310   TKPRLCIKALTSDAKAKS  327



>ref|XP_008805048.1| PREDICTED: uncharacterized protein LOC103718148 [Phoenix dactylifera]
 ref|XP_008805050.1| PREDICTED: uncharacterized protein LOC103718148 [Phoenix dactylifera]
 ref|XP_008805051.1| PREDICTED: uncharacterized protein LOC103718148 [Phoenix dactylifera]
 ref|XP_008810275.1| PREDICTED: uncharacterized protein LOC103721736 [Phoenix dactylifera]
 ref|XP_008810276.1| PREDICTED: uncharacterized protein LOC103721736 [Phoenix dactylifera]
 ref|XP_008810277.1| PREDICTED: uncharacterized protein LOC103721736 [Phoenix dactylifera]
Length=356

 Score =   285 bits (729),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 177/325 (54%), Positives = 216/325 (66%), Gaps = 34/325 (10%)
 Frame = +1

Query  283   GMKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYIPKT  462
             G+ PWEQHSAVIS+PR+DY APSS+L  SH GFL+TCPIKREKSATKEAI +LEKY+  T
Sbjct  29    GLTPWEQHSAVISLPRYDYTAPSSLLERSHSGFLITCPIKREKSATKEAISLLEKYVGYT  88

Query  463   A---------------AKKRKVCPGA---ANGEYPDSFKNKDAG-----------CKDDI  555
                             AKKRK+C       NGE  D+ +N D              +   
Sbjct  89    CSKGCESLQPCDANVPAKKRKICSSEICPRNGE--DAERNGDINILEVSGKLEEEARLGS  146

Query  556   SDSDTCAEKNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHR  735
             S++    +   +LSLVKLT SGLLLFTFP      +V+IL D+  SL S  L  P WCHR
Sbjct  147   SETTENVKDRPDLSLVKLTGSGLLLFTFPSNSFRHVVDILSDMFLSLRSGKLKPPLWCHR  206

Query  736   IFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKN  915
             IFPIQ TC+L EK L+ ++SKL  E++ + Q++LD   KFA GYNRRGI+ETEMK V+KN
Sbjct  207   IFPIQETCLLTEKNLKVVISKLVQEYLSNKQDRLDGLFKFAAGYNRRGIDETEMK-VQKN  265

Query  916   EYDPLS--TLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVG  1089
               +      LLDRD CF VVA A+K +  N+VVDLK PEV+VL+ELLPLSG+P G+ VVG
Sbjct  266   TLEDSEGLILLDRDTCFKVVAGAVKAVAKNAVVDLKSPEVAVLVELLPLSGVPHGTLVVG  325

Query  1090  VSVLPKALVSTKPRLSVKALVADIK  1164
             VSVLP  LV+TKPRL VK+LVAD K
Sbjct  326   VSVLPVVLVTTKPRLCVKSLVADTK  350



>ref|XP_010093353.1| hypothetical protein L484_022914 [Morus notabilis]
 gb|EXB53947.1| hypothetical protein L484_022914 [Morus notabilis]
Length=279

 Score =   281 bits (720),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 146/252 (58%), Positives = 184/252 (73%), Gaps = 14/252 (6%)
 Frame = +1

Query  460   TAAKKRKVCPGAANGEYPDSFKNKDAGCKDD----------ISDS--DTCAEKNHELSLV  603
             + +K+RK C    +GE+ +  ++ DA   +D          +S +  DT  E+N  LSLV
Sbjct  29    STSKRRKTCTDDVDGEHINGEESNDADNSEDKPGNRSGEFPLSSAKIDTMEERNSVLSLV  88

Query  604   KLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCVLDEKELR  783
             KLTRSGLLLFTF  G S   VNI+ +I  SLES   + P+WCHRIFPIQ TC L+E ELR
Sbjct  89    KLTRSGLLLFTFTRGTSFDTVNIVSEIFQSLESAGSSSPQWCHRIFPIQATCTLNENELR  148

Query  784   TLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDPLSTLLDRDKCFS  963
              +VS+L  EF+ D QNKL +P+KFAVGYNRRGIEETEMK  +     P S LLDR+ CFS
Sbjct  149   VVVSRLVLEFVNDKQNKLARPLKFAVGYNRRGIEETEMKVTKGTS--PASNLLDRNSCFS  206

Query  964   VVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALVSTKPRLSVK  1143
              VA+A+KD+VP+S+VDLK PE+SVL+ELLPLSG+P+GS VV VSVLP+ LVSTKPRL VK
Sbjct  207   TVAAAVKDVVPDSIVDLKSPELSVLVELLPLSGVPNGSLVVAVSVLPQNLVSTKPRLCVK  266

Query  1144  ALVADIKAKGGK  1179
             AL++++KAKGGK
Sbjct  267   ALISNVKAKGGK  278



>dbj|BAJ91789.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=355

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 161/347 (46%), Positives = 214/347 (62%), Gaps = 30/347 (9%)
 Frame = +1

Query  214   EKEKPESGTTEIEPSVEKDKGEIGMKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTC  393
             E E P     +    V    G   ++PWEQH+AVI++PR+DY A  S+L  SH GFL+TC
Sbjct  9     ETETPAPSREQPPEPVAAAAGGRDLQPWEQHAAVINLPRYDYRASGSLLLRSHSGFLITC  68

Query  394   PIKREKSATKEAICILEKYIP---------------KTAAKKRKVCPGAANGEYPDSFKN  528
             PIKREKSATKEAI IL +YI                +TA+KKRK+   A+  E+ +    
Sbjct  69    PIKREKSATKEAISILGEYISDASSHSSENFEPCVMETASKKRKIFSEASEIEHSEDAAT  128

Query  529   KDAGCKDDI------------SDSDTCAEKNHELSLVKLTRSGLLLFTFPCGKSPPIVNI  672
                G   +             SD+    ++   LSL+KL+ SGLL F+FP G    +V +
Sbjct  129   NGKGDAPEFTGSIEVETNSVHSDTSGNPDRTSNLSLIKLSMSGLLFFSFPTG-GVHVVQM  187

Query  673   LFDIVHSLESKSLNMPRWCHRIFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVK  852
             L ++  SL S  L  P+WCHRIFPIQ TCVL E EL   VSKLF +F  + +++ D+P+K
Sbjct  188   LTEVFRSLRSGKLKSPQWCHRIFPIQETCVLSETELHATVSKLFLDFFRNKEDQ-DEPIK  246

Query  853   FAVGYNRRGIEETEMKNVRK-NEYDPLSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEV  1029
             FAVGY+RRGI+ET  K  +  N       L+DR +CF VVA+A+K +  +++VDLK PEV
Sbjct  247   FAVGYSRRGIDETVNKTQKNDNNSSVQQALMDRQQCFKVVAAAVKSVAKDAIVDLKSPEV  306

Query  1030  SVLIELLPLSGIPDGSAVVGVSVLPKALVSTKPRLSVKALVADIKAK  1170
             +VL+E+LP+SG+P GS+V GVSVLP  LVS KPRL VKA+V D K K
Sbjct  307   AVLVEVLPISGVPVGSSVAGVSVLPAELVSAKPRLCVKAMVFDTKTK  353



>ref|XP_009610210.1| PREDICTED: uncharacterized protein LOC104103942 isoform X2 [Nicotiana 
tomentosiformis]
Length=280

 Score =   269 bits (688),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 157/257 (61%), Positives = 194/257 (75%), Gaps = 5/257 (2%)
 Frame = +1

Query  400   KREKSATKEAICILEKYIPKTA-AKKRKVCPGAANGEYPDSFKNKDAGCKDDISDSDTCA  576
             +REKSATKEAI +LEKYI     AK+RK+C   AN E   S   + A  +   S+S T  
Sbjct  23    EREKSATKEAIALLEKYIVSNPDAKRRKICMEDANEECNGS--GEGAVNEHVNSESGTSI  80

Query  577   EKNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGT  756
             EK+  LSL+KLTRSGLLLFTFP GKSP +V+I+  I  SLES  L  P WC+RI PIQGT
Sbjct  81    EKSDILSLIKLTRSGLLLFTFPFGKSPAVVDIVSQIFQSLESGILKSPLWCNRILPIQGT  140

Query  757   CVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDP-LS  933
             C L+EKEL+ +V++L  +FM + Q +    VKFAVGYNRRGIEETEMKN+RK   DP + 
Sbjct  141   CPLEEKELKKIVTQLVDQFMTNRQKETGNTVKFAVGYNRRGIEETEMKNLRKACSDPDVF  200

Query  934   TLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKAL  1113
              LLDR+KCFSVVA+A+K++VP+S+VDLK PE+SVL+E+LPLS +PD  A+VGVSVLP+ L
Sbjct  201   ALLDRNKCFSVVAAAVKEVVPDSIVDLKEPELSVLVEVLPLSRVPD-KAIVGVSVLPRML  259

Query  1114  VSTKPRLSVKALVADIK  1164
             VSTKPRL VKALV+D K
Sbjct  260   VSTKPRLCVKALVSDTK  276



>ref|XP_008681306.1| PREDICTED: uncharacterized protein LOC100217057 isoform X1 [Zea 
mays]
 gb|ACG35688.1| hypothetical protein [Zea mays]
 gb|AFW72752.1| hypothetical protein ZEAMMB73_044682 [Zea mays]
Length=326

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 165/349 (47%), Positives = 215/349 (62%), Gaps = 47/349 (13%)
 Frame = +1

Query  172   AVIDIRSTKMTEEGEKEKPES-GTTEIEPSVEKDKGEIGMKPWEQHSAVISIPRFDYNAP  348
             AV   RS ++  E E + P S GT E             +KPWEQH+AVI++PR+DY A 
Sbjct  12    AVTPSRSYELPPESESDAPASTGTQE-------------LKPWEQHAAVINLPRYDYRAS  58

Query  349   SSILRHSHCGFLVTCPIKREKSATKEAICILEKYIPKTAAKKRKVCPGAANGEYPDSFKN  528
              S+L  SH GFL+TCPIK          C +     K A KKRK+C   A+G   ++  N
Sbjct  59    GSLLLRSHSGFLITCPIKP---------CDV-----KNAIKKRKLC-SEASGSLEEAVTN  103

Query  529   KD-----------AGCKDDISDSDTCAEKNHELSLVKLTRSGLLLFTFPCGKSPPIVNIL  675
              +                  S  +   ++   LSLVKL+RSGLL F FP G    +V +L
Sbjct  104   GNSSSVSESIGSTGNTSSPQSKVNDNVDRASNLSLVKLSRSGLLFFKFPSG-GVHVVEML  162

Query  676   FDIVHSLESKSLNMPRWCHRIFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKF  855
              +I+HSL S  L  P+WCHRIFPIQ TC+L E++L   VSKLF +F     N+ D+P+KF
Sbjct  163   TEILHSLRSGKLKSPQWCHRIFPIQETCILSEEDLHATVSKLFLDFSRSKTNE-DKPIKF  221

Query  856   AVGYNRRGIEETEMKNVRKNEYDPLSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSV  1035
             AV YNRRGI+ETE KN   NE     TL+DR++CF VVA+A+K +  NSVVDL+ PEV+V
Sbjct  222   AVAYNRRGIDETE-KN--SNEGSNQQTLMDREQCFKVVAAAVKSVAENSVVDLRSPEVAV  278

Query  1036  LIELLPLSGIPDGSAVVGVSVLPKALVSTKPRLSVKALVADIKAKGGKR  1182
             L+E+LP+SG+P GS+V GVSVLP  L+STKPRL V++LV D  AK GK+
Sbjct  279   LVEMLPVSGVPLGSSVAGVSVLPAELISTKPRLCVRSLVPD--AKAGKK  325



>gb|EMT17923.1| hypothetical protein F775_08118 [Aegilops tauschii]
Length=382

 Score =   266 bits (680),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 160/362 (44%), Positives = 215/362 (59%), Gaps = 58/362 (16%)
 Frame = +1

Query  250   EPSVEKDKGEIGMKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEA  429
             EP  E   G   ++PWEQH+AVI++PR+DY A  S+L  SH GFL+TCPIKREKSATKEA
Sbjct  22    EPVAEAAAGR-ELQPWEQHAAVINLPRYDYRASGSLLLRSHSGFLITCPIKREKSATKEA  80

Query  430   ICILEKYIP---------------KTAAKKRKVCPGAAN------------GEYPDSFKN  528
             I IL +YI                + A KKRK+ P A+             G+ P+S  +
Sbjct  81    ISILGEYISDASSHSSEKLEPCVTEAATKKRKIFPEASEIEHSEDTITNGKGDAPESTGS  140

Query  529   KDAGCKDDISDSDTCAEKNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKS  708
              +       SD+    ++   LSL+KL+ SGLL F+FP G    +V +L ++ HSL+S  
Sbjct  141   IEVKTNSLHSDTSGNPDRTSNLSLIKLSMSGLLFFSFPTG-GVHVVQMLTEVFHSLKSGK  199

Query  709   LNMPRWCHRIFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVK---------FAV  861
             L  P+WCHRIFPIQ TCVL E EL   VSKLF +F  + +++ D+P+K         F  
Sbjct  200   LKSPQWCHRIFPIQETCVLSETELHATVSKLFLDFFRNKEDQ-DEPIKVDKIALLILFYF  258

Query  862   GYNRRGIEETEMKNVRKNEYDPLST-LLDRDKCFSVVASAIKDIVPNSVVDLKHPE----  1026
             GY+RRGI+ET  K  + +    +   L+DR +CF VVA+A+K +  +++VDLK PE    
Sbjct  259   GYSRRGIDETVNKTQKNDNNSSIQQGLMDRQQCFKVVAAAVKSVAKDAIVDLKSPEFSKF  318

Query  1027  --------------VSVLIELLPLSGIPDGSAVVGVSVLPKALVSTKPRLSVKALVADIK  1164
                           V+VL+E+LP+SG+P GS+V GVSVLP  LVS KPRL VKALV+D K
Sbjct  319   TGQLSNIRNSKHHNVAVLVEVLPISGVPVGSSVAGVSVLPAELVSAKPRLCVKALVSDTK  378

Query  1165  AK  1170
              K
Sbjct  379   TK  380



>ref|XP_002314748.2| hypothetical protein POPTR_0010s10980g [Populus trichocarpa]
 gb|EEF00919.2| hypothetical protein POPTR_0010s10980g [Populus trichocarpa]
Length=345

 Score =   265 bits (676),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 148/287 (52%), Positives = 184/287 (64%), Gaps = 32/287 (11%)
 Frame = +1

Query  250   EPSVEKDKGEIGMKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEA  429
             E + EK++    MKPWEQH+ VI++PRFDYNAPS++L HSH GFL+TC IKREKSATKEA
Sbjct  6     EAAAEKER----MKPWEQHAGVINMPRFDYNAPSALLHHSHSGFLITCSIKREKSATKEA  61

Query  430   ICILEKYIP---------------KTAAKKRKVCPGAANGEYPDSFKNKD-------AGC  543
             + ILEKY                   +AKKR++     + +  +  K++           
Sbjct  62    MSILEKYAESYNCGSSESLERSDENKSAKKRRILTDETSAKCDEDVKSESIIDEISGGPA  121

Query  544   KDD---ISDSDTCAEKNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLN  714
             KDD   +S +D   E+   LSLVKLT SGL+L TFP        +++ +I   LES  L 
Sbjct  122   KDDCQSLSKADAPVERGFVLSLVKLTGSGLVLLTFPRENPSVTADVVSNIFQCLESGILK  181

Query  715   MPRWCHRIFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETE  894
              P WCHRIFPIQ TC+L EKELR +VSKL  +F+ D QNKL +P+KFAVGYNRRGIEET 
Sbjct  182   SPLWCHRIFPIQATCLLIEKELRAVVSKLVLQFINDKQNKLARPIKFAVGYNRRGIEETC  241

Query  895   MKNVRKN--EYDPLSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEV  1029
             MKN++ N  + DP   +LDR KCF VVASAIKD VP S VDLK PE 
Sbjct  242   MKNLKDNPKDSDPF-PMLDRSKCFDVVASAIKDAVPESAVDLKSPEA  287



>ref|XP_010066523.1| PREDICTED: uncharacterized protein LOC104453614 isoform X2 [Eucalyptus 
grandis]
Length=295

 Score =   261 bits (668),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 152/323 (47%), Positives = 190/323 (59%), Gaps = 58/323 (18%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYI----  453
             M PWEQHS                               REKSATK+A+C+LEK+     
Sbjct  1     MTPWEQHSG------------------------------REKSATKQAMCLLEKFCGAFA  30

Query  454   -----------PKTAAKKRKVCP---------GAANGEYPDSFKNKDAGCKDDISDS---  564
                         K  AK+RKVCP         G  +G+  D    +D    +D+S     
Sbjct  31    ARESTKLELADAKLTAKRRKVCPEESDQEGADGDESGQITDQCCKEDGKLSEDVSSQTKE  90

Query  565   DTCAEKNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFP  744
             D  A K+  LSLVKLT SGLLLFTFP   S   + I+ DI+ SL S   + P+WCHRIFP
Sbjct  91    DIGANKSSALSLVKLTGSGLLLFTFPHEDSTDTIQIVSDIIDSLGSADSSSPQWCHRIFP  150

Query  745   IQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVR-KNEY  921
             IQ TC L+E +LRT+V KL  +F+ D Q+ L  P+KFAVGYNRRG+EE E+KN + K + 
Sbjct  151   IQATCSLNEPDLRTVVQKLVLKFVKDKQSTLASPIKFAVGYNRRGLEEMELKNSKDKPDG  210

Query  922   DPLSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVL  1101
               L  LLDR KCF VVA+A+KD + +SVVDLK+PE+SVL+ELLPL+ IP GS V  VSVL
Sbjct  211   SDLLPLLDRRKCFEVVAAAVKDAISDSVVDLKNPEISVLVELLPLAAIPSGSLVAAVSVL  270

Query  1102  PKALVSTKPRLSVKALVADIKAK  1170
             P  +V+TKPRL VK LV   K+K
Sbjct  271   PPKMVTTKPRLCVKVLVPQAKSK  293



>ref|XP_004955146.1| PREDICTED: uncharacterized protein LOC101762499 [Setaria italica]
Length=301

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 144/282 (51%), Positives = 178/282 (63%), Gaps = 27/282 (10%)
 Frame = +1

Query  397   IKREKSATKEAICILEKYIPKTA--------------AKKRKVCP-------GAANGEYP  513
             IKREKSATKEAI ILE+YI                  AKKRK C         A  G   
Sbjct  18    IKREKSATKEAISILEEYIGHAKCHVSEQVEPCDVENAKKRKFCSLASENLEAAVTGGNS  77

Query  514   DSFKNKDAGCKDDISDSDTCAE---KNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDI  684
              S         +  S     +E   +   LSLVKL+RSGLL F FPCG    +V++L +I
Sbjct  78    ISVAESTGSIGESSSPQSKMSENVDRASNLSLVKLSRSGLLFFKFPCG-GLHVVDMLTEI  136

Query  685   VHSLESKSLNMPRWCHRIFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVG  864
              HSL S  L  P+WCHRIFP+Q TCVL EK+L   VSKLF +F+    N+ D+P+KFAV 
Sbjct  137   FHSLSSGKLKSPQWCHRIFPVQETCVLSEKDLHATVSKLFLDFLRSKNNQ-DEPIKFAVA  195

Query  865   YNRRGIEETEMKNVRK-NEYDPLSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLI  1041
             YNRRGI+ETE K  +  NE      L+DR++CF VVA+A+K I  NSVVDLK PEV+VL+
Sbjct  196   YNRRGIDETETKAQKNSNEGSNQQALMDREQCFKVVAAAVKSIAENSVVDLKSPEVAVLV  255

Query  1042  ELLPLSGIPDGSAVVGVSVLPKALVSTKPRLSVKALVADIKA  1167
             E+LP+SG+P GS+V GVSVLP  L+STKPRLSV++L +D KA
Sbjct  256   EMLPVSGVPLGSSVAGVSVLPAELISTKPRLSVRSLASDAKA  297



>ref|XP_007142824.1| hypothetical protein PHAVU_007G020000g [Phaseolus vulgaris]
 gb|ESW14818.1| hypothetical protein PHAVU_007G020000g [Phaseolus vulgaris]
Length=309

 Score =   249 bits (636),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 134/267 (50%), Positives = 179/267 (67%), Gaps = 20/267 (7%)
 Frame = +1

Query  286   MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYIP---  456
             M PWEQHSAVI++PRFDYNAPSS+LR+SH GFL+TC IKREKSATKEAI IL K++    
Sbjct  14    MSPWEQHSAVINLPRFDYNAPSSLLRNSHTGFLITCTIKREKSATKEAITILRKFLEPGH  73

Query  457   ---------KTAAKKRKVCPGAANGEYPDSFKNKDAGCK--DDISDSDTCAEKNHE----  591
                       + +K++K+C   A  E  D  +N+ A     D    S   AE + +    
Sbjct  74    FDSSKNPNENSISKRQKLCSDDAGEECLDGKENESATANSGDGELSSAGKAEPDKDGVTG  133

Query  592   LSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCVLDE  771
             LSLVKLTR+GLLL TFP       VN++ +I+ + ES + +   WCHRIFPIQ TC L+E
Sbjct  134   LSLVKLTRNGLLLLTFPSHTQSDTVNVVSNIIQAFESGNGSSLAWCHRIFPIQATCSLNE  193

Query  772   KELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDPLS-TLLDR  948
             K+L+ +VS L  +F+  NQ+KL +P+KFAVG+NRRG EET   + ++N  D  + +LLDR
Sbjct  194   KKLQEVVSMLVKKFVAANQDKLQRPLKFAVGFNRRGTEETAT-SAKENSNDSKALSLLDR  252

Query  949   DKCFSVVASAIKDIVPNSVVDLKHPEV  1029
             +KCF VVASA+  +V +SVVDL+ PE+
Sbjct  253   NKCFGVVASAVNHVVEDSVVDLRSPEL  279



>gb|KDO53573.1| hypothetical protein CISIN_1g0201161mg, partial [Citrus sinensis]
 gb|KDO53574.1| hypothetical protein CISIN_1g0201161mg, partial [Citrus sinensis]
 gb|KDO53575.1| hypothetical protein CISIN_1g0201161mg, partial [Citrus sinensis]
Length=217

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 155/205 (76%), Gaps = 0/205 (0%)
 Frame = +1

Query  562   SDTCAEKNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIF  741
             +DT  E + ++SLVKLTR+GLLL TFP   SP  +NI+ +I  SL S SL  P WCHRIF
Sbjct  13    TDTNTETDFDMSLVKLTRNGLLLLTFPREHSPNTINIVSNIFQSLGSGSLKSPVWCHRIF  72

Query  742   PIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEY  921
             PIQ TCVL EKEL+  VSKL  +F+ D QNKL +PVKFAVGYNRRG EE + K  +  + 
Sbjct  73    PIQATCVLKEKELQATVSKLVLQFVNDEQNKLSRPVKFAVGYNRRGFEEKQNKIPKDTKD  132

Query  922   DPLSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVL  1101
               +S LLDR+KCF++VA+A+K++V +S VDLK PE+SVL+ELLP+SG+P    VVGVS+L
Sbjct  133   SDVSALLDRNKCFTIVAAAVKEVVSDSAVDLKSPELSVLVELLPISGLPSELLVVGVSIL  192

Query  1102  PKALVSTKPRLSVKALVADIKAKGG  1176
             P+ LV+TKPRLS++ALV+   AK G
Sbjct  193   PQKLVTTKPRLSIRALVSGTNAKNG  217



>gb|KCW64431.1| hypothetical protein EUGRSUZ_G02045 [Eucalyptus grandis]
Length=280

 Score =   243 bits (619),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 135/257 (53%), Positives = 169/257 (66%), Gaps = 13/257 (5%)
 Frame = +1

Query  439   LEKYIPKTAAKKRKVCP---------GAANGEYPDSFKNKDAGCKDDISDS---DTCAEK  582
             LE    K  AK+RKVCP         G  +G+  D    +D    +D+S     D  A K
Sbjct  22    LELADAKLTAKRRKVCPEESDQEGADGDESGQITDQCCKEDGKLSEDVSSQTKEDIGANK  81

Query  583   NHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCV  762
             +  LSLVKLT SGLLLFTFP   S   + I+ DI+ SL S   + P+WCHRIFPIQ TC 
Sbjct  82    SSALSLVKLTGSGLLLFTFPHEDSTDTIQIVSDIIDSLGSADSSSPQWCHRIFPIQATCS  141

Query  763   LDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVR-KNEYDPLSTL  939
             L+E +LRT+V KL  +F+ D Q+ L  P+KFAVGYNRRG+EE E+KN + K +   L  L
Sbjct  142   LNEPDLRTVVQKLVLKFVKDKQSTLASPIKFAVGYNRRGLEEMELKNSKDKPDGSDLLPL  201

Query  940   LDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALVS  1119
             LDR KCF VVA+A+KD + +SVVDLK+PE+SVL+ELLPL+ IP GS V  VSVLP  +V+
Sbjct  202   LDRRKCFEVVAAAVKDAISDSVVDLKNPEISVLVELLPLAAIPSGSLVAAVSVLPPKMVT  261

Query  1120  TKPRLSVKALVADIKAK  1170
             TKPRL VK LV   K+K
Sbjct  262   TKPRLCVKVLVPQAKSK  278



>emb|CAN65717.1| hypothetical protein VITISV_023512 [Vitis vinifera]
Length=371

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 135/261 (52%), Positives = 170/261 (65%), Gaps = 24/261 (9%)
 Frame = +1

Query  469   KKRKVCPGAANGEYPDSFKNKDA--GCKDDISDSDTC---------------------AE  579
             K+RK+C    + E  +S +NK A   C +D   +D C                      E
Sbjct  85    KRRKICTEEIDEECVNSAENKTASNNCGEDGDIADLCLVQVGELSKDAGVSSANXDAIVE  144

Query  580   KNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTC  759
               H LSLVKLTRSGLLLF FP   S   V+++  I+ SL+S S+  P WCH IFPIQ TC
Sbjct  145   NGHVLSLVKLTRSGLLLFVFPRNNSVDTVDVVSQIIRSLQSGSVKPPLWCHXIFPIQATC  204

Query  760   VLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDPLS-T  936
              LDEKEL  +V+KL  +F+ + QNK  +P+KFAVGYNRRGIEETEMK  +    D  S  
Sbjct  205   RLDEKELHEVVTKLVVQFVNNEQNKFARPIKFAVGYNRRGIEETEMKIPKSTPRDCNSHA  264

Query  937   LLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALV  1116
             LLDR KCFSVVA+A+K  V +SVVDLK PE+SVL+ELLPLS +P+GS VV VSVLP+ L+
Sbjct  265   LLDRKKCFSVVATAVKGAVSDSVVDLKSPELSVLVELLPLSRVPNGSMVVAVSVLPQNLI  324

Query  1117  STKPRLSVKALVADIKAKGGK  1179
             +TKPRL +KAL++D K +  K
Sbjct  325   TTKPRLCIKALLSDTKLQXSK  345



>gb|AFW72753.1| hypothetical protein ZEAMMB73_044682 [Zea mays]
Length=313

 Score =   231 bits (590),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 146/313 (47%), Positives = 188/313 (60%), Gaps = 44/313 (14%)
 Frame = +1

Query  172   AVIDIRSTKMTEEGEKEKPES-GTTEIEPSVEKDKGEIGMKPWEQHSAVISIPRFDYNAP  348
             AV   RS ++  E E + P S GT E             +KPWEQH+AVI++PR+DY A 
Sbjct  12    AVTPSRSYELPPESESDAPASTGTQE-------------LKPWEQHAAVINLPRYDYRAS  58

Query  349   SSILRHSHCGFLVTCPIKREKSATKEAICILEKYIP-------------KTAAKKRKVCP  489
              S+L  SH GFL+TCPIKREKSATKEAI ILE+Y               K A KKRK+C 
Sbjct  59    GSLLLRSHSGFLITCPIKREKSATKEAIPILEEYHANCCVSEHAEPCDVKNAIKKRKLC-  117

Query  490   GAANGEYPDSFKNKD-----------AGCKDDISDSDTCAEKNHELSLVKLTRSGLLLFT  636
               A+G   ++  N +                  S  +   ++   LSLVKL+RSGLL F 
Sbjct  118   SEASGSLEEAVTNGNSSSVSESIGSTGNTSSPQSKVNDNVDRASNLSLVKLSRSGLLFFK  177

Query  637   FPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCVLDEKELRTLVSKLFSEFM  816
             FP G    +V +L +I+HSL S  L  P+WCHRIFPIQ TC+L E++L   VSKLF +F 
Sbjct  178   FPSG-GVHVVEMLTEILHSLRSGKLKSPQWCHRIFPIQETCILSEEDLHATVSKLFLDFS  236

Query  817   IDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDPLSTLLDRDKCFSVVASAIKDIVP  996
                 N+ D+P+KFAV YNRRGI+ETE KN   NE     TL+DR++CF VVA+A+K +  
Sbjct  237   RSKTNE-DKPIKFAVAYNRRGIDETE-KN--SNEGSNQQTLMDREQCFKVVAAAVKSVAE  292

Query  997   NSVVDLKHPEVSV  1035
             NSVVDL+ PEV++
Sbjct  293   NSVVDLRSPEVTL  305



>gb|ACG33622.1| hypothetical protein [Zea mays]
Length=313

 Score =   231 bits (589),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 146/313 (47%), Positives = 188/313 (60%), Gaps = 44/313 (14%)
 Frame = +1

Query  172   AVIDIRSTKMTEEGEKEKPES-GTTEIEPSVEKDKGEIGMKPWEQHSAVISIPRFDYNAP  348
             AV   RS ++  E E + P S GT E             +KPWEQH+AVI++PR+DY A 
Sbjct  12    AVTPSRSHELPPESESDAPASTGTQE-------------LKPWEQHAAVINLPRYDYRAS  58

Query  349   SSILRHSHCGFLVTCPIKREKSATKEAICILEKYIP-------------KTAAKKRKVCP  489
              S+L  SH GFL+TCPIKREKSATKEAI ILE+Y               K A KKRK+C 
Sbjct  59    GSLLLRSHSGFLITCPIKREKSATKEAIPILEEYHANCCVSEHAEPCDVKNAIKKRKLC-  117

Query  490   GAANGEYPDSFKNKD-----------AGCKDDISDSDTCAEKNHELSLVKLTRSGLLLFT  636
               A+G   ++  N +                  S  +   ++   LSLVKL+RSGLL F 
Sbjct  118   SEASGSLEEAVTNGNSSSVSESIGSTGNTSSPQSKVNDNVDRASNLSLVKLSRSGLLFFK  177

Query  637   FPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCVLDEKELRTLVSKLFSEFM  816
             FP G    +V +L +I+HSL S  L  P+WCHRIFPIQ TC+L E++L   VSKLF +F 
Sbjct  178   FPSG-GVHVVEMLTEILHSLRSGKLKSPQWCHRIFPIQETCILSEEDLHATVSKLFLDFS  236

Query  817   IDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDPLSTLLDRDKCFSVVASAIKDIVP  996
                 N+ D+P+KFAV YNRRGI+ETE KN   NE     TL+DR++CF VVA+A+K +  
Sbjct  237   RSKTNE-DKPIKFAVAYNRRGIDETE-KN--SNEGSNQQTLMDREQCFKVVAAAVKSVAE  292

Query  997   NSVVDLKHPEVSV  1035
             NSVVDL+ PEV++
Sbjct  293   NSVVDLRSPEVTL  305



>ref|XP_004140397.1| PREDICTED: uncharacterized protein LOC101219243 [Cucumis sativus]
Length=260

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 151/203 (74%), Gaps = 1/203 (0%)
 Frame = +1

Query  562   SDTCAEKNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIF  741
             S+   EK   +SLVKLTRSGLLLFTF    SP  V I+ DI+ SLE+++L    WCHRIF
Sbjct  58    SEAKVEKCSPISLVKLTRSGLLLFTFTKDISPDTVYIVKDIMQSLEARTLKSLAWCHRIF  117

Query  742   PIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEY  921
             PIQ TC L+E +L+ +VSKL   FM D  N L  PVKFA+GYNRRGIEETEMK   ++  
Sbjct  118   PIQATCSLNENDLQGVVSKLVLHFMNDKGNILSHPVKFAIGYNRRGIEETEMKKTFEDS-  176

Query  922   DPLSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVL  1101
               ++ +L RDKCFS+VA+A+K +V +++VDLK PE+ VL+ELLP+SG+P GS+VVGVSVL
Sbjct  177   SGVNVILGRDKCFSIVAAAVKGVVSDAIVDLKSPELCVLVELLPVSGLPSGSSVVGVSVL  236

Query  1102  PKALVSTKPRLSVKALVADIKAK  1170
                LV+TKPRL +KAL +D KAK
Sbjct  237   SNNLVTTKPRLCIKALTSDTKAK  259



>gb|AFW72751.1| hypothetical protein ZEAMMB73_044682 [Zea mays]
Length=286

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 133/300 (44%), Positives = 175/300 (58%), Gaps = 45/300 (15%)
 Frame = +1

Query  172   AVIDIRSTKMTEEGEKEKPES-GTTEIEPSVEKDKGEIGMKPWEQHSAVISIPRFDYNAP  348
             AV   RS ++  E E + P S GT E             +KPWEQH+AVI++PR+DY A 
Sbjct  12    AVTPSRSYELPPESESDAPASTGTQE-------------LKPWEQHAAVINLPRYDYRAS  58

Query  349   SSILRHSHCGFLVTCPIKREKSATKEAICILEKYIPKTAAKKRKVCPGAANGEYPDSFKN  528
              S+L  SH GFL+TCPIK          C +     K A KKRK+C   A+G   ++  N
Sbjct  59    GSLLLRSHSGFLITCPIK---------PCDV-----KNAIKKRKLC-SEASGSLEEAVTN  103

Query  529   KD-----------AGCKDDISDSDTCAEKNHELSLVKLTRSGLLLFTFPCGKSPPIVNIL  675
              +                  S  +   ++   LSLVKL+RSGLL F FP G    +V +L
Sbjct  104   GNSSSVSESIGSTGNTSSPQSKVNDNVDRASNLSLVKLSRSGLLFFKFPSG-GVHVVEML  162

Query  676   FDIVHSLESKSLNMPRWCHRIFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKF  855
              +I+HSL S  L  P+WCHRIFPIQ TC+L E++L   VSKLF +F     N+ D+P+KF
Sbjct  163   TEILHSLRSGKLKSPQWCHRIFPIQETCILSEEDLHATVSKLFLDFSRSKTNE-DKPIKF  221

Query  856   AVGYNRRGIEETEMKNVRKNEYDPLSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSV  1035
             AV YNRRGI+ETE KN   NE     TL+DR++CF VVA+A+K +  NSVVDL+ PEV++
Sbjct  222   AVAYNRRGIDETE-KN--SNEGSNQQTLMDREQCFKVVAAAVKSVAENSVVDLRSPEVTL  278



>ref|XP_010270743.1| PREDICTED: uncharacterized protein LOC104606974 isoform X2 [Nelumbo 
nucifera]
Length=283

 Score =   204 bits (518),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 140/220 (64%), Gaps = 30/220 (14%)
 Frame = +1

Query  277  EIGMKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYI-  453
            E G+ PWEQH+AVI+IPRFDYNAPSS+L +SH GFL+TCPIKREKSATKEAI ILEK+I 
Sbjct  16   EEGLTPWEQHAAVINIPRFDYNAPSSLLEYSHSGFLITCPIKREKSATKEAISILEKFIV  75

Query  454  ---------------PKTAAKKRKVCPGAANGEYPDSFKNKDAGCKDDISDSDTCA----  576
                              AAK+RKVC    NG+  ++ ++   G  D I DSD  +    
Sbjct  76   SQSCGSSSECLEVLDANVAAKRRKVCIEERNGKGGNNLESTKDG--DTIRDSDGISKETS  133

Query  577  --------EKNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCH  732
                    E +  LSLVKLTRSGLLL T P   S   V+IL +I  SL+S+SL  P W H
Sbjct  134  SFSAKIGVEFSQVLSLVKLTRSGLLLLTIPRNSSYNTVDILSNIFCSLDSRSLKAPLWIH  193

Query  733  RIFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVK  852
            RI PIQ TC L+E +LR +VSKL  +F+ D QN +++PVK
Sbjct  194  RILPIQATCSLNEMDLRRVVSKLVQQFLDDKQNNVERPVK  233



>gb|AAD18100.1| This gene is continued on the 5' end of BAC T12M14, partial [Arabidopsis 
thaliana]
Length=297

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 111/237 (47%), Positives = 139/237 (59%), Gaps = 31/237 (13%)
 Frame = +1

Query  265  KDKGEIG--MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICI  438
            +++GE    + PWEQHS++ISIPRFDY APSS+L HSH GFLVTC IKREKSATKE + I
Sbjct  23   RERGEEAETLTPWEQHSSIISIPRFDYKAPSSLLHHSHSGFLVTCNIKREKSATKEVMSI  82

Query  439  L------------EKYIPK-----------TAAKKRKVCPGAA--NGEYPDSFKN---KD  534
            L             KYI             TA+KK+KVC       GE     +N   ++
Sbjct  83   LGKVSSQFSIISEAKYIGSMHEEKPEVLNSTASKKQKVCAQETEEGGEKTVPLENDALQE  142

Query  535  AGCKDDISDSDTCAEKNHEL-SLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSL  711
             G   ++ D     E+++ L SLVKLT+SGLLLFTFP   SP   NI+  +  S+ES +L
Sbjct  143  TGENPNVEDLKLANEEHNSLMSLVKLTKSGLLLFTFPVENSPNTTNIVSRVFQSMESGAL  202

Query  712  NMPRWCHRIFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGI  882
              P WCHRIFP+Q TC L EKELR  VSKL   F+ D  N L +PVK    +   G+
Sbjct  203  KAPIWCHRIFPVQATCGLTEKELRETVSKLVQRFVNDKDNTLSKPVKVRKSFRYIGV  259



>gb|AFW72749.1| hypothetical protein ZEAMMB73_044682 [Zea mays]
Length=166

 Score =   181 bits (460),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 129/171 (75%), Gaps = 6/171 (4%)
 Frame = +1

Query  670   ILFDIVHSLESKSLNMPRWCHRIFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPV  849
             +L +I+HSL S  L  P+WCHRIFPIQ TC+L E++L   VSKLF +F     N+ D+P+
Sbjct  1     MLTEILHSLRSGKLKSPQWCHRIFPIQETCILSEEDLHATVSKLFLDFSRSKTNE-DKPI  59

Query  850   KFAVGYNRRGIEETEMKNVRKNEYDPLSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEV  1029
             KFAV YNRRGI+ETE KN   NE     TL+DR++CF VVA+A+K +  NSVVDL+ PEV
Sbjct  60    KFAVAYNRRGIDETE-KN--SNEGSNQQTLMDREQCFKVVAAAVKSVAENSVVDLRSPEV  116

Query  1030  SVLIELLPLSGIPDGSAVVGVSVLPKALVSTKPRLSVKALVADIKAKGGKR  1182
             +VL+E+LP+SG+P GS+V GVSVLP  L+STKPRL V++LV D  AK GK+
Sbjct  117   AVLVEMLPVSGVPLGSSVAGVSVLPAELISTKPRLCVRSLVPD--AKAGKK  165



>gb|KHN37405.1| hypothetical protein glysoja_013620 [Glycine soja]
Length=290

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 121/332 (36%), Positives = 154/332 (46%), Gaps = 106/332 (32%)
 Frame = +1

Query  262   EKDKGEIGMKPWEQHSAVISIPRFDYN-----APSSILRHSHCGFLVTCPIKREK-----  411
             + D   +GM PWEQHS VI +PR+DYN       SS+LR+SH  FL+TC I         
Sbjct  3     DADAYAVGMNPWEQHSGVIKLPRYDYNSPSSLLFSSLLRNSHSDFLITCTISSVNSLTSL  62

Query  412   -------------------SATKEAICILEKYI-------PK---TAAKKRKVCPGAANG  504
                                SATKEAI IL K++       PK   T++KKRK+C      
Sbjct  63    HSHSSPSNLPFHFFNSSFHSATKEAISILHKFVAYDSSNNPKEEGTSSKKRKLCTQDTAD  122

Query  505   EYPDSFKNKDAGCKDDISDSDTC------------------AEKNHE----LSLVKLTRS  618
             E    F +KD       S  D                    AE   +    LSLVKLTR+
Sbjct  123   E---CFDHKDTESASANSAEDGIHFFFADYTMSMILMAGVKAEGEKDGVACLSLVKLTRN  179

Query  619   GLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCVLDEKELRTLVSK  798
             GLLL  FP    P  VNI+ +I+ +LES ++ +P WC                       
Sbjct  180   GLLLLNFPSNTPPNTVNIVSNIIQALESGTVTLPVWC-----------------------  216

Query  799   LFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKNEYDPLSTLLDRDKCFSVVASA  978
                               FAVG+NRRGIEET       N+ +  S LL R+KCF VV+SA
Sbjct  217   ------------------FAVGFNRRGIEETTFAKEYSNDSNAFS-LLVRNKCFGVVSSA  257

Query  979   IKDIVPNSVVDLKHPEVSVLIELLPLSGIPDG  1074
             +  +V +SVVDL+ PE+SVL+ELLPLS  P G
Sbjct  258   VNHVVEDSVVDLRSPELSVLVELLPLSEYPLG  289



>gb|AFK46098.1| unknown [Lotus japonicus]
Length=212

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 83/105 (79%), Gaps = 1/105 (1%)
 Frame = +1

Query  850   KFAVGYNRRGIEETEMKNVRKNEYDPLSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEV  1029
             KFAVGYNRRGIE+T+      N  +  S LLDR+KCFSVVASA+ D+V +SVVDL+ PE+
Sbjct  103   KFAVGYNRRGIEDTKFAKENSNGSNAFS-LLDRNKCFSVVASAVNDVVEDSVVDLRSPEL  161

Query  1030  SVLIELLPLSGIPDGSAVVGVSVLPKALVSTKPRLSVKALVADIK  1164
             S+L+ELLPLS +P+GS VV VS LP+ LVSTKPRL VKAL ++ K
Sbjct  162   SILVELLPLSRVPNGSLVVAVSALPRNLVSTKPRLCVKALTSNTK  206


 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  286  MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKY  450
            M PWEQHS VI + R+DYNAP+S+L HS+ GFL+TC IKREKSATKEA+ ILEK+
Sbjct  50   MTPWEQHSGVIKLSRYDYNAPASLLLHSYSGFLITCTIKREKSATKEALSILEKF  104



>gb|KDO53571.1| hypothetical protein CISIN_1g0201162mg, partial [Citrus sinensis]
Length=102

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 60/81 (74%), Gaps = 4/81 (5%)
 Frame = +1

Query  286  MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYIPKTA  465
            +KPWEQHS VISIPRFDYN+PSS+L+ SH GFL+TC IKREKSATKEAI IL K +  + 
Sbjct  10   LKPWEQHSRVISIPRFDYNSPSSLLQRSHSGFLLTCTIKREKSATKEAISILHKRLESSN  69

Query  466  ----AKKRKVCPGAANGEYPD  516
                +K+RKVC     G+  D
Sbjct  70   TAGDSKRRKVCTDDMGGKCAD  90



>gb|KDO53570.1| hypothetical protein CISIN_1g0201162mg, partial [Citrus sinensis]
Length=113

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 62/92 (67%), Gaps = 15/92 (16%)
 Frame = +1

Query  286  MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYI----  453
            +KPWEQHS VISIPRFDYN+PSS+L+ SH GFL+TC IKREKSATKEAI IL KY+    
Sbjct  10   LKPWEQHSRVISIPRFDYNSPSSLLQRSHSGFLLTCTIKREKSATKEAISILHKYVGHNN  69

Query  454  ---------PKTA--AKKRKVCPGAANGEYPD  516
                       TA  +K+RKVC     G+  D
Sbjct  70   IENSQRLESSNTAGDSKRRKVCTDDMGGKCAD  101



>gb|AFW72748.1| hypothetical protein ZEAMMB73_044682 [Zea mays]
Length=80

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 67/81 (83%), Gaps = 2/81 (2%)
 Frame = +1

Query  940   LDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALVS  1119
             +DR++CF VVA+A+K +  NSVVDL+ PEV+VL+E+LP+SG+P GS+V GVSVLP  L+S
Sbjct  1     MDREQCFKVVAAAVKSVAENSVVDLRSPEVAVLVEMLPVSGVPLGSSVAGVSVLPAELIS  60

Query  1120  TKPRLSVKALVADIKAKGGKR  1182
             TKPRL V++LV D  AK GK+
Sbjct  61    TKPRLCVRSLVPD--AKAGKK  79



>gb|ACG24133.1| hypothetical protein [Zea mays]
Length=112

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 74/119 (62%), Gaps = 17/119 (14%)
 Frame = +1

Query  940   LDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALVS  1119
             +DR++CF VVA+A+K +  NSVVDL+ PEV+VL+E+LP+SG+P GS+V GVSVLP  L+S
Sbjct  1     MDREQCFKVVAAAVKSVAENSVVDLRSPEVAVLVEMLPVSGVPLGSSVAGVSVLPAELIS  60

Query  1120  TKPRLSVKALVADIKAKGGKRSQ**NVFHMHQTNRCLFVLYPRFCSFC*QIFPLSHFTC  1296
             TKPRL V++ +     K  KRS+          N+          S C    P+  FTC
Sbjct  61    TKPRLCVRSCLMQ---KQEKRSE----IRWRLVNQ----------SICNGKLPMQFFTC  102



>emb|CDP21747.1| unnamed protein product [Coffea canephora]
Length=120

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 58/86 (67%), Gaps = 3/86 (3%)
 Frame = +1

Query  286  MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPIKREKSATKEAICILEKYIPKTA  465
            +KPWEQHS VI+IPRFDYN  SS+L HSH GFL+TCPIKREKSATKEA+ I EK +    
Sbjct  38   LKPWEQHSVVITIPRFDYNTSSSLLSHSHSGFLITCPIKREKSATKEAMSIFEKVMNSAG  97

Query  466  AKKRKVCPGAANGEYPDSFKNKDAGC  543
                  CP +       +F++K+  C
Sbjct  98   FVS---CPFSGIMSKSGNFRHKENSC  120



>emb|CDP20169.1| unnamed protein product [Coffea canephora]
Length=78

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  286  MKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCPI  399
            +KPWEQHSAVISIPRFDYNAPSSIL HSH GFL+TCPI
Sbjct  32   LKPWEQHSAVISIPRFDYNAPSSILNHSHSGFLITCPI  69



>ref|XP_002970202.1| hypothetical protein SELMODRAFT_441087 [Selaginella moellendorffii]
 gb|EFJ28332.1| hypothetical protein SELMODRAFT_441087 [Selaginella moellendorffii]
Length=812

 Score = 88.2 bits (217),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 118/239 (49%), Gaps = 38/239 (16%)
 Frame = +1

Query  403   REKSATKEAICILEKYIPKTAAKKRKVCPGAANGEYPDSFKNKDAGCKDDISDSDTCAEK  582
             REKSATKE + IL +YI  +++      PG    E P   ++K       I         
Sbjct  111   REKSATKEIMDILPQYIGTSSS-----IPG---DETPKENEDKSTASPSGI---------  153

Query  583   NHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCV  762
                 SL+KL+ SG++  + P      +V++L  ++  + +       WC+R+ P+Q TC 
Sbjct  154   ---FSLIKLSGSGIVFLSTP--DDTDVVSVLSRVLDDIRAPHTKPFSWCNRLTPVQATCA  208

Query  763   LDEKELRTLVSKLFSEFMIDNQNKLDQP-VKFAVGYNRRGIEETEMKNVRKNEYDPLSTL  939
              +E+ +   V  L  +      +K  +  +K+AVG+N R  E+              +T 
Sbjct  209   SEEEAIFVTVLGLLRDDAGGIVSKTGRSNLKYAVGFNSRAAEDG-------------NTG  255

Query  940   LDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPKALV  1116
             ++RD C + VA A+++    + V+L +PE+ V +EL+PL G    + + G+S+LPK +V
Sbjct  256   VERDGCIAAVARAMQEFEQQASVNLSNPEIVVAVELIPLVG--KTTPLAGISLLPKEVV  312



>ref|XP_001767623.1| predicted protein [Physcomitrella patens]
 gb|EDQ67582.1| predicted protein [Physcomitrella patens]
Length=385

 Score = 86.3 bits (212),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 106/212 (50%), Gaps = 20/212 (9%)
 Frame = +1

Query  553   ISDSDT---CA---EKNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLN  714
             +SD DT   C+   +   E  LVKL R+G++  + PC  +  +      I++   S++  
Sbjct  187   LSDRDTGLGCSSAPDMKGEFRLVKLARNGMVYISIPCRSAEDLFTSFIKIINDFHSRTRA  246

Query  715   MPRWCHRIFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETE  894
              PR   +    +  CV     +R  +    S  M+   +   Q   +AV  N+RG+E+ E
Sbjct  247   APR-SEKPINFEHRCV--SFPVRLFIFWEASNGMLHAHSGSSQ---YAVAVNKRGLEDKE  300

Query  895   MKNVRKNEYDPLSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDG  1074
                V        +++  + +C   VA AI+ +     VDL +P++ V++ELLPL  +  G
Sbjct  301   KPGVTT------ASVFGKPECIHAVAEAIQSLTEYISVDLTNPQMVVMLELLPLVRV--G  352

Query  1075  SAVVGVSVLPKALVSTKPRLSVKALVADIKAK  1170
             ++V  VSVLP+ LV TKP+L ++AL    K K
Sbjct  353   TSVCAVSVLPRELVLTKPKLVIQALAPPKKQK  384


 Score = 55.8 bits (133),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 47/88 (53%), Gaps = 22/88 (25%)
 Frame = +1

Query  283  GMKPWEQHSAVISIPRFDYNAPSSILRHSHCGFLVTCP-----------------IKREK  411
             +KPW+QH  VI++PR+ Y++ +  L H   GFL+TC                  + REK
Sbjct  26   ALKPWDQHGGVINMPRYLYSSDAVPLLH-RSGFLITCAYRANIAKTWDDFVELRRVGREK  84

Query  412  SATKEAICILEKYI----PKTAAKKRKV  483
            SATKEA+ IL +++    P   AK+ + 
Sbjct  85   SATKEAVEILREFLDFTKPNGGAKRART  112



>ref|XP_002978366.1| hypothetical protein SELMODRAFT_443858 [Selaginella moellendorffii]
 gb|EFJ20352.1| hypothetical protein SELMODRAFT_443858 [Selaginella moellendorffii]
Length=742

 Score = 80.9 bits (198),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 115/233 (49%), Gaps = 38/233 (16%)
 Frame = +1

Query  412   SATKEAICILEKYIPKTAAKKRKVCPGAANGEYPDSFKNKDAGCKDDISDSDTCAEKNHE  591
             SATKE + IL +YI  +++      PG    E P   ++K            + A  +  
Sbjct  30    SATKEIMDILPQYIGTSSS-----IPG---DETPKDNEDK------------STASPSGV  69

Query  592   LSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFPIQGTCVLDE  771
              SL+KL+ SG++  + P      +V++L  ++  + +       WC+R+ P+Q TC  +E
Sbjct  70    FSLIKLSGSGIVFLSTP--DDTDVVSVLSRVLDDIRAPHTKPFSWCNRLTPVQATCASEE  127

Query  772   KELRTLVSKLFSEFMIDNQNKLDQP-VKFAVGYNRRGIEETEMKNVRKNEYDPLSTLLDR  948
             + +   V  L  +      +K  +  +K+AVG+N R  E+              +T ++R
Sbjct  128   EAIFVTVLGLLRDDAGGIVSKTGRSNLKYAVGFNSRAAEDG-------------NTGVER  174

Query  949   DKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLPLSGIPDGSAVVGVSVLPK  1107
             D C + VA A+++    + V+L +PE+ V +EL+PL G    + + G+S+LPK
Sbjct  175   DGCIAAVARAMQEFEQQASVNLSNPEIVVAVELIPLVG--KTTPLAGISLLPK  225



>gb|AFW72750.1| hypothetical protein ZEAMMB73_044682 [Zea mays]
Length=102

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 36/77 (47%), Positives = 46/77 (60%), Gaps = 14/77 (18%)
 Frame = +1

Query  172  AVIDIRSTKMTEEGEKEKPES-GTTEIEPSVEKDKGEIGMKPWEQHSAVISIPRFDYNAP  348
            AV   RS ++  E E + P S GT E             +KPWEQH+AVI++PR+DY A 
Sbjct  12   AVTPSRSYELPPESESDAPASTGTQE-------------LKPWEQHAAVINLPRYDYRAS  58

Query  349  SSILRHSHCGFLVTCPI  399
             S+L  SH GFL+TCPI
Sbjct  59   GSLLLRSHSGFLITCPI  75



>emb|CDP22246.1| unnamed protein product [Coffea canephora]
Length=97

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 50/74 (68%), Gaps = 8/74 (11%)
 Frame = +1

Query  187  RSTKMTEEGEKE-KPESGTTEIEPSVEKDKGEIGMKPWEQHSAVISIPRFDYNAPSSILR  363
            R T  TEE  KE   E+   E++ + E       +KPWEQHSAVI+IPRFDYNA SS+L 
Sbjct  3    RGTAKTEERAKELATEAMKVELKTTEE-------LKPWEQHSAVITIPRFDYNASSSLLS  55

Query  364  HSHCGFLVTCPIKR  405
            HSH GFL+TCPI +
Sbjct  56   HSHSGFLITCPISK  69



>ref|XP_004297811.1| PREDICTED: uncharacterized protein LOC101314559 [Fragaria vesca 
subsp. vesca]
Length=107

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +1

Query  565  DTCAEKNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHRIFP  744
            +T  E    L LVKLT+SGLLLF F    SP +V I+  IV S ES S     WC+RIFP
Sbjct  43   NTDGETGPLLKLVKLTKSGLLLFVFGKSVSPDVVGIVLRIVQSGESGSSASLLWCNRIFP  102

Query  745  IQGT  756
            IQ T
Sbjct  103  IQAT  106



>gb|EKC17198.1| THUMP domain-containing protein 1 [Crassostrea gigas]
Length=399

 Score = 54.7 bits (130),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 90/224 (40%), Gaps = 22/224 (10%)
 Frame = +1

Query  376   GFLVTCPIKREKSATKEAICILEKYIPKTAAKKRKVCPGAANGEYPDSFKNKDAGCKDDI  555
             GFLVTC    EK A ++A  IL +Y  K    +++   G+   E     + ++   K   
Sbjct  54    GFLVTCN-NNEKGAVRDAYNILNEYADKLYGPEKE-SSGSKEDEDLSEEEEEEDIEKAMK  111

Query  556   SDSDTCAEKNHELSLVKLTRSGLLLFTFPCGKSPPIVNILFDIVHSLESKSLNMPRWCHR  735
              + D   E  HEL   + T +      F     P    +   I+  L    +   R+  R
Sbjct  112   KEVDEIKESKHELRRFQNTNTKAKNLIFIRTTIPDPSQLAHSILSDLWETKVQKSRFAIR  171

Query  736   IFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRRGIEETEMKNVRKN  915
             + PI GTC  +E E++ L  +LF+               F  GYN   I +     +R N
Sbjct  172   LLPIAGTCRAEEDEVKKLGKELFTPIF---------QTPFGEGYNFSIIVK-----IRNN  217

Query  916   EYDPLSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIEL  1047
                     L RD     +A  IKD+ P   V+   P+  VL+E+
Sbjct  218   ------NGLGRDSVIPALAGIIKDLNPLHRVNHDKPDFVVLVEV  255



>gb|KDR11885.1| THUMP domain-containing protein 1 [Zootermopsis nevadensis]
Length=388

 Score = 54.7 bits (130),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 60/256 (23%), Positives = 100/256 (39%), Gaps = 50/256 (20%)
 Frame = +1

Query  355   ILRHSHCGFLVTCPIKREKSATKEAICILEKYIPKTAAKKRKVCPGAANGEYPDSFKNKD  534
             +L+    GFL TC   REK   +E+  IL +Y      ++++   G +            
Sbjct  25    VLKPGLKGFLCTCN-SREKDCIRESYNILNEYADCLYGEEKETSAGTSAVR---------  74

Query  535   AGCKDDISDSDTCAEKNHELSLVKLTR-------------SGLLLFTFPCGKSPPIVNIL  675
                KD+  D D     + EL  +K  R             SG     F     P  V + 
Sbjct  75    GTAKDESEDEDIETALSKELDSLKAERKKVPSKCRFQAVDSGANNCIFIQTTVPEPVQLA  134

Query  676   FDIVHSLESKSLNMPRWCHRIFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKF  855
               I+  LES      R+  R+ PI+ TC    +++R     L  ++         +   F
Sbjct  135   HYIMKDLESTKKQKTRFLLRLLPIEATCKAYLEDIRQTADNLLDKYFSK------EGKTF  188

Query  856   AVGYNRRGIEETEMKNVRKNEYDPLSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSV  1035
             AV +NRR                  S+ ++RD     +A  +    P +  DLKHP++++
Sbjct  189   AVLFNRRN-----------------SSGVNRDDLIRDLAEMVLRRHPENRADLKHPQLAI  231

Query  1036  LIELLP----LSGIPD  1071
             ++E++     LS +PD
Sbjct  232   IVEVIRNMCCLSVLPD  247



>emb|CDP20332.1| unnamed protein product [Coffea canephora]
Length=85

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/21 (95%), Positives = 21/21 (100%), Gaps = 0/21 (0%)
 Frame = +1

Query  286  MKPWEQHSAVISIPRFDYNAP  348
            MKPWEQHSAVI+IPRFDYNAP
Sbjct  32   MKPWEQHSAVITIPRFDYNAP  52



>gb|EZA52159.1| THUMP domain-containing protein [Cerapachys biroi]
Length=324

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 117/283 (41%), Gaps = 44/283 (16%)
 Frame = +1

Query  376   GFLVTCPIKREKSATKEAICILEKYIPKTAAKKRKVCPGAAN--GEYPDSFKNKDAGCKD  549
             GFL TC    E+    +A  +L  +  + +A + K  P   N       S ++ D   +D
Sbjct  38    GFLCTCNF-HERGCVTDAYKLLNLFADEESAPEVKKEPEGLNVANTLDKSSEDADKSSED  96

Query  550   DISDSDTCAEKN-------HELSL----VKLTRSGLLLFTFPCGKSPPIVNILFDIVHSL  696
             D  D  T  +K        HEL L     ++  +G+    F     P  + ++  IV  L
Sbjct  97    D--DISTALKKEITELRTEHELPLSSRRFQVVDTGVKNMIFVASTLPNPLELVTKIVTQL  154

Query  697   ESKSLNMPRWCHRIFPIQGTCVLDEKELRTLVSKLFSEFMIDNQNKLDQPVKFAVGYNRR  876
             +       R+  R+ PIQ  C     ++RT  S LF ++         +P  F++ +NRR
Sbjct  155   DVTKKQCTRYLLRLLPIQVICKAYMNDIRTKASALFEKYFA------QEPKTFSIVFNRR  208

Query  877   GIEETEMKNVRKNEYDPLSTLLDRDKCFSVVASAIKDIVPNSVVDLKHPEVSVLIELLP-  1053
                               +  + R++    +A  I    P +  DLK+PE++V++E++  
Sbjct  209   S-----------------NNSIKRNEIIEDLAEIIARKNPGNKADLKNPEIAVVVEVIRG  251

Query  1054  ---LSGIPDGSAVVGVSVLPKALVSTKPRLSVKALVADIKAKG  1173
                LS  P+       +++ +   S KP+   K+   +IK +G
Sbjct  252   ICLLSIAPNYYKFKKYNLI-EICNSAKPKQEQKSENKEIKEEG  293



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3595941013084