BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c12868_g1_i1 len=1763 path=[1:0-657 659:658-1762]

Length=1763
                                                                      Score     E

ref|XP_009603861.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    336   2e-105   
ref|XP_009798338.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    333   2e-104   
ref|XP_004235805.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    321   8e-100   
ref|XP_006341612.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    317   2e-98    
emb|CDO98435.1|  unnamed protein product                                307   4e-94    
ref|XP_010265147.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    294   4e-89    
ref|XP_007036519.1|  Transcription factor, putative                     289   4e-87    
ref|XP_011016373.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    288   5e-87    
ref|XP_006374368.1|  hypothetical protein POPTR_0015s06480g             287   1e-86    
ref|XP_002282578.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    285   1e-85    Vitis vinifera
ref|XP_010263709.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    286   1e-85    
ref|XP_009602362.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    280   3e-84    
ref|XP_002533412.1|  transcription factor, putative                     281   3e-84    Ricinus communis
ref|XP_007044348.1|  B-box type zinc finger protein with CCT doma...    280   1e-83    
ref|XP_006440964.1|  hypothetical protein CICLE_v10020440mg             278   2e-83    
emb|CAN73757.1|  hypothetical protein VITISV_026326                     278   2e-82    Vitis vinifera
ref|XP_011072947.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     274   4e-82    
ref|XP_002276181.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    275   6e-82    Vitis vinifera
ref|XP_011022115.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     275   1e-81    
ref|XP_009765495.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    273   2e-81    
gb|AIE41597.1|  zinc finger protein CONSTANS-LIKE 6                     272   2e-81    
ref|XP_006485786.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    270   2e-80    
ref|XP_010066724.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    271   3e-80    
gb|KHG04097.1|  Zinc finger CONSTANS-LIKE 16 -like protein              270   4e-80    
ref|XP_007152761.1|  hypothetical protein PHAVU_004G157300g             269   5e-80    
ref|XP_011076793.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    270   1e-79    
ref|XP_009347093.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    270   1e-79    
ref|XP_009627333.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    268   7e-79    
ref|XP_008374747.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     266   1e-78    
ref|XP_008240273.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    266   7e-78    
gb|KDP20116.1|  hypothetical protein JCGZ_05885                         264   1e-77    
ref|XP_010094760.1|  Zinc finger protein CONSTANS-LIKE 16               263   3e-77    
ref|XP_004300528.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    263   5e-77    
ref|XP_009360161.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    262   6e-77    
emb|CDP00619.1|  unnamed protein product                                261   2e-76    
ref|XP_006367940.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    260   2e-76    
gb|KHG17662.1|  Zinc finger CONSTANS-LIKE 16 -like protein              259   5e-76    
ref|XP_009777706.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    258   4e-75    
gb|AFX73409.1|  constans-like protein 5                                 256   6e-75    
gb|AEF12205.1|  CONSTANS-like zinc finger protein                       256   6e-75    
gb|AHI45077.1|  COL domain class transcription factor                   257   6e-75    
gb|AHI45078.1|  COL domain class transcription factor                   257   8e-75    
ref|NP_001278940.1|  zinc finger protein CONSTANS-LIKE 16-like          255   1e-74    
ref|XP_009356747.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    256   2e-74    
ref|XP_010031966.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    255   5e-74    
gb|KHN11420.1|  Zinc finger protein CONSTANS-LIKE 16                    254   5e-74    
ref|XP_003555902.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    253   8e-74    
ref|XP_009356271.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    254   1e-73    
gb|AEF12203.1|  CONSTANS-like zinc finger protein                       253   1e-73    
ref|XP_008339676.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     251   1e-72    
ref|XP_008352923.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    251   2e-72    
ref|XP_004238926.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    249   3e-72    
ref|XP_008389292.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    250   4e-72    
ref|XP_008360050.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    250   4e-72    
ref|XP_004236986.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    249   5e-72    
ref|XP_009397482.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    248   9e-72    
ref|XP_003525256.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    245   3e-71    
ref|XP_006344138.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    246   6e-71    
ref|XP_011071256.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    246   9e-71    
gb|ACX42573.1|  CONSTANS-like zinc finger protein                       243   2e-70    Glycine max [soybeans]
ref|XP_004497095.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    243   9e-70    
ref|XP_008446600.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    241   1e-69    
ref|XP_007160372.1|  hypothetical protein PHAVU_002G316100g             240   2e-69    
ref|XP_004135402.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    241   2e-69    
gb|KGN52081.1|  hypothetical protein Csa_5G609670                       241   2e-69    
gb|KEH44219.1|  zinc finger constans-like protein                       241   7e-69    
ref|XP_008775153.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    239   1e-68    
gb|AIE41596.1|  zinc finger protein CONSTANS-LIKE 5                     238   1e-68    
ref|XP_010916170.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    238   6e-68    
emb|CDY03851.1|  BnaC07g10760D                                          236   1e-67    
gb|KFK44524.1|  hypothetical protein AALP_AA1G267800                    236   2e-67    
ref|XP_007222133.1|  hypothetical protein PRUPE_ppa005713mg             237   3e-67    
ref|XP_003630849.1|  CONSTANS-like zinc finger protein                  235   4e-67    
ref|XP_009105041.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    235   4e-67    
emb|CDY44890.1|  BnaA02g13920D                                          234   5e-67    
emb|CDY65591.1|  BnaC05g50730D                                          232   1e-66    
emb|CDX81527.1|  BnaC02g18310D                                          234   1e-66    
emb|CDY51133.1|  BnaA07g37160D                                          232   2e-66    
ref|XP_010527538.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    234   3e-66    
emb|CDY67920.1|  BnaAnng25560D                                          231   3e-66    
ref|XP_010667660.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    233   4e-66    
ref|XP_004164163.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    231   5e-66    
ref|XP_009127638.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     232   6e-66    
ref|XP_008802436.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    233   9e-66    
ref|XP_008243227.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    233   1e-65    
ref|XP_004512860.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    231   1e-65    
ref|XP_003530677.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    229   2e-65    
gb|EYU45446.1|  hypothetical protein MIMGU_mgv1a026677mg                230   3e-65    
gb|AEF12200.1|  CONSTANS-like zinc finger protein                       229   3e-65    
gb|AFK37106.1|  unknown                                                 230   3e-65    
emb|CDY53119.1|  BnaCnng24470D                                          229   4e-65    
gb|AAM13173.1|  unknown protein                                         229   6e-65    Arabidopsis thaliana [mouse-ear cress]
gb|AAG50803.1|AC079281_5  zinc finger protein, putative                 229   7e-65    Arabidopsis thaliana [mouse-ear cress]
ref|NP_173915.2|  zinc finger protein CONSTANS-LIKE 16                  229   9e-65    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010499109.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    229   1e-64    
ref|XP_010460378.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    229   1e-64    
ref|XP_009115317.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    228   2e-64    
ref|XP_010460379.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    228   2e-64    
ref|XP_010320765.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    228   3e-64    
ref|XP_010460380.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    228   3e-64    
ref|XP_006307606.1|  hypothetical protein CARUB_v10009230mg             228   3e-64    
gb|EPS73837.1|  hypothetical protein M569_00919                         227   4e-64    
emb|CDY24402.1|  BnaCnng04690D                                          226   4e-64    
ref|XP_007142909.1|  hypothetical protein PHAVU_007G027200g             227   6e-64    
ref|XP_009103068.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    226   7e-64    
gb|AAG52391.1|AC011915_5  putative B-box zinc finger protein; 520...    226   9e-64    Arabidopsis thaliana [mouse-ear cress]
ref|NP_564932.1|  zinc finger protein CONSTANS-LIKE 6                   226   1e-63    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006391130.1|  hypothetical protein EUTSA_v10018663mg             226   1e-63    
gb|EYU26768.1|  hypothetical protein MIMGU_mgv1a006045mg                228   1e-63    
ref|XP_006302328.1|  hypothetical protein CARUB_v10020384mg             225   2e-63    
gb|AAM61001.1|  putative B-box zinc finger protein                      225   3e-63    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010477926.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    225   4e-63    
ref|XP_007153446.1|  hypothetical protein PHAVU_003G036000g             220   1e-61    
gb|KGN63817.1|  hypothetical protein Csa_1G023050                       217   8e-61    
ref|XP_010470801.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    218   8e-61    
ref|XP_008453390.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    214   7e-60    
ref|XP_009109881.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    215   1e-59    
ref|XP_009409257.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    214   3e-59    
ref|XP_010926126.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    214   6e-59    
ref|XP_009410076.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    211   6e-58    
ref|XP_006829901.1|  hypothetical protein AMTR_s00073p00061640          208   4e-57    
gb|AGI62036.1|  CONSTANS-like 12                                        205   1e-56    
gb|EYU29978.1|  hypothetical protein MIMGU_mgv1a007591mg                207   1e-56    
ref|XP_009381104.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    207   2e-56    
ref|XP_008445668.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    204   3e-56    
ref|XP_004982006.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    204   2e-55    
ref|NP_001051053.1|  Os03g0711100                                       201   2e-54    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003560836.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    198   3e-53    
ref|NP_001149548.1|  CCT motif family protein                           197   7e-53    Zea mays [maize]
ref|NP_177528.1|  zinc finger protein CONSTANS-LIKE 7                   196   8e-53    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010416209.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    196   9e-53    
ref|XP_008801158.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    194   2e-52    
ref|XP_010428333.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    195   4e-52    
ref|XP_010907326.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    191   3e-51    
ref|XP_009381448.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    192   4e-51    
ref|XP_006302335.1|  hypothetical protein CARUB_v10020393mg             192   4e-51    
ref|XP_010471465.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7     192   5e-51    
ref|XP_002466587.1|  hypothetical protein SORBIDRAFT_01g010420          190   3e-50    Sorghum bicolor [broomcorn]
dbj|BAK01505.1|  predicted protein                                      188   1e-49    
ref|XP_002887511.1|  zinc finger (B-box type) family protein            185   1e-48    
ref|XP_010519197.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    185   4e-48    
ref|XP_010519196.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    182   3e-47    
ref|XP_008393304.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    178   1e-46    
emb|CDY36106.1|  BnaA08g19420D                                          177   6e-46    
dbj|BAK04456.1|  predicted protein                                      177   8e-46    
ref|NP_001140584.1|  uncharacterized protein LOC100272654               176   5e-45    Zea mays [maize]
dbj|BAJ87752.1|  predicted protein                                      171   6e-43    
gb|KHN32039.1|  Zinc finger protein CONSTANS-LIKE 16                    169   8e-43    
ref|NP_001239992.1|  uncharacterized protein LOC100802113               165   5e-42    
ref|XP_006468698.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    165   3e-41    
ref|XP_006448477.1|  hypothetical protein CICLE_v10015173mg             165   3e-41    
ref|XP_002311458.2|  zinc finger family protein                         162   5e-40    Populus trichocarpa [western balsam poplar]
ref|XP_007210807.1|  hypothetical protein PRUPE_ppa017267mg             161   6e-40    
gb|KHN05568.1|  Zinc finger protein CONSTANS-LIKE 16                    154   2e-39    
ref|XP_010103762.1|  Zinc finger protein CONSTANS-LIKE 16               155   7e-38    
ref|XP_011007910.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    155   8e-38    
ref|XP_002315940.1|  Zinc finger protein CONSTANS-LIKE 6                154   2e-37    Populus trichocarpa [western balsam poplar]
ref|XP_002531628.1|  conserved hypothetical protein                     154   2e-37    Ricinus communis
ref|XP_002894160.1|  hypothetical protein ARALYDRAFT_891757             151   2e-37    
ref|XP_006393307.1|  hypothetical protein EUTSA_v10011633mg             150   3e-37    
ref|XP_006393308.1|  hypothetical protein EUTSA_v10011633mg             150   4e-37    
gb|AGM20692.1|  COL6-2                                                  152   6e-37    
ref|XP_009144991.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 8     149   7e-37    
ref|XP_010500456.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    149   1e-36    
ref|XP_011007901.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    150   4e-36    
ref|XP_010500455.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    146   1e-35    
emb|CDY07383.1|  BnaA07g24620D                                          141   5e-35    
gb|KDP29405.1|  hypothetical protein JCGZ_18326                         145   1e-34    
ref|XP_010546462.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    141   1e-34    
ref|XP_010543105.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    141   3e-34    
ref|XP_003637430.1|  Zinc finger protein CONSTANS-like protein          137   5e-34    
ref|XP_006656860.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    139   3e-33    
ref|XP_004299078.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    139   1e-32    
ref|XP_009409258.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    137   2e-32    
ref|XP_010551268.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    139   2e-32    
gb|ADK63396.1|  B-box type zinc finger protein                          135   2e-32    
ref|XP_004140861.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    136   4e-32    
gb|AAF69700.1|AC016041_5  F27J15.10                                     133   2e-31    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031160.1|  zinc finger protein CONSTANS-LIKE 8                131   1e-30    Arabidopsis thaliana [mouse-ear cress]
gb|EAZ36554.1|  hypothetical protein OsJ_20892                          134   2e-30    Oryza sativa Japonica Group [Japonica rice]
emb|CDY04230.1|  BnaC06g25850D                                          129   2e-30    
ref|XP_006415872.1|  hypothetical protein EUTSA_v10007685mg             132   3e-30    
ref|NP_175339.2|  zinc finger protein CONSTANS-LIKE 8                   130   5e-30    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002888669.1|  zinc finger (B-box type) family protein            130   1e-29    
gb|EEE59794.1|  hypothetical protein OsJ_12314                          125   1e-29    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ00428.1|  hypothetical protein OsI_22452                          130   3e-29    Oryza sativa Indica Group [Indian rice]
ref|XP_002890690.1|  hypothetical protein ARALYDRAFT_472829             129   4e-29    
gb|EMS53816.1|  Zinc finger protein CONSTANS-LIKE 16                    126   4e-29    
gb|EMT27110.1|  hypothetical protein F775_43077                         126   1e-28    
ref|XP_003559520.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     127   1e-28    
dbj|BAH19571.1|  AT1G68520                                              125   2e-28    Arabidopsis thaliana [mouse-ear cress]
emb|CDX77359.1|  BnaC08g04040D                                          121   2e-28    
gb|ABF98510.1|  CCT motif family protein, expressed                     125   3e-28    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010415472.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    126   5e-28    
gb|EEC73943.1|  hypothetical protein OsI_08813                          124   9e-28    Oryza sativa Indica Group [Indian rice]
ref|NP_001048022.1|  Os02g0731700                                       123   1e-27    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010511849.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    124   1e-27    
gb|AFK49208.1|  unknown                                                 120   2e-27    
ref|XP_010511850.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    124   2e-27    
ref|NP_001057333.2|  Os06g0264200                                       125   2e-27    Oryza sativa Japonica Group [Japonica rice]
dbj|BAD15937.1|  zinc finger protein-like                               124   2e-27    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006649016.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    122   3e-27    
ref|XP_004138344.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    121   3e-27    
ref|XP_004965182.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    124   3e-27    
ref|NP_001149457.1|  zinc finger protein CONSTANS-LIKE 16               122   1e-26    Zea mays [maize]
gb|AFW87599.1|  zinc finger protein CONSTANS-LIKE 16                    122   1e-26    
ref|XP_004953821.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    121   2e-26    
ref|XP_002436824.1|  hypothetical protein SORBIDRAFT_10g009480          122   2e-26    Sorghum bicolor [broomcorn]
ref|XP_004953820.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    120   6e-26    
ref|XP_004953822.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    120   8e-26    
gb|AFX97569.1|  K                                                       114   2e-25    
gb|AFX97570.1|  K                                                       112   6e-25    
ref|XP_003573014.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    115   2e-24    
ref|XP_004155029.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    110   3e-24    
gb|ACF84125.1|  unknown                                                 110   7e-24    Zea mays [maize]
gb|ACL53155.1|  unknown                                                 108   7e-24    Zea mays [maize]
ref|XP_002452605.1|  hypothetical protein SORBIDRAFT_04g028920          114   8e-24    Sorghum bicolor [broomcorn]
ref|XP_008646195.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    113   3e-23    
gb|EMT01944.1|  hypothetical protein F775_21198                         110   7e-23    
ref|XP_002961709.1|  hypothetical protein SELMODRAFT_438000             108   6e-22    
ref|XP_002964778.1|  hypothetical protein SELMODRAFT_266834             108   7e-22    
ref|XP_001771896.1|  predicted protein                                  108   1e-21    
ref|XP_001769011.1|  predicted protein                                  107   2e-21    
ref|XP_008665284.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    105   9e-21    
ref|XP_008354841.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  99.4    9e-20    
ref|XP_007206389.1|  hypothetical protein PRUPE_ppa018053mg           99.0    1e-19    
emb|CBI15893.3|  unnamed protein product                              95.5    1e-19    
ref|XP_009354295.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  98.6    2e-19    
ref|XP_008233500.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   98.6    2e-19    
ref|XP_010685899.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   98.2    2e-19    
gb|AGI62031.1|  CONSTANS-like 7                                       99.4    2e-19    
gb|EPS70096.1|  hypothetical protein M569_04666                       94.0    2e-19    
ref|XP_004294775.1|  PREDICTED: uncharacterized protein LOC101310098  97.4    4e-19    
ref|XP_006488582.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  97.4    4e-19    
gb|KDP45740.1|  hypothetical protein JCGZ_17347                       96.7    6e-19    
ref|XP_006425148.1|  hypothetical protein CICLE_v10029146mg           97.1    6e-19    
ref|XP_008384739.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  96.3    8e-19    
ref|XP_009369559.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  96.3    9e-19    
ref|XP_011003377.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   95.5    1e-18    
dbj|BAJ89584.1|  predicted protein                                    98.6    1e-18    
ref|XP_002274679.2|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   95.1    2e-18    Vitis vinifera
ref|XP_007016977.1|  CCT motif family protein isoform 2               95.1    2e-18    
ref|XP_008797174.1|  PREDICTED: uncharacterized protein LOC103712429  94.7    2e-18    
ref|XP_008354834.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  94.7    3e-18    
dbj|BAE98863.1|  hypothetical protein                                 94.7    4e-18    Arabidopsis thaliana [mouse-ear cress]
gb|KHN40106.1|  Protein CHLOROPLAST IMPORT APPARATUS 2                94.0    4e-18    
gb|EPS70097.1|  hypothetical protein M569_04667                       89.7    5e-18    
ref|XP_006574444.1|  PREDICTED: uncharacterized protein LOC100803...  93.6    5e-18    
ref|XP_009354286.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  94.0    6e-18    
ref|XP_003544900.2|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  94.0    6e-18    
ref|XP_002298500.1|  CONSTANS-like family protein                     93.2    7e-18    Populus trichocarpa [western balsam poplar]
ref|XP_001769217.1|  predicted protein                                97.4    8e-18    
ref|XP_008799931.1|  PREDICTED: uncharacterized protein LOC103714457  94.0    8e-18    
ref|XP_010938521.1|  PREDICTED: uncharacterized protein LOC105057575  92.8    1e-17    
ref|XP_003615824.1|  Zinc finger protein CONSTANS-like protein        92.4    1e-17    
ref|XP_010927568.1|  PREDICTED: uncharacterized protein LOC105049568  92.8    1e-17    
ref|XP_001765504.1|  predicted protein                                95.9    1e-17    
ref|XP_009125969.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  90.5    2e-17    
ref|XP_008799492.1|  PREDICTED: LOW QUALITY PROTEIN: protein CHLO...  94.7    2e-17    
ref|XP_007142158.1|  hypothetical protein PHAVU_008G257300g           91.7    2e-17    
ref|XP_004490653.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  91.3    3e-17    
ref|XP_006453246.1|  hypothetical protein CICLE_v10008308mg           94.4    3e-17    
emb|CDX70561.1|  BnaC03g06450D                                        89.7    3e-17    
ref|XP_009383142.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  92.8    3e-17    
ref|XP_011010948.1|  PREDICTED: uncharacterized protein LOC105115687  92.8    3e-17    
gb|KHN16247.1|  Zinc finger protein CONSTANS-LIKE 16                  88.2    4e-17    
gb|KFK36040.1|  hypothetical protein AALP_AA4G070200                  92.4    4e-17    
ref|XP_010111554.1|  Protein CHLOROPLAST IMPORT APPARATUS 2           93.6    5e-17    
gb|EEE59793.1|  hypothetical protein OsJ_12313                        89.4    6e-17    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010273555.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  93.2    6e-17    
emb|CDY09849.1|  BnaC09g43120D                                        92.0    6e-17    
ref|XP_010927244.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  93.2    6e-17    
gb|KFK25676.1|  hypothetical protein AALP_AA8G144900                  92.0    6e-17    
ref|XP_010046933.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  92.8    7e-17    
ref|XP_006286526.1|  hypothetical protein CARUB_v10001375mg           92.0    7e-17    
ref|XP_010539413.1|  PREDICTED: LOW QUALITY PROTEIN: protein CHLO...  93.2    7e-17    
ref|XP_002268929.1|  PREDICTED: uncharacterized protein LOC100254358  91.7    8e-17    Vitis vinifera
emb|CBI17712.3|  unnamed protein product                              91.7    8e-17    
ref|XP_010557193.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 8   90.1    8e-17    
ref|XP_010264549.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   90.5    8e-17    
ref|XP_009420122.1|  PREDICTED: uncharacterized protein LOC103999941  91.3    8e-17    
ref|XP_002268213.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  92.0    1e-16    
emb|CAN72725.1|  hypothetical protein VITISV_015092                   92.0    1e-16    
ref|XP_006417850.1|  hypothetical protein EUTSA_v10008808mg           89.4    1e-16    
emb|CDX91067.1|  BnaC02g05300D                                        91.3    1e-16    
emb|CDX78575.1|  BnaA03g04870D                                        90.9    1e-16    
ref|XP_010690879.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  92.4    1e-16    
emb|CDX69586.1|  BnaA10g19350D                                        90.9    1e-16    
ref|XP_009121672.1|  PREDICTED: uncharacterized protein LOC103846490  90.9    1e-16    
emb|CAN75558.1|  hypothetical protein VITISV_028190                   90.9    1e-16    
ref|XP_010932278.1|  PREDICTED: uncharacterized protein LOC105052987  90.1    2e-16    
emb|CBI40095.3|  unnamed protein product                              91.7    2e-16    
ref|XP_011017668.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  92.4    2e-16    
gb|EMS59726.1|  Zinc finger protein CONSTANS-LIKE 6                   88.2    2e-16    
gb|EMS51379.1|  Zinc finger protein CONSTANS-LIKE 6                   89.7    2e-16    
ref|XP_008230480.1|  PREDICTED: uncharacterized protein LOC103329755  90.5    2e-16    
gb|KDP46366.1|  hypothetical protein JCGZ_10206                       90.5    2e-16    
ref|XP_007014423.1|  Chloroplast import apparatus 2, putative iso...  91.3    3e-16    
ref|XP_006399947.1|  hypothetical protein EUTSA_v10014044mg           90.1    3e-16    
gb|KDP41094.1|  hypothetical protein JCGZ_03224                       91.3    3e-16    
ref|XP_010479338.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  90.1    3e-16    
gb|AAM63153.1|  unknown                                               89.4    4e-16    
emb|CDP09243.1|  unnamed protein product                              86.3    4e-16    
ref|XP_002324691.2|  hypothetical protein POPTR_0018s13890g           91.3    4e-16    
ref|XP_009340847.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  90.1    4e-16    
ref|XP_001759088.1|  predicted protein                                91.7    4e-16    
emb|CDX85600.1|  BnaA02g02130D                                        89.4    4e-16    
ref|NP_568300.1|  CCT motif family protein                            89.4    5e-16    
ref|XP_009131400.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  89.0    5e-16    
ref|XP_006305351.1|  hypothetical protein CARUB_v10009731mg           89.0    6e-16    
ref|XP_010457868.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  87.0    6e-16    
ref|XP_010487064.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  87.0    6e-16    
ref|XP_010929359.1|  PREDICTED: LOW QUALITY PROTEIN: protein CHLO...  90.1    6e-16    
ref|XP_010248760.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   89.4    7e-16    
ref|XP_010492239.1|  PREDICTED: uncharacterized protein LOC104769672  89.0    8e-16    
gb|KGN61175.1|  hypothetical protein Csa_2G061540                     89.7    9e-16    
ref|XP_006362450.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  89.7    1e-15    
ref|XP_008451201.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  89.7    1e-15    
ref|XP_011024893.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  87.0    1e-15    
ref|XP_010420071.1|  PREDICTED: uncharacterized protein LOC104705709  88.2    1e-15    
ref|XP_010453557.1|  PREDICTED: uncharacterized protein LOC104735456  88.2    1e-15    
ref|XP_004507897.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  88.6    1e-15    
ref|XP_004242804.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  89.0    2e-15    
ref|XP_010479339.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  87.4    2e-15    
ref|XP_010479340.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  87.0    2e-15    
ref|XP_007216840.1|  hypothetical protein PRUPE_ppa022528mg           87.4    2e-15    
ref|XP_003543009.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  88.6    2e-15    
ref|XP_008379178.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   87.8    2e-15    
ref|XP_006447220.1|  hypothetical protein CICLE_v10015864mg           87.4    2e-15    
gb|KFK43009.1|  hypothetical protein AALP_AA1G067400                  85.5    2e-15    
ref|XP_009590839.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  87.0    2e-15    
ref|XP_010927243.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  88.2    3e-15    
ref|XP_009801175.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  88.2    3e-15    
ref|XP_011097346.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  86.7    3e-15    
gb|EYU18216.1|  hypothetical protein MIMGU_mgv1a007342mg              87.8    3e-15    
ref|XP_009593986.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  88.2    3e-15    
ref|XP_002873661.1|  hypothetical protein ARALYDRAFT_488277           86.7    3e-15    
ref|XP_002308112.2|  hypothetical protein POPTR_0006s07490g           88.6    3e-15    
ref|XP_009349161.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.9    4e-15    
ref|XP_007016976.1|  CCT motif family protein isoform 1               85.9    4e-15    
emb|CDY52734.1|  BnaC09g53340D                                        87.4    4e-15    
ref|XP_010433566.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  87.4    4e-15    
ref|XP_007031686.1|  CCT motif family protein, putative               87.0    4e-15    
ref|XP_009410222.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  87.8    4e-15    
ref|XP_006425147.1|  hypothetical protein CICLE_v10029146mg           85.5    4e-15    
ref|XP_002993117.1|  hypothetical protein SELMODRAFT_136568           81.6    4e-15    
ref|XP_004296491.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  87.8    4e-15    
gb|EMT29986.1|  hypothetical protein F775_13638                       85.9    4e-15    
gb|KHN46121.1|  Protein CHLOROPLAST IMPORT APPARATUS 2                85.1    4e-15    
emb|CDY66177.1|  BnaC08g46470D                                        84.3    5e-15    
ref|XP_009370323.1|  PREDICTED: uncharacterized protein LOC103959692  86.7    5e-15    
dbj|BAK01784.1|  predicted protein                                    85.9    5e-15    
ref|XP_009371730.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 8   86.7    5e-15    
ref|XP_001752335.1|  predicted protein                                80.9    5e-15    
ref|XP_007154713.1|  hypothetical protein PHAVU_003G141200g           86.7    6e-15    
ref|XP_007225066.1|  hypothetical protein PRUPE_ppa018578mg           87.4    6e-15    
gb|KDO45660.1|  hypothetical protein CISIN_1g017778mg                 85.9    7e-15    
ref|XP_004231827.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16  85.5    8e-15    
ref|XP_011020038.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  87.0    8e-15    
ref|XP_010099464.1|  Protein CHLOROPLAST IMPORT APPARATUS 2           84.3    9e-15    
gb|KDO67019.1|  hypothetical protein CISIN_1g025320mg                 84.7    9e-15    
ref|NP_568852.2|  chloroplast import apparatus 2 protein              86.7    9e-15    
ref|XP_001758440.1|  predicted protein                                87.0    9e-15    
ref|XP_006401232.1|  hypothetical protein EUTSA_v10013517mg           86.7    1e-14    
ref|XP_009110963.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  83.6    1e-14    
ref|XP_008223874.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  86.7    1e-14    
emb|CDY38274.1|  BnaA10g11220D                                        85.9    1e-14    
ref|XP_009120241.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  86.3    1e-14    
ref|XP_010448341.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.9    1e-14    
gb|KFK27272.1|  hypothetical protein AALP_AA8G360600                  86.3    1e-14    
ref|XP_002520096.1|  hypothetical protein RCOM_1709850                79.7    1e-14    
gb|EMT06010.1|  hypothetical protein F775_08552                       85.5    1e-14    
ref|NP_563778.1|  CCT motif family protein                            83.2    1e-14    
ref|XP_002892377.1|  predicted protein                                82.8    2e-14    
ref|XP_001751672.1|  predicted protein                                86.3    2e-14    
ref|XP_011094103.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.5    2e-14    
ref|XP_006280489.1|  hypothetical protein CARUB_v10026429mg           85.9    2e-14    
ref|XP_010690870.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.5    2e-14    
ref|XP_009403041.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.5    2e-14    
ref|XP_006338638.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  84.3    2e-14    
ref|XP_002451540.1|  hypothetical protein SORBIDRAFT_04g003470        85.9    2e-14    
ref|XP_010451861.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.9    2e-14    
ref|NP_567737.1|  CIA2-like transcription factor                      85.1    2e-14    
ref|XP_008388630.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.5    3e-14    
ref|XP_010483220.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.5    3e-14    
ref|XP_002867585.1|  hypothetical protein ARALYDRAFT_354188           84.7    3e-14    
dbj|BAC42037.1|  putative B-box zinc finger protein                   83.6    3e-14    
ref|XP_006646882.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.5    3e-14    
dbj|BAJ92256.1|  predicted protein                                    85.1    3e-14    
ref|XP_009359939.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.1    3e-14    
ref|XP_008811451.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.1    3e-14    
dbj|BAJ85986.1|  predicted protein                                    82.8    4e-14    
emb|CDP15779.1|  unnamed protein product                              84.7    4e-14    
ref|XP_010438814.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  84.0    5e-14    
ref|XP_010443395.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  84.7    5e-14    
ref|XP_006596439.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  82.0    6e-14    
emb|CDY10244.1|  BnaC05g04870D                                        80.9    8e-14    
gb|ABF00989.1|  putative stress resistance-related protein            84.0    9e-14    
ref|XP_001769056.1|  predicted protein                                77.4    9e-14    
ref|XP_002864503.1|  hypothetical protein ARALYDRAFT_495815           83.6    1e-13    
ref|XP_003549301.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  83.2    1e-13    
ref|XP_006453248.1|  hypothetical protein CICLE_v10008308mg           83.2    1e-13    
ref|XP_004499509.1|  PREDICTED: uncharacterized protein LOC101500...  82.0    1e-13    
ref|XP_006453244.1|  hypothetical protein CICLE_v10008308mg           83.2    1e-13    
ref|XP_008677196.1|  PREDICTED: LOC100281423 isoform X1               83.6    1e-13    
ref|XP_006283882.1|  hypothetical protein CARUB_v10004999mg           83.2    1e-13    
gb|KDO61918.1|  hypothetical protein CISIN_1g0135002mg                83.2    1e-13    
gb|KDO61917.1|  hypothetical protein CISIN_1g0135002mg                83.2    1e-13    
ref|NP_001147813.1|  LOC100281423                                     83.6    1e-13    
gb|KHG21982.1|  Zinc finger CONSTANS-LIKE 7 -like protein             82.0    1e-13    
ref|XP_002964550.1|  hypothetical protein SELMODRAFT_38981            77.0    1e-13    
ref|XP_010524282.1|  PREDICTED: uncharacterized protein LOC104802388  82.4    1e-13    
ref|XP_004304686.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  82.4    1e-13    
emb|CDY47926.1|  BnaA02g08300D                                        82.4    2e-13    
emb|CDY42238.1|  BnaC02g11770D                                        82.4    2e-13    
ref|XP_002962768.1|  hypothetical protein SELMODRAFT_141010           81.3    2e-13    
ref|XP_009410221.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  82.8    2e-13    
ref|NP_001169082.1|  uncharacterized protein LOC100382924             83.2    2e-13    
ref|XP_001754240.1|  predicted protein                                76.6    2e-13    
ref|XP_006850881.1|  hypothetical protein AMTR_s00025p00156240        82.8    2e-13    
ref|XP_007140857.1|  hypothetical protein PHAVU_008G147400g           81.3    2e-13    
gb|EYU34766.1|  hypothetical protein MIMGU_mgv1a008504mg              82.0    2e-13    
ref|XP_010487055.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  79.3    2e-13    
ref|XP_010236261.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  82.4    3e-13    
ref|XP_007142159.1|  hypothetical protein PHAVU_008G257300g           79.7    3e-13    
ref|XP_004305701.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  82.4    3e-13    
ref|XP_008645243.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  82.0    3e-13    
emb|CDY06672.1|  BnaA10g04510D                                        79.0    4e-13    
ref|XP_009119001.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  79.0    4e-13    
ref|XP_008458850.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   80.1    5e-13    
ref|XP_004142772.1|  PREDICTED: uncharacterized protein LOC101217596  80.1    5e-13    
ref|XP_004156700.1|  PREDICTED: uncharacterized LOC101217596          80.1    5e-13    
ref|XP_009126853.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  80.9    6e-13    
ref|XP_004490652.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  79.0    8e-13    
ref|XP_007014424.1|  Chloroplast import apparatus 2, putative iso...  80.5    9e-13    
emb|CDX94392.1|  BnaC01g17920D                                        79.7    1e-12    
ref|XP_010323337.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  80.1    1e-12    
ref|XP_008811450.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  80.1    1e-12    
emb|CDX89377.1|  BnaA01g15160D                                        79.3    2e-12    
emb|CAB87776.1|  putative protein                                     78.6    2e-12    
ref|XP_006413244.1|  hypothetical protein EUTSA_v10025322mg           79.3    2e-12    
ref|XP_008363941.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  79.7    2e-12    
gb|EYU38741.1|  hypothetical protein MIMGU_mgv1a008071mg              79.0    2e-12    
ref|XP_002526951.1|  hypothetical protein RCOM_0531220                77.4    2e-12    
ref|XP_006362451.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  79.3    2e-12    
ref|XP_003622266.1|  CONSTANS-like zinc finger protein                78.2    3e-12    
ref|XP_010029065.1|  PREDICTED: uncharacterized protein LOC104419187  78.2    3e-12    
ref|XP_008451210.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  78.6    4e-12    
ref|XP_006305953.1|  hypothetical protein CARUB_v10011200mg           75.9    4e-12    
ref|XP_004149511.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  78.6    4e-12    
ref|XP_003553886.1|  PREDICTED: uncharacterized protein LOC100811815  77.4    6e-12    
ref|XP_007154712.1|  hypothetical protein PHAVU_003G141200g           77.4    6e-12    
ref|XP_011098790.1|  PREDICTED: uncharacterized protein LOC105177...  76.3    7e-12    
ref|XP_002518229.1|  CIL, putative                                    77.4    9e-12    
emb|CDP16632.1|  unnamed protein product                              77.0    1e-11    
ref|XP_009139739.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  76.6    1e-11    
ref|XP_011020039.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  76.3    2e-11    
ref|NP_851201.1|  chloroplast import apparatus 2 protein              75.5    3e-11    
ref|XP_003547688.2|  PREDICTED: DNA topoisomerase 1-like isoform X1   74.7    4e-11    
ref|XP_006599067.1|  PREDICTED: DNA topoisomerase 1-like isoform X2   74.7    4e-11    
ref|XP_009120242.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  75.1    5e-11    
ref|XP_006401233.1|  hypothetical protein EUTSA_v10013517mg           75.1    5e-11    
ref|NP_849445.1|  CIA2-like transcription factor                      74.7    7e-11    
ref|XP_011097348.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  73.2    8e-11    
emb|CAB39664.1|  putative protein                                     73.9    8e-11    
ref|XP_004145240.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  71.2    9e-11    
ref|XP_001776067.1|  predicted protein                                68.6    1e-10    
emb|CDY07382.1|  BnaA07g24610D                                        68.2    1e-10    
emb|CDY04231.1|  BnaC06g25840D                                        67.8    2e-10    
ref|XP_009137564.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  73.2    2e-10    
gb|KHG01643.1|  chloroplast import apparatus 2 -like protein          72.4    4e-10    
ref|XP_004499508.1|  PREDICTED: uncharacterized protein LOC101500...  71.2    4e-10    
gb|KDO45661.1|  hypothetical protein CISIN_1g017778mg                 71.6    4e-10    
emb|CDY42769.1|  BnaA03g47700D                                        70.1    4e-10    
gb|EEC84137.1|  hypothetical protein OsI_30489                        67.8    7e-10    
emb|CDX92740.1|  BnaC07g39980D                                        71.2    8e-10    
dbj|BAD36814.1|  zinc finger protein-like                             67.4    9e-10    
ref|XP_010111661.1|  Protein CHLOROPLAST IMPORT APPARATUS 2           70.5    1e-09    
ref|XP_008804437.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  70.5    1e-09    
ref|XP_006379128.1|  hypothetical protein POPTR_0009s08080g           67.4    1e-09    
gb|ABG57263.1|  CONSTANS-like 1                                       69.3    2e-09    
gb|EMT12233.1|  hypothetical protein F775_25319                       67.0    2e-09    
gb|AFV78277.1|  constans-like 1                                       70.1    2e-09    
gb|AFV79556.1|  constans-like 1                                       69.3    3e-09    
gb|AAD22518.1|AF001136_1  zinc finger protein                         69.3    4e-09    
emb|CAK26123.1|  constans-like 1                                      69.3    4e-09    
emb|CAK26151.1|  constans-like 1                                      69.3    4e-09    
ref|XP_004296743.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  65.1    4e-09    
emb|CAK26149.1|  constans-like 1                                      69.3    4e-09    
emb|CAK26110.1|  constans-like 1                                      68.9    4e-09    
emb|CAK26112.1|  constans-like 1                                      68.9    4e-09    
emb|CAK26107.1|  constans-like 1                                      68.9    4e-09    
emb|CAK26108.1|  constans-like 1                                      68.9    4e-09    
emb|CAK26129.1|  constans-like 1                                      68.9    4e-09    
emb|CAK26141.1|  constans-like 1                                      68.9    4e-09    
emb|CAK26119.1|  constans-like 1                                      68.9    4e-09    
emb|CAK26106.1|  constans-like 1                                      68.9    4e-09    
emb|CAK26147.1|  constans-like 1                                      68.9    4e-09    
emb|CAK26109.1|  constans-like 1                                      68.9    4e-09    
gb|AAX47173.1|  CONSTANS-LIKE b                                       68.2    4e-09    



>ref|XP_009603861.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
tomentosiformis]
Length=420

 Score =   336 bits (862),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 217/442 (49%), Positives = 263/442 (60%), Gaps = 75/442 (17%)
 Frame = +1

Query  217   MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  396
             MM+S+  KTANAI GKTARACDSCLSKRARWFC ADDAFLCQSCDVSVHSAN LASRH+R
Sbjct  1     MMTSES-KTANAIGGKTARACDSCLSKRARWFCPADDAFLCQSCDVSVHSANQLASRHER  59

Query  397   VRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAV  576
             VRL        +++  +  K VD     S P+WH+GFTRK RTPRN K    Q       
Sbjct  60    VRL------ETSSNKSTDTKFVDQTV--SQPSWHQGFTRKARTPRNGKNKSTQIGQRKKD  111

Query  577   EESVNPVLPFVPEMGSDDDYNNNNEID------------------LFCQVP---Vllddd  693
             EE++      VPEMGS+++  + NE +                  L C VP   V     
Sbjct  112   EENM------VPEMGSEENSPDENEFENEEQLLYRVPVFDPFEAELCCTVPNEVVDETTT  165

Query  694   lnallndgggddHMRGLEIPEFLSSDVELAEFAADVETLLGDD--DVGEDKATA------  849
             +N L      +D    L IPEFLSS++ELAEFAADVE+LLG++   V E++  +      
Sbjct  166   INDLDILLNSEDVCDDLGIPEFLSSEIELAEFAADVESLLGEEFRVVAEEEEQSRLINGS  225

Query  850   -----AVKIEINGGD---------------CTEALNWSFGEEQEVEQKVMMTMLSGFDes  969
                  A+KIE+   +                 EALNW F  E+ VEQKV MT  + F   
Sbjct  226   VEDNKAIKIEVEDEEMRAVVACHLDPELDMAREALNWDFEYEETVEQKVNMTAATEF---  282

Query  970   sssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG--  1143
                  +     +   K R+LL LNYE VISAW +Q  PWT+G RPHF+P+ CWPDF+   
Sbjct  283   --VPSAECGGSKADAKRRLLLRLNYEAVISAWPNQSSPWTNGIRPHFNPDDCWPDFLETC  340

Query  1144  -GDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKG  1320
              G+   H PYG   +      GRE RVSRYREKRRTRLFSKKIRY+VRKLNAEKRPRLKG
Sbjct  341   IGEGGVHQPYGGGKVRGGD-GGREERVSRYREKRRTRLFSKKIRYQVRKLNAEKRPRLKG  399

Query  1321  RFVKRSSLFQPPPPFPNYLLNR  1386
             RFVKR++ F  PP FP YL+N+
Sbjct  400   RFVKRTTSFS-PPGFP-YLMNK  419



>ref|XP_009798338.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Nicotiana 
sylvestris]
Length=417

 Score =   333 bits (855),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 220/445 (49%), Positives = 262/445 (59%), Gaps = 84/445 (19%)
 Frame = +1

Query  217   MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  396
             MM+S +RKTANAI GKTARACDSCLSKRARWFC ADDAFLCQSCDVSVHSAN LASRH+R
Sbjct  1     MMTS-ERKTANAIGGKTARACDSCLSKRARWFCPADDAFLCQSCDVSVHSANQLASRHER  59

Query  397   VRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAV  576
             VRL        +++  +  K VD     S P+WH+GFTRK RTPRN K    Q       
Sbjct  60    VRL------ETSSNKSTDTKFVDQTA--SQPSWHQGFTRKARTPRNGKNKSTQIGQRKKD  111

Query  577   EESVNPVLPFVPEMGSDDDY-NNNNEIDLFCQVPV----------------lldddlnal  705
             EE++      VPEMGS+++  ++ NE  L  +VPV                     +N L
Sbjct  112   EENM------VPEMGSEENSPDDENEEQLLYRVPVFDPFEAELCTVPNEVVDETTTINDL  165

Query  706   lndgggddHMRGLEIPEFLSSDVELAEFAADVETLLGDD-----------------DVGE  834
                   +D    L IP+FLSS++ELAEFAADVE+LLG++                  V E
Sbjct  166   DILLNSEDACDDLGIPKFLSSEIELAEFAADVESLLGEEFRVVAEEEDEEQSRLISGVVE  225

Query  835   DKATAAVKIEINGGD---------------CTEALNWSFGEEQEVEQKVMMTMLSGFDes  969
             D    A+KIE+   +                 EALNW F  E+ VEQKV M   + F   
Sbjct  226   D--NKAIKIEVEDEEMRAVVACHLDPELDMAREALNWDFEYEETVEQKVNMAAATEF---  280

Query  970   sssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFM---  1140
                  +     +   K RMLL LNYEEVISAW +Q  PWT+G RPHF+P+ CWPDF+   
Sbjct  281   --VPSAECGGSKADAKRRMLLRLNYEEVISAWPNQSSPWTNGIRPHFNPDDCWPDFLETC  338

Query  1141  ---GGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR  1311
                GG    H PYG   +      GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR
Sbjct  339   IGEGG----HQPYGGGNVRGGD-GGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR  393

Query  1312  LKGRFVKRSSLFQPPPPFPNYLLNR  1386
             LKGRFVKR++ F   P FP YL+N+
Sbjct  394   LKGRFVKRTTSFS-APGFP-YLMNK  416



>ref|XP_004235805.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Solanum 
lycopersicum]
Length=408

 Score =   321 bits (823),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 207/441 (47%), Positives = 262/441 (59%), Gaps = 85/441 (19%)
 Frame = +1

Query  217   MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  396
             MM+S+  KTANAI GKTARACDSCLSKRARWFC ADDAFLCQSCDVS+HSAN LASRH+R
Sbjct  1     MMTSES-KTANAIGGKTARACDSCLSKRARWFCPADDAFLCQSCDVSIHSANQLASRHER  59

Query  397   VRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTK----KQNSG  564
             VRL          +  +   I    D    P+WH+GFTRK RTPRN K+ +    K+N  
Sbjct  60    VRL---------ETCSNKSTITKLVDKTHQPSWHQGFTRKARTPRNGKKAQIRQWKKN--  108

Query  565   GVAVEESVNPVLPFVPEMGSDDDYNNNNEID----LFCQVPV------------lldddl  696
                 EE+       VPE+GS+++  + NE +    L  +VP+                 +
Sbjct  109   ----EENR------VPEIGSEENSLDENEFENEEQLLYRVPIFDPFEAELCNVPDETGSI  158

Query  697   nallndgggddHMRGLEIPEFLSSDVELAEFAADVETLLGDDDVGEDKATA---------  849
               L      +D    L +PEFLSSD+ELAEFAADVETLLG +   E+++T          
Sbjct  159   VDLDILLNTEDACHDLNLPEFLSSDIELAEFAADVETLLGGE---EEQSTQLLNADFENN  215

Query  850   -AVKIEINGGDC---------------TEALNWSFGE--EQEVEQKVMMTMLSGFDesss  975
              A+KIE+   +                 EALNW+F E  E+ VEQKVM    +  +  +S
Sbjct  216   KAIKIEVEDEEMRAVVACHLDPELDMEREALNWNFDEYYEETVEQKVMAADAAVTEFIAS  275

Query  976   smesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG----  1143
             + E      +  +K+R+ LSLN+E VISAW +Q  PWT+G RPHF+P+  WPDF      
Sbjct  276   AEEYSGSSTKSDEKNRLFLSLNHEAVISAWPNQSSPWTNGIRPHFNPDDYWPDFFSETSV  335

Query  1144  GDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGR  1323
             G++  H        +R  D GREARVSRYREKR+ RLFSKKIRYEVRKLNAEKRPRLKGR
Sbjct  336   GNYGGH--------VRCGDGGREARVSRYREKRQNRLFSKKIRYEVRKLNAEKRPRLKGR  387

Query  1324  FVKRSSLFQPPPPFPNYLLNR  1386
             F+KRSS     P F +Y++N+
Sbjct  388   FIKRSSSLFSVPGF-SYMMNK  407



>ref|XP_006341612.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Solanum 
tuberosum]
Length=402

 Score =   317 bits (812),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 215/437 (49%), Positives = 259/437 (59%), Gaps = 83/437 (19%)
 Frame = +1

Query  217   MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  396
             MM+S   KTANAI GKTARACDSCLSKRARWFC ADDAFLCQSCDVS+HSAN LASRH+R
Sbjct  1     MMTSGS-KTANAIGGKTARACDSCLSKRARWFCPADDAFLCQSCDVSIHSANQLASRHER  59

Query  397   VRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAK----RTKKQNSG  564
             VRL T S+ +          I    D    PAWH+GFTRK RTPRN K    R +K+N  
Sbjct  60    VRLDTCSNKST---------ITKLVDKTHQPAWHQGFTRKARTPRNGKKAQIRQRKKN--  108

Query  565   GVAVEESVNPVLPFVPEMGSDDDYNNNNEIDLF------------CQVPVlldddlnall  708
                 EE+       VPE+GSD++   N E  L+            C VP      +  L 
Sbjct  109   ----EENR------VPEIGSDENEFENEEQLLYRVPIFDPFEAELCNVP-DETGSIADLD  157

Query  709   ndgggddHMRGLEIPEFLSSDVELAEFAADVETLLGDDDVGEDKAT----------AAVK  858
                  +D    L +PEFLSSD+ELAEFAADVETLLG +   E+++T           A+K
Sbjct  158   ILLNTEDACDDLNLPEFLSSDIELAEFAADVETLLGGE---EEQSTRLLNADFEDNKAIK  214

Query  859   IEINGGDC---------------TEALNWSFGE--EQEVEQKVMMTMLSGFDessssmes  987
             IE+   +                 E LNW+F E  E+ VEQKVM  +        +S E 
Sbjct  215   IEVEDEEMRAVVACHLDPELDMEREGLNWNFDEYYEERVEQKVMAAVTE----FVASAEY  270

Query  988   gsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDF---MGGDHHH  1158
                  +  +K+R+ L LN+E VISAW +Q  PWT+G RPHF+P+  WPDF    GG+  +
Sbjct  271   SGSSTKSDEKNRLFLRLNHEAVISAWPNQSSPWTNGIRPHFNPDDYWPDFSETCGGNLGY  330

Query  1159  HHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR-  1335
                YG    +R  D GREARV RYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF+KR 
Sbjct  331   ---YGG--HVRSGDGGREARVLRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFIKRN  385

Query  1336  SSLFQPPPPFPNYLLNR  1386
             SS     P FP Y++N+
Sbjct  386   SSSSFSVPGFP-YMMNK  401



>emb|CDO98435.1| unnamed protein product [Coffea canephora]
Length=431

 Score =   307 bits (786),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 196/444 (44%), Positives = 235/444 (53%), Gaps = 90/444 (20%)
 Frame = +1

Query  238   KTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtss  417
             KTAN + GKTARACDSCL KRARWFC ADDAFLCQ+CD SVHSAN LASRH+R+RL TSS
Sbjct  6     KTANVLGGKTARACDSCLKKRARWFCAADDAFLCQACDTSVHSANQLASRHERIRLATSS  65

Query  418   sstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPV  597
                          I    D++S P WH+GFTRK RTPRN K +              NP 
Sbjct  66    FM----------PIETKGDENSLPTWHQGFTRKARTPRNNKASLVHQPKDEEKMAKANP-  114

Query  598   LPFVPEMGSDDDY-NNNNEIDLFCQVPVlldddlnallndgggddHMRG-----------  741
             LP VPE+  D+   + + E  LFC+VPV                 +++            
Sbjct  115   LPLVPEISGDETSPDESEEQHLFCRVPVFDPFAAELCSELSDEVQNIQADKGTHDEILTS  174

Query  742   ------------LEIPEFLSSDVELAEFAADVETLLG-----------------------  816
                         L+IPE ++SD ELAEFAADVE+LLG                       
Sbjct  175   NELNVLLNDDQDLDIPELIASDAELAEFAADVESLLGTGLDEDSCHMEDPGMMVCKEEDD  234

Query  817   --------------DDDVGEDKATAAVKIEINGGDCTEALNWSFGE-----EQEVEQKVM  939
                           D+D  E +A  A  ++       E+LNW F       E+E E KV 
Sbjct  235   VVDVSFEDKLVKVEDEDDQEVQAVIACHLDPALDMARESLNWDFDSSSPVIEEEEELKVT  294

Query  940   MTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN  1119
               M                K +  ++  M L LNYEEVI+AWASQG PW DGT+P F+  
Sbjct  295   KDM-----------PDKDIKSKEEERRMMHLKLNYEEVITAWASQGSPWADGTKPEFNLG  343

Query  1120  HCWPDFMGGDHHH-HHPYGSAM-MMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLN  1293
              CWPDFMG   +  HHP G+    +   DE REARV+RYREKRRTRLFSKKIRYEVRKLN
Sbjct  344   DCWPDFMGMSLNELHHPNGAGGGRVSSHDEEREARVTRYREKRRTRLFSKKIRYEVRKLN  403

Query  1294  AEKRPRLKGRFVKRSSLFQPPPPF  1365
             AEKRPR+KGRFVKR+S   P  P+
Sbjct  404   AEKRPRMKGRFVKRTSFAGPSFPY  427



>ref|XP_010265147.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nelumbo 
nucifera]
Length=439

 Score =   294 bits (753),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 196/449 (44%), Positives = 240/449 (53%), Gaps = 86/449 (19%)
 Frame = +1

Query  220   MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  399
             MSSD +K ANA+ GKTARACDSCL KRARW+C ADDAFLCQ CD SVHSAN LA RH RV
Sbjct  1     MSSD-KKVANAVGGKTARACDSCLRKRARWYCAADDAFLCQGCDASVHSANPLARRHGRV  59

Query  400   RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  579
             RL        A+   +   +V++      PAWH+GFTRK RTPR+ K T  Q S     E
Sbjct  60    RL------KTASFKPNDDSLVENYV----PAWHQGFTRKARTPRHGKPTALQQSKSTDHE  109

Query  580   ESVNPVLPFVPEMGSDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMR-------  738
             E +   LP VPEMGS++   + NE  L  +VP+               +  M        
Sbjct  110   EPIPNPLPLVPEMGSEEASPDENEEQLLYRVPIFDPFVAELCTPATSNEASMTANDSSTA  169

Query  739   --GLE-----------------IPEFLSSDVELAEFAADVETLLG----DDDVG------  831
               G E                 +P FL SD++L EFAADVETLLG    +D  G      
Sbjct  170   AVGTETKAFLHEGHDVTGDMDNLPGFLPSDMDLVEFAADVETLLGKGLDEDSFGMEGLGL  229

Query  832   -----EDKATAA----------------------VKIEINGGDCTEALNWSFGEEQEVEQ  930
                  E+K                          V++E +    T  LN+ +      E 
Sbjct  230   LDCKDEEKTDCCFGSGRVKVEEEEVEAAVECHVEVELEHDMARETLDLNFDYDSPTTAED  289

Query  931   KVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHF  1110
             +V   M++G   +      G   EE  +K+   L L+YE +ISAWA++G PWT G RP F
Sbjct  290   EVEEKMVTG--ATMMVTNGGCKAEETTRKTS--LKLDYEAIISAWANKGLPWTTGDRPLF  345

Query  1111  DPNHCWPDFMGG----DHHHHHPYGS----AMMMRRSDEGREARVSRYREKRRTRLFSKK  1266
             +P+ CWPD MG     + HH+HPYG        +   D GREARVSRYREKRRTRLFSKK
Sbjct  346   NPDDCWPDCMGTCPMTEVHHYHPYGEMGGVGGHVTAGDGGREARVSRYREKRRTRLFSKK  405

Query  1267  IRYEVRKLNAEKRPRLKGRFVKRSSLFQP  1353
             IRYEVRKLNAEKRPR+KGRFVKR+S   P
Sbjct  406   IRYEVRKLNAEKRPRMKGRFVKRASCTGP  434



>ref|XP_007036519.1| Transcription factor, putative [Theobroma cacao]
 gb|EOY21020.1| Transcription factor, putative [Theobroma cacao]
Length=431

 Score =   289 bits (739),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 199/458 (43%), Positives = 250/458 (55%), Gaps = 101/458 (22%)
 Frame = +1

Query  220   MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  399
             M++D +K ANA+ GKTARACD CL KRARW+C ADDAFLCQ CD SVHSAN LASRH+RV
Sbjct  1     MTTD-KKAANAMGGKTARACDGCLRKRARWYCAADDAFLCQGCDTSVHSANQLASRHERV  59

Query  400   RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRT--KKQNSGGVA  573
             RL        A+    S  + +  + D+PPAWH+GFTRK RTPR  K    ++++ G V 
Sbjct  60    RL------ETASFSKFSASVTNRTNQDAPPAWHQGFTRKARTPRQNKSMLGQQKDEGKVF  113

Query  574   VEESVNPVLPFVPEMGSDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMRGLE--  747
                S+NP+ P VPE+GS+D   + NE  L C+VPVL               D +  +   
Sbjct  114   ---SLNPLDPVVPEIGSEDGSVDENEEQLLCRVPVLNPFAAELCNMVTSDGDEVAMVNED  170

Query  748   -------------------IPEFLSSDVELAEFAADVETLLG---DDDV-----------  828
                                +  FL SD++LA+FAADVE LLG   DDD            
Sbjct  171   GNFVIDDYEREGTCELDDGLHGFLPSDMDLADFAADVENLLGVGLDDDACCDTKGIELLH  230

Query  829   --GEDKATA-----AVKI----EING---------GDCT-EALNWSFGEE-----QEVEQ  930
                ED +        VK+    E+ G          D T E+LNWS+  E     +E E+
Sbjct  231   SKEEDGSNVLHEGKIVKVKDEEEVEGITACCFDSAFDVTRESLNWSYDYESPTIGEEEEE  290

Query  931   KVM----MTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGT  1098
             KV+     T ++G             + +   K  MLL LNYE VI+AWA QG PWT G+
Sbjct  291   KVLPATETTTMNG-------------ESKAEMKRNMLLRLNYESVITAWARQGSPWTAGS  337

Query  1099  RPHFDPNHCWPDFMGGD----HHHHHPYGSAMMMR---RSDEGREARVSRYREKRRTRLF  1257
             RP F+P+    DFMG +    HH     G    ++    +D  REARVSRYREKRRTRLF
Sbjct  338   RPEFNPD----DFMGSNLKEGHHLSGGIGGIYSLQGRGNTDGEREARVSRYREKRRTRLF  393

Query  1258  SKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPN  1371
             SKKIRYEVRKLNAEKRPR+KGRFVKR+S       + N
Sbjct  394   SKKIRYEVRKLNAEKRPRMKGRFVKRTSFVGTAFTYIN  431



>ref|XP_011016373.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Populus 
euphratica]
Length=426

 Score =   288 bits (738),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 195/424 (46%), Positives = 241/424 (57%), Gaps = 61/424 (14%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             RK ANA+ GKTARACDSCL KRARWFCVADDAFLCQ+CD SVHSAN LASRHQRVRL T+
Sbjct  5     RKAANAMGGKTARACDSCLRKRARWFCVADDAFLCQACDASVHSANQLASRHQRVRLETA  64

Query  415   ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKK----QNSGGVAVEE  582
             SS   ++S       ++ D D SPPAWH+GFTRK RTPR+   + K    Q       E+
Sbjct  65    SSYRISSS-------LNTDQDYSPPAWHQGFTRKARTPRHNSNSNKSLLVQKLLKDDREK  117

Query  583   SVNPVLPFVPEMGSDDDYN---NNNEIDLFCQVPVlldddlnallndgggddHMR-----  738
              +NP LP VPE+GS+++ N   + NE  L C+VPV               D +M      
Sbjct  118   VLNP-LPLVPEIGSEEEPNMAADENEDQLLCRVPVFDPFAAKMCDIVTSEDGNMAVEVYG  176

Query  739   -----GLE-IPEFLSSDVELAEFAADVETLLGDDDVGEDKATAAVKI------EINGGDC  882
                  GL+ +P FL SD++LAEFAADVE LLG +   E   T  +++      E  G  C
Sbjct  177   QEGACGLDNLPGFLPSDMDLAEFAADVENLLGRETDEEYHDTKDLELLDCSKGEDEGQFC  236

Query  883   TEALNWSFGEEQEVEQKV---------------------MMTMLSGFDessssmesgsck  999
                      +EQE+E  +                       T++ G +E           
Sbjct  237   FADKVVKMKDEQEMETIIDCHFDQDFNMARESLLGWNFDYETLVDGDEEVEERKVPVPET  296

Query  1000  eeVAK------KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHH-  1158
             E +        K  + L L+YE VI AWA+QGCPWT G+RP  + +  W D MG      
Sbjct  297   EMMTSTEYKEMKRNVSLRLDYESVIIAWANQGCPWTTGSRPELNADDSWTDSMGTSPKDV  356

Query  1159  HHPYGSAMMMRRSDEG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
             ++PYG      R  +G REARV RY+EKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  357   NNPYGGLGSHTRGGDGEREARVMRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  416

Query  1336  SSLF  1347
             +SL 
Sbjct  417   TSLM  420



>ref|XP_006374368.1| hypothetical protein POPTR_0015s06480g [Populus trichocarpa]
 gb|ERP52165.1| hypothetical protein POPTR_0015s06480g [Populus trichocarpa]
Length=425

 Score =   287 bits (734),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 201/433 (46%), Positives = 246/433 (57%), Gaps = 80/433 (18%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             RK ANA+ GKTARACDSCL KRARWFCVADDAFLCQ+CD SVHSAN LASRHQRVRL T+
Sbjct  5     RKAANAMGGKTARACDSCLRKRARWFCVADDAFLCQACDASVHSANQLASRHQRVRLETA  64

Query  415   ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPR--NAKRTKKQNSGGVAVEESV  588
             SS   ++S       ++ D D SPPAWH+GFTRK RTPR  + K    Q       E+ +
Sbjct  65    SSYRISSS-------LNTDQDYSPPAWHQGFTRKARTPRHNSNKSLLVQQLLKDDREKVL  117

Query  589   NPVLPFVPEMGSDDDYN---NNNEID-LFCQVPVlldddlnallndgggddHMR------  738
             NP LP VPE+GS+++ N   + NE D L C+VPV               D++M       
Sbjct  118   NP-LPLVPEIGSEEEPNMAPDENEDDQLLCRVPVFDPFAAKMCDIVTSEDENMVVEVYGQ  176

Query  739   ----GLE-IPEFLSSDVELAEFAADVETLLG----------------DDDVGEDK-----  840
                 GL+ +P FL SD++LAEFAADVE LLG                D   GED+     
Sbjct  177   EGACGLDNLPGFLPSDMDLAEFAADVENLLGREADEEYHDTKDLELLDCSKGEDEGQFCF  236

Query  841   ATAAVKIEINGG-----DC----------TEALNWSF-------GEEQEVEQKVMMTMLS  954
             A   VK++         DC             L W+F       G+E+  E+KV +    
Sbjct  237   ADKVVKMKDEQEMETIIDCHFDQDFNMARESLLGWNFDYETLVDGDEEVEEKKVPVPETE  296

Query  955   GFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPD  1134
               + +               K  + L L+YE VI AWA+QGCPWT G+RP  +P+  W D
Sbjct  297   MMNSTGYKEM----------KRNVSLRLDYESVIIAWANQGCPWTTGSRPELNPDDSWTD  346

Query  1135  FMGG-DHHHHHPYGSAMMMRRSDEG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRP  1308
              MG      ++PYG      R  +G REARV RY+EKRRTRLFSKKIRYEVRKLNAEKRP
Sbjct  347   SMGACPKDVNNPYGGLGSHTRGGDGEREARVMRYKEKRRTRLFSKKIRYEVRKLNAEKRP  406

Query  1309  RLKGRFVKRSSLF  1347
             R+KGRFVKR+SL 
Sbjct  407   RMKGRFVKRTSLM  419



>ref|XP_002282578.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Vitis vinifera]
 emb|CBI27020.3| unnamed protein product [Vitis vinifera]
Length=432

 Score =   285 bits (729),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 192/452 (42%), Positives = 250/452 (55%), Gaps = 90/452 (20%)
 Frame = +1

Query  232   QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  411
             ++  ANA+ GKTARACDSC+ KRAR++C ADDAFLCQ+CD+SVHSAN LA RH+RVRL T
Sbjct  4     EKNVANAVGGKTARACDSCIRKRARFYCAADDAFLCQACDMSVHSANPLARRHERVRLKT  63

Query  412   sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVN  591
             +S     A  L +          S P+WH+GFTRK RTPR+ K     +    + E + N
Sbjct  64    ASLKLPGADSLEN----------SMPSWHQGFTRKARTPRHGK--PAAHPAFKSDELTRN  111

Query  592   PVLPFVPEMGSDDDYNNNNEIDLFCQVPV----------------------lldddlnal  705
             P LPFVPE+G+D+   ++NE  L  +VP+                         +  +  
Sbjct  112   P-LPFVPEIGADETSYDDNEEQLLYRVPIFDPFVAELCASTNSNEAVTTVANDTETADVT  170

Query  706   lndgggddHMRGLEIPE---FLSSDVELAEFAADVETLLGDD--------------DVGE  834
              ++       RG ++     FL SD++LAEFAADVE+LLG                D  E
Sbjct  171   GSETKALVAGRGHDVDSLHGFLPSDMDLAEFAADVESLLGKGLDNESFGMEGLGLIDCKE  230

Query  835   DKA------TAAVKIE----INGGDCTEA------------LNWSFGEEQEVEQKVMMTM  948
              ++      +  VK+E    I G    +A            LN+ +G     E++     
Sbjct  231   KESVEYSLHSGRVKLEEEEDIGGVMACQADAEIDMTREPFELNFDYGSPATCEEEEEKVA  290

Query  949   LSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCW  1128
             +   D ++   +         KK+++LL L+YE +I+AWASQG PWT+G RP  DP+ CW
Sbjct  291   VGAMDMNNKVDDPK-------KKNKILLRLDYEAIITAWASQGSPWTNGHRPELDPDDCW  343

Query  1129  PDFMGG-DHHHHHPYGSAMMMRR-----SDEGREARVSRYREKRRTRLFSKKIRYEVRKL  1290
             PD +G      HHPYG    M        D GREARVSRYREKRRTRLFSKKIRYEVRKL
Sbjct  344   PDCLGTCGIQVHHPYGEFGGMGEQQAAMGDGGREARVSRYREKRRTRLFSKKIRYEVRKL  403

Query  1291  NAEKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  1386
             NAEKRPR+KGRFVKR+S F  P  FP  LLN+
Sbjct  404   NAEKRPRMKGRFVKRAS-FGGPAAFP--LLNK  432



>ref|XP_010263709.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Nelumbo nucifera]
Length=451

 Score =   286 bits (731),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 201/474 (42%), Positives = 242/474 (51%), Gaps = 115/474 (24%)
 Frame = +1

Query  220   MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  399
             MSSD +K ANA+ GKTARACDSCL KRARW+C ADDAFLCQ CD SVHSAN LA RH+RV
Sbjct  1     MSSD-KKAANAVGGKTARACDSCLRKRARWYCAADDAFLCQGCDSSVHSANPLARRHERV  59

Query  400   RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  579
             RL T+S                   ++S PAWH+GFTRK RTPR+ K    Q      VE
Sbjct  60    RLKTASIKPMLNDGFLV--------ENSAPAWHQGFTRKARTPRHVKPAALQPP---KVE  108

Query  580   ESV--NPVLPFVPEMGSDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMR-----  738
             E +  NP LP VPEMG ++   ++NE  L  +VP+               +  M      
Sbjct  109   EPILLNP-LPLVPEMGGEESSPDDNEEQLLYRVPIFDPFVAELCTPATFNEPAMTTNDAT  167

Query  739   -----GLE---------------------IPEFLSSDVELAEFAADVETLLG----DDDV  828
                  G E                     +P FL SD+++AEFAADVETLLG    DD  
Sbjct  168   TAEDMGSERKALLPDGHDFDNDLTGETDKLPVFLLSDMDIAEFAADVETLLGRGLDDDSF  227

Query  829   G-EDKATAAVKIEINGGDC-----------------------------TEALNWSFGEEQ  918
             G ED      K E N   C                              E+L+ +F  + 
Sbjct  228   GMEDLGLLDCKEEENMEHCFRSGRVKVEVEEVEAVVGCQQVEPGLGMTRESLDLNFNSDS  287

Query  919   EV----------------EQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEE  1050
                                  V+  M SG+             ++++ K  + L LNYE 
Sbjct  288   PTTAEEEEVEEKAVKEAANSNVVTNMNSGY-----------KGDKMSSKISLRLRLNYEG  336

Query  1051  VISAWASQGCPWTDGTRPHFDPNH-CWPDFMGG---DHHHHHPYGS----AMMMRRSDEG  1206
             VI AWAS+G PWT G RP F+P+  CWPD MG    + +HHHPYG        +   + G
Sbjct  337   VICAWASKGSPWTTGERPQFNPDDDCWPDCMGTYPMEVYHHHPYGEMGGVGGHVTMGNGG  396

Query  1207  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  1368
             REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+SL     PFP
Sbjct  397   REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSLMGVAAPFP  450



>ref|XP_009602362.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
tomentosiformis]
Length=394

 Score =   280 bits (716),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 184/428 (43%), Positives = 239/428 (56%), Gaps = 73/428 (17%)
 Frame = +1

Query  220   MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  399
             M+S ++K AN +  KTARACDSC+ KRARW+C ADDAFLCQSCD SVHSAN LA RH+RV
Sbjct  1     MTSSEKKIANVVGAKTARACDSCIRKRARWYCAADDAFLCQSCDSSVHSANPLARRHERV  60

Query  400   RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  579
             RL TSS  ++           +  +  S P+WHRGFTRK RTPRN K ++K         
Sbjct  61    RLKTSSLKSSD----------EFSNSVSVPSWHRGFTRKARTPRNGKNSRKVK-------  103

Query  580   ESVNPVLPFVPEMGSDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMRG------  741
                NP+   VPE+ SD++  ++NE  L  +VP+L     +  + +    D M+       
Sbjct  104   ---NPIQLVVPEILSDENSQDDNEEQLLYRVPILDPFVADDAIGNEYSKDQMKNDFNDDH  160

Query  742   -------LEIPEFLSSDVELAEFAADVETLLG----------------------DDDVGE  834
                    L IP    S++ELAEFAADVE+LLG                      DD +G 
Sbjct  161   MSKFNGMLNIP----SEMELAEFAADVESLLGRRLDDEESFNYMELGLGFLEKHDDSMGC  216

Query  835   DKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeeVAK  1014
                   +K+E N G+    ++ S   + +      + +    D  S  +      +   K
Sbjct  217   SLVDEKIKVE-NEGEMEVVIDRSSYNQVDYSDTFDLKL----DCDSPIITLEEDDKGDTK  271

Query  1015  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR-  1191
              +++LL+L+Y  V++AWA Q  PWT G RP  D N CWP  M G+   +H YG    M  
Sbjct  272   NNKILLNLDYGGVLNAWADQRSPWTTGERPEVDFNDCWPVCM-GNCGKNHLYGDMGTMTG  330

Query  1192  ---RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPP  1362
                  DEGREARV RY+EKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++    P P
Sbjct  331   HGPTVDEGREARVLRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTNF--APTP  388

Query  1363  FPNYLLNR  1386
             FP+  LNR
Sbjct  389   FPS--LNR  394



>ref|XP_002533412.1| transcription factor, putative [Ricinus communis]
 gb|EEF28970.1| transcription factor, putative [Ricinus communis]
Length=430

 Score =   281 bits (719),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 199/455 (44%), Positives = 244/455 (54%), Gaps = 100/455 (22%)
 Frame = +1

Query  226   SDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  405
             ++ RK ANA+SGKTARACD C  KRARWFC ADDAFLCQ+CD SVHSAN LASRH+RVRL
Sbjct  2     TNDRKAANALSGKTARACDGCSRKRARWFCAADDAFLCQACDDSVHSANQLASRHERVRL  61

Query  406   GtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKK-QNSGGVAVEE  582
              T+SS  + +               S PAWH+GF RK RTPRN+   ++ ++   V V  
Sbjct  62    ETASSKISGSRNTVD----------SVPAWHQGFIRKARTPRNSSNKQQLKDEDKVLV--  109

Query  583   SVNPVLPFVPEMGSDDDYNNN--NEID--LFCQVPVlldddlnallndgggddHMRGLEI  750
              +NP LP VPE+G +++ N+   +E D  L  +VPV          +D        G EI
Sbjct  110   -MNP-LPLVPEIGGEEEGNSTFADEDDDRLLYRVPVFDPYASELCTDDMVTCGE--GTEI  165

Query  751   ---------------------------PEFLSSDVELAEFAADVETLLG-----------  816
                                        PEF SSD++LAEFAADVE LLG           
Sbjct  166   TMGNEEGNIVFDGYNGQEGTCDDLDILPEFFSSDMDLAEFAADVENLLGVNEDSPDIEDL  225

Query  817   --------DDDV-----GEDKATAAVKIEINGGDCT--------EALNWSFGEE------  915
                     +DD       +DK    VK E     C         E+L+WSF  E      
Sbjct  226   CLLHCKEEEDDQKCFFDDQDKVVMKVKDEQEVEACDHFDQAFERESLDWSFNYESPTITA  285

Query  916   QEVEQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDG  1095
              EVE+K  + +              S +++  K +  LL LNYE+VI+AWASQG PWT G
Sbjct  286   DEVEEKKRVPV-----------AINSQQKKETKSTASLLRLNYEDVINAWASQGSPWTSG  334

Query  1096  TRPHFDPNHCWPDFMGG--DHHHHHPYGSAMMMRRSDEG-REARVSRYREKRRTRLFSKK  1266
             +RP  + + CWPD M       HHHPYG      R   G REARV RY+EKRRTRLFSKK
Sbjct  335   SRPELNSDDCWPDCMDICLKDGHHHPYGGMGGHTRGGNGAREARVLRYKEKRRTRLFSKK  394

Query  1267  IRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPN  1371
             IRYEVRKLNAEKRPR+KGRFVKR+S      P+ N
Sbjct  395   IRYEVRKLNAEKRPRMKGRFVKRTSFMGNGFPYMN  429



>ref|XP_007044348.1| B-box type zinc finger protein with CCT domain, putative [Theobroma 
cacao]
 gb|EOY00180.1| B-box type zinc finger protein with CCT domain, putative [Theobroma 
cacao]
Length=440

 Score =   280 bits (716),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 193/461 (42%), Positives = 245/461 (53%), Gaps = 98/461 (21%)
 Frame = +1

Query  217   MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  396
             M+S+  +  ANA+ GKTARACDSC+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+R
Sbjct  1     MIST--KNVANAVGGKTARACDSCIKKRARWYCAADDAFLCQACDSSVHSANPLARRHER  58

Query  397   VRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAV  576
             VRL T+S  ++                   P+WH+GFTRK RT R  K +  Q       
Sbjct  59    VRLKTASLQSSGHEAPLE---------SFAPSWHKGFTRKARTRRPTKASIHQKLKAEHT  109

Query  577   EESVNPVLPFVPEMGSDD-DYNNNNEIDLFCQVPVlldddlnallndgggddHMRGL---  744
             + + NP  P VPE+G+D+  Y  N E  L  +VP+          +    +  +  +   
Sbjct  110   KRNSNP-FPLVPEIGADEISYEENEEEQLLYRVPIFDPLVAKLCTSTTSNEAAVSAVGND  168

Query  745   ---------EIPEFLS--------------SDVELAEFAADVETLLGD---------DDV  828
                      E   FL+              S+++LAEFAADVE+LLG          +D+
Sbjct  169   VETADAAVSESKAFLACNGQDADGSHGLFPSEMDLAEFAADVESLLGKGLENESFGMEDL  228

Query  829   G---------EDKATAAVKIEINGGDCTEA------------------LNWSF------G  909
             G          D +    K++I   +  EA                  LN+S       G
Sbjct  229   GLKDSKEKYFRDCSLGNGKVKIEDEESFEAVGACHVDSEIDMAREPFKLNFSCDSPGNCG  288

Query  910   EEQE-VEQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPW  1086
             EE E V+++V +     ++E ++            KK ++LLSLNYE VI+AWASQG PW
Sbjct  289   EEDELVKEEVTVKSYEEYEEDTAKK----------KKRKILLSLNYESVITAWASQGSPW  338

Query  1087  TDGTRPHFDPNHCWPDFMG-GDHHHHHPYGSAMMM----RRSDEGREARVSRYREKRRTR  1251
             T G RP FDP+ CWPD MG G    HH Y   + M       D GREARVSRYREKRRTR
Sbjct  339   TSGGRPDFDPDECWPDCMGTGGTEVHHTYSDLIGMGAHQALGDGGREARVSRYREKRRTR  398

Query  1252  LFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPP-PFPN  1371
             LFSKKIRYEVRKLNAEKRPR+KGRFVKR+S    P  PF N
Sbjct  399   LFSKKIRYEVRKLNAEKRPRMKGRFVKRASFLAGPAFPFVN  439



>ref|XP_006440964.1| hypothetical protein CICLE_v10020440mg [Citrus clementina]
 gb|ESR54204.1| hypothetical protein CICLE_v10020440mg [Citrus clementina]
Length=403

 Score =   278 bits (710),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 189/406 (47%), Positives = 236/406 (58%), Gaps = 43/406 (11%)
 Frame = +1

Query  220   MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  399
             M + +++TANA+ GKTARACD CL KRARW+CVADDAFLCQ CD SVHSAN LASRH+RV
Sbjct  1     MMTGEKRTANAMGGKTARACDGCLLKRARWYCVADDAFLCQGCDASVHSANQLASRHERV  60

Query  400   RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  579
             RL      TA++   ++  I +  D D+ P WH+GFTRK RTPR        N+    + 
Sbjct  61    RL-----ETASSCNNNNKLINEHTDKDTVPVWHQGFTRKARTPR-------HNNNKAMLV  108

Query  580   ESVNPVLPFVPEMGSDDD--YNNNNEID--LFCQVPVlldddlnallndgggddH--MRG  741
             +      P VPE+G +D     ++  ID  L  QVPV    +      +   D +    G
Sbjct  109   QQAKANEPLVPEIGCEDGSLQADDQVIDEQLLYQVPVFDPFEAVEPDENLIVDGYNGQDG  168

Query  742   L----EIPEFLSSDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTE----ALN  897
                  ++  FL SD++LAEFAADVE+LLG      D+ +  VK      DC E    ALN
Sbjct  169   TGDLDDLHGFLPSDLDLAEFAADVESLLGGGGGALDEDSCDVKEFGTLLDCKEEETIALN  228

Query  898   WSFGEEQEVEQKVMMTML-----SGFDessssmesgsckeeVAK-KSRML----LSLNYE  1047
                  E EVE+ V+           FD  S      +      + K +++    L LNY+
Sbjct  229   LKIKAE-EVEEAVIAAATREAIDCNFDYQSPVTGDDTAGLMSTECKPKLMRNVCLKLNYD  287

Query  1048  EVISAWASQGCPWTDGTRPHFDPNHCWPDFMG---GDHHHHHPYGSAMM---MRRSDEGR  1209
              VI+AWASQGCPWT G+RP  + NHCWP   G    D HHH   G A++      +  GR
Sbjct  288   AVITAWASQGCPWTAGSRPEINLNHCWPHCTGLCCKDVHHHTCGGGAVLRGCHLGAGGGR  347

Query  1210  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  1347
             EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S  
Sbjct  348   EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSFM  393



>emb|CAN73757.1| hypothetical protein VITISV_026326 [Vitis vinifera]
Length=475

 Score =   278 bits (710),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 190/436 (44%), Positives = 232/436 (53%), Gaps = 71/436 (16%)
 Frame = +1

Query  214   RMMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQ  393
             + M   Q K ANA+ GKTARACD+CL KRARW+C ADDAFLCQ+CD SVHSAN LA RH+
Sbjct  63    QQMDLTQAKVANAMGGKTARACDNCLHKRARWYCGADDAFLCQACDASVHSANQLAERHE  122

Query  394   RVRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVA  573
             RVRL             +S K  D   D+S PAWH+GFTRK R+PRN KRT  Q S    
Sbjct  123   RVRL-----------QAASCKNADSMRDNSTPAWHQGFTRKARSPRNVKRTSVQPSKH--  169

Query  574   VEESVNPVLPFVPEMGSDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMRGLE--  747
              E       P VPE+GS++   + NE     +VP           +         G+E  
Sbjct  170   -ENKFPTPPPLVPEIGSEEASPDENEEQFLFRVPTFDPFVAELNNDGIREI----GMEND  224

Query  748   -----------------IPEFLSSDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGG  876
                              +  FL S+++LAEFAADVE+ LG    G D+ +  +K  I   
Sbjct  225   SKPLSDYGHEEIGDLDSLTGFLPSEMDLAEFAADVESYLG---AGLDEDSCGIK-GIGVL  280

Query  877   DCTEA-LNWSFGE------EQEVEQKVMMTMLSGFDess---------------ssmesg  990
             DC +  ++  FG+      E+ VE      +    D +                      
Sbjct  281   DCEQGDMDACFGDQKVKVKEERVETDATFHLDPELDMTKELLAWNLDYESTVMDEEEHEE  340

Query  991   sckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHH--  1164
                  V  + ++ LSLNYE+VI+AWASQG PWT G RP FDPN  WPD+MG    + H  
Sbjct  341   KMVAAVEMRRKISLSLNYEDVITAWASQGSPWTTGNRPEFDPNDYWPDYMGACPTNVHGP  400

Query  1165  ---PYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
                  G        D GREARV RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  401   CGDVGGVGGNFGGRDGGREARVLRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  460

Query  1336  SSLFQPPPPFPNYLLN  1383
             +S F   P FP  +LN
Sbjct  461   AS-FAAGPCFP--ILN  473



>ref|XP_011072947.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Sesamum indicum]
Length=393

 Score =   274 bits (701),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 187/430 (43%), Positives = 225/430 (52%), Gaps = 77/430 (18%)
 Frame = +1

Query  217   MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  396
             M   DQ K ANA+ GKTARACDSCL KRARWFC ADDAFLCQSCDVSVHSAN LASRH+R
Sbjct  1     MNIVDQCKAANALGGKTARACDSCLLKRARWFCAADDAFLCQSCDVSVHSANQLASRHER  60

Query  397   VRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAV  576
             VRL                      +  S PAWH+GFTRK RTPR  K   +       +
Sbjct  61    VRL--------------EASSFKGSEGHSSPAWHQGFTRKARTPRQGKPAAR-------L  99

Query  577   EESVNPVLPFVPEMGSDDD-YNNNNEIDLFCQVPVlldddlnallndgggddHMRG--LE  747
             +   N   P VPE+ ++D  ++  NE     +VPV              G++   G  L 
Sbjct  100   QPLANHAFPLVPEINAEDGAFSEENEEQFLYRVPVFDPFADEFCSETVKGEEADGGHDLN  159

Query  748   IPEFLSS-DVELAEFAADVETLLG--------------DDDVGEDKATAAVKIEINGGDC  882
             + E LS+ D +LAEFAADVE LLG              D+D G D+      ++I   D 
Sbjct  160   LAELLSTCDDDLAEFAADVENLLGTGVEEGSGCPIHCKDEDNGSDELLHGKGVKIEEDDD  219

Query  883   TEA-----------------LNWSFG-----EEQEVEQKVMMTMLSGFDessssmesgsc  996
              +                  LNW F        QE +    +   S  D  S S      
Sbjct  220   DDDEVQAVIACHFDPALDMELNWDFDYVSSMARQETKNVAAIETTSSMDSGSESHA----  275

Query  997   keeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGS  1176
                   K+RM L LNYE VI+AWA+QG PWT+G RPHF+ +      + GD H      S
Sbjct  276   ------KTRMFLRLNYEAVIAAWAAQGSPWTNGVRPHFNLDDFMVTCLEGDSHPSCGGRS  329

Query  1177  AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  1356
                   +D  REARV RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++ F   
Sbjct  330   GA----NDAEREARVLRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTN-FSGS  384

Query  1357  PPFPNYLLNR  1386
                P YL+N+
Sbjct  385   SSLP-YLINK  393



>ref|XP_002276181.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Vitis vinifera]
Length=410

 Score =   275 bits (702),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 188/429 (44%), Positives = 230/429 (54%), Gaps = 71/429 (17%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +K ANA+ GKTARACD+CL KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL  +
Sbjct  5     KKVANAMGGKTARACDNCLHKRARWYCGADDAFLCQACDASVHSANQLAERHERVRLQAA  64

Query  415   ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNP  594
             S            K  D   D+S PAWH+GFTRK R+PRN KRT  Q S     E     
Sbjct  65    SC-----------KNADSMRDNSTPAWHQGFTRKARSPRNVKRTSVQPSKH---ENKFPT  110

Query  595   VLPFVPEMGSDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMRGLE---------  747
               P VPE+GS++   + NE     +VP           +         G+E         
Sbjct  111   PPPLVPEIGSEEASPDENEEQFLFRVPTFDPFVAELNNDGIREI----GMENDSKPLSDY  166

Query  748   ----------IPEFLSSDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEA-L  894
                       +  FL S+++LAEFAADVE+ LG    G D+ +  +K  I   DC +  +
Sbjct  167   GHEEIGDLDSLTGFLPSEMDLAEFAADVESYLG---AGLDEDSCGIK-GIGVLDCEQGDM  222

Query  895   NWSFGE------EQEVEQKVMMTMLSGFDess---------------ssmesgsckeeVA  1011
             +  FG+      E+ VE      +    D +                           V 
Sbjct  223   DACFGDQKVKVKEERVETDATFHLDPELDMTKELLAWNLDYESTVMDEEEHEEKMVAAVE  282

Query  1012  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHH-----PYGS  1176
              + ++ LSLNYE+VI+AWASQG PWT G RP FDPN  WPD+MG    + H       G 
Sbjct  283   MRRKISLSLNYEDVITAWASQGSPWTTGNRPEFDPNDYWPDYMGACPTNVHGPCGDVGGV  342

Query  1177  AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  1356
                    D GREARV RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S F   
Sbjct  343   GGNFGGRDGGREARVLRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAS-FAAG  401

Query  1357  PPFPNYLLN  1383
             P FP  +LN
Sbjct  402   PCFP--ILN  408



>ref|XP_011022115.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Populus euphratica]
Length=440

 Score =   275 bits (702),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 191/462 (41%), Positives = 237/462 (51%), Gaps = 119/462 (26%)
 Frame = +1

Query  232   QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  411
              + +ANA+ GKTARACDSC+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL  
Sbjct  4     NKSSANAVGGKTARACDSCIKKRARWYCAADDAFLCQACDSSVHSANPLARRHERVRL--  61

Query  412   sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESV-  588
                        S   +     ++S P+WH GFTRK RTPR+ K   +       + E++ 
Sbjct  62    --------KTASLKSLDLCSKENSVPSWHGGFTRKARTPRHGKPVSQSK-----IAETIR  108

Query  589   NPVLPFVPEMGSDDDYNNNNE---------------IDLFCQVPVlldddlnallndggg  723
             N  +P VPE+GSD+  + +NE                DL     +  +            
Sbjct  109   NIPIPLVPEVGSDEISHEDNEEEHLLYRVPIFDPSVADLCASTTISNEAPAGGNGCTDQR  168

Query  724   ddHMRGLE---------------IPEFLSSDVELAEFAADVETL--------------LG  816
                  G+E               +P FL SD +LAEFAAD+E+L              LG
Sbjct  169   VADSNGVESKILIGAIERRDVESLPGFLPSDTDLAEFAADMESLLGRGLENESFGMEELG  228

Query  817   DDDVGEDKA---------TAAVKIE------------------INGGDCTEA---LNWSF  906
               D  E+K             VK+E                  I  G   E    L++ F
Sbjct  229   LMDCKEEKEFEVKGFPLWNGKVKVEDEENAGVERKAVRKCHAGIETGTAKEPIFELSFDF  288

Query  907   ------GEEQEVEQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWA  1068
                   GEE E   KV      G +E       G  +++   K ++LLSL+YE V++AWA
Sbjct  289   NSPATCGEEDE---KV------GIEEGDLKNTRGEYEDDDGAKRKILLSLDYEAVMTAWA  339

Query  1069  SQGCPWTDGTRPHFDPNHCWPDFMG-GDHHHHHPYGS---------AMMMRRSDEGREAR  1218
             SQG PWT+G RP FDP+ CWPD MG      HHPYG          AMM    D GREAR
Sbjct  340   SQGSPWTNGNRPDFDPDECWPDCMGICGAQLHHPYGDMISGLGAHPAMM----DGGREAR  395

Query  1219  VSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
             VSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++L
Sbjct  396   VSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTTL  437



>ref|XP_009765495.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
sylvestris]
Length=405

 Score =   273 bits (698),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 185/441 (42%), Positives = 237/441 (54%), Gaps = 88/441 (20%)
 Frame = +1

Query  220   MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  399
             M+S ++K AN +  KTARACDSC+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RV
Sbjct  1     MTSSEKKLANVVGAKTARACDSCIRKRARWYCAADDAFLCQTCDSSVHSANPLARRHERV  60

Query  400   RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  579
             RL T+S            K  D ++  S P+WHRGFTRK RTPR  K     NSG +   
Sbjct  61    RLKTASL-----------KSSDSENSASVPSWHRGFTRKARTPRIGK-----NSGSIK--  102

Query  580   ESVNPVLPFVPEMGSDDDYNNNNEIDLFCQVPV----lldddlnallndgggddHMRGLE  747
                NP+   VPE+ SD++  + NE  L  +VP+    + D+     +     DDHM    
Sbjct  103   ---NPIQLIVPEISSDENSQDENEEQLLYRVPIPDPFVADEYSKDQMKSDFNDDHMNKFH  159

Query  748   IPEFLSSDVELAEFAADVETLLG----------------------DDDVGEDKATAAVKI  861
                 + S++ELAEFAADVE+LLG                      DD +G       +K+
Sbjct  160   GMLNIPSEMELAEFAADVESLLGKGLDDEESFNYMELGLGFLEKHDDSMGCFLVDEKIKV  219

Query  862   E-------------INGGDCTEALNWSFG---------EEQEVEQKVMMTMLSGFDesss  975
             E              N  D ++  +  F          E+ + E   ++   S  D    
Sbjct  220   ENEGEMEVVMDNTNYNQVDYSDTFDLKFDCDSPVITLEEDDKGEAGEIIMQDSTNDGLIG  279

Query  976   smesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHH  1155
                        +K +++LL+L+Y  V++AWA Q  PWT G RP  D N CWP  M G+  
Sbjct  280   D----------SKNNKILLNLDYGGVLNAWADQRSPWTTGERPQVDSNDCWPVCM-GNCG  328

Query  1156  HHHPYGSAMMMR----RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGR  1323
               H YG   +M       DEGREARV RY+EKRRTRLFSKKIRYEVRKLNAE RPR+KGR
Sbjct  329   QIHAYGDMEIMTGHGPMIDEGREARVLRYKEKRRTRLFSKKIRYEVRKLNAEMRPRMKGR  388

Query  1324  FVKRSSLFQPPPPFPNYLLNR  1386
             FVKR++    P PFP+  LNR
Sbjct  389   FVKRTNF--APTPFPS--LNR  405



>gb|AIE41597.1| zinc finger protein CONSTANS-LIKE 6 [Lagerstroemia indica]
Length=376

 Score =   272 bits (695),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 182/408 (45%), Positives = 229/408 (56%), Gaps = 62/408 (15%)
 Frame = +1

Query  232   QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  411
             Q K +N + GKTARACD+CL KRARWFC  DDAFLCQSCD SVHSANLLASRH+RVRL  
Sbjct  8     QSKASNVLGGKTARACDNCLVKRARWFCPGDDAFLCQSCDHSVHSANLLASRHKRVRL--  65

Query  412   sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVN  591
                    +S     +I+ D+   SPP+WH GFTRK RTPR  +RT + +           
Sbjct  66    -----ETSSSSFKKEILIDNSTTSPPSWHHGFTRKARTPRPWRRTPQLD----------R  110

Query  592   PVLPFVPEMGSDDDYNNNNEIDLFCQVPV-----lldddlnallndgggddHMRGLEIPE  756
               LP VPE+ S+D +   ++  LFC+VPV             +  D         L + E
Sbjct  111   HQLPLVPEINSEDPFMEESDEQLFCRVPVFDPFCTDFVKGEEMFLDDQEMILEHDLNLDE  170

Query  757   FLSS-DVELAEFAADVETL-----------------LGDDDVGEDKATAAVKIEINGGDC  882
              LS+ + +LAEFAADVE L                 + + +  E K      +++ G   
Sbjct  171   LLSTCEDDLAEFAADVECLLGGGEDLGLMDCRERVKVEEREDEEVKGVVQCNLDVEG---  227

Query  883   TEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISA  1062
                  W  GEE        +  +SG +E++S  ++   KE   KK RMLL LNYE VI++
Sbjct  228   ----KWGCGEE--------VKRVSGGNETTSLSKNDVEKESQVKK-RMLLRLNYEAVIAS  274

Query  1063  WASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGREARVSRYREKR  1242
             WA+QG PWTDG RP F+ +      +GG       Y    + R    GREARVSRYREKR
Sbjct  275   WATQGSPWTDGIRPQFNLDEFMVACLGGS-----CYELGGLSRAKIGGREARVSRYREKR  329

Query  1243  RTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  1386
             RTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRS+ F      P  L+N+
Sbjct  330   RTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSTTFS-GSSLPYQLINK  376



>ref|XP_006485786.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Citrus 
sinensis]
 gb|KDO57445.1| hypothetical protein CISIN_1g015643mg [Citrus sinensis]
Length=403

 Score =   270 bits (691),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 185/405 (46%), Positives = 234/405 (58%), Gaps = 41/405 (10%)
 Frame = +1

Query  220   MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  399
             M + +++TANA+ GKTARACD CL KRARW+CVADDAFLCQ CD SVHSAN LASRH+RV
Sbjct  1     MMTGEKRTANAMGGKTARACDGCLRKRARWYCVADDAFLCQGCDASVHSANQLASRHERV  60

Query  400   RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  579
             RL      TA++   ++  I +  D D+ P WH+GFTRK RTPR        N+    + 
Sbjct  61    RL-----ETASSCNNNNKLINEHTDKDTVPVWHQGFTRKARTPR-------HNNNKAMLM  108

Query  580   ESVNPVLPFVPEMGSDDD--YNNNNEID--LFCQVPVlldddlnallndgggddH--MRG  741
             +      P VPE+G +D     ++  ID  L  QVPV    +      +   D +    G
Sbjct  109   QQAKANEPLVPEIGCEDGSLQADDQVIDEQLLYQVPVFDPFEAVEPDENLIVDGYNGQDG  168

Query  742   L----EIPEFLSSDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTE----ALN  897
                  ++  FL SD++LAEFAADVE+LLG      D+ +  VK      DC E    ALN
Sbjct  169   TGDLDDLHGFLPSDLDLAEFAADVESLLGGGGGALDEDSCDVKEFWTLLDCKEEETIALN  228

Query  898   WSFGEEQEVEQKVMM----TMLSGFDessssmesgsckeeVAK-KSRML----LSLNYEE  1050
                 +E+  E  +       +   FD  S      +      + K +++    L LNY+ 
Sbjct  229   LKIKDEEVEEAVIAEATREAIGCNFDYQSPVTGDDTAGLMSTECKPKLMRNVSLKLNYDA  288

Query  1051  VISAWASQGCPWTDGTRPHFDPNHCWPDFMG--GDHHHHHPYGSAMMMRR----SDEGRE  1212
             VI+AWASQGCPWT G+RP  + NHCWP   G      HHH  G   ++R     +  GRE
Sbjct  289   VITAWASQGCPWTAGSRPEINLNHCWPYCTGLCCKGVHHHTCGGGAVLRGCHLGAGGGRE  348

Query  1213  ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  1347
             ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S  
Sbjct  349   ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSFM  393



>ref|XP_010066724.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Eucalyptus grandis]
 gb|KCW64739.1| hypothetical protein EUGRSUZ_G02322 [Eucalyptus grandis]
Length=463

 Score =   271 bits (694),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 196/472 (42%), Positives = 243/472 (51%), Gaps = 104/472 (22%)
 Frame = +1

Query  232   QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  411
              +  ANA SGKTARACD+C+ +RARW+C ADDAFLCQSCD SVHSAN LA RH+RVRL T
Sbjct  9     HKNAANAFSGKTARACDNCIQRRARWYCAADDAFLCQSCDRSVHSANPLARRHERVRLKT  68

Query  412   sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKR-----TKKQNSGGVAV  576
             +++                     P +WHRGFT+KPRTPR AK      TK +N+     
Sbjct  69    AATPQKHLGE------FSSHHRKKPSSWHRGFTKKPRTPRGAKSALHRATKPENA-----  117

Query  577   EESVNPVLPFVPEMGSDDDYNNNNEIDLFCQVPVlldddlnallndgggddHM-------  735
               + NP  P VPE+G D+  N  +E  L  +VP           + G             
Sbjct  118   --ARNP-FPVVPEVGGDETSNEESEEHLLYRVPAYDPFVAEMCTSKGAEATAFSAEPETV  174

Query  736   -------------RGL-----EIPEFLSSDVELAEFAADVETLLG---------------  816
                          +GL      + EFL SD +LAEFAADVE+LLG               
Sbjct  175   AAFDGSGDGDNRSKGLTDEVENLQEFLPSDADLAEFAADVESLLGRALDTESFGIEGLGF  234

Query  817   ------DDD-------------VGEDKATAAVKIEINGGDC-------TEALNWSF----  906
                   DD+             V E +  A V +E+   D        T  LN+ +    
Sbjct  235   VDCKERDDNSMDCSLGSGGAIKVEEKEGVAEVVVELGHDDMEMDVSKETFELNFDYDSPT  294

Query  907   --GEEQEVEQKVMMTMLSGFDess----ssmesgsckeeVAKKSRMLLSLNYEEVISAWA  1068
               G+E+E E KV++ +    +  +          S + +  KK  + L L+YE VISAWA
Sbjct  295   TCGDEEE-EAKVIVELEGEKNVENCGADEGTNISSEERKKKKKREIFLRLDYEAVISAWA  353

Query  1069  SQGCPWTDGTRPHFDPNHCWPDFMG-GDHHHHHPYGSAMMMRRS----DEGREARVSRYR  1233
              QG PWT G RP F P++CWPDFMG       + YG A +        D GREA+VSRYR
Sbjct  354   GQGSPWTTGERPDFSPDNCWPDFMGMSGLEFQNLYGEAGVHGGHVGMGDAGREAKVSRYR  413

Query  1234  EKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR-SSLFQPPPPFPNYLLNR  1386
             EKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR SS     P FP  LLN+
Sbjct  414   EKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASSASSSAPAFP--LLNK  463



>gb|KHG04097.1| Zinc finger CONSTANS-LIKE 16 -like protein [Gossypium arboreum]
Length=416

 Score =   270 bits (690),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 191/428 (45%), Positives = 238/428 (56%), Gaps = 76/428 (18%)
 Frame = +1

Query  220   MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  399
             M SD+R  ANA+ GKTARACD CL KRARW+C ADDAFLCQ CD SVHSAN LASRH RV
Sbjct  1     MISDKR-AANAMGGKTARACDGCLRKRARWYCSADDAFLCQGCDTSVHSANQLASRHTRV  59

Query  400   RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  579
             RL T+SS   A+ + +S       D D+ PAWH+GFTRK RTPR  +  + Q       +
Sbjct  60    RLETASSRFNASVINNS-----ATDQDALPAWHQGFTRKARTPRQNRSIQGQQKS----D  110

Query  580   ESVNPVLPFVPEMGSDDDYNNNNEIDLFCQVPVll-dddlnallndgggddHMRGLE---  747
               V  + P VPE+G +D      E  L C+VPV          + +  G+  + G E   
Sbjct  111   GKVWDLNPLVPEVGCEDGSAEETEDQLLCRVPVFDPFSAELRDMANENGNLVVDGFEDEG  170

Query  748   -------IPEFLSSDVELAEFAADVETLLGD-----------------DDVGEDKATAAV  855
                    +  FL SD++LA+FAADVE+LLGD                 D   ED++ A  
Sbjct  171   TCQLDDGLHGFLPSDLDLAQFAADVESLLGDGLDENNTCNHTKGTELMDCKQEDESNAFQ  230

Query  856   KIEINGG-----------------DCT-EALNWSFGEE------QEVEQKVMMTMLSGFD  963
             + +I                    D T  +LNWSF  E      QE E+KV+    +   
Sbjct  231   ERKIKDEEEEEEGIITACCFDSDFDVTRSSLNWSFDYESPTIGDQEEEEKVVPVAETPI-  289

Query  964   essssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG  1143
                        + +  KK  MLL L+YE VI+AWA+QG PWT GTRP F+P+    DFMG
Sbjct  290   --------MDGEIKAEKKRSMLLRLDYESVITAWATQGSPWTSGTRPEFNPD----DFMG  337

Query  1144  GDHHHHHPYGSAMMMRRSDEG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKG  1320
              + +       +   R   +G REARVSRYREKRRTRLFSKKIRY+VRKLNAEKRPR+KG
Sbjct  338   SNPNEGIGGICSQGKRNITDGEREARVSRYREKRRTRLFSKKIRYQVRKLNAEKRPRIKG  397

Query  1321  RFVKRSSL  1344
             RFVKR+S 
Sbjct  398   RFVKRASF  405



>ref|XP_007152761.1| hypothetical protein PHAVU_004G157300g [Phaseolus vulgaris]
 gb|ESW24755.1| hypothetical protein PHAVU_004G157300g [Phaseolus vulgaris]
Length=406

 Score =   269 bits (688),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 175/409 (43%), Positives = 235/409 (57%), Gaps = 46/409 (11%)
 Frame = +1

Query  226   SDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  405
             +++ K A+A+  +TARAC+SCL  RARW+C ADDAFLC  CD  VHSAN LASRHQRV+L
Sbjct  2     NNEMKEASALGARTARACESCLKVRARWYCAADDAFLCHGCDNMVHSANQLASRHQRVKL  61

Query  406   GtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEES  585
              T+SS    +  L+  K V         AWH GFTRK RTPR++ + ++Q    +  E  
Sbjct  62    QTASSKLNYSDTLNHNKKV---------AWHSGFTRKARTPRHSTKLQEQQQKKIHEEGE  112

Query  586   V----------NPV-LPFVPEMGSDDD-YNNNNEIDLFCQVPVlldddlnallndgggdd  729
                        N + LP VPE+GS++  YN+ +E  L C+VPV   +  +          
Sbjct  113   EEQQQQQVFFNNTISLPLVPELGSEEALYNDESEEQLLCRVPVFDAELCSVYNEVKEEV-  171

Query  730   HMRGLEI-------PEFLSSDVELAEFAADVETLLG---DDDVGEDKATAAVKIEINGGD  879
              + G E+        EFL SD++LAEFAADVE+LLG   D+D  E    + + ++    D
Sbjct  172   -LAGEEVFDLENFSCEFLPSDMDLAEFAADVESLLGNGADEDSSEHVKGSEIVLDCKEED  230

Query  880   -----CTEALN-----WSFGEEQEVEQKVMMTMLS-GFDessssmesgsckeeVAKKSRM  1026
                  C + +          +E+E++      + S   D + + +       +   K  M
Sbjct  231   DEMDACVDGVGEKDAMVKVKDEEELDADTSCHLDSIILDMNWNDIVESESLAQEQDKKEM  290

Query  1027  LLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHH-HHPYGSAMMMR-RSD  1200
              L LNYE+VI+AWASQGCPWT GT P+F+ +   P F+G +       YG    +R  +D
Sbjct  291   FLRLNYEDVIAAWASQGCPWTTGTPPNFNSDDFLPGFLGSNGEDVLCCYGEMRSLRGHAD  350

Query  1201  EGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  1347
              GREARV RYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+S  
Sbjct  351   GGREARVLRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTSFL  399



>ref|XP_011076793.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Sesamum indicum]
Length=439

 Score =   270 bits (689),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 189/453 (42%), Positives = 243/453 (54%), Gaps = 95/453 (21%)
 Frame = +1

Query  217   MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  396
             M+SSD RK A A+ GK+ARACD+C+ KRARW+C ADDAFLCQSCD SVHSAN LA RH+R
Sbjct  1     MVSSD-RKLATAVGGKSARACDNCVKKRARWYCTADDAFLCQSCDSSVHSANPLARRHER  59

Query  397   VRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAV  576
             VRL T+S+ ++     S  ++       S P+WH+GFTRK RTPR  K  +  +   V+ 
Sbjct  60    VRLKTASTKSSDDESRSGLQV-------SVPSWHQGFTRKARTPRQKKHNRLSSDELVS-  111

Query  577   EESVNPVLPFVPEMGSDDDYNNNNEIDLFCQVPV-----------lldddlnallndggg  723
                ++  L  VPE+ S+D+ +  NE  L  +VP+               +    + +GG 
Sbjct  112   --GISNPLHLVPEVCSEDNSHEENEEQLLYRVPIFDPSVAELRNSANSSEAANSIQNGGE  169

Query  724   ddHMRGLEIPE--------------FLSSDVELAEFAADVETLLG---------------  816
               H+ G E+                FL S+++LAEFAADVE+LLG               
Sbjct  170   TTHVSGPELKPALNDFSQEMSHLQGFLPSEMDLAEFAADVESLLGKGLENESFDMEGLGL  229

Query  817   ---DDDVGEDK----ATAAVKIE----------------INGGDCTEALNWSF-----GE  912
                D  V E +     +  VK+E                I+ G  T  LN+ +     GE
Sbjct  230   LDCDGKVKESRECSLGSGRVKVEDEEIGEVANHRIDAEFIDMGSETFELNFDYDSPITGE  289

Query  913   EQEVE-QKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWT  1089
             E+ ++ + V     + FD+ S+          V    R+ L L+YE V+SAW  Q  PWT
Sbjct  290   EEYIKAENVEPITPNNFDQDSNK---------VHDSKRIFLRLDYEGVLSAWDDQKSPWT  340

Query  1090  DGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMM-----RRSDEGREARVSRYREKRRTRL  1254
              G RP  D   CWPD MG      H YG   MM        D GREARVSRYREKRRTRL
Sbjct  341   TGERPDLDSAGCWPDCMG-TCGTVHVYGEMGMMIGHAVAVGDGGREARVSRYREKRRTRL  399

Query  1255  FSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  1353
             FSKKIRYEVRKLNAEKRPR+KGRFVKR++L  P
Sbjct  400   FSKKIRYEVRKLNAEKRPRMKGRFVKRANLVAP  432



>ref|XP_009347093.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Pyrus x 
bretschneideri]
Length=441

 Score =   270 bits (689),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 186/429 (43%), Positives = 231/429 (54%), Gaps = 77/429 (18%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +K ANA+ G TARACDSCL KRARWFC ADDAFLCQ CD  VHSAN LASRHQRVRL  S
Sbjct  5     KKAANAMGGNTARACDSCLVKRARWFCAADDAFLCQRCDALVHSANQLASRHQRVRLQGS  64

Query  415   ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEE----  582
             S    A+        V    D + PAWH+GF RK RTPR+ K+      G  A +E    
Sbjct  65    SVKANAS--------VQLIADQAAPAWHKGFKRKARTPRHNKK-----PGFAAKDEQEKV  111

Query  583   SVNPVLPFVPEMGSDD-----DYNNNNEIDLFCQVPVll--dddlnallndgggddHMRG  741
              ++P LPFVPE+G  +     D  N +   L  +VP+      +L  + +     ++   
Sbjct  112   GLHPPLPFVPEIGCQETNLMEDEENEDLERLLYRVPIYDPFAAELCNISSSDQVGNNTGA  171

Query  742   LEIPE-----------------FLSSDVELAEFAADVETLLG---DDDVGEDKATAAV--  855
             +++ +                 FL SD+ELAEFAADVE LLG   D+D  + K    +  
Sbjct  172   IDLDDEEIEIRNTGNDLDNLGGFLRSDMELAEFAADVENLLGGGLDEDCSDIKGILGLLD  231

Query  856   ------------KIEINGGDCTEALNWSFGEEQEVEQKVMM-----------TMLSGFDe  966
                          IE N       L+W+   EQ     V+M            +L    +
Sbjct  232   EGKEVKVEEEVEGIEFN----PSILDWNLYYEQSSAVPVLMGSEEDKEEEEKVVLFMGAQ  287

Query  967   ssssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-  1143
             SS  +     K+ V K+  + L L+YE VI+AWASQG PWT GTRP  +P+  W D MG 
Sbjct  288   SSDEIGFMENKQIVMKRKNICLKLDYEAVITAWASQGSPWTTGTRPELNPDEGWLDCMGM  347

Query  1144  ---GDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRL  1314
                  H  H      +  R  D  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+
Sbjct  348   WPTEIHQAHGDSAGCVSGRGDDPRREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRM  407

Query  1315  KGRFVKRSS  1341
             KGRFVKR++
Sbjct  408   KGRFVKRTT  416



>ref|XP_009627333.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
tomentosiformis]
Length=446

 Score =   268 bits (684),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 193/468 (41%), Positives = 247/468 (53%), Gaps = 105/468 (22%)
 Frame = +1

Query  220   MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  399
             M SD RK A+A+ GKT RACD+C+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RV
Sbjct  1     MVSD-RKLASAMGGKTTRACDNCIRKRARWYCPADDAFLCQNCDSSVHSANPLARRHERV  59

Query  400   RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  579
             RL  +S    ++   + P + +     S P+WHRGFTRK RTPRN ++  K        E
Sbjct  60    RL-KTSPLKESSPDENFPNL-ESPVSVSLPSWHRGFTRKARTPRNGRKVSKSTEEEEEEE  117

Query  580   ESV-------NPVLPFVPEMGSDDDYNNNNEIDLFCQVPV----lldddlnallndgggd  726
             E         NP+   VPE+ SD++  + NE  L  +VP+    + +   +A  ND   +
Sbjct  118   EEEEEEVILKNPI-HLVPEILSDENSLDENEEQLLYRVPIFDPFVAELCTSATRNDQIEN  176

Query  727   dHMRGLEIPEF-----------------------LSSDVELAEFAADVETLLG-------  816
                     PEF                       L S++ELAEFAADVE+LLG       
Sbjct  177   VQTATETDPEFKLESKEMHKHDICNDDLNTFHGMLPSEMELAEFAADVESLLGKGLEDES  236

Query  817   -------------------------------DDDVGEDKATAAVKIEINGGDCTEALNW-  900
                                            +D+V  D  T +  I+ING      +++ 
Sbjct  237   FDMEGLGLLGGCNKEENSMECSMVSNEKVKIEDEVVMDTTTTSHDIDINGDTFEFKIDYD  296

Query  901   ---SFGEEQEVEQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWAS  1071
                +   E EV + VM   ++G D                +K ++LL+L+YE V++AWA 
Sbjct  297   SPININGEDEVGEVVMK--INGEDGVVGDGNYN-------EKKKILLNLDYESVLTAWAD  347

Query  1072  QGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYG-----SAMMMRRSDEGREARVSRYRE  1236
             Q  PWT+G RP  D N CWPD MG +    HPYG     + M+    D GREARVSRYRE
Sbjct  348   QRSPWTNGERPELDSNDCWPDCMG-NCGTIHPYGIMNGHTTMI----DRGREARVSRYRE  402

Query  1237  KRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLL  1380
             KRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRS+L       PNY L
Sbjct  403   KRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSNL------VPNYPL  444



>ref|XP_008374747.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Malus domestica]
Length=442

 Score =   266 bits (681),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 192/431 (45%), Positives = 233/431 (54%), Gaps = 80/431 (19%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +K ANA+ G T+RACDSCL KRARWFC ADDAFLCQ CD SVHSAN LASRH+RVRL  S
Sbjct  5     KKAANAMGGNTSRACDSCLVKRARWFCAADDAFLCQRCDASVHSANQLASRHERVRLQGS  64

Query  415   ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEE----  582
             S    A+        V    D + PAWH+GF RK RTPR+  +      G VA +E    
Sbjct  65    SFKANAS--------VQLIADQAAPAWHKGFKRKARTPRHNNKP-----GFVAKDEQEKV  111

Query  583   SVNPVLPFVPEMGSDD-----DYNNNNEIDLFCQVPV---------lldddlnallndgg  720
              ++P LPFVPE+G  +     D  N +   L  +VP+          +        N G 
Sbjct  112   GLHPPLPFVPEIGCQEANLMEDEENEDLEQLLYRVPIYDPFAAELCNISSSDQVGNNTGA  171

Query  721   gddHMRGLEIPE----------FLSSDVELAEFAADVETLLG---DDDVGEDKATAAV--  855
              D     +EI            FL SD+ELAEFAADVE LLG   D+D  + K    +  
Sbjct  172   IDLDAEEIEIRNTGNDLDNLGGFLRSDMELAEFAADVENLLGGGLDEDCSDIKGVLGLLD  231

Query  856   ------------KIEINGGDCTEALNWSFGEEQEVEQKVMM------------TMLSGFD  963
                          IE N       L+WS   +Q     V+M             +L G  
Sbjct  232   EGKEVKVEEEVEGIEFN----PSILDWSLYYDQSSAVPVLMGSEEDREEEEKVVLLMGA-  286

Query  964   essssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG  1143
             +SS  +     K+ V K+  + L L+YE VI+AWASQG  WT GTRP  + +  W D MG
Sbjct  287   QSSDEIGFMENKQIVMKRKNICLKLDYEAVITAWASQGSQWTTGTRPELNADEGWLDCMG  346

Query  1144  G-DHHHHHPYG-SAMMMRRS---DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRP  1308
                   H P+G SA  + R    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRP
Sbjct  347   MWPTEIHQPHGDSAGCVSRGKGDDPGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRP  406

Query  1309  RLKGRFVKRSS  1341
             R+KGRFVKR++
Sbjct  407   RMKGRFVKRTT  417



>ref|XP_008240273.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Prunus mume]
Length=480

 Score =   266 bits (680),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 192/465 (41%), Positives = 239/465 (51%), Gaps = 114/465 (25%)
 Frame = +1

Query  238   KTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtss  417
             K ANA+ G TARACDSCL KRARWFC ADDAFLCQ CD SVHSAN LASRH+RV+L    
Sbjct  5     KKANAMGGNTARACDSCLIKRARWFCAADDAFLCQRCDGSVHSANQLASRHERVKL----  60

Query  418   sstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKR---TKKQNSGGVAVEESV  588
                  A+     +      D SPPAWH+GFTRK RTPR+  +     K +   V    S+
Sbjct  61    ----QAASSKPNQSTLLAADQSPPAWHKGFTRKARTPRHNNKPPFMAKDDKEKV----SL  112

Query  589   NPVLPFVPEMGS------DDDYNNNNEIDLF-------------CQVPVlldddlnalln  711
             NP LPFVPE+G       DDD  N +   L              C +      ++ + +N
Sbjct  113   NPPLPFVPEIGCEEANYMDDDGENEDLEQLLYRVPIYDPFAAELCNMSSHEVGNITSAIN  172

Query  712   dgggddHM-RGL----------------------EIPEFLSSDVELAEFAADVETLLG--  816
                    M RG                        +P FL SD+ELAEFAADVE L+G  
Sbjct  173   LDDEVTEMGRGNHHEVGDDEEENNNNNYGGNDLDNLPGFLPSDMELAEFAADVENLIGGG  232

Query  817   --DDDVGEDKATAAV----KIEINGG--------DCTE-------------------ALN  897
               D+D G+ K    +    K+E +GG        D  E                    L+
Sbjct  233   LDDEDSGDIKGVLGLLDDSKLEGDGGVDVCMKNVDINEDRKAVKVEEEAEGMEFNPSMLD  292

Query  898   WSFGEE-----------QEVEQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNY  1044
             W+   E            E E+KV+  M +     SS   +    +++  K ++ L L+Y
Sbjct  293   WNSDYELRLSSSPLPMGGEEEEKVVFLMGA----QSSDEVALMDNKQMMMKRKICLRLDY  348

Query  1045  EEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG----GDHHHHHPYGSA---MMMRRSDE  1203
             E +I+AWA+QG PWT GTRP  +P+  W D MG       H  H +G +   +  R  D 
Sbjct  349   EAIITAWANQGSPWTTGTRPELNPDDGWLDCMGMWGSDQIHQSHGHGESAGCVGGRGDDR  408

Query  1204  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  1338
             GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  409   GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRT  453



>gb|KDP20116.1| hypothetical protein JCGZ_05885 [Jatropha curcas]
Length=431

 Score =   264 bits (674),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 183/455 (40%), Positives = 236/455 (52%), Gaps = 103/455 (23%)
 Frame = +1

Query  229   DQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLG  408
             ++RK ANA+SGKTARAC+ C  KRARWFC ADDAFLCQSCD SVHSAN LA RH+RVRL 
Sbjct  3     NERKAANALSGKTARACEGCSRKRARWFCAADDAFLCQSCDESVHSANQLARRHERVRL-  61

Query  409   tsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESV  588
                      S    P + ++      PAWH+GFTRK RTPR+   + K+           
Sbjct  62    --------ESSSFKPTVSNEYI----PAWHQGFTRKARTPRHNNNSNKKIFNN-------  102

Query  589   NPVLPFVPEMGSDDDYN----NNNEIDLFCQVPVlldddlnallndgggddHMRGLEIPE  756
             N  LP VPE+G++++ N    + +E     +VPV    +     +D   ++    + I  
Sbjct  103   NSNLPLVPEIGNEEEGNGIAADEDEDQFLYRVPVFDPFEAELCADDLYNEEEGNEIAIGN  162

Query  757   ----------------FLSSDVELAEFAADVETLLG----------DDDVG---------  831
                             +L SD++LAEFAADVE LLG          ++D+G         
Sbjct  163   DQERINMGTDDNLDNYYLPSDMDLAEFAADVENLLGAGLDDNSPDRNNDLGFLEYCNKKQ  222

Query  832   ---------------EDKATAAVKIE-----INGGDCT--EALN------WSFGEEQ---  918
                            +++    VK E     I  G C   +A +      WSF  +Q   
Sbjct  223   EQEESDYYSNNKFYFDEEKVVKVKNEQQMEEIVAGGCNLGQAFDQMGKEDWSFSYDQSSL  282

Query  919   -----EVEQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCP  1083
                  E E+KV +  ++     ++     S + +   K  + L LNYE VI+AWAS G P
Sbjct  283   VTGDEEEEEKVALPAVTN----TTVKVVSSDQHKKEMKRDVSLRLNYEAVITAWASHGSP  338

Query  1084  WTDGTRPHFDPNHCWPDFMGG--DHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLF  1257
             WT GTRP  +P+ CWPD +G      HHHPY           GREARV RY+EKRRTRLF
Sbjct  339   WTTGTRPELNPDDCWPDCLGTCPKDGHHHPYRGHNGGGNG--GREARVLRYKEKRRTRLF  396

Query  1258  SKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPP  1362
             SKKIRYEVRKLNAEKRPRL+GRFVKR+S      P
Sbjct  397   SKKIRYEVRKLNAEKRPRLQGRFVKRTSFMGATFP  431



>ref|XP_010094760.1| Zinc finger protein CONSTANS-LIKE 16 [Morus notabilis]
 gb|EXB56925.1| Zinc finger protein CONSTANS-LIKE 16 [Morus notabilis]
Length=444

 Score =   263 bits (673),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 187/425 (44%), Positives = 233/425 (55%), Gaps = 65/425 (15%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +KTANA++GKTARACDSCL KRARWFC ADDAFLCQ+CD SVHSAN LASRH+RVRL TS
Sbjct  5     KKTANAMAGKTARACDSCLRKRARWFCAADDAFLCQACDTSVHSANQLASRHERVRLQTS  64

Query  415   ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNP  594
             S                  DD+  PAWHRGFTRK RTPR+  +   Q +    VE+ ++ 
Sbjct  65    SHKGNYNHSHHD-----LHDDECSPAWHRGFTRKARTPRHNNKPAAQQAKYDDVEKVLSA  119

Query  595   V------LPFVPEMGSDDD---YNNNNEIDLFCQVPVlldddlnallndgggddHMRGL-  744
                    LPFVPEM ++++    + N E  L  +VPV          +  G DD   G+ 
Sbjct  120   ANHRHDPLPFVPEMSNEEESPITDENEEEQLLYRVPVFDPFAAELCNSINGDDDERAGMT  179

Query  745   ------------------------------EIPEFLSSDVELAEFAADVETLLGDDDVGE  834
                                           EI  FL S++ELAEFAADVE+LLG      
Sbjct  180   TTEKGKELGQQDYGKSVISTSTAHEAEFDHEIHGFLPSELELAEFAADVESLLGGGLEDH  239

Query  835   DKATAAVK-IEINGGDCTEALNWSFGEEQEV-----EQKVMMTMLSGFDessssmesgsc  996
             D++   +  +E+    C E  ++    + +V     EQ+V +       E+    E+ + 
Sbjct  240   DQSCQDINGLELELLGCKEEDDFDIDIDVDVCINPSEQRVKVKEEK---ETCVFHETANS  296

Query  997   keeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFM-----------G  1143
                  KK  ++L LNYE VI+AWASQG PWT G RP F+P+  WPD +            
Sbjct  297   PMVQTKKRDIILRLNYEAVIAAWASQGSPWTTGNRPDFNPDDGWPDCLDVCHTDHVGPAN  356

Query  1144  GDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGR  1323
             GD          +     D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGR
Sbjct  357   GDSSRGGLGLGGVGGSVGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  416

Query  1324  FVKRS  1338
             FVKR+
Sbjct  417   FVKRT  421



>ref|XP_004300528.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Fragaria 
vesca subsp. vesca]
Length=457

 Score =   263 bits (672),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 182/445 (41%), Positives = 229/445 (51%), Gaps = 91/445 (20%)
 Frame = +1

Query  232   QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  411
             ++K ANA+ G TARACDSCL KRARWFC ADDAFLCQ CD SVHSANLLASRH+RVRL +
Sbjct  4     EKKAANAMGGNTARACDSCLVKRARWFCGADDAFLCQRCDASVHSANLLASRHERVRLKS  63

Query  412   sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVN  591
             SS   +    +  P           PAW +G TRK RTPR     K   SG     +++ 
Sbjct  64    SSHKVSDHLAIEPP----------VPAWQQGVTRKARTPRGHGNHK---SGKDEAGKALG  110

Query  592   PVLPFVPEMGSD--------DDYNNNNEIDLFCQVPVlldddlnallndgggddHMRGL-  744
               +PFVPE+GS+        DD+ + +   L  +VP+    +     N    D H   + 
Sbjct  111   QSMPFVPEIGSEEVDYCCLEDDHESEDLEQLLYRVPIFDPFEGELCNNMTNIDHHKVKMG  170

Query  745   ---------------EIPEF----LSSDVELAEFAADVETLLG-----------------  816
                            E+  F    L SD+ELAEFAADVE +LG                 
Sbjct  171   HEDYGARTSSTSPCDELDNFQGLILPSDMELAEFAADVENMLGKGLDEDCSDIKGLGLLD  230

Query  817   ----DDDVG-------EDKATAAVKIEINGGDCT---EALNWSFGEEQEVEQKVMMTMLS  954
                 ++D G       E++    ++ E  G +C      L+W+     + + +    +L 
Sbjct  231   ETKEEEDYGMDVCIGIEERKLVKIEEEDQGMECEFNPSMLDWNL----DYDDESAAVLLG  286

Query  955   GFDessssmesgsckeeVAKKSR--MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCW  1128
             G   +    E        A+K R  + L LN+E VISAWAS+G PWT G +P  +P+  W
Sbjct  287   GSTSTDQEEEDKVAVLMEAEKKRKKICLRLNHEAVISAWASKGSPWTTGVKPELNPDDGW  346

Query  1129  PDFMG----------GDHHHHHPYGSAMMMRRSDE---GREARVSRYREKRRTRLFSKKI  1269
             PD MG            H         M MR   E   GREARVSRYREKRRTRLFSKKI
Sbjct  347   PDCMGVWGTNQIMNLQGHGDSSAAAHRMGMRGDTEQRPGREARVSRYREKRRTRLFSKKI  406

Query  1270  RYEVRKLNAEKRPRLKGRFVKRSSL  1344
             RYEVRKLNAEKRPR+KGRFVKR+S 
Sbjct  407   RYEVRKLNAEKRPRMKGRFVKRTSF  431



>ref|XP_009360161.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Pyrus x 
bretschneideri]
Length=447

 Score =   262 bits (670),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 179/439 (41%), Positives = 234/439 (53%), Gaps = 91/439 (21%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +K ANA+ G TARACDSCL KRARWFC ADDAFLCQ CD SVHSAN LASRH+RVRL   
Sbjct  5     KKAANAMGGNTARACDSCLVKRARWFCAADDAFLCQRCDASVHSANQLASRHERVRL---  61

Query  415   ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEE----  582
                    S   + + +    D + PAWHRG  RK RTPR+ K+       G  ++E    
Sbjct  62    -----QGSSFKANEPMQLTADQATPAWHRGVKRKARTPRHNKKP------GFPIKEEQEK  110

Query  583   -SVNPVLPFVPEMGSDD-----DYNNNNEIDLFCQVPV--------------lldddlna  702
               ++P LPFVPE+G ++     D  N +   L  +VP+                 ++   
Sbjct  111   VGLHPPLPFVPEIGCEEANLMEDEENEDLEQLLYRVPIYDPFAAKLCNISSTDQVENNTD  170

Query  703   llndgggddHMRGL------------EIPEFLSSDVELAEFAADVETLLG---DDDVGED  837
              +N    +  +R +            ++  FL +++ELAEFAADVE LLG   D+D  + 
Sbjct  171   AINLDDEEIEIRNMGDNHEGVQDDLDKLGGFLPTEMELAEFAADVENLLGGGLDEDCSDI  230

Query  838   KATAAV--------------KIEINGGDCTEALNWSF-------------GEEQEVEQKV  936
             K    +               +E N       L+W+               E+ E E+K 
Sbjct  231   KGVLGLLDDGKEVKVEEEVEGMEFN----PSILDWNLDYDKSSAVPVQMGNEDNEEEEK-  285

Query  937   MMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDP  1116
              + +L+G   S       +   E+ K+ ++ L L+YE VI+AWASQG PWT+GTRP  +P
Sbjct  286   -LVLLTGAQSSDEMAFMENKHMEM-KRKKICLRLDYETVITAWASQGSPWTNGTRPELNP  343

Query  1117  NHCWPDFMG----GDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVR  1284
             +  W D MG         H      +  R  D GREARVSRYREKRRTRLFSKKIRYEVR
Sbjct  344   DDGWLDCMGMWPTEIPQPHGDTAGCVSGRGDDRGREARVSRYREKRRTRLFSKKIRYEVR  403

Query  1285  KLNAEKRPRLKGRFVKRSS  1341
             KLNAEKRPR+KGRFVKR++
Sbjct  404   KLNAEKRPRMKGRFVKRTT  422



>emb|CDP00619.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   261 bits (667),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 187/459 (41%), Positives = 235/459 (51%), Gaps = 93/459 (20%)
 Frame = +1

Query  220   MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  399
             M SD RK ANA+ GKTARACD+C+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RV
Sbjct  1     MVSD-RKLANAMGGKTARACDNCIRKRARWYCAADDAFLCQNCDASVHSANPLARRHERV  59

Query  400   RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  579
             RL TSS   +    L            S P+WHRGFT+K RTPR+ K  K ++      +
Sbjct  60    RLKTSSLKPSKELSLEI----------SVPSWHRGFTKKARTPRSGKHAKSKSD-----Q  104

Query  580   ESVNPVLPFVPEMGSDD--DYNNNNEIDLFCQVPVlldddlnallndgggddHMR-----  738
             E     L  VPE+ SD+    + +NE  L  +VP+          ++   +         
Sbjct  105   EPARSPLHLVPEICSDEIETSHEDNEEQLLYRVPIFDPFVAELRTSENSNEAATNMGNDG  164

Query  739   ------------------GLEIPEF---LSSDVELAEFAADVETLLG---DDD-------  825
                               G  I +F   L S++ELAEFAADVE+LLG   DD+       
Sbjct  165   EAADAVGVDESKGTVYDCGNHINQFHGPLPSEMELAEFAADVESLLGKGLDDESFDIEGL  224

Query  826   ---------------VG------EDKATAAV---------KIEINGGDCTEALNWSFGEE  915
                            +G      ED+  A V         +I+++ GD  E    SF  +
Sbjct  225   GLSDCKEADLVDNNSLGRGRVKVEDEGEAEVAMGNNQIDGEIDMSRGD-HEPFELSFDYD  283

Query  916   -----QEVEQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGC  1080
                  +E + K  +       +   S +       +    ++LLSL+YE VISAWA Q  
Sbjct  284   SPMTCEEEDNKAGVERAIALKDHLKSEDCKVEDAGINTNKKILLSLDYEGVISAWADQRS  343

Query  1081  PWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRR---SDEGREARVSRYREKRRTR  1251
             PWT G RP  D N CWPD +G     H+ YG   M       D GREARVSRYREKRRTR
Sbjct  344   PWTTGERPELDSNDCWPDCLGTCGTIHNLYGEVGMFGHPAMMDGGREARVSRYREKRRTR  403

Query  1252  LFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  1368
             LF KKIRYEVRKLNAEKRPR+KGRFVKR++       FP
Sbjct  404   LFCKKIRYEVRKLNAEKRPRMKGRFVKRATFSAAAAAFP  442



>ref|XP_006367940.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Solanum 
tuberosum]
Length=428

 Score =   260 bits (665),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 183/430 (43%), Positives = 236/430 (55%), Gaps = 56/430 (13%)
 Frame = +1

Query  226   SDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  405
             S ++K ANA+  KTARACD+C+ KRARW+C ADDAFLCQSCD SVHSAN LA RH+RVRL
Sbjct  2     SSEKKLANAVGAKTARACDNCIRKRARWYCAADDAFLCQSCDSSVHSANPLARRHERVRL  61

Query  406   Gtsssstaaas-llssPKIVddddddSPPAWHRGFTRKPRTPR----NAKRTKKQNSGGV  570
              TSS  ++     L S         +S P+WHRGFTRK RTPR    +AKR K       
Sbjct  62    KTSSIKSSDEFPNLGSTVSGSGSGSESVPSWHRGFTRKARTPRHGNKHAKRVKSTEEEEE  121

Query  571   AVEESVNPVLPFVPEMGSDDD-YNNNNEIDLFCQVPV----------lldddlnallndg  717
               EE  NP+   VPE+ SD++ ++ N E  L  +VP+            +   +  ++  
Sbjct  122   DEEEMKNPIQLVVPEILSDENSHDENEEEQLLYRVPIFDPFVEDGSNYGNKYSSNKVDFN  181

Query  718   ggddHMRGLEIPEFLSSDVELAEFAADVETLLG---DDDVG----------EDKATAAVK  858
                +  +GL  P    S++ELA+FAADVE LLG   DD+            E      VK
Sbjct  182   QDMNTFQGLLAP----SEMELADFAADVECLLGKGLDDEESFNYMEGLGFLEKHDEKLVK  237

Query  859   IE------------INGGDCTEALNWSF---GEEQEVEQKVMMTMLSGFDessssmesgs  993
             +E             N  D  +     F   GE  E++      ++S  DE         
Sbjct  238   VEDEGEMGFVNMVSTNNHDINQVDYSDFDMVGETFELKFDYDSQVMSNLDEDKKVEFGEI  297

Query  994   ckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYG  1173
               +     ++++L+L+YE V+ +WA +  PWT G RP  D N CWP  M G+    H YG
Sbjct  298   NYDSGKNNNKIMLNLDYESVLKSWADKRSPWTMGERPEVDFNDCWPVCM-GNCGKIHSYG  356

Query  1174  SAMMMRRS-----DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  1338
                ++ R      DEGREARV RY+EKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  357   DIGIVNRHGGGGVDEGREARVLRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRT  416

Query  1339  SLFQPPPPFP  1368
             +    P PFP
Sbjct  417   NF--APTPFP  424



>gb|KHG17662.1| Zinc finger CONSTANS-LIKE 16 -like protein [Gossypium arboreum]
Length=417

 Score =   259 bits (662),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 189/441 (43%), Positives = 227/441 (51%), Gaps = 85/441 (19%)
 Frame = +1

Query  244   ANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtssss  423
             ANA+  KT RACDSC+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL T+S  
Sbjct  2     ANAVGAKTVRACDSCIKKRARWYCAADDAFLCQACDSSVHSANPLARRHKRVRLKTASVK  61

Query  424   taaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLP  603
             ++   L               P W RGFTRK RT R  K +  +      ++   NPV P
Sbjct  62    SSGDELPLE---------SFSPTWDRGFTRKARTRRPVKGSIHRK----LLKAKNNPV-P  107

Query  604   FVPEMGSDDDYNNNNEI-DLFCQVPV---------lldddlnallndgggddHMRGLEIP  753
              VPE+G D+ +N  NE   L  +VP+                A ++  G +      E  
Sbjct  108   VVPEVGIDELFNEENEEEQLLYRVPIFDPFVAELCTSTTSTEAAVSAVGNEAETTATESK  167

Query  754   EFLSSDVE-----------LAEFAADVETLLG-------------------DDDVGE-DK  840
              FL  DV+           LAEFAADVE+LLG                   D D+ E   
Sbjct  168   AFLGQDVDGSHGLFPSEMDLAEFAADVESLLGKGLENESFTMVELGLTGSKDKDLREYSY  227

Query  841   ATAAVKIE----INGGDCTEALNWSF---------GEEQEVEQKVMMTMLSGFDessssm  981
                 VKIE      GG   E    SF         G ++ V+++V M         S   
Sbjct  228   GNGQVKIEDEESFEGGMGREPFELSFNYDSPPSCGGVDELVKEEVAM--------KSKED  279

Query  982   esgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFM-GGDHHH  1158
                       KK + LLSL+YE VI+AWA+QG PWT G +P  DP+ CWPD M  G    
Sbjct  280   GECQESTAKKKKRKTLLSLDYEAVITAWATQGSPWTSGGKPDLDPDECWPDCMRNGGTEV  339

Query  1159  HHPYGSAMMM-----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGR  1323
                Y   + M        D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGR
Sbjct  340   QQSYSGLIGMGGQQQAMGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  399

Query  1324  FVKRSSLFQPPPPFPNYLLNR  1386
             FVKR+S F   P FP  LLN+
Sbjct  400   FVKRAS-FLAGPAFP--LLNK  417



>ref|XP_009777706.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
sylvestris]
Length=447

 Score =   258 bits (658),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 188/466 (40%), Positives = 241/466 (52%), Gaps = 107/466 (23%)
 Frame = +1

Query  232   QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  411
             +RK A+A+ GKT RACD+C+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL  
Sbjct  4     ERKLASAMGGKTVRACDNCIRKRARWYCPADDAFLCQNCDSSVHSANPLARRHERVRL-K  62

Query  412   sssstaaasllssPKI---VddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEE  582
             +SS   ++   + P +   V      S P+WHRGFTRK RTPRN ++  K        E 
Sbjct  63    TSSLKESSPDENFPNLESPVSVSVSVSVPSWHRGFTRKARTPRNGRKVSKSTEEEEEEEV  122

Query  583   SVNPVLPFVPEMGSDDDYNNNNEIDLFCQVPVll--dddlnallndgggddHMRGLEIPE  756
              +   +  VPE+ SD++  + NE  L  +VP+      +L          ++++     E
Sbjct  123   ILKNPIHLVPEILSDENSLDENEEQLLYRVPIFDPFVAELYTSATRNDRMENVQTAADSE  182

Query  757   F-------------------------LSSDVELAEFAADVETLLGD--------------  819
             F                         L S++ELAEFAADVE LLG               
Sbjct  183   FKPESKETLQHDDNICNGDLNRFHGMLPSEMELAEFAADVENLLGKGLDDESFDMEGLGL  242

Query  820   ------------------------------DDVGEDKATAAVKIEINGG------DCTEA  891
                                           D+V  D  T    I+ING       D    
Sbjct  243   LGGCNKEENSMECSMVSIHEKVKIEDEGEGDEVVMDTTTTNHDIDINGDTFEFKFDYDSP  302

Query  892   LNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWAS  1071
             +N + G+E  V + VM   ++G D   +            +K ++LL+L+YE V++AWA 
Sbjct  303   MNINGGDE--VGEVVMK--INGEDGDGN----------YNEKKKILLNLDYESVLTAWAD  348

Query  1072  QGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRS---DEGREARVSRYREKR  1242
             Q  PWT+G RP  D N CWPD MG +    HPYG  +M   +   D GREARVSRYREKR
Sbjct  349   QRSPWTNGERPELDSNDCWPDCMG-NCGTIHPYG--IMNGHTTIIDRGREARVSRYREKR  405

Query  1243  RTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLL  1380
             RTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRS+L       PNY L
Sbjct  406   RTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSNL------VPNYPL  445



>gb|AFX73409.1| constans-like protein 5 [Gossypium hirsutum]
Length=423

 Score =   256 bits (655),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 190/450 (42%), Positives = 233/450 (52%), Gaps = 87/450 (19%)
 Frame = +1

Query  217   MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  396
             M+SS  +K ANA+  KT RACDSC+  RARW+C ADDAFLCQ+CD SVHSAN LA RH+R
Sbjct  1     MISS--KKMANAVGAKTVRACDSCIRGRARWYCAADDAFLCQACDSSVHSANPLARRHKR  58

Query  397   VRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAV  576
             VRL T+S  ++   L               P+W RGFTRK RT R  K +  +      +
Sbjct  59    VRLKTASVKSSGDELPLE---------SFSPSWDRGFTRKARTRRPVKGSIHRK----PL  105

Query  577   EESVNPVLPFVPEMGSDDDYNNNNEI-DLFCQVPV---------lldddlnallndgggd  726
             +   NPV P VPE+G D+ +N  NE   L  +VP+                A ++  G +
Sbjct  106   KAKNNPV-PVVPEVGIDEIFNEENEEEQLLYRVPIFDPFVAELCTSTTSTEAAVSAVGNE  164

Query  727   dHMRGLEIPEFLSSDVE-----------LAEFAADVETLLG-------------------  816
                   E   F+  DV+           LAEFAADVE+LLG                   
Sbjct  165   AETTATESKAFMGQDVDGSHGLFPSEMDLAEFAADVESLLGKGLENESFTMVELGLTGSK  224

Query  817   DDDVGE-DKATAAVKIE----INGGDCTEALNWSF---------GEEQEVEQKVMMTMLS  954
             D D+ E       VKIE       G   E   +SF         G ++ V+++V M    
Sbjct  225   DKDLREYSYGNGQVKIEDEESFEDGMGREPFEFSFNYDSPPSCGGVDELVKEEVAM----  280

Query  955   GFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPD  1134
                  S             KK + LLSL+YE VI+AWA+QG PWT G +P  DP+ CWPD
Sbjct  281   ----KSKEDGECQENTAKKKKRKTLLSLDYEAVITAWATQGSPWTSGGKPDLDPDECWPD  336

Query  1135  FM-GGDHHHHHPYGSAMMM-----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNA  1296
              M  G       Y   + M        D GREARVSRYREKRRTRLFSKKIRYEVRKLNA
Sbjct  337   CMRNGGTEVQQSYSGLIGMGGQQQAMGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNA  396

Query  1297  EKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  1386
             EKRPR+KGRFVKR+S F   P FP  LLN+
Sbjct  397   EKRPRMKGRFVKRAS-FLAGPAFP--LLNK  423



>gb|AEF12205.1| CONSTANS-like zinc finger protein [Glycine max]
Length=430

 Score =   256 bits (655),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 179/437 (41%), Positives = 242/437 (55%), Gaps = 68/437 (16%)
 Frame = +1

Query  226   SDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  405
             +++ K A+A+  +TARAC+SCL  RARW+C ADDAFLC  CD  VHSAN LASRH+RV+L
Sbjct  2     TNEMKEASALGARTARACESCLKVRARWYCAADDAFLCHGCDNMVHSANQLASRHERVKL  61

Query  406   GtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPR-NAKRTKKQNS-------  561
                 ++++  +   +PK+          AWH GFTRK RTPR N K +  Q         
Sbjct  62    ---QTASSKVNYSVTPKV----------AWHSGFTRKARTPRSNNKHSSLQQQQQKPLHE  108

Query  562   -----GGVAVEESVNPVLPFVPEMGSDDD-YNNNNEIDLFCQVPVlldddlnallndggg  723
                    V    ++  V P VPE+GS++   N+  E  L C+VPV  D +L ++ N+   
Sbjct  109   EQGEEEEVFFNNTIISVQPLVPELGSEEPLLNDETEEQLLCRVPV-FDAELCSIYNEVKD  167

Query  724   ddHMRGLEIP--------EFLSSDVELAEFAADVETLLG---DDDVGEDKATAAVKIEIN  870
             + ++ G E+         EFL +D++LAEF+ADVE+LLG   D+D    K +  V ++  
Sbjct  168   EVNVAGGEVAFDLENFSSEFLPTDMDLAEFSADVESLLGNGVDEDSPVKKGSELVLLDCK  227

Query  871   --GGDCTEALNWSFGEEQEVEQKV---------------------MMTMLSGFDessssm  981
               G D  +A     G  ++   KV                     M +    ++ + S  
Sbjct  228   EEGDDEMDACVNGIGANKDAMVKVKDEEELDADDDTACHLDSILDMNSEAFNWNIAESES  287

Query  982   esgsckeeVAK----KSRMLLSLNYEEVISAWASQGCPWTDGTRPH-FDPNHCWPDFMGG  1146
              + + ++EV+K    K  + L LNYEEVI+AWASQG PWT GT P  F+ + CW D    
Sbjct  288   PAQAQEDEVSKVGTNKKDIFLRLNYEEVITAWASQGSPWTTGTPPKFFNSDDCWLDLGSN  347

Query  1147  DHHHHHPYGSAMMMR-RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGR  1323
                    YG    +R  +D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGR
Sbjct  348   GGGVQCYYGEVRSLRVHADGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGR  407

Query  1324  FVKRSSLFQPPPPFPNY  1374
             FVK   L +P     NY
Sbjct  408   FVKSVPLLEPLLCQLNY  424



>gb|AHI45077.1| COL domain class transcription factor [Boehmeria nivea]
Length=453

 Score =   257 bits (657),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 188/445 (42%), Positives = 238/445 (53%), Gaps = 71/445 (16%)
 Frame = +1

Query  220   MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  399
             M  ++ K  +A+ GKTARACDSCL KRARWFC ADDAFLCQ+CD SVH+AN LAS H+RV
Sbjct  1     MICEKIKAVSAVGGKTARACDSCLRKRARWFCAADDAFLCQACDTSVHAANRLASSHERV  60

Query  400   RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTK--------KQ  555
             RL TSS   + +      +      D+S P W RG TRK RTPR+  +          K 
Sbjct  61    RLLTSSFKGSTSVCGEDSQ------DESSPKWLRGLTRKARTPRHNSKAAPAALQLAAKD  114

Query  556   NSGGVAVEESVNPV--LPFVPEMGSDDDYN-----NNNEIDLFCQVPVll----------  684
                 V V++++N V     VPEM + +D +      + E +L  +VPVL           
Sbjct  115   GGDDVFVDKALNLVDQPSIVPEMSNGEDRSPIGDRRDEEDELLYRVPVLDPFAAGLCMPI  174

Query  685   --dddlnallndgggddHMRGLEIPEFLSSDVELAEFAADVETLLG--------------  816
               + +L         DDH    +I  FL +++ELAEFAADVE+LLG              
Sbjct  175   CDEHELQLGQKSDDDDDHELNHQIQGFLQTELELAEFAADVESLLGVAGIEEDQSCIDHD  234

Query  817   ----------DDDVGEDKATAAVKIEIN-GGDCTEALNWSFGEEQEVEQKVMMTMLSGF-  960
                       D D  E+     + ++++ GG C    N +   EQ V+ +   ++L GF 
Sbjct  235   VKGFGLMDDLDQDRREEDGDFDIDVDVDLGGVCA---NTAAKSEQRVKVEEDESVL-GFQ  290

Query  961   ---DessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWP  1131
                +  S      +      KK  +LL LNYE VI+AWASQG PWT G RP   P H WP
Sbjct  291   VNPNFGSELSSPATTPATEMKKRDILLRLNYEAVIAAWASQGSPWTTGIRPEVKPEHGWP  350

Query  1132  DFMGGDH----HHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAE  1299
             D M   H      +  +   +   R D GREARVSRYREKRRTRLFSKKIRYEVRKLNAE
Sbjct  351   DCMDMCHPDFSQINGDWRGLVGSGRRDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAE  410

Query  1300  KRPRLKGRFVKRSSLFQ-PPPPFPN  1371
             KRPR+KGRFVKR+S        FPN
Sbjct  411   KRPRMKGRFVKRTSFMGINNSTFPN  435



>gb|AHI45078.1| COL domain class transcription factor [Boehmeria nivea]
Length=458

 Score =   257 bits (657),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 182/462 (39%), Positives = 241/462 (52%), Gaps = 95/462 (21%)
 Frame = +1

Query  220   MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  399
             MS  +   +  +  KTARACDSC+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH RV
Sbjct  1     MSCKKAVPSGVVGYKTARACDSCVKKRARWYCAADDAFLCQACDNSVHSANSLARRHTRV  60

Query  400   RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  579
             RL T+SSS +++S  S  K          P WHRGFTRK RTPR+  ++K  +     VE
Sbjct  61    RLKTASSSPSSSSSWSRDKPA--------PTWHRGFTRKARTPRSNGKSKTNSDHVPHVE  112

Query  580   ESVNPVLPFVPEMGSDDDYNNNNEI---DLFCQVPV--------------------lldd  690
              S +P+ P VPE+  D+    ++E     L  +VP+                      + 
Sbjct  113   ASRDPMFPVVPEIFGDETTTTSHEESDEQLLYRVPILDPLVAELCSAAAATTTSGNSSEA  172

Query  691   dlnallndgggddHMRGLEIPE-FLSSDVELAEFAADVETL---------------LGDD  822
                         ++  G  I + FL ++++LAEFAADVE+L               LG  
Sbjct  173   VAINESKVVSASENCEGDMIAQGFLPTEMDLAEFAADVESLLGRGLENECDFGIEGLGFV  232

Query  823   DVGEDKATAAVKIEI------------------NGGDC------------TEALNWSFGE  912
             D  E + + + ++++                  N   C             E    +F +
Sbjct  233   DCEEKEFSGSGRVKVEEDDEEEEEDQEQEAKHGNFKGCWAESSMEMDMMRPEPFELNFED  292

Query  913   ---------EQEVEQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAW  1065
                      E E +QKV +++ +  + S +       K+   KK ++LL LNYE VI+ W
Sbjct  293   YDESPASCGENEEDQKVDVSLAAQHEVSKAKNGEEDVKKSKKKKKKILLRLNYEAVITEW  352

Query  1066  ASQGCPWTDGTRPHFDPNHCWPDFMGGD----HHHHHPYGSAMMM-----RRSDEGREAR  1218
             ASQG PWT G RP FDP+ CWP+ MG      HHHHH    + ++       +D GREAR
Sbjct  353   ASQGSPWTTGDRPDFDPDTCWPNCMGTFDTQLHHHHHYMDLSGLVGGNPAALADGGREAR  412

Query  1219  VSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
             VSRYREKRR RLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S 
Sbjct  413   VSRYREKRRNRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF  454



>ref|NP_001278940.1| zinc finger protein CONSTANS-LIKE 16-like [Glycine max]
 gb|AEF12204.1| CONSTANS-like zinc finger protein [Glycine max]
Length=419

 Score =   255 bits (652),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 180/454 (40%), Positives = 231/454 (51%), Gaps = 100/454 (22%)
 Frame = +1

Query  220   MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  399
             MSS  +  ANA+  KTARACDSC++KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RV
Sbjct  1     MSSATKNAANAVGAKTARACDSCITKRARWYCAADDAFLCQACDSSVHSANPLARRHERV  60

Query  400   RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  579
             RL T+S  +                   PP WH   T+KPRTPR+ K ++  N       
Sbjct  61    RLKTASYKSTDE--------QQQQQQQQPPTWH---TKKPRTPRHGKHSRNNN-------  102

Query  580   ESVNPVLPF--VPEMGSDD-DYNNNNEIDLFCQVPVl--------------ldddlnall  708
                    PF  VPE GS++ + ++ NE  L  +VP+                        
Sbjct  103   -------PFHLVPEEGSEEANSHDENEEQLLYRVPIFDPFVAELCGTNSSPSPVTSTDQG  155

Query  709   ndgggddHMRGLEIPEF-------------LSSDVELAEFAADVETLLG----DDDVG--  831
                  +   +G +   F             L SD ELAEFAADVE+LLG    ++ VG  
Sbjct  156   VVAAAEVEYKGFQSNGFCSNSSEMENLHGMLPSDAELAEFAADVESLLGRGLENECVGME  215

Query  832   ------------------------EDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVM  939
                                     E+     +++++  G   ++   SF  E   E KV 
Sbjct  216   ELGLVDAKEEECSVGSGKVKMEDQEESPLVEMEMDMVVGRDDQSFELSFDYETCEEVKVC  275

Query  940   MTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN  1119
                L         + +    ++  KK+++ L L+YE VI AWASQ  PWT   +P+ DP+
Sbjct  276   DLGLGN------ELGAKKENDDEVKKNKISLQLDYEAVIIAWASQKSPWTTADKPNLDPD  329

Query  1120  HCWPDFMGG-DHHHHHPYGS----AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVR  1284
              CW   MG  +  +HHP G      +     D GREARVSRYREKRRTRLFSKKIRYEVR
Sbjct  330   ECWKQCMGSCETAYHHPCGEMGGFGIHPVIIDGGREARVSRYREKRRTRLFSKKIRYEVR  389

Query  1285  KLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  1386
             KLNAEKRPR+KGRFVKR+S    PP FP  LLN+
Sbjct  390   KLNAEKRPRMKGRFVKRASF--APPTFP--LLNK  419



>ref|XP_009356747.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Pyrus x 
bretschneideri]
Length=453

 Score =   256 bits (654),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 175/449 (39%), Positives = 233/449 (52%), Gaps = 89/449 (20%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +K A+A+ GKTARACDSC+ KRARW+C ADDAFLC++CD  VHSAN LA RH+RV L   
Sbjct  5     KKVAHAVGGKTARACDSCIKKRARWYCAADDAFLCEACDSDVHSANQLARRHERVLL---  61

Query  415   ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNP  594
              ++++        +        + P+WHRGFTRKPRTPR  K            +E +  
Sbjct  62    KTASSLKPSNKDDRTTAVSKTSAAPSWHRGFTRKPRTPRGGKSMTHHGKS----KEGIRN  117

Query  595   VLPFVPEMGSDDD--YNNNNEID--LFCQVPV---------lldddlnallndgggddHM  735
             + P VPE+G DD+  Y+  NE D  L  +VP+             + +         +++
Sbjct  118   LFPQVPEVGGDDNNSYDEENEEDQQLLYRVPIFDPSVAELCSNSGNSSEDAAANYEANNL  177

Query  736   RGLE------------IPE-------FLSSDVELAEFAADVETLLG----DD--------  822
               +             +P         L SD++LAEFAADV++LLG    DD        
Sbjct  178   STVSDNVGSQSKAVSSLPNCNGHDGFLLPSDMDLAEFAADVDSLLGRGLNDDQCIGMEGL  237

Query  823   ---DVGEDKATAAVKIE----INGGDCTEALNWSFGEEQ---------------------  918
                D  E ++   VK+E     +G D  + +    GE +                     
Sbjct  238   GLRDCKEKESKGRVKLEEDDDQDGIDGVDFMGCQLGESEIDMMKEPFVLNFEDYDDSPAS  297

Query  919   --EVEQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTD  1092
               E + K+++ + S   E     E+     + +KK + +L L+YE VI+AW   G PWT 
Sbjct  298   CGEQDDKMIVGIDSNCTEDHEHEEADEDAIDNSKKRKTILRLDYEAVITAW--DGSPWTS  355

Query  1093  GTRPHFDPNHCWPDFMG-GDHHHHHPYGS----AMMMRRSDEGREARVSRYREKRRTRLF  1257
             G RP FD + C PD+MG      H+PYG      +     D GREARVSRYREKRRTRLF
Sbjct  356   GDRPDFD-SECLPDYMGVCGPGLHYPYGDLNGIGVHPAMVDGGREARVSRYREKRRTRLF  414

Query  1258  SKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
             SKKIRYEVRKLNAEKRPR+KGRFVKRSS 
Sbjct  415   SKKIRYEVRKLNAEKRPRMKGRFVKRSSF  443



>ref|XP_010031966.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Eucalyptus 
grandis]
 gb|KCW83853.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
 gb|KCW83854.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
 gb|KCW83855.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
 gb|KCW83856.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
Length=461

 Score =   255 bits (652),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 190/467 (41%), Positives = 244/467 (52%), Gaps = 104/467 (22%)
 Frame = +1

Query  232   QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  411
             +RK A A   KTARACDSCL +RARW+C ADDAFLCQ CD SVHSAN LA RH+RVRLGT
Sbjct  4     ERKAAKAFGAKTARACDSCLRRRARWYCTADDAFLCQGCDSSVHSANQLARRHERVRLGT  63

Query  412   sssstaaasllssPKIVddd-----dddSPPAWHRGFTRKPRTPRNAKRT--KKQNSGGV  570
             +SS ++        K+         D+ + PAWH GFTRK RTPR +K+   + Q     
Sbjct  64    ASSLSSRIGCGGGAKLPSSAPPQFVDNSAAPAWHGGFTRKARTPRISKKILLRSQARNNH  123

Query  571   AVEESVNPV----------LPFVPEMGSD------DDYNNNNEIDLFCQVPVlldddlna  702
               ++ V+ +             VPE+G+D      ++YN  +E     +VPV        
Sbjct  124   CEDDKVSKLNLTRDDNFIDHNLVPELGNDLGGSPNENYNEEDEEQFLYRVPVFNPLASEM  183

Query  703   llndgggddHMRG--LEIPEF-LSSDVELAEFAADVETLLGDDDVG---EDKA-------  843
             + ++      +    L    F L SD++LAEFAADVE LL +D+ G   ED A       
Sbjct  184   IGDEMADLLRVGDDVLRDGSFDLPSDMDLAEFAADVENLLSNDNEGGTEEDFACDVKDLG  243

Query  844   ------------------------TAAVKIE--INGG--DC-----------TEALNWSF  906
                                        VK+E  + GG  DC            + ++W F
Sbjct  244   VLLECKEEGHHEEGVIGVCFDRRDQGVVKVEGLVGGGALDCHMEIGFDATGAGDDVDWDF  303

Query  907   G------------EEQEVEQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEE  1050
                          EE+E E+  M T++SG             +  + KK +MLL LNYE 
Sbjct  304   DFYNDDHVQSLGIEEKEDEENKMRTVVSG---------DAEEQATMKKKRKMLLRLNYEG  354

Query  1051  VISAWASQGCPWTDGTRPHFDPNHCWPDF-MGGDHH---HHHPYGSAMMMRR----SDEG  1206
             V++AWASQG PWT G RP F+ +  WP+  MG   H   +H P+  AM +R      D G
Sbjct  355   VMAAWASQGSPWTTGDRPDFELDEGWPNSNMGTASHSLKYHLPFAEAMGLRAHVGAEDGG  414

Query  1207  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  1347
             REARVSRYREKRRTR+FSKKIRY+VRKLNAEKRPR+KGRFVKR S  
Sbjct  415   REARVSRYREKRRTRMFSKKIRYQVRKLNAEKRPRMKGRFVKRMSFI  461



>gb|KHN11420.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=417

 Score =   254 bits (648),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 180/453 (40%), Positives = 230/453 (51%), Gaps = 100/453 (22%)
 Frame = +1

Query  220   MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  399
             MSS  +  ANA+ GKTARACD C++KRARW+C ADDAFLCQ+CD SVH AN LA RH+RV
Sbjct  1     MSSATKNAANAVGGKTARACDGCITKRARWYCAADDAFLCQACDSSVHLANPLARRHERV  60

Query  400   RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  579
             RL              +      D+   PP WH   T+KPRTPR+ K ++  N       
Sbjct  61    RL-------------KTASYKSTDERRQPPTWH---TKKPRTPRHGKHSRNNN-------  97

Query  580   ESVNPVLPF--VPEMGSDD-DYNNNNEIDLFCQVP------------------Vlldddl  696
                    PF  VPE GS++ + ++ NE  L  +VP                  V   D  
Sbjct  98    -------PFHLVPEEGSEEANSHDENEEQLVYRVPIVDPFVAELCGTNSSPSSVTSTDQG  150

Query  697   nallndgggddHMRGLEIPEF-------------LSSDVELAEFAADVETLLGDD-----  822
                      +   +G++  +F             L SD ELAEFAADVE+ LG       
Sbjct  151   VVAAAAASAEVEYKGIQSNDFCSNSNEIENLHGMLPSDAELAEFAADVESFLGRGLENKC  210

Query  823   ---------DVGEDKATAA---VKIE--------INGGDCTEALNWSFGEEQEVEQKVMM  942
                      D  E++ +     VK+E        ++ G   ++   SF  E   E K M 
Sbjct  211   VGMEELGLVDTKEEECSVGSGKVKVEEEESPLMEMDMGRDDQSFELSFDYETCEEVKEMK  270

Query  943   TMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH  1122
               +S  +  +   E     ++  K+ ++ L L+YE +I AWASQ  PWT   + + DP+ 
Sbjct  271   --VSDLELGNELGEMKENDDDEVKRKKVSLQLDYEAIIIAWASQKSPWTTADKQNLDPDE  328

Query  1123  CWPDFMGG-DHHHHHPYGS----AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRK  1287
             CW   MG      HHPYG      +     D GREARVSRYREKRRTRLFSKKIRYEVRK
Sbjct  329   CWHQCMGSCGTAFHHPYGELGGFGIHSVIVDGGREARVSRYREKRRTRLFSKKIRYEVRK  388

Query  1288  LNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  1386
             LNAEKRPR+KGRFVKR+S    PP FP  LLN+
Sbjct  389   LNAEKRPRMKGRFVKRASF--APPTFP--LLNK  417



>ref|XP_003555902.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Glycine 
max]
Length=418

 Score =   253 bits (647),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 181/454 (40%), Positives = 233/454 (51%), Gaps = 101/454 (22%)
 Frame = +1

Query  220   MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  399
             MSS  +  ANA+ GKTARACD C++KRARW+C ADDAFLCQ+CD SVH AN LA RH+RV
Sbjct  1     MSSATKNAANAVGGKTARACDGCITKRARWYCAADDAFLCQACDSSVHLANPLARRHERV  60

Query  400   RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  579
             RL T+S  +                   PP WH   T+KPRTPR+ K ++  N       
Sbjct  61    RLKTASYKSTDERR-------------QPPTWH---TKKPRTPRHGKHSRNNN-------  97

Query  580   ESVNPVLPF--VPEMGSDD-DYNNNNEIDLFCQVPV-------------------llddd  693
                    PF  VPE GS++ + ++ NE  L  +VP+                     D  
Sbjct  98    -------PFHLVPEEGSEEANSHDENEEQLVYRVPIVDPFVAELCGTNSSPSSVTSTDQG  150

Query  694   lnallndgggddHMRGLEIPEF-------------LSSDVELAEFAADVETLLGDD----  822
             + A       +   +G++  +F             L SD ELAEFAADVE+ LG      
Sbjct  151   VVAAAAAASAEVEYKGIQSNDFCSNSNEIENLHGMLPSDAELAEFAADVESFLGRGLENK  210

Query  823   ----------DVGEDKATAA---VKIE--------INGGDCTEALNWSFGEEQEVEQKVM  939
                       D  E++ +     VK+E        ++ G   ++   SF  E   E K M
Sbjct  211   CVGMEELGLVDTKEEECSVGSGKVKVEEEESPLMEMDMGRDDQSFELSFDYETCEEVKEM  270

Query  940   MTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN  1119
                +S  +  +   E     ++  K+ ++ L L+YE +I AWASQ  PWT   + + DP+
Sbjct  271   K--VSDLELGNELGEMKENDDDEVKRKKVSLQLDYEAIIIAWASQKSPWTTADKQNLDPD  328

Query  1120  HCWPDFMGG-DHHHHHPYGS----AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVR  1284
              CW   MG      HHPYG      +     D GREARVSRYREKRRTRLFSKKIRYEVR
Sbjct  329   ECWHQCMGSCGTAFHHPYGELGGFGIHSVIVDGGREARVSRYREKRRTRLFSKKIRYEVR  388

Query  1285  KLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  1386
             KLNAEKRPR+KGRFVKR+S    PP FP  LLN+
Sbjct  389   KLNAEKRPRMKGRFVKRASF--APPTFP--LLNK  418



>ref|XP_009356271.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Pyrus x 
bretschneideri]
Length=454

 Score =   254 bits (649),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 182/451 (40%), Positives = 235/451 (52%), Gaps = 92/451 (20%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +K A+A+ GKTARACDSC+ KRARW+C ADD FLCQ+CD +VHSAN LA RH+RV L T+
Sbjct  5     KKVAHAVGGKTARACDSCIKKRARWYCAADDGFLCQACDSAVHSANQLAHRHKRVLLKTA  64

Query  415   ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNP  594
             SS   +     +  +    +  + P+WHRGFTRK RTPR  K            EE V  
Sbjct  65    SSLKPSNKDDRASAV---SETSAAPSWHRGFTRKARTPRGGKSMTHHGKS----EEGVRN  117

Query  595   VLPFVPEMGSDD----DYNNNNEIDLFCQVPV----------------lldddlnallnd  714
             + P VPE+G DD    D  N  +  L  +VP+                          N 
Sbjct  118   LFPQVPEVGGDDINSYDEENKEDQQLLYRVPIFDPFVAELCNNSGNSNEDAVANYEANNL  177

Query  715   gggddHMRGLE------IPEF-------LSSDVELAEFAADVETLLG----DD-------  822
                 DH+ G+E      +P F       L SD++LAEFAADV++LLG    DD       
Sbjct  178   STVSDHV-GIESKAVSSLPNFNCHDGFPLPSDMDLAEFAADVDSLLGRGVDDDECFGMER  236

Query  823   ----DVGEDKATAAVKIEIN----GGDCTEALNWSFGE-EQEVEQKVMMTMLSGFDesss  975
                 D  + ++   VK+E +    G D  + +    GE E ++ ++        +D+S +
Sbjct  237   LGFMDCKKKESNGRVKLEEDDDQEGTDDVDFMGCQLGESEIDMMREPFALNFEDYDDSPA  296

Query  976   smesgsckeeV-----------------------AKKSRMLLSLNYEEVISAWASQGCPW  1086
             S      K  V                       +KK +M+L L+YE VI+AW   G PW
Sbjct  297   SCGEQDDKLRVGSYSKCSTEDHEREDADDDARDNSKKRKMILRLDYEAVITAW--DGSPW  354

Query  1087  TDGTRPHFDPNHCWPDFMGG-DHHHHHPYGSAMMM----RRSDEGREARVSRYREKRRTR  1251
             T G RP FD + C PD+MG      H+PYG    +       D GREARVSRYREKRRTR
Sbjct  355   TSGDRPDFD-SECLPDYMGACGAELHYPYGEMNGLGVHPAMVDGGREARVSRYREKRRTR  413

Query  1252  LFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
             LFSKKIRYEVRKLNA+KRPR+KGRFVKR+S 
Sbjct  414   LFSKKIRYEVRKLNAQKRPRMKGRFVKRASF  444



>gb|AEF12203.1| CONSTANS-like zinc finger protein [Glycine max]
 gb|KHN20727.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=427

 Score =   253 bits (646),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 175/450 (39%), Positives = 230/450 (51%), Gaps = 113/450 (25%)
 Frame = +1

Query  226   SDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  405
             +++ K A+A+  +TARAC+SCL  RARW+C ADDAFLC  CD  VHSAN LASRH+RV+L
Sbjct  2     TNEMKEASALGARTARACESCLKVRARWYCAADDAFLCHGCDNMVHSANQLASRHERVKL  61

Query  406   GtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPR---NAKRTKKQNSGGVAV  576
                 ++++  +   +PK+          AWH GFTRK RTPR   N   + KQ      +
Sbjct  62    ---QTASSKVNYSVTPKV----------AWHSGFTRKARTPRHNNNRHSSLKQQQQKKPL  108

Query  577   EE----------SVNPVLPFVPEMGSDDDY-NNNNEIDLFCQVPVlldd--dlnallndg  717
              E          +   +LP VPE+GS++   N+  E  L C+VPV   +   +   + D 
Sbjct  109   HEERGEEEVFFNNTISLLPLVPELGSEEPLLNDETEEQLLCRVPVFDAELCSIYNEVKDE  168

Query  718   ggddHMRGLEI----PEFLSSDVELAEFAADVETLLG--------DDD------------  825
                     L++     EFL SD +LAEF ADV++ LG        DDD            
Sbjct  169   VVAAGEEALDLENFSSEFLPSDTDLAEFTADVKSFLGNGADEDSPDDDEHVKESELLILD  228

Query  826   ------------------VGEDKATAAVK------------------IEINGGDCTEALN  897
                               +G   A   VK                  +++NG    EA N
Sbjct  229   CKEEEGDEEMDECIDGVLIGAKDAMVKVKDEEELDADDDTACHLDSILDMNG----EAFN  284

Query  898   WSFGEEQEVEQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQG  1077
             W+  E +   Q                        +V  K  + L LNYEEVI+AWASQG
Sbjct  285   WNIVESESPAQ-----------------AQEDEVSKVGTKKDIFLRLNYEEVITAWASQG  327

Query  1078  CPWTDGTRPHF-DPNHCWPDFMGGDHHHHHP-YGSAMMMR-RSDEGREARVSRYREKRRT  1248
              PWT+GT P F + + CW DF+G +  +    YG+   +R  +D GREARVSRYREKRRT
Sbjct  328   SPWTNGTPPKFFNSDDCWLDFLGSNGGNVQCCYGAVGSLRVHADGGREARVSRYREKRRT  387

Query  1249  RLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  1338
             RLF+KKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  388   RLFAKKIRYEVRKLNAEKRPRMKGRFVKRT  417



>ref|XP_008339676.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Malus domestica]
Length=453

 Score =   251 bits (642),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 176/449 (39%), Positives = 228/449 (51%), Gaps = 89/449 (20%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +K A+A+ GKTARACDSC+ KRARW+C ADDAFLC++CD +VHSAN LA RH+RV L   
Sbjct  5     KKVAHAVGGKTARACDSCIKKRARWYCAADDAFLCEACDSAVHSANDLARRHERVLL---  61

Query  415   ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNP  594
              ++++        +          P+WHRGFTRKPRTPR  K            +E +  
Sbjct  62    KTASSLKPSNKDDRTXAVSKTSXAPSWHRGFTRKPRTPRGGKSMTHHGKS----KEGIRN  117

Query  595   VLPFVPEMGSDD----DYNNNNEIDLFCQVPV----------------lldddlnallnd  714
             + P VPE+G DD    D  N+ +  L  +VP+                          N 
Sbjct  118   LFPQVPEVGGDDNNSYDEENDEDQQLLYRVPIFDPSVAELCSNSGNSSEDAVANYEASNL  177

Query  715   gggddHMRGL-----EIPEF-------LSSDVELAEFAADVETLLG----DD--------  822
                 DH+         +P F       L SD++LAEFAADV++LLG    DD        
Sbjct  178   STVSDHVGSQSKAVSSLPNFNGHDGFLLPSDMDLAEFAADVDSLLGRGLNDDQCFGMEGL  237

Query  823   ---DVGEDKATAAVKIE----INGGDCTEALNWSFGEEQ---------------------  918
                D  E ++   VK+E     +G D  + +    GE +                     
Sbjct  238   GLRDCKEKESKGRVKLEEDDDQDGIDGVDFMGCQLGESENDMMREPFVLNFEDYDDSPAS  297

Query  919   --EVEQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTD  1092
               E + K+++ + S   E     E+     +  KK + +L L+YE VI+AW   G PWT 
Sbjct  298   CGEQDDKMIVGIDSNCTEDHEHEEADEDATDNXKKRKTILRLDYEAVITAW--DGSPWTS  355

Query  1093  GTRPHFDPNHCWPDFMG-GDHHHHHPYGS----AMMMRRSDEGREARVSRYREKRRTRLF  1257
             G RP FD +   PD+MG      H+PYG      +     D GREARVSRYREKRRTRLF
Sbjct  356   GDRPDFD-SEFLPDYMGVCGPGLHYPYGDLNGIGVHPAMVDGGREARVSRYREKRRTRLF  414

Query  1258  SKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
             SKKIRYEVRKLNAEKRPR+KGRFVKRSS 
Sbjct  415   SKKIRYEVRKLNAEKRPRMKGRFVKRSSF  443



>ref|XP_008352923.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Malus domestica]
Length=453

 Score =   251 bits (640),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 176/449 (39%), Positives = 228/449 (51%), Gaps = 89/449 (20%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +K A+A+ GKTARACDSC+ KRARW+C ADDAFLC++CD +VHSAN LA RH+RV L   
Sbjct  5     KKVAHAVGGKTARACDSCIKKRARWYCAADDAFLCEACDSAVHSANDLARRHERVLL---  61

Query  415   ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNP  594
              ++++        +          P+WHRGFTRKPRTPR  K            +E +  
Sbjct  62    KTASSLKPSNKDDRTXAVSKTSXAPSWHRGFTRKPRTPRGGKSMTHHGKS----KEGIRN  117

Query  595   VLPFVPEMGSDD----DYNNNNEIDLFCQVPV----------------lldddlnallnd  714
             + P VPE+G DD    D  N+ +  L  +VP+                          N 
Sbjct  118   LFPQVPEVGGDDNNSYDEENDEDQQLLYRVPIFDPSVAELCSNSGNSSEDAVANYEASNL  177

Query  715   gggddHMRGL-----EIPEF-------LSSDVELAEFAADVETLLG----DD--------  822
                 DH+         +P F       L SD++LAEFAADV++LLG    DD        
Sbjct  178   STVSDHVGSQSKAVSSLPNFNGHDGFLLPSDMDLAEFAADVDSLLGRGLNDDQCFGMEGL  237

Query  823   ---DVGEDKATAAVKIE----INGGDCTEALNWSFGEEQ---------------------  918
                D  E ++   VK+E     +G D  + +    GE +                     
Sbjct  238   GLRDCKEKESKGRVKLEEDDDQDGIDGVDFMGCQLGESENDMMREPFVLNFEDYDDSPAS  297

Query  919   --EVEQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTD  1092
               E + K+++ + S   E     E+     +  KK + +L L+YE VI+AW   G PWT 
Sbjct  298   CGEQDDKMIVGIDSNCTEDHEHEEADEDATDNRKKRKTILRLDYEAVITAW--DGSPWTS  355

Query  1093  GTRPHFDPNHCWPDFMG-GDHHHHHPYGS----AMMMRRSDEGREARVSRYREKRRTRLF  1257
             G RP FD +   PD+MG      H+PYG      +     D GREARVSRYREKRRTRLF
Sbjct  356   GDRPDFD-SEFLPDYMGVCGPGLHYPYGDLNGIGVHPAMVDGGREARVSRYREKRRTRLF  414

Query  1258  SKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
             SKKIRYEVRKLNAEKRPR+KGRFVKRSS 
Sbjct  415   SKKIRYEVRKLNAEKRPRMKGRFVKRSSF  443



>ref|XP_004238926.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X1 [Solanum lycopersicum]
Length=437

 Score =   249 bits (637),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 179/444 (40%), Positives = 227/444 (51%), Gaps = 73/444 (16%)
 Frame = +1

Query  232   QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  411
             +RK A+A+ GKT RACD+C+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL T
Sbjct  4     ERKLASAMGGKTTRACDNCIKKRARWYCPADDAFLCQNCDASVHSANPLARRHERVRLKT  63

Query  412   sssstaaasllssPKIV----------ddddddSPPAWHRGFTRKPRTPRNAKRTKKQNS  561
             SS    ++   SS                    S P+WHRGFTRK RTPR  ++  K   
Sbjct  64    SSLKQTSSPSSSSDDYFPDLESPLSISSVSVSVSVPSWHRGFTRKARTPRQGRKASKSAG  123

Query  562   GGVAVEESVNPVLPFVPEMGSDDD-YNNNNEIDLFCQVP-----Vlldddlnallndggg  723
              G  + +  NP+   VPE+ SD++  + N E  L  +VP     V      +    D   
Sbjct  124   DGDVIRK--NPI-HLVPEILSDENSLDENEEEQLLYRVPILDPFVGHLYSSSTAPTDADS  180

Query  724   ddHMRGLEIP--------------EFLSSDVELAEFAADVETLLGD--DDVGEDKATAAV  855
             +  +   E+               E L S++ELAEFAADVE+LLG   DD   D     +
Sbjct  181   EFKLESKEMTLQDDICNVDLNRFHEMLPSEMELAEFAADVESLLGKGLDDESFDMEGLGL  240

Query  856   KIEINGGDCTEALNWSFGEEQEVEQKVMMTMLS---------------------------  954
                 N  + +   +     E E E +V+    S                           
Sbjct  241   LGVCNKEENSMISHEKVKIEDEGEMEVVTKTTSPTTHNHQYNHTHDHDIDINEDTFEFKF  300

Query  955   GFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPD  1134
              +D S + +           K ++LL+L+YE V+ AWA Q CPWT+G RP  D N  WPD
Sbjct  301   DYDSSINIIGDDEVVTNDENKKKILLNLDYEGVLKAWADQRCPWTNGERPELDSNESWPD  360

Query  1135  FMGGDHHHHHPYGSAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRP  1308
              MG        Y   M    +  D GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRP
Sbjct  361   CMGN-------YMGIMNENVTIVDRGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRP  413

Query  1309  RLKGRFVKRSSLFQPPPPFPNYLL  1380
             R+KGRFVKR++        PNY L
Sbjct  414   RMKGRFVKRANFVTTST--PNYPL  435



>ref|XP_008389292.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Malus domestica]
Length=454

 Score =   250 bits (638),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 181/459 (39%), Positives = 236/459 (51%), Gaps = 92/459 (20%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +K ANA+ GKTARACDSC+ KRARW+C ADDAFLCQ+CD +VHSAN LA RH+RV L T+
Sbjct  5     KKVANAVGGKTARACDSCIKKRARWYCAADDAFLCQACDSAVHSANQLAHRHKRVLLKTA  64

Query  415   ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNP  594
             SS   +     +  +    +  + P+WHRGFTRK RTPR  K            ++ V  
Sbjct  65    SSLKPSNKDDRASAV---SETSAAPSWHRGFTRKARTPRGGKSMTHHGKS----QDGVRN  117

Query  595   VLPFVPEMGSDD----DYNNNNEIDLFCQVPV----------------lldddlnallnd  714
             + P VPE+G DD    D  N  +  L  +VP+                          N 
Sbjct  118   LFPQVPEVGGDDNNSYDEENTEDQQLLYRVPIFDPFVAELCNNSDXSKEDAVPNYEATNL  177

Query  715   gggddHMRGLE------IPEFLS-------SDVELAEFAADVETLLG----DD-------  822
                 DH+ G E      +P F         SD++LAEFAADV++LLG    DD       
Sbjct  178   ITVSDHV-GSESKAVSSLPNFNGHDAFLPPSDMDLAEFAADVDSLLGRGLDDDECFGMER  236

Query  823   ----DVGEDKATAAVKIEIN----GGDCTEALNWSFGE-EQEVEQKVMMTMLSGFDesss  975
                 D  + ++   VK+E +    G D  + +    GE E ++ ++     +  +D+S +
Sbjct  237   LGLMDCXKKESNGRVKLEEDDDQEGTDNVDFMGCQLGESEIDMXREPFALNIEDYDDSPA  296

Query  976   smesgsckeeV-----------------------AKKSRMLLSLNYEEVISAWASQGCPW  1086
             S      K  V                       +KK +M+L L+YE VI+AW   G PW
Sbjct  297   SCGEQDDKLRVGIYSNCSTEDHEREEADDDAXDNSKKRKMILRLDYEAVITAW--DGSPW  354

Query  1087  TDGTRPHFDPNHCWPDFMGG-DHHHHHPYGSAMMMRR----SDEGREARVSRYREKRRTR  1251
             T G RP FD + C PD+M       H+PYG    +      +D  REARVSRYREKRRTR
Sbjct  355   TSGDRPDFD-SECLPDYMSACGAELHYPYGDXNGLGXHPAMADGXREARVSRYREKRRTR  413

Query  1252  LFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  1368
             LFSKKIRYEVRKLNAEKRPR+KGRFVK++S      P P
Sbjct  414   LFSKKIRYEVRKLNAEKRPRMKGRFVKKASFAGSAFPVP  452



>ref|XP_008360050.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Malus domestica]
Length=454

 Score =   250 bits (638),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 181/459 (39%), Positives = 236/459 (51%), Gaps = 92/459 (20%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +K ANA+ GKTARACDSC+ KRARW+C ADDAFLCQ+CD +VHSAN LA RH+RV L T+
Sbjct  5     KKVANAVGGKTARACDSCIKKRARWYCAADDAFLCQACDSAVHSANQLAHRHKRVLLKTA  64

Query  415   ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNP  594
             SS   +     +  +    +  + P+WHRGFTRK RTPR  K            ++ V  
Sbjct  65    SSLKPSNKDDRASAV---SETSAAPSWHRGFTRKARTPRGGKSMTHHGKS----QDGVRN  117

Query  595   VLPFVPEMGSDD----DYNNNNEIDLFCQVPV----------------lldddlnallnd  714
             + P VPE+G DD    D  N  +  L  +VP+                          N 
Sbjct  118   LFPQVPEVGGDDNNSYDEENTEDQQLLYRVPIFDPFVAELCNNSDXSKEDAVPNYEATNL  177

Query  715   gggddHMRGLE------IPEFLS-------SDVELAEFAADVETLLG----DD-------  822
                 DH+ G E      +P F         SD++LAEFAADV++LLG    DD       
Sbjct  178   ITVSDHV-GSESKAVSSLPNFNGHDAFLPPSDMDLAEFAADVDSLLGRGLDDDECFGMER  236

Query  823   ----DVGEDKATAAVKIEIN----GGDCTEALNWSFGE-EQEVEQKVMMTMLSGFDesss  975
                 D  + ++   VK+E +    G D  + +    GE E ++ ++     +  +D+S +
Sbjct  237   LGLMDCKKKESNGRVKLEEDDDQEGTDNVDFMGCQLGESEIDMXREPFALNIEDYDDSPA  296

Query  976   smesgsckeeV-----------------------AKKSRMLLSLNYEEVISAWASQGCPW  1086
             S      K  V                       +KK +M+L L+YE VI+AW   G PW
Sbjct  297   SCGEQDDKLRVGIYSNCSTEDHEREEADDDAXDNSKKRKMILRLDYEAVITAW--DGSPW  354

Query  1087  TDGTRPHFDPNHCWPDFMGG-DHHHHHPYGSAMMMRR----SDEGREARVSRYREKRRTR  1251
             T G RP FD + C PD+M       H+PYG    +      +D  REARVSRYREKRRTR
Sbjct  355   TSGDRPDFD-SECLPDYMSACGAELHYPYGDXNGLGXHPAMADGXREARVSRYREKRRTR  413

Query  1252  LFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  1368
             LFSKKIRYEVRKLNAEKRPR+KGRFVK++S      P P
Sbjct  414   LFSKKIRYEVRKLNAEKRPRMKGRFVKKASFAGSAFPVP  452



>ref|XP_004236986.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Solanum lycopersicum]
Length=428

 Score =   249 bits (635),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 181/431 (42%), Positives = 240/431 (56%), Gaps = 58/431 (13%)
 Frame = +1

Query  226   SDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  405
             S ++K ANA+  KTARACD+C+ KRARW+C ADDAFLCQSCD SVHSAN LA RH+RVRL
Sbjct  2     SSEKKLANAMGAKTARACDNCIRKRARWYCAADDAFLCQSCDSSVHSANPLARRHERVRL  61

Query  406   Gtssssta-----aasllssPKIVddddddSPPAWHRGFTRKPRTPR----NAKRTKKQN  558
              TSS  ++       S +S          DS P+WH GFTRK RTPR    +AKR K   
Sbjct  62    KTSSFKSSDDFPNLESTVSGLGSGSGSGSDSIPSWHCGFTRKARTPRYGNKHAKRVKSTE  121

Query  559   SGGVAVEESVNPVLPFVPEMGSDDD-YNNNNEIDLFCQVPV----------lldddlnal  705
                   E   NP+   VPE+ SD++ ++ N E  L  +VP+            ++  +  
Sbjct  122   EEEEEEEMK-NPIQLVVPEILSDENSHDENEEEQLLYRVPIFDPFMADGSNYGNEYSSNK  180

Query  706   lndgggddHMRGLEIPEFLSSDVELAEFAADVETLLG---DDDVG----------EDKAT  846
             ++     +  +GL  P    S++ELAEFAADV +LLG   DD+            E    
Sbjct  181   VDFNQDMNTFQGLLAP----SEMELAEFAADVVSLLGKGLDDEESFNYMEGLGFLEKHDE  236

Query  847   AAVKIE-------INGGDCTEALNWS----FGEEQEVEQKVMMTMLSGFDessssmesgs  993
               VK+E       +N       +++S     GE  E++      +++  DE +  +E   
Sbjct  237   KLVKVEDEGEVGFVNMISTNNQVDYSEFDMVGETFELKFDYDSQVINNLDEDNKKVEFLE  296

Query  994   ckeeVAKKS-RMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPY  1170
                +  K + +++L+L+YE V+ +W  +  PWT G RP  D N CWP  MG +    H Y
Sbjct  297   INYDSGKNNNKIMLNLDYESVLKSWGDKRFPWTTGVRPEVDFNDCWPVCMG-NCGKIHSY  355

Query  1171  GSAMMMRRS-----DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
             G   +M        DEGREARV RY+EKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  356   GDIAIMNGHGGGVVDEGREARVLRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  415

Query  1336  SSLFQPPPPFP  1368
             ++    P PFP
Sbjct  416   TNF--APTPFP  424



>ref|XP_009397482.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Musa acuminata 
subsp. malaccensis]
Length=406

 Score =   248 bits (632),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 176/413 (43%), Positives = 224/413 (54%), Gaps = 52/413 (13%)
 Frame = +1

Query  217   MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  396
             M  ++++++A A++ +TARACDSCL +RARWFC ADDAFLCQSCD SVHSAN LA RH+R
Sbjct  1     MSYAEKQRSAGAVAARTARACDSCLRRRARWFCEADDAFLCQSCDASVHSANPLARRHRR  60

Query  397   VRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAV  576
             VRL T+S S+ ++S  S P      D   PP W  GF RKPRTPR          G    
Sbjct  61    VRLDTASCSSPSSSSSSPPTDDVSGDHSMPP-WLHGFKRKPRTPRG-------KPGRALA  112

Query  577   EESVNPVLPFVPEMGSDDDYNNNNEIDLFC-------------QVPV---lldddlnall  708
                V  ++P +  M ++++ +N  E  L C             Q PV      +D     
Sbjct  113   AAKVETLVPDLETMSTEENQSNEEEQLLHCVPTLDPLLIESCSQHPVDDGSPSEDDVKPA  172

Query  709   ndgggddHMRGLE-IPEFLSSDVELAEFAADVETLLG---------------DDDVGEDK  840
                    H+   + +  F  SD++LAEFA+D+E LLG                D   ED 
Sbjct  173   LQLADFAHVSAADGLAGFRPSDLDLAEFASDMEALLGRGLDDHSFCIDGLGLADATLEDD  232

Query  841   ATAAVKIEINGGDCTEALNWSFGEEQEVEQKVM-MTMLSGFDessssmesgsckeeVAKK  1017
                 VK+E     C       FG E  + +  M +   S     +  ++      E A K
Sbjct  233   GMEHVKVEDGDAAC------GFGVEIALSKDTMDLDFDSRTATMAVQVKDQKPSPEAATK  286

Query  1018  SRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFM----GGDHHHHHPYGSAM  1182
              R +L L+YE VI+AW+S GC PWTDG RP FDP+  W DF+    GG       Y  A 
Sbjct  287   RRPILRLDYEAVIAAWSSNGCSPWTDGERPQFDPSDAWADFLVAEAGGGGEVQGMYQQAG  346

Query  1183  MMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  1341
              M   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVK+++
Sbjct  347   HMAAVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKQAA  399



>ref|XP_003525256.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Glycine 
max]
Length=365

 Score =   245 bits (625),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 171/406 (42%), Positives = 214/406 (53%), Gaps = 73/406 (18%)
 Frame = +1

Query  238   KTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtss  417
             K A A+ GKTARACDSC+S+RARWFC ADDAFLC  CD  VHSAN LASRH+RVRL    
Sbjct  5     KDAGALGGKTARACDSCVSRRARWFCAADDAFLCHGCDTLVHSANQLASRHERVRLQ---  61

Query  418   sstaaasllssPKIVddddddSPPAWHRGFTRKPRTPR-NAKRTKKQNSGGVAVEESVNP  594
                                  +  AWH GFTRK RTPR N+K    Q      V  +   
Sbjct  62    --------------TASSKVTTTHAWHSGFTRKARTPRHNSKHFALQQRLKDEVLFNNTS  107

Query  595   VLPFVPEMGSDDDY-----NNNNEIDLFCQVPVlldddlnallndgggddHMRGLEIPEF  759
             VLP VPE+G ++       N+  E  + C+VPV                  +R  ++  F
Sbjct  108   VLPLVPELGGEEQEPVVVDNDETEEQMLCRVPV-------------FDPFDVRTDDLDSF  154

Query  760   LSSDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVM  939
               SD++ AEFAADVE+LL  +D   D+ +A V     GG+  +       +E+E++  V 
Sbjct  155   --SDMDFAEFAADVESLLDKED---DEISACV----GGGEGVQGAMVKVKDEEEIDGDVA  205

Query  940   MTMLSGFD--------essssmesgsckeeVA-----------KKSRMLLSLNYEEVISA  1062
               + S FD        ES  S      +  VA            K  + L LNY+EVI+A
Sbjct  206   CYLESVFDDAFHWNNIESVLSDAREEKEGVVACDGGVGDEEGGTKRDIFLRLNYDEVITA  265

Query  1063  WASQG-CPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR-RSDEGREARVSRYRE  1236
             W+SQG  PWT    P F+ ++ +   + G        G    +R   D GREARVSRYRE
Sbjct  266   WSSQGSSPWTTSNPPKFNSDYDFSLGLSG------VGGEVRSLRGHLDGGREARVSRYRE  319

Query  1237  KRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNY  1374
             KRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR + F     FP Y
Sbjct  320   KRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR-TCFVGANAFPAY  364



>ref|XP_006344138.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Solanum 
tuberosum]
Length=447

 Score =   246 bits (629),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 178/454 (39%), Positives = 234/454 (52%), Gaps = 83/454 (18%)
 Frame = +1

Query  232   QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  411
             +RK A+A+ GKT RACD+C+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL T
Sbjct  4     ERKLASAMGGKTTRACDNCIKKRARWYCPADDAFLCQNCDASVHSANPLARRHERVRLKT  63

Query  412   sssstaaasllss---PKIVd--dddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAV  576
             SS    ++S  S    P +         S P+WHRGFTRK RTPR+ ++  K    G  +
Sbjct  64    SSLKQPSSSSSSDDYFPDLESPLSISSVSVPSWHRGFTRKVRTPRHGRKASKSAGDGDVI  123

Query  577   EESVNPVLPFVPEMGSDDD-YNNNNEIDLFCQVPVlldddlnallndgggddHMR-----  738
             +   NP+   VPE+ SD++ ++ N E  L  +VP+L         +    +  M      
Sbjct  124   QR--NPI-HLVPEILSDENSHDENEEEQLLYRVPILDPFVAQLYSSATRNNHEMVESNAT  180

Query  739   ---------GLE-----------------IPEFLSSDVELAEFAADVETLLG---DDDVG  831
                       LE                   E L S++ELAEFAADVE+LLG   DD+  
Sbjct  181   AAADADSEFKLESKEMMLQDDICNVDLNRFHEMLPSEMELAEFAADVESLLGKGLDDESF  240

Query  832   EDKATAAVKI---EINGGDCTEALNWSFGEEQEVEQKVMMTMLSGF--------------  960
             + +    + +   E N  + +   +     E E E +V+   +S                
Sbjct  241   DMEGLGLLGVCNKEENSMEYSMISHEKVKIEDEGEIEVVRKTISATTHDHQYNHTHHDID  300

Query  961   ------------DessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRP  1104
                         D   + +       +   K ++LL+L+YE V++AWA Q  PWT+G RP
Sbjct  301   INEDTFEFKFDCDSPMNIIGEDEVIMKDENKKKILLNLDYEGVLTAWADQRSPWTNGERP  360

Query  1105  HFDPNHCWPDFMGGDHHHHHPYGSAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYE  1278
               D N  WP  MG        Y   M    +  D GREARV+RYREKRRTRLFSKKIRYE
Sbjct  361   ELDSNDSWPHCMGN-------YMGIMNENVTIVDRGREARVTRYREKRRTRLFSKKIRYE  413

Query  1279  VRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLL  1380
             VRKLNAEKRPR+KGRFVKR++        PNY L
Sbjct  414   VRKLNAEKRPRMKGRFVKRTNFVTTTT--PNYPL  445



>ref|XP_011071256.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Sesamum 
indicum]
Length=458

 Score =   246 bits (629),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 179/451 (40%), Positives = 230/451 (51%), Gaps = 89/451 (20%)
 Frame = +1

Query  220   MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  399
             M SD RK ANA+ GK+ARACD+C+ KRARW+C ADDAFLCQSCD SVHSAN LA RH+RV
Sbjct  7     MVSD-RKLANAVGGKSARACDNCVRKRARWYCAADDAFLCQSCDSSVHSANPLARRHERV  65

Query  400   RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  579
             RL T+S S+      +  +I       S P+WH+GFTRK RTPR  K  K  N+    + 
Sbjct  66    RLKTASISSFDDGSKAGLQI-------SVPSWHQGFTRKARTPRQKKPGKLINNSEDPIN  118

Query  580   ESVNPVLPFVPEMGSDDDYNNNNEIDLFCQVPV-----------lldddlnallndgggd  726
                +P L  VPE+ S++  +  NE  L  +VP+               ++         +
Sbjct  119   RISHP-LHLVPEICSEEQSHEENEEQLLYRVPIFDPFVAELCTSANSPEVLTTTFQINDE  177

Query  727   dHMRGL----------------EIPEFLSSDVELAEFAADVETLLG--------------  816
             ++ RG                  +  FL SD++LAEFAADVE+LLG              
Sbjct  178   ENKRGFGHESKAAANGFSQEMNHLQGFLPSDMDLAEFAADVESLLGKGLEDESFHMEELG  237

Query  817   --------------------------DDDVGEDKATAA----VKIEINGGDCTEALNWSF  906
                                       D+DV E  A       + +E + G  T  L + +
Sbjct  238   LFDCDEKGKELHDCSNLLPSGRVKVEDEDVAELMAMGHENHHLDVEFDMGRETFELKFDY  297

Query  907   GEEQEVEQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPW  1086
             G     E++ +       +E      S   + ++   S+  L L+YE V+SAW  +  PW
Sbjct  298   GSPVACEEEDIKAQ----NEERIGWNSCFQECKMGDSSKTFLRLDYEGVLSAWDDKKSPW  353

Query  1087  TDGTRPHFDPNHCWPDFMGGDHHHHHPYG-----SAMMMRRSDEGREARVSRYREKRRTR  1251
             T G RP+ D   CWPD   G     H YG     S      +D GREARVSRYREKRRTR
Sbjct  354   TTGERPNLDSCDCWPDHCLGTSGAMHVYGEMGRMSGHAAAMADGGREARVSRYREKRRTR  413

Query  1252  LFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
             LFSKKIRYEVRKLNAEKRPR+KGRFVKRS+ 
Sbjct  414   LFSKKIRYEVRKLNAEKRPRMKGRFVKRSNF  444



>gb|ACX42573.1| CONSTANS-like zinc finger protein [Glycine max]
 gb|KHN21563.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=366

 Score =   243 bits (619),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 170/406 (42%), Positives = 213/406 (52%), Gaps = 69/406 (17%)
 Frame = +1

Query  238   KTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtss  417
             K A A+ GKTARACDSC+S+RARWFC ADDAFLC  CD  VHSAN LASRH+RVRL    
Sbjct  2     KDAGALGGKTARACDSCVSRRARWFCAADDAFLCHGCDTLVHSANQLASRHERVRLQ---  58

Query  418   sstaaasllssPKIVddddddSPPAWHRGFTRKPRTPR-NAKRTKKQNSGGVAVEESVNP  594
                                  +  AWH GFTRK RTPR N+K    Q      V  +   
Sbjct  59    --------------TASSKVTTTHAWHSGFTRKARTPRHNSKHFALQQRLKDEVLFNNTS  104

Query  595   VLPFVPEMGSDDDY-----NNNNEIDLFCQVPVlldddlnallndgggddHMRGLEIPEF  759
             VLP VPE+G ++       N+  E  + C+VPV                  +R  ++  F
Sbjct  105   VLPLVPELGGEEQEPVVVDNDETEEQMLCRVPV-------------FDPFDVRTDDLDSF  151

Query  760   LSSDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVM  939
               SD++ AEFAADVE+LL  +D   D+ +A V      G+  +       +E+E++  V 
Sbjct  152   --SDMDFAEFAADVESLLDKED---DEISACVGGGEGEGEGVQGAMVKVKDEEEIDGDVA  206

Query  940   MTMLSGFD--------essssmesgsckeeVA-----------KKSRMLLSLNYEEVISA  1062
               + S FD        ES  S      +  VA            K  + L LNY+EVI+A
Sbjct  207   CYLESVFDDAFHWNNIESVLSDAREEKEGVVACDVGVGDEEGGTKRDIFLRLNYDEVITA  266

Query  1063  WASQG-CPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR-RSDEGREARVSRYRE  1236
             W+SQG  PWT    P F+ ++ +   + G        G    +R   D GREARVSRYRE
Sbjct  267   WSSQGSSPWTTSNPPKFNSDYDFSLGLSG------VGGEVRSLRGHLDGGREARVSRYRE  320

Query  1237  KRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNY  1374
             KRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR + F     FP Y
Sbjct  321   KRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR-TCFVGANAFPAY  365



>ref|XP_004497095.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Cicer arietinum]
Length=445

 Score =   243 bits (621),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 177/455 (39%), Positives = 234/455 (51%), Gaps = 92/455 (20%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +  ANA+ GKTARACD+C++KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL T+
Sbjct  3     KNVANAVGGKTARACDNCITKRARWYCAADDAFLCQACDSSVHSANSLARRHERVRLKTA  62

Query  415   ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKR--------TKKQNSGGV  570
             S  +  +   S   I      +  P+WH GFT+K RTPR+ K+        T K +S G 
Sbjct  63    SYKSTGSGSGSGEFI------NCGPSWHHGFTKKARTPRHGKQYSASTTLQTTKSSSPG-  115

Query  571   AVEESVNPVLPFVPEMGSDD---DYNNNNEIDLFCQVP---------------------V  678
                ++ NP    VPEMG D+     + +NE  L  +VP                     V
Sbjct  116   --RKNYNP-FHLVPEMGFDEVNSISHEDNEAQLLYRVPIFDPFVVELCTSPRSEGGPGAV  172

Query  679   lldddlnallndgggddHMRG---LEIPEF---LSSDVELAEFAADVETLLG--------  816
             ++     + +N       + G    E+  F   L SD+ELAEFAADVE+LLG        
Sbjct  173   VVTSAFASDVNTSENKVQLGGDSNYEMENFHGILPSDIELAEFAADVESLLGRGLENECI  232

Query  817   -----------------------DDDVGEDKATAAVKIEIN----GGDCTEALNWSFGEE  915
                                    D++  E       KIE +    G + +  LN+ + + 
Sbjct  233   GMEELGLVDTKREVYSEGKVKVEDEESHEVVVLEGYKIEGDNIEMGKESSFELNFDYDDS  292

Query  916   QEVEQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDG  1095
              E  ++V   +     +     E+ + K     K ++ L L+Y+ VI AW  + CPWT G
Sbjct  293   NETSEEVKEKVELEIGKCGEQNENNNNKG----KRKISLQLDYDAVIIAWDGRKCPWTTG  348

Query  1096  TRPHFDPNHCWPDFMGG-DHHHHHPYGSAMMMR----RSDEGREARVSRYREKRRTRLFS  1260
              +P+ D +  WPD  G       +PYG           +D GREARVSRYREKRRTRLFS
Sbjct  349   DKPNLDADETWPDCTGSCGTEVLYPYGELGGYECHPVMADGGREARVSRYREKRRTRLFS  408

Query  1261  KKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPF  1365
             KKIRYEVRKLNAEKRPR+KGRFVKR+S   P  P 
Sbjct  409   KKIRYEVRKLNAEKRPRMKGRFVKRASFAVPTFPL  443



>ref|XP_008446600.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein CONSTANS-LIKE 
6-like [Cucumis melo]
Length=402

 Score =   241 bits (616),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 174/433 (40%), Positives = 229/433 (53%), Gaps = 90/433 (21%)
 Frame = +1

Query  220   MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  399
             M++ +     A  GKTARACDSC+SKRARW+C ADDAFLCQ+CD SVHSAN LA RH+RV
Sbjct  1     MTTRKSVEKTAEGGKTARACDSCISKRARWYCAADDAFLCQACDASVHSANSLARRHERV  60

Query  400   RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  579
             RL              +       D+ S  +WH+GFT+KPR+PR  K    +        
Sbjct  61    RL-------------QTASFRPSSDNSSAASWHQGFTKKPRSPRIGKTAPARKP------  101

Query  580   ESVNPVLPFVPEMGSDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMRGLEIPEF  759
                    P VPE+ + ++     ++ L  +VPVL  D  +  L    G+          +
Sbjct  102   ------FPQVPEVSAKEESEEQEQLLLH-RVPVLGADSKDGNLASFVGEKESSN----GY  150

Query  760   LSSDVELAEFAADVETLLGDD------DVGEDKATAA-----------------VKIEIN  870
             LS D++ AEFAADVE+LLG+       D+ E    A+                 +KIE  
Sbjct  151   LSYDMDPAEFAADVESLLGNSLDNECFDMEELGLAASKDHSLTNDDYSLNSHEIIKIE--  208

Query  871   GGDCTEALNWSFGEEQEV----------------------EQKVMMTMLSGFDessssme  984
               D  E L    G E +                       E KVMM +++       + E
Sbjct  209   -PDEIEELTPMLGSEADTMREPFELNFMDFGSNPTTCGEDEDKVMMEVMA----VVKNGE  263

Query  985   sgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHH--H  1158
                 +++  K+ ++ LSL+ E VI AW S+G PWT G RP+ D ++ WPD+MG      +
Sbjct  264   LEMEEKDCXKQKKISLSLDSEAVIIAWGSRGTPWTSGDRPNLDLDYYWPDYMGTYESDCY  323

Query  1159  HHPYG--SAMMMRRSDEG----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKG  1320
             + PYG   + + R +  G    REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KG
Sbjct  324   YQPYGEFGSGIGRHAVTGVEGEREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKG  383

Query  1321  RFVKRSSLFQPPP  1359
             RFVKRSS F PPP
Sbjct  384   RFVKRSSCFAPPP  396



>ref|XP_007160372.1| hypothetical protein PHAVU_002G316100g [Phaseolus vulgaris]
 gb|ESW32366.1| hypothetical protein PHAVU_002G316100g [Phaseolus vulgaris]
Length=369

 Score =   240 bits (613),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 170/411 (41%), Positives = 213/411 (52%), Gaps = 79/411 (19%)
 Frame = +1

Query  238   KTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtss  417
             K A A+  KTARACDSC+S+RARWFC ADDAFLC  CD  VHSAN LASRH+RVRL    
Sbjct  5     KDAGALGAKTARACDSCISRRARWFCAADDAFLCHGCDTLVHSANQLASRHERVRL----  60

Query  418   sstaaasllssPKIVddddddSPPAWHRGFTRKPRTPR---NAKRTKKQNSGGVAVEESV  588
                         +        +  AWH GFTRK RTPR   N+K +  Q      V  + 
Sbjct  61    ------------QTASSKVATTTHAWHSGFTRKARTPRHNNNSKHSALQQRLKEEVLFNN  108

Query  589   NPVLPFVPEMGSDDDY-----NNNNEIDLFCQVPVlldddlnallndgggddHMRGLEIP  753
               VLP VPE+G ++       N+  E  + C+VPV  +               +R  ++ 
Sbjct  109   GSVLPLVPELGGEEQETVVVDNDETEEQMLCRVPVFDNY-------------DVRTDDLD  155

Query  754   EFLSSDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQK  933
              F  SD++ AEFAADVE LL  +D   D+ +A V     GG    A+     +E++++  
Sbjct  156   SF--SDMDFAEFAADVENLLVKED---DERSACV-----GGGVQGAMA-KVKDEEDIDGD  204

Query  934   VMMTMLSGFDessssmesgsckeeV----------------------AKKSRMLLSLNYE  1047
             V   + S FD S+      +  E V                        K  + L LNY+
Sbjct  205   VACYLESVFDMSNDDTLHWNSIESVLSDAGEEKACVVASDGGVGEEEGTKRDIFLRLNYD  264

Query  1048  EVISAWASQGC-PWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR-RSDEGREARV  1221
             EVISAW++QG  PWT    P F+  +   DF  G        G    +R   D GREARV
Sbjct  265   EVISAWSTQGSSPWTTSNPPKFNSGY---DFCLG---LSGVDGEVRSLRGHLDGGREARV  318

Query  1222  SRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNY  1374
             SRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR + F     FP Y
Sbjct  319   SRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR-TCFVGVNAFPAY  368



>ref|XP_004135402.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
sativus]
Length=403

 Score =   241 bits (615),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 170/430 (40%), Positives = 228/430 (53%), Gaps = 83/430 (19%)
 Frame = +1

Query  220   MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  399
             M++ +     A  GKTARACDSC+SKRARW+C ADDAFLCQ+CD SVHSAN LA RH+RV
Sbjct  1     MTTRKSVERTAEGGKTARACDSCISKRARWYCAADDAFLCQACDASVHSANSLARRHERV  60

Query  400   RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  579
             RL              +       D+ S  +WH+GFT+KPR+PR  K    +        
Sbjct  61    RL-------------QTASFRPSSDNSSAASWHQGFTKKPRSPRMGKTAPTRKP------  101

Query  580   ESVNPVLPFVPEMGSDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMRGLEIPEF  759
                    P VPE+ + ++     ++ L  +VPVL  D  +  L    G+          +
Sbjct  102   ------FPQVPEVSAKEESEEQEQLLLH-RVPVLGADSKDGNLASFVGEKESSN----GY  150

Query  760   LSSDVELAEFAADVETLLGD---------DDVG-----------EDKATAAVKIEINGGD  879
             LS D++ AEFAADVE+LLG+         +++G           +D +  + +I     D
Sbjct  151   LSYDMDPAEFAADVESLLGNSLDNECFDMEELGLVASKDHSLTNDDYSLTSHEIIKIEPD  210

Query  880   CTEALNWSFGEE----------------------QEVEQKVMMTMLSGFDessssmesgs  993
               E L    G E                       E + K+MM +++      +      
Sbjct  211   EIEVLTPMLGIEADTMREPFELNFMDFGSNPTTCSEEDDKMMMEVMA---VVKNGELEME  267

Query  994   ckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHH--HHHP  1167
               + V  K ++ LSL+ E VI AW S+G PWT G RP+ D ++ WPD+MG      ++ P
Sbjct  268   ETKIVKNKKKVSLSLDSEAVIIAWGSRGTPWTSGDRPNLDLDYYWPDYMGTYESDCYYQP  327

Query  1168  YG--SAMMMRRSDEG----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFV  1329
             YG   + + R++  G    REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFV
Sbjct  328   YGEFGSGIGRQAVTGVEGEREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFV  387

Query  1330  KRSSLFQPPP  1359
             KRSS F PPP
Sbjct  388   KRSSCFAPPP  397



>gb|KGN52081.1| hypothetical protein Csa_5G609670 [Cucumis sativus]
Length=403

 Score =   241 bits (615),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 173/433 (40%), Positives = 227/433 (52%), Gaps = 89/433 (21%)
 Frame = +1

Query  220   MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  399
             M++ +     A  GKTARACDSC+SKRARW+C ADDAFLCQ+CD SVHSAN LA RH+RV
Sbjct  1     MTTRKSVERTAEGGKTARACDSCISKRARWYCAADDAFLCQACDASVHSANSLARRHERV  60

Query  400   RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  579
             RL              +       D+ S  +WH+GFT+KPR+PR  K    +        
Sbjct  61    RL-------------QTASFRPSSDNSSAASWHQGFTKKPRSPRMGKTAPTRKP------  101

Query  580   ESVNPVLPFVPEMGSDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMRGLEIPEF  759
                    P VPE+ + ++     ++ L  +VPVL  D  +  L    G+          +
Sbjct  102   ------FPQVPEVSAKEESEEQEQLLLH-RVPVLGADSKDGNLASFVGEKESSN----GY  150

Query  760   LSSDVELAEFAADVETLLGDD------DVGEDKATAA-----------------VKIEIN  870
             LS D++ AEFAADVE+LLG+       D+ E    A+                 +KIE  
Sbjct  151   LSYDMDPAEFAADVESLLGNSLDNECFDMEELGLVASKDHSLTNDDYSLNSHEIIKIE--  208

Query  871   GGDCTEALNWSFGEE----------------------QEVEQKVMMTMLSGFDessssme  984
               D  E L    G E                       E + K+MM +++      +   
Sbjct  209   -PDEIEVLTPMLGIEADTMREPFELNFMDFGSNPTTCSEEDDKMMMEVMA---VVKNGEL  264

Query  985   sgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHH--H  1158
                  + V  K ++ LSL+ E VI AW S+G PWT G RP+ D ++ WPD+MG      +
Sbjct  265   EMEETKIVKNKKKVSLSLDSEAVIIAWGSRGTPWTSGDRPNLDLDYYWPDYMGTYESDCY  324

Query  1159  HHPYG--SAMMMRRSDEG----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKG  1320
             + PYG   + + R++  G    REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KG
Sbjct  325   YQPYGEFGSGIGRQAVTGVEGEREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKG  384

Query  1321  RFVKRSSLFQPPP  1359
             RFVKRSS F PPP
Sbjct  385   RFVKRSSCFAPPP  397



>gb|KEH44219.1| zinc finger constans-like protein [Medicago truncatula]
Length=436

 Score =   241 bits (614),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 182/450 (40%), Positives = 228/450 (51%), Gaps = 84/450 (19%)
 Frame = +1

Query  220   MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  399
             M+   +  ANA+ GKTARACDSC++KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RV
Sbjct  1     MTCSSKNVANAVGGKTARACDSCITKRARWYCAADDAFLCQACDSSVHSANSLARRHERV  60

Query  400   RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  579
             RL             S   I  D+  +  P    GFT+K RTPR  K   K +S      
Sbjct  61    RL----------KTASYKSINGDEFFNCGP--FSGFTKKARTPRQGKHKSKSSSSSEPAR  108

Query  580   ESVNPVLPFVPEMGSDDDYNNN---NEIDLFCQVPVlldddlnallndgggddHMRGL--  744
              + N     VPE+G D+  +N+   NE  L  +VP+      +   +         GL  
Sbjct  109   NNNNIPFHLVPELGFDEVNSNSIEENEAQLLYRVPIFDPSIADLCTSPPSVCSTEGGLGV  168

Query  745   ----------------------------EIPEF---LSSDVELAEFAADVETLLGDDDVG  831
                                         E+  F   L SD+ELAEFAADVE+LLG     
Sbjct  169   VVVASAFAPDVKNNESESRVQLGSDNNYEMESFHGLLPSDIELAEFAADVESLLGRG--L  226

Query  832   EDKATAAVKIEINGGDCTEALNWSFG----EEQE-----VEQKVMMTM--LSGFDessss  978
             E++     ++ +      E+  W  G    EE E     VE   MM +   S F+ +   
Sbjct  227   ENECIGMEELGLIDTKHEESEKWKCGGKVKEEGEECYEVVEGDNMMEIGKESSFELNFDY  286

Query  979   mesgsckeeVAKKS--------------RMLLSLNYEEVISAWASQGCPWTDGTRPHFDP  1116
              +S    EEV +K               ++ L L+Y+ VI AW SQ CPWT+G +P  D 
Sbjct  287   DDSHETCEEVKEKCGEQNENNDYNKGKRKISLQLDYDAVIIAWDSQKCPWTNGDKPILDA  346

Query  1117  NHCWPDFMG--GDHHHHH-----PYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRY  1275
             +  WPD MG  G   H+       YG   +M   D GREARVSRYREKRRTRLFSKKIRY
Sbjct  347   DENWPDCMGTFGTEVHYAYGEFGGYGCHPVM--VDGGREARVSRYREKRRTRLFSKKIRY  404

Query  1276  EVRKLNAEKRPRLKGRFVKRSSLFQPPPPF  1365
             EVRKLNAEKRPR+KGRFVKR+S   P  P 
Sbjct  405   EVRKLNAEKRPRMKGRFVKRASFAVPTFPL  434



>ref|XP_008775153.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Phoenix dactylifera]
Length=420

 Score =   239 bits (611),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 176/452 (39%), Positives = 221/452 (49%), Gaps = 108/452 (24%)
 Frame = +1

Query  223   SSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVR  402
             S  QR +A A+  +TARACDSCL +RARW+C ADDAFLCQ+CD SVHSAN LA RH R+R
Sbjct  6     SDKQRFSAGALGARTARACDSCLRRRARWYCGADDAFLCQACDSSVHSANPLARRHHRLR  65

Query  403   LGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEE  582
             L             SS      + +D+PP W  GF RK RTPR     K   +G   +E 
Sbjct  66    L----------KTSSSSPPSTANSEDAPPPWLHGFRRKARTPRG----KPAPAGPPKLE-  110

Query  583   SVNPVLPFVPEMGSDDDYNNNNEIDL------------FCQVPVlldddlnallndgggd  726
                   P VP++ +D+      E  L            FC  P L +             
Sbjct  111   ------PLVPDLEADEKLYIEEEHLLYRVPIFDPVLAEFCSPPALDEASGLTDEAKPAVQ  164

Query  727   dHMRGLEIPEFLS------SDVELAEFAADVETLLG---DDDV-------------GEDK  840
                     P F +      SD++LAEFAADVE+LLG   DDD              G+DK
Sbjct  165   -QQPPEHAPVFAAAAGLHPSDLDLAEFAADVESLLGRGLDDDKFCIDALGLMDPAEGDDK  223

Query  841   ATAAVKIEINGGD----------------CTEALNWSFG----------EEQEVEQKVMM  942
                 +++++  G                   E L+  FG          E+Q+  ++  M
Sbjct  224   GRVKLELDVGAGGERSDIVACDIDMEIDLSRETLDLDFGCGSPAAVEELEDQKAAEEAAM  283

Query  943   TMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPN  1119
                 G              E VA   RM L L+YE VI+AW+ +GC PWTDG RP F+P+
Sbjct  284   ASGGG-----------CVTEAVAAGRRMTLRLDYEAVIAAWSCKGCSPWTDGERPQFNPD  332

Query  1120  HCWPDFMGGDHHHHH---------PYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIR  1272
              CWPDF G                P    + M   + GREA+V+RYREKRRTRLFSKKIR
Sbjct  333   DCWPDFAGMMWGGAGGGGGGGEVAPVYGEVGMVAGNGGREAKVTRYREKRRTRLFSKKIR  392

Query  1273  YEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  1368
             YEVRKLNAEKRPR+KGRFVKR++      PFP
Sbjct  393   YEVRKLNAEKRPRMKGRFVKRAAA-----PFP  419



>gb|AIE41596.1| zinc finger protein CONSTANS-LIKE 5 [Lagerstroemia indica]
Length=379

 Score =   238 bits (608),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 166/397 (42%), Positives = 212/397 (53%), Gaps = 48/397 (12%)
 Frame = +1

Query  253   ISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaa  432
             ++G++ARACD+C+ KRARW+C ADDAFLCQSCD SVHSAN LA RH+RVRL T+S ++  
Sbjct  1     MAGRSARACDNCVRKRARWYCAADDAFLCQSCDSSVHSANTLARRHERVRLKTASINSRT  60

Query  433   asllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVP  612
                    KI       S P W +GFTRKPRTPR+ K  K            +NP L  VP
Sbjct  61    FDDDDEMKI-----SVSVPTWDQGFTRKPRTPRHKKHGK-----------LLNP-LHLVP  103

Query  613   EMGSDD-DYNNNNEIDLFCQVPVlldddlnallndgggddHMRGL------------EIP  753
             EM S++  +  N+E+ L  +VPV    ++          ++                ++ 
Sbjct  104   EMCSEEHSHEENDEVQLLYRVPVFDPFEVAVNPIRNDDAENSNPFGSESKAATSIYYKMD  163

Query  754   E-FLSSDVELAEFAADVETLLGDDDVGEDKATAAVKI------EINGGDCTEALNWSFGE  912
             E  L S+++LAEFAADVE+LLG     E      + +      E    DC          
Sbjct  164   EGVLPSELDLAEFAADVESLLGKGLEDESFYMEELGLVDCHDYEKESKDCCLMSGRMVKV  223

Query  913   EQE----VEQKVMMTMLSGFDessssmesgsckeeVAKKSRM------LLSLNYEEVISA  1062
             E E    VE K  +  L+ FD +   ME    K     + +        L L+YE V+S+
Sbjct  224   EDEEIGDVEDKNQVFELN-FDLTCEEMEEEEYKPRNILEMKQDDFRSNFLKLDYEGVMSS  282

Query  1063  WASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGREARVSRYREKR  1242
             W  +  PWT G RP F+   CWPD +         YG   M+     GREARV RYREKR
Sbjct  283   WDDRKSPWTTGERPEFNSADCWPDSLVSASGAMQAYGGMAMVSGDARGREARVMRYREKR  342

Query  1243  RTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  1353
             RTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+ L  P
Sbjct  343   RTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRACLVAP  379



>ref|XP_010916170.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Elaeis 
guineensis]
Length=424

 Score =   238 bits (607),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 170/425 (40%), Positives = 221/425 (52%), Gaps = 75/425 (18%)
 Frame = +1

Query  232   QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  411
             QR +A A+  KTARACDSCL +RARW+C ADDA LCQ+CD SVHSAN LA RH R+RL T
Sbjct  9     QRSSAGALGAKTARACDSCLRRRARWYCAADDACLCQACDSSVHSANPLARRHHRLRLKT  68

Query  412   sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVN  591
             +S S  +++                  W  GF RK RTPR     K   +G   +E    
Sbjct  69    TSFSPPSSASSDDAPP----------PWLHGFRRKARTPRG----KPAPAGPPKLE----  110

Query  592   PVLPFVPEMGSDDDYNNNNEIDL------------FCQVPVlldddlnallndgggddHM  735
                P VP++ +D+  +   E  L            FC  P L D +              
Sbjct  111   ---PLVPDLEADEKLHTEEEHLLYRVPIFDPALAEFCSPPALDDANALTDEAKPAVQQPP  167

Query  736   RGLEIPE----FLSSDVELAEFAADVETLLG---DDDV-----------GEDKATAAVKI  861
                 +P     F  SD++LAEFAADVE+LLG   DDD             ED     VK+
Sbjct  168   EHAHVPAAAAGFHPSDLDLAEFAADVESLLGRGLDDDTFCIDALGLMDSAEDDNKGRVKV  227

Query  862   EIN---GGDCTEALNWSFGEEQEVEQKVM--------------MTMLSGFDessssmesg  990
             E++   GG+ T+ +      E ++ ++ +              +      +E++ + + G
Sbjct  228   ELDVDAGGERTDFVACDIDVEIDLSRETLDLDFGCGSPAAVEDLEEQEAAEEAAMASDGG  287

Query  991   sckeeVAKKSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMGGDHHHHH-  1164
                E VA   RM L L+YE VI+AW+ + C PWTDG RP F+P+ CWPDF G        
Sbjct  288   CGTEAVAAGRRMTLRLDYEAVIAAWSCKDCSPWTDGERPQFNPDDCWPDFTGMMWGGAGG  347

Query  1165  -----PYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFV  1329
                  P    + M   D GREA+V+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFV
Sbjct  348   GREVAPVYGELGMVAGDGGREAKVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV  407

Query  1330  KRSSL  1344
             KR++ 
Sbjct  408   KRAAF  412



>emb|CDY03851.1| BnaC07g10760D [Brassica napus]
Length=372

 Score =   236 bits (601),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 169/403 (42%), Positives = 208/403 (52%), Gaps = 78/403 (19%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +  A+A+  KTARACDSC+ +RARW+C ADDAFLCQSCD  VHSANLLA RH+RV L ++
Sbjct  2     KSLASAVGAKTARACDSCVKRRARWYCAADDAFLCQSCDTLVHSANLLARRHERVLLKSA  61

Query  415   ssstaaasllssPKIVddddddSPP----AWHRGFTRKPRTPRNAKRTKKQNSGGVAVEE  582
             S  +      S           SPP     WH GFTRKPRTPR +   KK N        
Sbjct  62    SKHSNHNHNHSP---------SSPPHEAATWHHGFTRKPRTPRGS--GKKNN--------  102

Query  583   SVNPVLPFVPEMGSDDDYNNNN-EIDLFCQVPVlldddlnallndgggddHMRGLEIP--  753
              ++     VPE+  +D       E  L CQVPVL       +LND         +E P  
Sbjct  103   -LSIFHALVPEISVEDQTEGCELEEQLICQVPVLDPTVAEQILNDVVEAK----IEFPIM  157

Query  754   --------------------EFLSSDVELAEFAADVETLLGDDDVGEDKATAAVKIEING  873
                                  F  + +EL E+AADVE+LLG    G D  + A+      
Sbjct  158   RSGVMMDDQEDEDNDESCLNGFFPTGMELEEYAADVESLLGR---GLDTESYAM------  208

Query  874   GDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEV  1053
                 E L + +      E++ +  + S  +  +   E         +K+ ++L LNYE V
Sbjct  209   ----EELGFDYESHNTYEEEALKNVESSGECITVKEEE--------QKNVLMLRLNYESV  256

Query  1054  ISAWASQGCPWTDGTRPHFDPN-HCWPDF-MGGD----HHHHHPYGSAMMMRRSDEGREA  1215
             IS W  QG PWT G  P  D +   WP   MGG+       HH  G        D GREA
Sbjct  257   ISTWGGQGPPWTSGEPPERDVDISGWPVVSMGGNVRESQQKHHVGGCLPSSGFGDGGREA  316

Query  1216  RVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
             RVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+SL
Sbjct  317   RVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASL  359



>gb|KFK44524.1| hypothetical protein AALP_AA1G267800 [Arabis alpina]
Length=407

 Score =   236 bits (601),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 170/422 (40%), Positives = 215/422 (51%), Gaps = 81/422 (19%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +  ANA+  KTARACDSC+ +RARW+C ADDAFLCQSCD  VHSAN LA RH+RVRL   
Sbjct  2     KSLANAVGAKTARACDSCVKRRARWYCAADDAFLCQSCDGLVHSANPLARRHERVRL---  58

Query  415   ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNP  594
                       S+   V    +     WH GFTRK RTPR          GG   +   + 
Sbjct  59    ---------KSASPAVAKHSNHEAATWHHGFTRKARTPR----------GGSGKKNHQSV  99

Query  595   VLPFVPEMGSDDDYNNNN---EIDLFCQVPVlldddlnallndgggdd----HMRGLEIP  753
                 VPE+  +D    ++   E  L CQVPVL        L D          MR ++  
Sbjct  100   FHDLVPEISVEDQTETDSYELEEQLICQVPVLDPMVAEQFLTDVVEPKIEFPMMRMIDDL  159

Query  754   E------------FLSSDVELAEFAADVETLLGD---------DDVGEDKA---------  843
             E            F  +D+EL EFAADVETLLG          +++G   +         
Sbjct  160   EEEDNVVESCLNGFFPTDMELEEFAADVETLLGRGLDNESYVMEELGLSNSEMFKIEKDE  219

Query  844   ------TAAVKIEINGGDCTEALNWSFGEE--QEVEQKVMMTMLSGFDessssmesgsck  999
                   + A+ +E    + T A   +F  E  +  E++V+ ++    +E     E     
Sbjct  220   DEEEDESKAMNMETFDENKTVAFELTFDYESHKTCEEEVIKSVERSSNECIKVKEEE---  276

Query  1000  eeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN--HCWPDF-MG--GDHHHHH  1164
                 +K+ ++L LNY+ VIS W  QG PW+ G RP  D +  + WP   MG  G   H  
Sbjct  277   ----QKNVLMLRLNYDSVISTWGGQGPPWSPGERPELDIDIINTWPSVSMGENGGESHQK  332

Query  1165  PYGSAMMMRR--SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  1338
             P+    +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRS
Sbjct  333   PFVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRS  392

Query  1339  SL  1344
             SL
Sbjct  393   SL  394



>ref|XP_007222133.1| hypothetical protein PRUPE_ppa005713mg [Prunus persica]
 gb|EMJ23332.1| hypothetical protein PRUPE_ppa005713mg [Prunus persica]
Length=447

 Score =   237 bits (604),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 181/454 (40%), Positives = 225/454 (50%), Gaps = 99/454 (22%)
 Frame = +1

Query  226   SDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  405
             S  +K ANA+  KTARACDSC+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RV L
Sbjct  2     SSNKKVANAVGAKTARACDSCIRKRARWYCAADDAFLCQACDSSVHSANQLARRHERVLL  61

Query  406   GtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEES  585
              T+SS             V   D+ + P+WH GFTRK RTPR  K            +E 
Sbjct  62    KTASSVKPTDKDDQ----VSVSDNPAAPSWHGGFTRKARTPRQGKHKS---------QEG  108

Query  586   VNPVLPFVPEMGSDDD--YNNNNEID---LFCQVPVlldddlnallndgggddHMRGL--  744
                  P VPE+G+DD   Y+  NE D   L  +VPV               + +   +  
Sbjct  109   ARNRFPQVPEVGADDSNSYDEENEEDQQQLLYRVPVFDPFVAEMCTATTSANSNEEAVAN  168

Query  745   ---------EIPEF---------LSSDVELAEFAADVETL---------------LGDDD  825
                        P +         L SD++LAEFAADV+++               LG  D
Sbjct  169   TCDVSKVSSSSPNYNHNGRDGFLLPSDMDLAEFAADVDSMLGRGLEDDECFGMEGLGLMD  228

Query  826   VGEDKATAAVKIE--------------INGGDCTEA-------------LNW--------  900
               E+++   VK+E              +N   C                LN+        
Sbjct  229   SKENESNCRVKLEDEEEEEEEEGGTGGVNFMGCELGETPEIDMMREPFVLNFEDYDDSPQ  288

Query  901   SFGEEQEVEQKVMM-TMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQG  1077
             S GE+ +     MM T  SG  +     E  +   +  KK  + L L+YE VI+AW   G
Sbjct  289   SCGEQDDKLGVGMMDTTYSG--DHQQHEEVHTGASKSGKKKEIFLRLDYEAVITAW--DG  344

Query  1078  CPWTDGTRPHFDPNHCWPDFMG-GDHHHHHPYGS----AMMMRRSDEGREARVSRYREKR  1242
              PWT G RP F  + C PD MG      H+PYG      +    +D GREARVSRYREKR
Sbjct  345   SPWTSGGRPDFS-SECLPDCMGVCGTELHYPYGDLNGLGVHPAMADGGREARVSRYREKR  403

Query  1243  RTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
             RTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S 
Sbjct  404   RTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF  437



>ref|XP_003630849.1| CONSTANS-like zinc finger protein [Medicago truncatula]
 gb|AET05325.1| zinc finger constans-like protein [Medicago truncatula]
Length=416

 Score =   235 bits (600),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 168/424 (40%), Positives = 214/424 (50%), Gaps = 66/424 (16%)
 Frame = +1

Query  244   ANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtssss  423
             A A+  KTARACDSCL +RARWFC ADDAFLC  CD  VHSANLLASRH+RVRL      
Sbjct  11    AGALGAKTARACDSCLRRRARWFCAADDAFLCHGCDNLVHSANLLASRHERVRL------  64

Query  424   taaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESV--NPV  597
                       +        +  AWH GFTRK RTPR+ K +  Q       E+ +     
Sbjct  65    ----------QTASAKVTTTAQAWHSGFTRKARTPRHNKNSSIQQQQQRLKEKVLFNTSF  114

Query  598   LPFVPEMGSDD--------DYNNNNEIDLFCQVPVlldd--dlnallndgggddHMRGLE  747
             LP VPE+G ++        D +  +E  L C+VPV   +  DL          D     +
Sbjct  115   LPLVPELGGEEEQGQELLVDIDEADEEQLLCRVPVFDANPFDLETCTVKNDAVDFEEMCD  174

Query  748   IPEFLSSDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVE  927
             +  F   DV+LAEFAA+VE+LLG   VG  +       ++        ++ S  E  +V+
Sbjct  175   LDSFCEFDVDLAEFAANVESLLG---VGSSEIQENSSGQVFDYKQENEMDASKSEMLKVK  231

Query  928   QKVMMTMLSGFDess-------------------------ssmesgsckeeVAK---KSR  1023
              + +  + S FD +S                         S+   G  +  + K   K  
Sbjct  232   DEELDDLESVFDMTSDDVFHWNIDNNDVSLAQQEKEYMPLSNSSVGYSESVITKEETKRE  291

Query  1024  MLLSLNYEEVISAWASQG--CPWTDGTRPHFD-PNHCWPDFMG--GDHHHHHPYGSAMMM  1188
               L LNYEEVI+ W+ QG   PWT    P F+  +  W + +G  G           +M 
Sbjct  292   RFLRLNYEEVITEWSRQGSPSPWTTANPPKFNCDDDSWQNLLGSSGVEGEVRSLRGQLMG  351

Query  1189  RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ-PPPPF  1365
                D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR++ F      F
Sbjct  352   SGGDGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTACFAGGATSF  411

Query  1366  P-NY  1374
             P NY
Sbjct  412   PTNY  415



>ref|XP_009105041.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1 
[Brassica rapa]
 ref|XP_009105042.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Brassica rapa]
Length=402

 Score =   235 bits (599),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 170/424 (40%), Positives = 217/424 (51%), Gaps = 82/424 (19%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +  ANA+ GKTARACDSC+ KRARW+C ADDAFLC SCD SVHSAN LA RH+RVRL T+
Sbjct  3     KSLANAVGGKTARACDSCVKKRARWYCAADDAFLCHSCDSSVHSANPLACRHERVRLKTA  62

Query  415   ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNP  594
             S+     +  S P          P  WH+GFTRK RTPR  K++                
Sbjct  63    SAGKHRHASSSPPH---------PATWHQGFTRKARTPRGGKKSHTM------------V  101

Query  595   VLPFVPEMGSDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMRGLEIPE------  756
                 VPEM S+D      E  +F +VPVL        L +      M  +          
Sbjct  102   FHDLVPEMSSEDQRYEVEEQLIF-EVPVLNPMGNEQCLKETKIVFPMMPVCFKSNEEEDD  160

Query  757   --------FLSSDVELAEFAADVETLLGDDDVGEDKATAAVKI-----------------  861
                        +++ELA+F+ADVETLLG     E  A   +                   
Sbjct  161   NTESCLNGLFPTEMELAQFSADVETLLGGGTDREFHAMEEIGFGEMLKIEKEEVKEEEEV  220

Query  862   ------EINGGDCTEALNWSFG---------EEQEVEQKVMMTMLS-GFDessssmesgs  993
                   +++  + T     SF          EE + ++ VM  ++  G +E +  ++   
Sbjct  221   ATREVCDLDDANETSPFEISFDYESSHKTAFEEDDEKEDVMKNLVDVGVNEVTGRIKEEK  280

Query  994   ckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH--CWPDFM---GGD-HH  1155
                   K+  ++L L+YE VIS W SQG PWT       D +   C  + M   GG+ HH
Sbjct  281   ------KEKVLMLRLDYETVISTWGSQGTPWTALKPSEIDLDMLCCQTNSMCESGGEAHH  334

Query  1156  HHHPYGSAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVK  1332
             H+H  G  + MR + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVK
Sbjct  335   HNHFPGLGLHMREAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVK  394

Query  1333  RSSL  1344
             RSS+
Sbjct  395   RSSI  398



>emb|CDY44890.1| BnaA02g13920D [Brassica napus]
Length=401

 Score =   234 bits (598),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 164/416 (39%), Positives = 211/416 (51%), Gaps = 67/416 (16%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +  AN + GKTARACDSCL +RARW+C ADDAFLC SCD SVHSAN LA RH+RV L ++
Sbjct  3     KNLANVVGGKTARACDSCLKRRARWYCAADDAFLCHSCDGSVHSANPLARRHERVLLKSA  62

Query  415   ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTK-----------KQNS  561
             S         S P          PP WH+GFTRK RTPR  K++                
Sbjct  63    SPGKQRHDSSSPPH---------PPTWHQGFTRKARTPRGGKKSHTMIFHDLVPEMSSED  113

Query  562   GGVAVEESVNPVLPFVPEMGSDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMRG  741
                 VEE +   +P +  M  +   N + E  +  ++P++      +   D   +  + G
Sbjct  114   QSFEVEEQLIFEVPVLNPMSHEKCLNESVETKI--ELPLMSMCFKGSDEEDDNAESCLNG  171

Query  742   LEIPEFLSSDVELAEFAADVETLLG----------DDDVGE-----------DKATAAVK  858
             L       +D ELA+F+ADVE LLG          +  +GE           ++  A + 
Sbjct  172   L-----FPTDTELAQFSADVEILLGGGTDREYNMEELGLGEMLKVEKEEVDEEEEVATID  226

Query  859   I-EINGGDCTEALNWSFG---------EEQEVEQKVMMTMLSGFDessssmesgsckeeV  1008
             + +++  D       SF          EE++ +Q V   +L       S        E+V
Sbjct  227   VCDLDAADEITPFVISFENEYSQKTNLEEEDEKQDVENNILDVGVNEMSCSIKEEKNEKV  286

Query  1009  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH--CWPDFM--GGDHHHHHPYGS  1176
                   +L L+YE VIS W  QG PWT    P  D N   C  D M   G   HHH Y  
Sbjct  287   H-----MLRLDYESVISTWGGQGTPWTARETPQIDLNMLCCPTDSMVESGGEAHHHNYVR  341

Query  1177  AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
              + +   + GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  342   GLGLHMGEAGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  397



>emb|CDY65591.1| BnaC05g50730D [Brassica napus]
Length=348

 Score =   232 bits (592),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 170/397 (43%), Positives = 201/397 (51%), Gaps = 96/397 (24%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +  ANA+  KTARACDSC+ KRARW+C ADDAFLCQSCD  VHSAN LA RH+RVRL ++
Sbjct  2     KNLANAVGAKTARACDSCVKKRARWYCAADDAFLCQSCDTLVHSANPLARRHERVRLKSA  61

Query  415   ssstaaasllssPKIVddddddSPP----AWHRGFTRKPRTPRNAKRTKKQNSGGVAVEE  582
             S      S  +           SPP     WH+GFTRKPRTPR +   KK N        
Sbjct  62    SPVATKYSSHNH-------SASSPPLEAATWHQGFTRKPRTPRGS--GKKNN--------  104

Query  583   SVNPVLPFVPEMGSDDDYNNNNEID--LFCQVPVlldddlnallndgggddHMRGLEIP-  753
              ++     VPE+ S +D  ++ EI+  L CQVPVL        LND         +E P 
Sbjct  105   -LSIFHDLVPEI-SAEDQTDSYEIEELLICQVPVLDPMVAEQFLNDVIEPK----IEFPM  158

Query  754   -----------------EFLSSDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDC  882
                               F  +D+EL EFAADVE LL            A+ + I    C
Sbjct  159   ITIDDQEDEDNAESCLNGFFPTDMELEEFAADVEILL------------AMNMGIG---C  203

Query  883   TEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISA  1062
              E      G  +E EQK ++                            +LSLNYE VIS 
Sbjct  204   GEDRGDGDGTVKEEEQKNVL----------------------------MLSLNYESVIST  235

Query  1063  WASQGCPWTDGTRPHFDPNH-----CWPDFMGGDHHHHHPYGSAMMMRR-SDEGREARVS  1224
             W  QG PW  G  P  D +         +  GG+ HH H  G  +      D GREARVS
Sbjct  236   WGGQGQPWMSGEPPERDIDISDKPVVSMEINGGESHHKHYVGGCLPSSGFGDGGREARVS  295

Query  1225  RYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
             RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  296   RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  332



>emb|CDX81527.1| BnaC02g18310D [Brassica napus]
Length=401

 Score =   234 bits (596),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 166/416 (40%), Positives = 210/416 (50%), Gaps = 67/416 (16%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +  AN + GKTARACDSCL +RARWFC ADDAFLC SCD SVHSAN LA RH+RV L ++
Sbjct  3     KNLANVVGGKTARACDSCLKRRARWFCAADDAFLCHSCDGSVHSANPLARRHERVLLKSA  62

Query  415   ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTK-----------KQNS  561
             S         S P          PP WH+GFTRK RTPR  K++                
Sbjct  63    SPGKQRHDSSSPPH---------PPTWHQGFTRKARTPRGGKKSHTMIFHDLVPEMSSED  113

Query  562   GGVAVEESVNPVLPFVPEMGSDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMRG  741
                 VEE +   +P +  M  +   N + E  +  ++P++      +   D   +  + G
Sbjct  114   QSFEVEEQLIFEVPVLNPMCHEKCLNESVESKI--ELPLMSMCFKGSDEEDDNAESCLNG  171

Query  742   LEIPEFLSSDVELAEFAADVETLLG----------DDDVGE---------DKATAAVKIE  864
             L       +D ELA+F+ADVE LLG          +  +GE         ++      IE
Sbjct  172   L-----FPTDTELAQFSADVEILLGGGTDREYNMEELGLGEMLKVEKEEVEEEEELATIE  226

Query  865   INGGDCTEALN---WSFG---------EEQEVEQKVMMTMLSGFDessssmesgsckeeV  1008
             +   D  + +     SF          EE++ +Q V   M+       S        E+V
Sbjct  227   VCDLDVADEITPFVISFEYEYSQKTNLEEEDEKQDVENNMIDVGVNEMSCSIKEEKNEKV  286

Query  1009  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH--CWPDFM--GGDHHHHHPYGS  1176
                   +L L+YE VIS W  QG PWT    P  D N   C  D M   G   HHH Y  
Sbjct  287   H-----MLRLDYESVISTWGGQGTPWTAREPPQIDLNMLCCPTDSMVESGGEAHHHNYVR  341

Query  1177  AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
              + +   + GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  342   GLGLHMGEAGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  397



>emb|CDY51133.1| BnaA07g37160D [Brassica napus]
Length=377

 Score =   232 bits (592),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 169/405 (42%), Positives = 210/405 (52%), Gaps = 77/405 (19%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +  A+A+  KTARACDSC+ +RARW+C ADDAFLCQSCD  VHSANLLA RH+RV L ++
Sbjct  2     KSLASAVGAKTARACDSCVKRRARWYCAADDAFLCQSCDTLVHSANLLARRHERVLLKSA  61

Query  415   ssstaaasllssPKIVddddddSPP----AWHRGFTRKPRTPRNAKRTKKQNSGGVAVEE  582
             S  +      S           SPP     WH GFTRKPRTPR +   KK N        
Sbjct  62    SKHSNHNHNHSP---------SSPPHEAATWHHGFTRKPRTPRGS--GKKNN--------  102

Query  583   SVNPVLPFVPEMGSDDDYNNNN-EIDLFCQVPVlldddlnallndgggddHMRGLEIP--  753
              ++     VPE+  +D   +   E  L CQVPVL       +LND         +E P  
Sbjct  103   -LSIFHDLVPEISVEDQTESCELEEQLICQVPVLDPTVAEQILNDVVEAK----IEFPIM  157

Query  754   --------------------EFLSSDVELAEFAADVETLLGDDDVG--EDKATAAVKIEI  867
                                  F  +D+EL E+AADVETLL D ++G  +D   A    E 
Sbjct  158   RSGVMMDDQEDEDNAESCLNGFFPTDMELEEYAADVETLL-DMNIGICDDDRDATAPFE-  215

Query  868   NGGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYE  1047
                     L++ +      E++V+  +    +      E         +K+ ++L LNY+
Sbjct  216   --------LSFDYESHNTYEEEVIKNIEGSGECVKVKEEE--------QKNVLMLRLNYD  259

Query  1048  EVISAWASQGCPWTDGTRPHFDPN-HCWPDF-MGGD----HHHHHPYGSAMMMRRSDEGR  1209
              VIS W  QG PWT G  P  D +   WP   MGG+       HH           D GR
Sbjct  260   SVISTWGGQGPPWTSGEPPERDIDISSWPFVSMGGNVRESQQKHHVGVCLPSSGFGDGGR  319

Query  1210  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
             EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+SL
Sbjct  320   EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASL  364



>ref|XP_010527538.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Tarenaya 
hassleriana]
Length=443

 Score =   234 bits (596),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 182/453 (40%), Positives = 231/453 (51%), Gaps = 106/453 (23%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             + +ANA+ GKTARACDSC+ +RARW+C +DDAFLCQ+CD SVHSAN LA R +RVRL   
Sbjct  2     KSSANAVGGKTARACDSCVKRRARWYCPSDDAFLCQACDGSVHSANPLARRPERVRL---  58

Query  415   ssstaaasllssPKIVddddddSPPA---WHRGFTRKPRTPRNAKRTKKQNSGGVAVEES  585
                +A++S    P  V      SPP    WH GFTRK RTPR +    K N   V   + 
Sbjct  59    --KSASSSRTHRPTTV------SPPGTAKWHHGFTRKARTPRGSGSAGKPNQRAVFFHD-  109

Query  586   VNPVLPFVPEMGSDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMRGLEIPE---  756
                    VPE+  +D   N  E  L  QVPVL         +D   +    G  +PE   
Sbjct  110   ------LVPEISVEDQTENYEEEQLIFQVPVLDPTVSEQYRDDAIEEK--TGFPLPELIK  161

Query  757   -------------------FLSSDVELAEFAADVETLLG---------------------  816
                                F  +D+ELAEFAADV+TLLG                     
Sbjct  162   FADMNEENDEDNAESCLDRFFPTDMELAEFAADVDTLLGHNLETESFATEDLGLGDGLSV  221

Query  817   ------------DDDVGEDKATA------AVKIEINGGDCT--------EALNWSFGEEQ  918
                         ++DV E++  A       +  E  G D T        +  + +F EE+
Sbjct  222   CGRSSSMMLKLENEDVHEEETVAREGTPMELFYERKGMDMTPFELSFDQDHSHRAFEEEE  281

Query  919   EVEQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGT  1098
             E E+K ++ + +G  ES  S  S +    + KK+ ++L LN+E VIS W  +G PWT G 
Sbjct  282   EDEEKNVINVNTGERESVRSGGSSNISHSIKKKNVLMLRLNHEAVISTWGGKGPPWTAGK  341

Query  1099  RPHFD-PNHCWPDFMG--GDHHHHHPYGS--------AMMMRRSDEGREARVSRYREKRR  1245
              P  D  ++ W   MG  G+      YG         A MM   D GREARVSRYREKRR
Sbjct  342   PPELDLDDNSWHISMGENGNEVPLDRYGGRFCGLGLQAAMM---DGGREARVSRYREKRR  398

Query  1246  TRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
             TRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S+
Sbjct  399   TRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASI  431



>emb|CDY67920.1| BnaAnng25560D [Brassica napus]
Length=348

 Score =   231 bits (588),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 167/397 (42%), Positives = 199/397 (50%), Gaps = 96/397 (24%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +  ANA+  KTARACDSC+ KRARW+C ADDAFLCQSCD  VHSAN LA RH+RVRL ++
Sbjct  2     KNLANAVGAKTARACDSCVKKRARWYCAADDAFLCQSCDTLVHSANPLARRHERVRLKSA  61

Query  415   ssstaaasllssPKIVddddddSPP----AWHRGFTRKPRTPRNAKRTKKQNSGGVAVEE  582
             S      S  +            PP     WH+GFTRKPRTPR +   KK N        
Sbjct  62    SPVATKYSSHNH-------SASCPPLEAATWHQGFTRKPRTPRGS--GKKNN--------  104

Query  583   SVNPVLPFVPEMGSDDDYNNNN-EIDLFCQVPVlldddlnallndgggddHMRGLEIPE-  756
              ++     VPE+ ++D  ++   E  L CQVPVL        LND         +E P  
Sbjct  105   -LSIFHDLVPEISAEDQTDSYEIEEQLICQVPVLDPMVAEQFLNDVVEPK----IEFPMI  159

Query  757   -----------------FLSSDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCT  885
                              F  +D+EL EFAADVE LL                 +N G C 
Sbjct  160   TIDDQEDEDNAESCLNGFFPTDMELEEFAADVEILLA----------------MNMGICC  203

Query  886   EAL-NWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISA  1062
             EA+ N    + +E EQK ++                            +LSLNYE VIS 
Sbjct  204   EAIKNADCIKVEEEEQKNVL----------------------------MLSLNYESVIST  235

Query  1063  WASQGCPWTDGTRPHFDPNH-----CWPDFMGGDHHHHHPYGSAMMMRR-SDEGREARVS  1224
             W  QG PW     P  D +         +  GG+ HH H  G  +      D GREARVS
Sbjct  236   WGGQGQPWLSREPPERDIDISDKPVVSMEINGGESHHKHYVGGCLPSSGFGDGGREARVS  295

Query  1225  RYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
             RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  296   RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  332



>ref|XP_010667660.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Beta vulgaris 
subsp. vulgaris]
Length=429

 Score =   233 bits (595),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 171/454 (38%), Positives = 222/454 (49%), Gaps = 99/454 (22%)
 Frame = +1

Query  220   MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  399
             M SD +K ANA+SGKTARACD C+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RV
Sbjct  1     MISD-KKIANAVSGKTARACDCCIRKRARWYCPADDAFLCQTCDSSVHSANQLARRHERV  59

Query  400   RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  579
             RL T+S   +     +             P+WHRG TRKPRTPR+ K   K         
Sbjct  60    RLKTASLRRSDDHQQT-----------DIPSWHRGLTRKPRTPRHGKHQSKT--------  100

Query  580   ESVNPVLPFVPEMGSDDDYNNNN----EIDLFCQVPVlldddlnallndgggddHMRGLE  747
             E  NP+   VPE+G +D  ++ +    E  L  +VP+      + +           GL+
Sbjct  101   EERNPLHVIVPELGMEDSSSSQDGETEEEHLLYRVPIYDPFIADDIRPMELEG----GLD  156

Query  748   IPE------------FLSSDVELAEFAA--------------------------------  795
               +            +L SD++L EFAA                                
Sbjct  157   TAKCMFNNSKSSPDGYLPSDIDLEEFAADVETLLGKGLDDESYGIEELGLLGCSINNNEI  216

Query  796   -DVETLLGDDDVGEDKATAAVKIEI----NGGDCTEALNWSFG-----------EEQEVE  927
              D+E ++ ++    D+     + EI    N     E   +SF            ++ E +
Sbjct  217   HDIEKIIKEEGELGDEGEMIRRCEIEADSNSLVIKEPFEFSFDYDDHYFGTMCEDDVEDQ  276

Query  928   QKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPH  1107
             +KV+M   S  +E S        +    K+ ++LL L+YE +  AWAS G PW +G RP 
Sbjct  277   KKVIMIEQSMGNELSKIEGDDETEN---KRRKILLRLDYEAISDAWASHGSPWINGQRPQ  333

Query  1108  FDPNHCWPDFMG--GDHHHHHPYGSAMMMRRSDEG------REARVSRYREKRRTRLFSK  1263
              + + CWP  M   G    H  +G   M             REARVSRYREKRRTRLFSK
Sbjct  334   INSDDCWPHCMATCGLEGRHPIFGDHQMGGMGGNRGIGDGGREARVSRYREKRRTRLFSK  393

Query  1264  KIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPF  1365
             KIRYEVRKLNAEKRPR+KGRFVKRSS       F
Sbjct  394   KIRYEVRKLNAEKRPRMKGRFVKRSSFTAATTAF  427



>ref|XP_004164163.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
sativus]
Length=375

 Score =   231 bits (589),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 161/402 (40%), Positives = 221/402 (55%), Gaps = 55/402 (14%)
 Frame = +1

Query  220   MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  399
             M++ +     A  GKTARACDSC+SKRARW+C ADDAFLCQ+CD SVHSAN LA RH+RV
Sbjct  1     MTTRKSVERTAEGGKTARACDSCISKRARWYCAADDAFLCQACDASVHSANSLARRHERV  60

Query  400   RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  579
             RL              +       D+ S  +WH+GFT+KPR+PR  K    +        
Sbjct  61    RL-------------QTASFRPSSDNSSAASWHQGFTKKPRSPRMGKTAPTRKP------  101

Query  580   ESVNPVLPFVPEMGSDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMRGLEIPEF  759
                    P VPE+ + ++     ++ L  +VPVL  D  +  L    G+          +
Sbjct  102   ------FPQVPEVSAKEESEEQEQLLLH-RVPVLGADSKDGNLASFVGEKESSN----GY  150

Query  760   LSSDVELAEFAADVETLLGDD------DVGEDKATAAVKIEINGGDCTEALNWSFGEEQE  921
             LS D++ AEFAADVE+LLG+       D+ E    A+    +   D +  LN     + E
Sbjct  151   LSYDMDPAEFAADVESLLGNSLDNECFDMEELGLVASKDHSLTNDDYS--LNSHEIIKIE  208

Query  922   VEQKVMMTMLSGFDessssmesgsckeeVA--------KKSRMLLSLNYEEVISAWASQG  1077
              ++  ++T + G +  +          +          +  +M++ +    V +AW S+G
Sbjct  209   PDEIEVLTPMLGIEADTMREPFELNFMDFGSNPTTCSEEDDKMMMEV-MAVVKNAWGSRG  267

Query  1078  CPWTDGTRPHFDPNHCWPDFMGGDHH--HHHPYG--SAMMMRRSDEG----REARVSRYR  1233
              PWT G RP+ D ++ WPD+MG      ++ PYG   + + R++  G    REARVSRYR
Sbjct  268   TPWTSGDRPNLDLDYYWPDYMGTYESDCYYQPYGEFGSGIGRQAVTGVEGEREARVSRYR  327

Query  1234  EKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPP  1359
             EKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKRSS F PPP
Sbjct  328   EKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRSSCFAPPP  369



>ref|XP_009127638.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Brassica rapa]
Length=401

 Score =   232 bits (591),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 162/416 (39%), Positives = 212/416 (51%), Gaps = 67/416 (16%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             + +AN + GKTARACDSCL +RARW+C ADDAFLC SCD S+HSAN LA RH+RV L ++
Sbjct  3     KNSANVVGGKTARACDSCLKRRARWYCAADDAFLCHSCDGSIHSANPLARRHERVLLKSA  62

Query  415   ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTK-----------KQNS  561
             S         S P          PP WH+GFTRK RT R  K++                
Sbjct  63    SPGKQRHDSSSPPH---------PPTWHQGFTRKARTRRGGKKSHTMIFHDLVPEMSSED  113

Query  562   GGVAVEESVNPVLPFVPEMGSDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMRG  741
                 VEE +   +P +  M  +   N + E  +  ++P++      +   D   +  + G
Sbjct  114   QSFEVEEQLIFEVPVLNPMCHEKCLNESMETKI--ELPLMSMCFKGSDEEDDNAESCLNG  171

Query  742   LEIPEFLSSDVELAEFAADVETLLG----------DDDVGE-----------DKATAAVK  858
             L       +D ELA+F+ADVE LLG          +  +GE           ++  A ++
Sbjct  172   L-----FPTDTELAQFSADVEILLGGGTDREYNMEELGLGEMLKVEKEEVEEEEEVATIE  226

Query  859   I-EINGGDCTEALNWSFG---------EEQEVEQKVMMTMLSGFDessssmesgsckeeV  1008
             + +++  D       SF          EE++ +Q V   M+       S        E+V
Sbjct  227   VCDLDAADEITPFVISFEYEYSQKTNLEEEDEKQDVENNMIDVGVNEMSCSIKEEKNEKV  286

Query  1009  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH--CWPDFM--GGDHHHHHPYGS  1176
                   +L L+YE VIS W  QG PWT    P  D N   C  D M   G   HHH Y  
Sbjct  287   H-----MLRLDYESVISTWGGQGTPWTARETPQIDLNMLCCPTDSMVESGGEAHHHNYVR  341

Query  1177  AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
              + +   + GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  342   GLGLHMGEAGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  397



>ref|XP_008802436.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Phoenix 
dactylifera]
Length=440

 Score =   233 bits (593),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 170/431 (39%), Positives = 223/431 (52%), Gaps = 74/431 (17%)
 Frame = +1

Query  226   SDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  405
             SD++++A A+  KTARACDSCL +RARW+C ADDAFLC +CD SVHSAN LA RH R+RL
Sbjct  7     SDEQRSARALGAKTARACDSCLRRRARWYCAADDAFLCMACDASVHSANPLARRHHRLRL  66

Query  406   GtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEES  585
               SSSS++     +S   +        P W  GF R  RTPR     K   +G   +E  
Sbjct  67    KISSSSSSPPPSSNSDDAL--------PPWLHGFKRGARTPR----IKPTMAGPPKLE--  112

Query  586   VNPVLPFVPEMGSDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMRG------LE  747
                  P VP++ +D+  +   E  L+ +VP+               D           ++
Sbjct  113   -----PLVPDLEADEKLHAEEEYLLY-RVPIFDPVLAEFCSPPAINDADTLADEAKPVVQ  166

Query  748   IPE---------------FLSSDVELAEFAADVETLLG---DD-----------DVGEDK  840
             +PE               F S+D++LAEF ADVETLLG   DD           +  ED 
Sbjct  167   LPEHAHVAAAAAADSLAGFHSTDLDLAEFVADVETLLGRGLDDGAFCIDGLGLMNSAEDD  226

Query  841   ATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessss--------------  978
                 VK+E++ G  ++ +  +   E    +K +  +  GF   ++               
Sbjct  227   GKGRVKVELDIGAGSDVMACTIDMEINPSRKTL-DLDFGFRSPAAGEELEEQKAAEEAAM  285

Query  979   -mesgsckeeVAKKSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMGGDH  1152
                 G   E VA    M+L L+YE VI+AW+  GC PWTDG RP F+P+ C P F G   
Sbjct  286   ASGGGCGVETVAAGRGMILKLDYEAVIAAWSCNGCSPWTDGERPQFNPDDCCPIFTGMMW  345

Query  1153  HHHHPYGSA--MMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  1326
                   G A  + M     GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRF
Sbjct  346   SGGVGEGDAGEVGMMAGGGGREARVARYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  405

Query  1327  VKRSSLFQPPP  1359
             VKR++     P
Sbjct  406   VKRTAFSAAGP  416



>ref|XP_008243227.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Prunus mume]
Length=451

 Score =   233 bits (593),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 178/457 (39%), Positives = 220/457 (48%), Gaps = 101/457 (22%)
 Frame = +1

Query  226   SDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  405
             S  +K AN++  KTARACDSC+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RV L
Sbjct  2     SSNKKVANSLGAKTARACDSCIRKRARWYCAADDAFLCQACDSSVHSANQLARRHERVLL  61

Query  406   GtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEES  585
              T+SS             V   D+ + P+WHRGF RK RTPR  K            +E 
Sbjct  62    KTASSLKPTDKDDQ----VSVSDNPAAPSWHRGFRRKARTPRQGKHK---------CQEG  108

Query  586   VNPVLPFVPEMGSDDD--YNNNNEID---LFCQVPVlldddlnallndgggddHMRGLEI  750
                  P VPE+G+DD   Y+  NE D   L  +VPV               + +   +  
Sbjct  109   SRNRFPQVPEVGADDSNSYDEENEEDQQQLLYRVPVFDPFVAEMCTATTSANSNEEAVAN  168

Query  751   PEF-------------------------LSSDVELAEFAADVETL---------------  810
              E                          L SD++LAEFAADV++L               
Sbjct  169   YELANTGDVSKVSSSSPNYNHNGHDGFLLPSDMDLAEFAADVDSLLGKGLEDDECFGMEG  228

Query  811   LGDDDVGEDKATAAVKIE-------------INGGDCTEA-------------LNW----  900
             LG  D  E+++   VK+E             +N   C                LN+    
Sbjct  229   LGLMDSKENESNCRVKLEDEEEEDEEGGTGGVNFMGCELGETPEIDMMREPFVLNFEDYD  288

Query  901   ----SFGEEQEVEQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWA  1068
                 S GE+ +     MM      D            +  +KK  + L L+YE VI+AW 
Sbjct  289   DSPQSCGEQDDKLGVGMMDNTYSGDHQQHEEVHAGASKS-SKKKEIFLRLDYEAVITAW-  346

Query  1069  SQGCPWTDGTRPHFDPNHCWPDFMG-GDHHHHHPYGSAMMM----RRSDEGREARVSRYR  1233
               G PWT G RP F+ + C PD MG      H PYG    +      +D GREARVSRYR
Sbjct  347   -DGSPWTSGGRPDFN-SECLPDCMGVCGTELHFPYGDLNGLWVHPAIADGGREARVSRYR  404

Query  1234  EKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
             EKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S 
Sbjct  405   EKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF  441



>ref|XP_004512860.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Cicer arietinum]
Length=405

 Score =   231 bits (589),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 171/417 (41%), Positives = 210/417 (50%), Gaps = 60/417 (14%)
 Frame = +1

Query  244   ANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtssss  423
             + A+  KTARACDSCL +RARWFC ADDAFLC  CD  VHSAN LASRH+RVRL      
Sbjct  7     SGALGAKTARACDSCLRRRARWFCGADDAFLCHGCDTLVHSANQLASRHERVRLQ-----  61

Query  424   taaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESV----N  591
                                +  AWH GFTRK RTPR+  +          ++E V    +
Sbjct  62    ------------TASAKVTTAQAWHSGFTRKARTPRHHNKNLLLQQKQQRLKEKVLFNTS  109

Query  592   PVLPFVPEMGSDDDYNNNNEID-----------LFCQVPVlldd--dlnallndgggddH  732
               LP VPE+G ++++     +D           L C+VPV   D  DL          D 
Sbjct  110   VFLPLVPEIGGEEEHEPALVVDDHEAEEEEEEQLMCRVPVFDVDPFDLETCNLKNDAADF  169

Query  733   MRGLEIPEFLSSDVELAEFAADVETLLGDDDVGEDKATAAV--KIEINGGDCT--EALNW  900
                 ++  F+  DV+LAEFAA+VE+LLG   V E+  T     K E N  D +  E L  
Sbjct  170   EEMCDLDSFVEFDVDLAEFAANVESLLG---VHENSTTQVFDYKQENNEMDASKNEMLKV  226

Query  901   SFGEEQEVEQKVMMTMLSGF----DessssmesgsckeeVAK-------KSRMLLSLNYE  1047
                E  ++E    MT    F    D ++ ++     +  V         K    L LNYE
Sbjct  227   KDEELDDLESVFDMTSDEVFQWNIDCNNETVAQEEKECVVGSFDAKEETKRERFLRLNYE  286

Query  1048  EVISAWASQG--CPWTDGTRPHF-DPNHCWPDFMGG---DHHHHHPYGSAMMMRRSDEGR  1209
             +VISAW  QG   PWT G  P F   + CW +F+G    D       G  +     D GR
Sbjct  287   DVISAWNIQGSPSPWTTGNPPKFISHDDCWQNFLGPSGVDEEVRSLRGQLIGNINGDGGR  346

Query  1210  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR--SSLFQPPPPFPNY  1374
             EARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR           FP Y
Sbjct  347   EARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTTCFAGTTTTSFPTY  403



>ref|XP_003530677.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Glycine 
max]
Length=371

 Score =   229 bits (584),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 169/410 (41%), Positives = 210/410 (51%), Gaps = 75/410 (18%)
 Frame = +1

Query  238   KTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtss  417
             K A A+ GKTARACDSC+S+RARWFC ADDAFLC +CD  VHSAN LASRH+RVRL    
Sbjct  5     KDAGALGGKTARACDSCVSRRARWFCAADDAFLCHACDTLVHSANQLASRHERVRL----  60

Query  418   sstaaasllssPKIVddddddSPPAWHRGFTRKPRTPR--NAKRTKKQNSGGVAVEESVN  591
                                  +  AWH GFTRK RTPR  N+K    Q      V  +  
Sbjct  61    -----------QTASSKATTTTTHAWHSGFTRKARTPRHNNSKHFALQQRLKHEVLFNNT  109

Query  592   PVLPFVPEMGSDDDY-----NNNNEIDLFCQVPVlldddlnallndgggddHMRGLEIPE  756
              VLP VPE+G ++       N+  E  + C+VPV    D             +R  ++  
Sbjct  110   SVLPLVPELGGEEQEPVVVDNDETEEQMLCRVPVFDPFD-------------VRTDDLDS  156

Query  757   FLSSDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKV  936
             F  SD++ +EFAADVE  L  +D   D+ +A V            L    GEE E++  V
Sbjct  157   F--SDMDFSEFAADVEGRLDKED---DEISAYVGGGEGV---QGVLAKVKGEE-EIDGDV  207

Query  937   MMTMLSGFDessssmesgsckeeVAKKSR----------------------MLLSLNYEE  1050
                + S FD  S      +  E V   +R                      + L LNY+E
Sbjct  208   ACYLESVFDMISDDAFHWNNIESVVSDAREEKGCVVPCDGGVSEQGGIKRDIFLRLNYDE  267

Query  1051  VISAWASQG-CPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR-RSDEGREARVS  1224
             VI+AW+SQG  PWT    P F+ ++ +   + G        G    +R   D GREARVS
Sbjct  268   VITAWSSQGSSPWTTSNPPKFNSDYDFSLGLSG------VDGEGRSLRGHLDGGREARVS  321

Query  1225  RYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNY  1374
             RYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR + F     FP Y
Sbjct  322   RYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR-TCFVGANAFPAY  370



>gb|EYU45446.1| hypothetical protein MIMGU_mgv1a026677mg [Erythranthe guttata]
Length=394

 Score =   230 bits (586),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 164/417 (39%), Positives = 215/417 (52%), Gaps = 78/417 (19%)
 Frame = +1

Query  220   MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  399
             MSSD  K +NA+ GK+ARACDSCL KRARWFC ADDAFLCQSCD SVHSAN LASRH RV
Sbjct  1     MSSDSSKVSNALGGKSARACDSCLVKRARWFCAADDAFLCQSCDASVHSANQLASRHDRV  60

Query  400   RLGtsssstaaasllssPKIVddddddSPPAWHRGF-TRKPRTPRNAKRTKKQNSGGVAV  576
             RL                K  +     + PAW +GF TRK RTPR+ K T K+    +  
Sbjct  61    RLD---------------KTSNASPPANAPAWQQGFTTRKARTPRHGKPTTKR---LLHE  102

Query  577   EESVNPVLPFVPEMGSDDD----YNNNNEIDLFCQVPV---------lldddlnallndg  717
                 N +LP VPE+ + +D     +N     L  +VPV           +D  N L    
Sbjct  103   YPPANQLLPPVPEIDAHEDPFAEEDNEGGQFLLYRVPVFDPFGQDFFNEEDANNMLPEHE  162

Query  718   ggddHMRGLEIPEFLSS-DVELAEFAADVETLLGDDD---------------------VG  831
                +    L + E L S D +L  FAADV++LL D++                     + 
Sbjct  163   DDAEGCLDLNLAELLGSCDEDL--FAADVDSLLIDEEDCSNINIGLFDHQDDQNKGIIIN  220

Query  832   EDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeeVA  1011
             ++    A ++++         N+  GE+ + E++ M +     +                
Sbjct  221   DEFVDGAKRMKVEDDVIAACNNYEAGEKTKSEEEDMSSRSESHN----------------  264

Query  1012  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDP-NHCWPDFMGGDHH----HHHPYGS  1176
               + M L LNYE VI+AWA++GCPWT+GT P FD  +    ++ GG             +
Sbjct  265   -NNNMFLRLNYEAVIAAWATKGCPWTNGTPPQFDNLDQFMDEWSGGSSEWCGGRIGGNNN  323

Query  1177  AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  1347
                   +D  REARV RY+EKRRTRLFSKKIRY+VRKLNAE RPR+KGRFVKR + F
Sbjct  324   NNNNNNNDAEREARVLRYKEKRRTRLFSKKIRYQVRKLNAENRPRMKGRFVKRPTAF  380



>gb|AEF12200.1| CONSTANS-like zinc finger protein [Glycine max]
 gb|KHN16579.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=371

 Score =   229 bits (584),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 169/410 (41%), Positives = 210/410 (51%), Gaps = 75/410 (18%)
 Frame = +1

Query  238   KTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtss  417
             K A A+ GKTARACDSC+S+RARWFC ADDAFLC +CD  VHSAN LASRH+RVRL    
Sbjct  5     KDAGALGGKTARACDSCVSRRARWFCAADDAFLCHACDTLVHSANQLASRHERVRL----  60

Query  418   sstaaasllssPKIVddddddSPPAWHRGFTRKPRTPR--NAKRTKKQNSGGVAVEESVN  591
                                  +  AWH GFTRK RTPR  N+K    Q      V  +  
Sbjct  61    -----------QTASSKATTTTTHAWHSGFTRKARTPRHNNSKHFALQQRLKDEVLFNNT  109

Query  592   PVLPFVPEMGSDDDY-----NNNNEIDLFCQVPVlldddlnallndgggddHMRGLEIPE  756
              VLP VPE+G ++       N+  E  + C+VPV    D             +R  ++  
Sbjct  110   SVLPLVPELGGEEQEPVVVDNDETEEQMLCRVPVFDPFD-------------VRTDDLDS  156

Query  757   FLSSDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKV  936
             F  SD++ +EFAADVE  L  +D   D+ +A V            L    GEE E++  V
Sbjct  157   F--SDMDFSEFAADVEGRLDKED---DEISAYVGGGEGV---QGVLAKVKGEE-EIDGDV  207

Query  937   MMTMLSGFDessssmesgsckeeVAKKSR----------------------MLLSLNYEE  1050
                + S FD  S      +  E V   +R                      + L LNY+E
Sbjct  208   ACYLESVFDMISDDAFHWNNIESVVSDAREEKGCVVPCDGGVSEQGGIKRDIFLRLNYDE  267

Query  1051  VISAWASQG-CPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR-RSDEGREARVS  1224
             VI+AW+SQG  PWT    P F+ ++ +   + G        G    +R   D GREARVS
Sbjct  268   VITAWSSQGSSPWTTSNPPKFNSDYDFSLGLSG------VDGEGRSLRGHLDGGREARVS  321

Query  1225  RYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNY  1374
             RYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR + F     FP Y
Sbjct  322   RYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR-TCFVGANAFPAY  370



>gb|AFK37106.1| unknown [Medicago truncatula]
Length=416

 Score =   230 bits (587),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 169/421 (40%), Positives = 213/421 (51%), Gaps = 60/421 (14%)
 Frame = +1

Query  244   ANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtssss  423
             A A+  KTARACDSCL +RARWFC ADDAFLC  CD  VHSANLLASRH++VRL      
Sbjct  11    AGALGAKTARACDSCLRRRARWFCAADDAFLCHGCDNLVHSANLLASRHEKVRL------  64

Query  424   taaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESV--NPV  597
                       +        +  AWH GFTRK RTPR+ K +  Q       E+ +     
Sbjct  65    ----------QTASAKVTTTAQAWHSGFTRKARTPRHNKNSSIQQQQQRLKEKVLFNTSF  114

Query  598   LPFVPEMGSDD--------DYNNNNEIDLFCQVPVlldd--dlnallndgggddHMRGLE  747
             LP VPE+G ++        D +  +E  L C+VPV   +  DL          D     +
Sbjct  115   LPLVPELGGEEEQGQELLVDIDEADEEQLLCRVPVFDANPFDLETCTVKNDAVDFEEMCD  174

Query  748   IPEFLSSDVELAEFAADVETLL--GDDDVGEDKATAAVKI-EINGGDC--TEALNWSFGE  912
             +  F   DV+LAEFAA+VE+LL  G  ++ E+ +       + N  D   +E L    GE
Sbjct  175   LDSFCEFDVDLAEFAANVESLLGVGSSEIQENSSGQVFDYKQENEMDASKSEMLKVKDGE  234

Query  913   EQEVEQKVMMTMLSGFD--------------------essssmesgsckeeVAKKSRMLL  1032
               ++E    MT    F                      +SS   S S   +   K    L
Sbjct  235   LDDLESVFDMTSDDVFHWNIDNNDVSLAQQEKEYMPLSNSSVGYSESVITKEETKRERFL  294

Query  1033  SLNYEEVISAWASQG--CPWTDGTRPHFD-PNHCWPDFMG--GDHHHHHPYGSAMMMRRS  1197
              LNYEEVI+  + QG   PWT  + P F+  +  W + +G  G           +M    
Sbjct  295   RLNYEEVITECSRQGSPSPWTTASPPKFNCDDDSWQNLLGSSGVEGEVRSLRGQLMGSGG  354

Query  1198  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ-PPPPFP-N  1371
             D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR++ F      FP N
Sbjct  355   DGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTACFAGGATSFPTN  414

Query  1372  Y  1374
             Y
Sbjct  415   Y  415



>emb|CDY53119.1| BnaCnng24470D [Brassica napus]
Length=376

 Score =   229 bits (583),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 169/403 (42%), Positives = 207/403 (51%), Gaps = 74/403 (18%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +  A+A+  K ARACDSC+ +RARW+C ADDAFLCQSCD  VHSANLLA RH+RV L ++
Sbjct  2     KSLASAVGAKRARACDSCVKRRARWYCAADDAFLCQSCDTLVHSANLLARRHERVLLKSA  61

Query  415   ssstaaasllssPKIVddddddSPP----AWHRGFTRKPRTPRNAKRTKKQNSGGVAVEE  582
             S  +      S           SPP     WH G +RKPRTPR +   KK N        
Sbjct  62    SKHSNHNHNHSP---------SSPPHEAATWHHGVSRKPRTPRGS--GKKNN--------  102

Query  583   SVNPVLPFVPEMGSDDDYNNNN-EIDLFCQVPVlldddlnallndgggddHMRGLEIP--  753
              ++     VPE+  +D   +   E  L CQVPVL       LL+D         +E P  
Sbjct  103   -LSIFHDLVPEISVEDQTESCELEEQLICQVPVLDPTVAEQLLHDVAEAK----IEFPIM  157

Query  754   --------------------EFLSSDVELAEFAADVETLLGDDDVGEDKATAAVKIEING  873
                                  F  +D+EL E+AADVE+LL D ++G         I  + 
Sbjct  158   RSGVMMDDQEDEDNAESCLNGFFPTDMELEEYAADVESLL-DMNIG---------ICDDD  207

Query  874   GDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEV  1053
              D T     SF  E     + ++  + G  E     E         KK+ ++L LNY+ V
Sbjct  208   RDATAPFELSFDYESHNTYEEVIKNIEGSGECVKVKEEE-------KKNVLMLRLNYDSV  260

Query  1054  ISAWASQGCPWTDGTRPHFDPN-HCWPDF-MGGD----HHHHHPYGSAMMMRRSDEGREA  1215
             IS W  QG PWT G  P  D +   WP   MGG+       HH  G        D GREA
Sbjct  261   ISTWGGQGPPWTSGEPPERDIDISSWPFVSMGGNVRESQQKHHVGGCLPSSGFGDGGREA  320

Query  1216  RVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
             RVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+SL
Sbjct  321   RVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASL  363



>gb|AAM13173.1| unknown protein [Arabidopsis thaliana]
Length=417

 Score =   229 bits (585),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 173/433 (40%), Positives = 211/433 (49%), Gaps = 98/433 (23%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +  ANA+  KTARACDSC+ +RARW+C ADDAFLCQSCD  VHSAN LA RH+RVRL   
Sbjct  3     KSLANAVGAKTARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRL---  59

Query  415   ssstaaasllssPKIVddd--dddSPP----AWHRGFTRKPRTPRNAKRTKKQNSGGVAV  576
                       +SP +V        SPP     WH GFTRK RTPR +   KK NS     
Sbjct  60    --------KTASPAVVKHSNHSSASPPHEVATWHHGFTRKARTPRGS--GKKNNS-----  104

Query  577   EESVNPVLPFVPEMGSDDDYNNNN-EIDLFCQVPV-----lldddlnallndgggddHMR  738
                 +     VP++  +D  +N   E  L CQVPV           + +           
Sbjct  105   ----SIFHDLVPDISIEDQTDNYELEEQLICQVPVLDPLLSEQFLNDVVEPKIEFPMIRS  160

Query  739   GLEIPE-----------FLSSDVELAEFAADVETLLGDDDVGEDKATAAV-KIEINGG--  876
             GL I E           F  +D+EL EFAADVETLLG    G D  + A+ ++E++    
Sbjct  161   GLMIEEEEDNAESCLNGFFPTDMELEEFAADVETLLGR---GLDTESYAMEELELSNSEM  217

Query  877   ------------------------------DCTEALNWSFGEE---QEVEQKVMMTMLSG  957
                                           D T     SF  E   +  E++VM  + S 
Sbjct  218   FKIEKDEIEEEVEEIKAMSMDIFDDDRKDVDGTVPFELSFDYESSHKTSEEEVMKNVESS  277

Query  958   FDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPD  1134
              +      E          K+ ++L LNY+ VIS W  QG PW+ G  P  D +   WP 
Sbjct  278   GECVVKVKEEE-------HKNVLMLRLNYDSVISTWGGQGPPWSSGEPPERDMDISGWPA  330

Query  1135  FM----GGDHHHHHPYGSAMMMRR--SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNA  1296
             F     GG+  H   Y    +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNA
Sbjct  331   FSMVENGGESTHQKQYVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNA  390

Query  1297  EKRPRLKGRFVKR  1335
             EKRPR+KGRFVKR
Sbjct  391   EKRPRMKGRFVKR  403



>gb|AAG50803.1|AC079281_5 zinc finger protein, putative [Arabidopsis thaliana]
Length=416

 Score =   229 bits (585),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 173/430 (40%), Positives = 208/430 (48%), Gaps = 92/430 (21%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +  ANA+  KTARACDSC+ +RARW+C ADDAFLCQSCD  VHSAN LA RH+RVRL   
Sbjct  2     KSLANAVGAKTARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRL---  58

Query  415   ssstaaasllssPKIVddd--dddSPP----AWHRGFTRKPRTPRNAKRTKKQNSGGVAV  576
                       +SP +V        SPP     WH GFTRK RTPR +   KK NS     
Sbjct  59    --------KTASPAVVKHSNHSSASPPHEVATWHHGFTRKARTPRGS--GKKNNS-----  103

Query  577   EESVNPVLPFVPEMGSDDDYNNNN-EIDLFCQVPV-----lldddlnallndgggddHMR  738
                 +     VP++  +D  +N   E  L CQVPV           + +           
Sbjct  104   ----SIFHDLVPDISIEDQTDNYELEEQLICQVPVLDPLVSEQFLNDVVEPKIEFPMIRS  159

Query  739   GLEIPE-----------FLSSDVELAEFAADVETLLGDDDVGEDKA--------------  843
             GL I E           F  +D+EL EFAADVETLLG     E  A              
Sbjct  160   GLMIEEEEDNAESCLNGFFPTDMELEEFAADVETLLGRGLDTESYAMEELGLSNSEMFKI  219

Query  844   -----------TAAVKIEI-----NGGDCTEALNWSFGEE---QEVEQKVMMTMLSGFDe  966
                          A+ ++I        D T     SF  E   +  E++VM  + S  + 
Sbjct  220   EKDEIEEEVEEIKAMSMDIFDDDRKDVDGTVPFELSFDYESSHKTSEEEVMKNVESSGEC  279

Query  967   ssssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDFM-  1140
                  E          K+ ++L LNY+ VIS W  QG PW+ G  P  D +   WP F  
Sbjct  280   VVKVKEEE-------HKNVLMLRLNYDSVISTWGGQGPPWSSGEPPERDMDISGWPAFSM  332

Query  1141  ---GGDHHHHHPYGSAMMMRR--SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKR  1305
                GG+  H   Y    +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKR
Sbjct  333   VENGGESTHQKQYVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKR  392

Query  1306  PRLKGRFVKR  1335
             PR+KGRFVKR
Sbjct  393   PRMKGRFVKR  402



>ref|NP_173915.2| zinc finger protein CONSTANS-LIKE 16 [Arabidopsis thaliana]
 sp|Q8RWD0.2|COL16_ARATH RecName: Full=Zinc finger protein CONSTANS-LIKE 16 [Arabidopsis 
thaliana]
 gb|AAU90068.1| At1g25440 [Arabidopsis thaliana]
 dbj|BAE98579.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE30625.1| zinc finger protein CONSTANS-LIKE 16 [Arabidopsis thaliana]
Length=417

 Score =   229 bits (584),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 173/430 (40%), Positives = 208/430 (48%), Gaps = 92/430 (21%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +  ANA+  KTARACDSC+ +RARW+C ADDAFLCQSCD  VHSAN LA RH+RVRL   
Sbjct  3     KSLANAVGAKTARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRL---  59

Query  415   ssstaaasllssPKIVddd--dddSPP----AWHRGFTRKPRTPRNAKRTKKQNSGGVAV  576
                       +SP +V        SPP     WH GFTRK RTPR +   KK NS     
Sbjct  60    --------KTASPAVVKHSNHSSASPPHEVATWHHGFTRKARTPRGS--GKKNNS-----  104

Query  577   EESVNPVLPFVPEMGSDDDYNNNN-EIDLFCQVPV-----lldddlnallndgggddHMR  738
                 +     VP++  +D  +N   E  L CQVPV           + +           
Sbjct  105   ----SIFHDLVPDISIEDQTDNYELEEQLICQVPVLDPLVSEQFLNDVVEPKIEFPMIRS  160

Query  739   GLEIPE-----------FLSSDVELAEFAADVETLLGDDDVGEDKA--------------  843
             GL I E           F  +D+EL EFAADVETLLG     E  A              
Sbjct  161   GLMIEEEEDNAESCLNGFFPTDMELEEFAADVETLLGRGLDTESYAMEELGLSNSEMFKI  220

Query  844   -----------TAAVKIEI-----NGGDCTEALNWSFGEE---QEVEQKVMMTMLSGFDe  966
                          A+ ++I        D T     SF  E   +  E++VM  + S  + 
Sbjct  221   EKDEIEEEVEEIKAMSMDIFDDDRKDVDGTVPFELSFDYESSHKTSEEEVMKNVESSGEC  280

Query  967   ssssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDFM-  1140
                  E          K+ ++L LNY+ VIS W  QG PW+ G  P  D +   WP F  
Sbjct  281   VVKVKEEE-------HKNVLMLRLNYDSVISTWGGQGPPWSSGEPPERDMDISGWPAFSM  333

Query  1141  ---GGDHHHHHPYGSAMMMRR--SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKR  1305
                GG+  H   Y    +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKR
Sbjct  334   VENGGESTHQKQYVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKR  393

Query  1306  PRLKGRFVKR  1335
             PR+KGRFVKR
Sbjct  394   PRMKGRFVKR  403



>ref|XP_010499109.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Camelina sativa]
Length=419

 Score =   229 bits (583),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 172/428 (40%), Positives = 216/428 (50%), Gaps = 87/428 (20%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +  ANA+  KTARACDSC+ +RARW+C ADDAFLCQSCD  VHSAN LA RH+RVRL T+
Sbjct  2     KSLANAVGAKTARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRLKTA  61

Query  415   ssstaaasllssPKIVddddddSPP----AWHRGFTRKPRTPRNAKRTKKQNSGGVAVEE  582
             S +          K  +     SPP     WH GFTRK RTPR +   KK N        
Sbjct  62    SPAAV--------KHSNHSSSASPPHEAATWHHGFTRKARTPRGSG--KKNN--------  103

Query  583   SVNPVLPFVPEMGSDDDYNNNN-EIDLFCQVPVl---ldddlnallndgggddHMRGLEI  750
              ++     VPE+  +D  ++   E  L CQVPVL   + +     +     +  M  + I
Sbjct  104   -LSIFHDLVPEISVEDQTDSYELEEQLICQVPVLDPLVAEQFLNDVVAPKIEFPMISVMI  162

Query  751   PE-----------FLSSDVELAEFAADVETLLGD---------DDVG-------------  831
              E           F  +D+EL EFAADVETLLG          +D+G             
Sbjct  163   DEEEDNAESCLNGFFPTDMELEEFAADVETLLGRGLDTESYAMEDLGFSNTEMFKVEKDE  222

Query  832   ----EDKATAAVKIEI--------NGGDCTEALNWSFGEEQEV-EQKVMMTMLSGFDess  972
                 E +   A+ +EI          G     L++ +    +  E++VM  + S  +   
Sbjct  223   IEEEEVEEKKAINMEIFDDDDRKDVDGTVPFELSFDYESSHKTSEEEVMKNVESSGECVV  282

Query  973   ssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDF----  1137
                E         +K+ ++L LNY+ VIS W  QG PWT G  P  D +   WP      
Sbjct  283   KVKE-------EEEKNVLMLRLNYDSVISTWGGQGPPWTSGEPPELDIDISSWPPVSMGE  335

Query  1138  MGGDHHHHHPYGSAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR  1311
              GGD  H   Y    +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR
Sbjct  336   FGGDQSHQKQYVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR  395

Query  1312  LKGRFVKR  1335
             +KGRFVKR
Sbjct  396   MKGRFVKR  403



>ref|XP_010460378.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X1 [Camelina sativa]
Length=419

 Score =   229 bits (583),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 175/428 (41%), Positives = 216/428 (50%), Gaps = 87/428 (20%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +  ANA+  KTARACDSC+ +RARW+C ADDAFLCQSCD  VHSAN LA RH+RVRL T+
Sbjct  2     KSLANAVGAKTARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRLKTA  61

Query  415   ssstaaasllssPKIVddddddSPP----AWHRGFTRKPRTPRNAKRTKKQNSGGVAVEE  582
             S +          K  +     SPP     WH GFTRK RTPR +   KK N        
Sbjct  62    SPAAV--------KHSNHSSSASPPHEAATWHHGFTRKARTPRGSG--KKNN--------  103

Query  583   SVNPVLPFVPEMGSDDDYNNNN-EIDLFCQVPVl---ldddlnallndgggddHMRGLEI  750
              ++     VPE+  +D  ++   E  L CQVPVL   + +     +     +  M  + I
Sbjct  104   -LSIFHDLVPEISVEDQTDSYELEEQLICQVPVLDPLVAEQFLNDVVAPKIEFPMISVMI  162

Query  751   PE-----------FLSSDVELAEFAADVETLLGD---------DDVG-------------  831
              E           F  +D+EL EFAADVETLLG          +D+G             
Sbjct  163   DEDEDNAESCLNGFFPTDMELEEFAADVETLLGRGLDTESYAMEDLGFSNTEMFKVEKDE  222

Query  832   ----EDKATAAVKIEI------NGGDCTEALNWSFGEE---QEVEQKVMMTMLSGFDess  972
                 E +   A+ +EI         D T     SF  E   +  E++VM  + S  +   
Sbjct  223   IEEEEVEEKKAINMEIFDDDDRKDVDGTVPFELSFDYESSHKTSEEEVMKNVESSGECVV  282

Query  973   ssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDF----  1137
                E         +K+ ++L LNY+ VIS W  QG PWT G  P  D +   WP      
Sbjct  283   KVKEE-------EEKNVLMLRLNYDSVISTWGGQGRPWTSGEPPELDIDISSWPPVSMGE  335

Query  1138  MGGDHHHHHPYGSAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR  1311
              GGD  H   Y    +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR
Sbjct  336   FGGDQSHQKQYVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR  395

Query  1312  LKGRFVKR  1335
             +KGRFVKR
Sbjct  396   MKGRFVKR  403



>ref|XP_009115317.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brassica 
rapa]
Length=414

 Score =   228 bits (582),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 173/419 (41%), Positives = 214/419 (51%), Gaps = 74/419 (18%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +  ANA+  KTARACDSC+ KRARW+C ADDAFLCQSCD  VHSAN LA RH+RVRL ++
Sbjct  2     KNLANAVGAKTARACDSCVKKRARWYCAADDAFLCQSCDTLVHSANPLARRHERVRLKSA  61

Query  415   ssstaaasllssPKIVddddddSPP----AWHRGFTRKPRTPRNAKRTKKQNSGGVAVEE  582
             S      S  +            PP     WH+GFTRKPRTPR +   KK N        
Sbjct  62    SPVATKYSSHNH-------SASCPPLEAATWHQGFTRKPRTPRGS--GKKNN--------  104

Query  583   SVNPVLPFVPEMGSDDDYNNNN-EIDLFCQVPVlldddlnallndgggddHMRGLEIP--  753
              ++     VPE+ ++D  ++   E  L CQVPVL        LND         +E P  
Sbjct  105   -LSIFHDLVPEISAEDQTDSYEIEEQLICQVPVLDPMVAEQFLNDVVEPK----IEFPMI  159

Query  754   ----------------EFLSSDVELAEFAADVETLLGDD-DVGEDKATAAVKIE------  864
                              F  +D+EL EFAADVE LLG   DV E  A   + +       
Sbjct  160   TIDDQEDEDNAESCLNGFFPTDMELEEFAADVEILLGRGLDVTESYAMEELGLSNTEMFK  219

Query  865   -------INGGDCTEALNWSF--GEEQ-EVEQKVMMTMLSGFDessssmesgsckeeVAK  1014
                       G+ T+A+N     GE++ + +  V   +    D  ++  E      +  K
Sbjct  220   IEKDEIEEEEGEETKAMNMGICCGEDRGDGDGTVAFELRFDHDSHNTYEEEAIKNADCIK  279

Query  1015  ------KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH-----CWPDFMGGDHHHH  1161
                   K+ ++LSLNYE VIS W  QG PW     P  D +         +  GG+ HH 
Sbjct  280   VEEEEQKNVLMLSLNYESVISTWGGQGQPWLSREPPERDIDISDKPVVSMEINGGESHHK  339

Query  1162  HPYGSAMMMRR-SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
             H  G  +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  340   HYVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  398



>ref|XP_010460379.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X2 [Camelina sativa]
Length=419

 Score =   228 bits (582),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 175/428 (41%), Positives = 216/428 (50%), Gaps = 87/428 (20%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +  ANA+  KTARACDSC+ +RARW+C ADDAFLCQSCD  VHSAN LA RH+RVRL T+
Sbjct  2     KSLANAVGAKTARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRLKTA  61

Query  415   ssstaaasllssPKIVddddddSPP----AWHRGFTRKPRTPRNAKRTKKQNSGGVAVEE  582
             S +          K  +     SPP     WH GFTRK RTPR +   KK N        
Sbjct  62    SPAAV--------KHSNHSSSASPPHEAATWHHGFTRKARTPRGSG--KKNN--------  103

Query  583   SVNPVLPFVPEMGSDDDYNNNN-EIDLFCQVPVl---ldddlnallndgggddHMRGLEI  750
              ++     VPE+  +D  ++   E  L CQVPVL   + +     +     +  M  + I
Sbjct  104   -LSIFHDLVPEISVEDQTDSYELEEQLICQVPVLDPLVAEQFLNDVVAPKIEFPMISVMI  162

Query  751   PE-----------FLSSDVELAEFAADVETLLGD---------DDVG-------------  831
              E           F  +D+EL EFAADVETLLG          +D+G             
Sbjct  163   DEDEDNAESCLNGFFPTDMELEEFAADVETLLGRGLDTESYAMEDLGFSNTEMFKVEKDE  222

Query  832   ----EDKATAAVKIEI------NGGDCTEALNWSFGEE---QEVEQKVMMTMLSGFDess  972
                 E +   A+ +EI         D T     SF  E   +  E++VM  + S  +   
Sbjct  223   IEEEEVEEKKAINMEIFDDDDRKDVDGTVPFELSFDYESSHKTSEEEVMKNVESSGECVV  282

Query  973   ssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDF----  1137
                E         +K+ ++L LNY+ VIS W  QG PWT G  P  D +   WP      
Sbjct  283   KVKEE-------EEKNVLMLRLNYDSVISTWGGQGPPWTSGEPPKLDIDISSWPPVSMGE  335

Query  1138  MGGDHHHHHPYGSAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR  1311
              GGD  H   Y    +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR
Sbjct  336   FGGDQSHQKQYVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR  395

Query  1312  LKGRFVKR  1335
             +KGRFVKR
Sbjct  396   MKGRFVKR  403



>ref|XP_010320765.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X2 [Solanum lycopersicum]
Length=424

 Score =   228 bits (581),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 170/434 (39%), Positives = 218/434 (50%), Gaps = 66/434 (15%)
 Frame = +1

Query  232   QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  411
             +RK A+A+ GKT RACD+C+ KRARW+C ADDAFLCQ+CD SV    L  S  ++    +
Sbjct  4     ERKLASAMGGKTTRACDNCIKKRARWYCPADDAFLCQNCDASVR---LKTSSLKQTSSPS  60

Query  412   sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVN  591
             SSS      L S   I       S P+WHRGFTRK RTPR  ++  K    G  + +  N
Sbjct  61    SSSDDYFPDLESPLSISSVSVSVSVPSWHRGFTRKARTPRQGRKASKSAGDGDVIRK--N  118

Query  592   PVLPFVPEMGSDDD-YNNNNEIDLFCQVP-----VlldddlnallndgggddHMRGLEIP  753
             P+   VPE+ SD++  + N E  L  +VP     V      +    D   +  +   E+ 
Sbjct  119   PI-HLVPEILSDENSLDENEEEQLLYRVPILDPFVGHLYSSSTAPTDADSEFKLESKEMT  177

Query  754   --------------EFLSSDVELAEFAADVETLLGD--DDVGEDKATAAVKIEINGGDCT  885
                           E L S++ELAEFAADVE+LLG   DD   D     +    N  + +
Sbjct  178   LQDDICNVDLNRFHEMLPSEMELAEFAADVESLLGKGLDDESFDMEGLGLLGVCNKEENS  237

Query  886   EALNWSFGEEQEVEQKVMMTMLS---------------------------GFDessssme  984
                +     E E E +V+    S                            +D S + + 
Sbjct  238   MISHEKVKIEDEGEMEVVTKTTSPTTHNHQYNHTHDHDIDINEDTFEFKFDYDSSINIIG  297

Query  985   sgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHH  1164
                       K ++LL+L+YE V+ AWA Q CPWT+G RP  D N  WPD MG       
Sbjct  298   DDEVVTNDENKKKILLNLDYEGVLKAWADQRCPWTNGERPELDSNESWPDCMGN------  351

Query  1165  PYGSAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  1338
              Y   M    +  D GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  352   -YMGIMNENVTIVDRGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA  410

Query  1339  SLFQPPPPFPNYLL  1380
             +        PNY L
Sbjct  411   NFVTTST--PNYPL  422



>ref|XP_010460380.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X3 [Camelina sativa]
Length=427

 Score =   228 bits (581),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 172/432 (40%), Positives = 218/432 (50%), Gaps = 87/432 (20%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +  ANA+  KTARACDSC+ +RARW+C ADDAFLCQSCD  VHSAN LA RH+RVRL T+
Sbjct  2     KSLANAVGAKTARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRLKTA  61

Query  415   ssstaaasllssPKIVddddddSPP----AWHRGFTRKPRTPRNAKRTKKQNSGGVAVEE  582
             S +          K  +     SPP     WH GFTRK RTPR +   KK N        
Sbjct  62    SPAAV--------KHSNHSSSASPPHEAATWHHGFTRKARTPRGSG--KKNN--------  103

Query  583   SVNPVLPFVPEMGSDDDYNNNN-EIDLFCQVPVl---ldddlnallndgggddHMRGLEI  750
              ++     VPE+  +D  ++   E  L CQVPVL   + +     +     +  M  + I
Sbjct  104   -LSIFHDLVPEISVEDQTDSYELEEQLICQVPVLDPLVAEQFLNDVVAPKIEFPMISVMI  162

Query  751   PE-----------FLSSDVELAEFAADVETLLGD---------DDVG-------------  831
              E           F  +D+EL EFAADVETLLG          +D+G             
Sbjct  163   DEDEDNAESCLNGFFPTDMELEEFAADVETLLGRGLDTESYAMEDLGFSNTEMFKVEKDE  222

Query  832   ----EDKATAAVKIEI--------NGGDCTEALNWSF-----GEEQEVEQKVMMTMLSGF  960
                 E +   A+ +EI          G     L++ +       E+EV + V   ++   
Sbjct  223   IEEEEVEEKKAINMEIFDDDDRKDVDGTVPFELSFDYESSHKTSEEEVMKNVEKEVMKNV  282

Query  961   DessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDF  1137
             + S   +     +    +K+ ++L LNY+ VIS W  QG PWT G  P  D +   WP  
Sbjct  283   ESSGECVVKVKEE---EEKNVLMLRLNYDSVISTWGGQGRPWTSGEPPELDIDISSWPPV  339

Query  1138  ----MGGDHHHHHPYGSAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAE  1299
                  GGD  H   Y    +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAE
Sbjct  340   SMGEFGGDQSHQKQYVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAE  399

Query  1300  KRPRLKGRFVKR  1335
             KRPR+KGRFVKR
Sbjct  400   KRPRMKGRFVKR  411



>ref|XP_006307606.1| hypothetical protein CARUB_v10009230mg [Capsella rubella]
 gb|EOA40504.1| hypothetical protein CARUB_v10009230mg [Capsella rubella]
Length=424

 Score =   228 bits (581),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 171/426 (40%), Positives = 215/426 (50%), Gaps = 79/426 (19%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +  ANA+  KTARACDSC+ +RARW+C ADDAFLCQSCD  VHSAN LA RH+RVRL   
Sbjct  2     KSLANAVGAKTARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRL---  58

Query  415   ssstaaasllssPKIVddddddSPP----AWHRGFTRKPRTPRNAKRTKKQNSGGVAVEE  582
                    +  ++ K  +     SPP     WH GFTRK RTPR +   K   S       
Sbjct  59    -----KTASPAAAKHSNHSPSASPPHGAATWHHGFTRKARTPRGSAGKKNNLS-------  106

Query  583   SVNPVLPFVPEMGSDDDYNNNNEIDLFCQVPV----lldddlnallndgggddHMR-GLE  747
             + + ++P +      D Y    E  L CQVPV    + +  LN ++        +R G+ 
Sbjct  107   TFHDLVPEISVEDQTDSYELELEEQLICQVPVLDPLVAEQFLNDVVEPKIEFPMIRSGVL  166

Query  748   IPE-----------FLSSDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTE--  888
             I E           F  +D+EL EFAADVETLL     G    T +  +E  G   TE  
Sbjct  167   IDEEEDNAESCLNGFFPTDMELEEFAADVETLL-----GRGLETESYAMEDLGFSNTEMF  221

Query  889   ----------------ALNWSFGEE--QEVEQKVMMTMLSGFDessssmesgsckeeVAK  1014
                             A+N    ++  ++V+  V   +   ++ S  + E    K   + 
Sbjct  222   KVEKDEIEEEEVEDIKAINMEIFDDDRKDVDGTVPFELTFDYESSHKTAEEEEIKNVESS  281

Query  1015  ------------KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDF-MG---  1143
                         K+ ++L LNY+ VIS W  QG PWT G  P  D +   WP   MG   
Sbjct  282   GECVVKVKEEEGKNVLMLRLNYDSVISTWGGQGQPWTSGEPPELDIDISSWPPVSMGETK  341

Query  1144  GDHHHHHPYGSAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLK  1317
             GD  H   Y S  +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+K
Sbjct  342   GDLSHQKQYVSVCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK  401

Query  1318  GRFVKR  1335
             GRFVKR
Sbjct  402   GRFVKR  407



>gb|EPS73837.1| hypothetical protein M569_00919 [Genlisea aurea]
Length=412

 Score =   227 bits (579),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 159/383 (42%), Positives = 198/383 (52%), Gaps = 49/383 (13%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             RK AN + GK+ARACD+C  KRARW+C ADDAFLCQSCD SVHS   L+ RH+RVRL   
Sbjct  47    RKLANVVGGKSARACDNCGKKRARWYCAADDAFLCQSCDSSVHSDRALSRRHERVRLK--  104

Query  415   ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTK---KQNSGGVAVEES  585
                                +D SPP WHRGFT+K RTPR  K  K   ++ +GG    E+
Sbjct  105   ---------------TSTGEDVSPPTWHRGFTKKARTPRQKKNGKFHLEEPTGGKT--EN  147

Query  586   VNPVLPFVPEMGSDDDYNNN--NEIDLFCQVPVlldddlnallndgggddHMRGLE----  747
              NP L  VPE+  ++   ++  NE  L  +VPV       A L           +E    
Sbjct  148   HNP-LYLVPEICGEEQSQSHEENEEQLLYRVPVFDPFGTEAELGSNSSSSAGAAIESRTH  206

Query  748   -----IPEFLSSDVELAEFAADVETLLGD--DDVGEDKATAAVKIEINGGDCTEALNWSF  906
                     FL  D++LAEFAADVE LLG   DD   D     +       +   AL    
Sbjct  207   NFVSNFNGFLQPDMDLAEFAADVECLLGKGLDDSCFDMEELGIFDRPLKSEVETAL--VM  264

Query  907   GEEQEVEQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPW  1086
              E  ++++K +       D     +  G  + E        L L+ + ++SAW S+  PW
Sbjct  265   NENHQIDEKSID------DLPVPVVPCGGEEYEEDDTKTTFLKLDLDGILSAWNSRNTPW  318

Query  1087  TDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKK  1266
               G +P       WPDF G        + +       D GREARVSRYREKRRTRLFSKK
Sbjct  319   ITGQKPDSKSIDFWPDFFGTTAARGDVWAAG-----GDGGREARVSRYREKRRTRLFSKK  373

Query  1267  IRYEVRKLNAEKRPRLKGRFVKR  1335
             IRYEVRKLNAEKRPR+KGRFVKR
Sbjct  374   IRYEVRKLNAEKRPRMKGRFVKR  396



>emb|CDY24402.1| BnaCnng04690D [Brassica napus]
Length=369

 Score =   226 bits (576),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 156/385 (41%), Positives = 204/385 (53%), Gaps = 51/385 (13%)
 Frame = +1

Query  244   ANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtssss  423
             AN +  KTAR CD+CL KRA WFC AD+AFLCQSCD SVHSANLLA RH+RV L      
Sbjct  5     ANGVRAKTARTCDNCLKKRAHWFCAADEAFLCQSCDTSVHSANLLARRHERVPL------  58

Query  424   taaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLP  603
                    +SP+          P WH GFTRKPRTPR +   K+ NS       + + ++P
Sbjct  59    -----KDTSPQ-------QEAPTWHHGFTRKPRTPRGS--GKRNNS------STFHDMVP  98

Query  604   FVPEMGSDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMRGLE--------IPEF  759
              +   G  D  ++  E  L CQVPVL    +   +        + G E        + E 
Sbjct  99    EITAEGQTD--SSEVEGPLICQVPVLDPMVVEPKIKFPTMRSGIDGHEDEDKDESCLNEI  156

Query  760   LSSDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVM  939
               +++E+ +FAADVETLLG    G DK +    +E  G   TE L     E++E +   M
Sbjct  157   FPTNMEVEDFAADVETLLGH---GLDKESYT--MEELGLSNTEMLKKDEIEDKETKAMNM  211

Query  940   MTMLSGFDessssmesgsckeeVA----KKSRMLLSLNYEEVISAWASQGCPWTDGTRPH  1107
                +   D+ +      + +   A    KK+ ++LSL+Y++VIS W  QG PWT G  P 
Sbjct  212   DIEICDDDQGNRDGTMPNGECVQAKEEKKKNVLMLSLDYDQVISTWGGQGLPWTSGGPPD  271

Query  1108  FDPNHCWPDFM----GGDHHHHHPYGSAMMMRR--SDEGREARVSRYREKRRTRLFSKKI  1269
              D N      +     G        G   +      D GREARVSRYREK++TR F+K I
Sbjct  272   IDINISGSPVVSKRDNGRKSRKKRRGGGRLPSSVVGDGGREARVSRYREKKKTRSFTKTI  331

Query  1270  RYEVRKLNAEKRPRLKGRFVKRSSL  1344
             RYEVRKLNAE +PR+KGRFVKR+SL
Sbjct  332   RYEVRKLNAENKPRMKGRFVKRASL  356



>ref|XP_007142909.1| hypothetical protein PHAVU_007G027200g [Phaseolus vulgaris]
 gb|ESW14903.1| hypothetical protein PHAVU_007G027200g [Phaseolus vulgaris]
Length=409

 Score =   227 bits (578),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 175/447 (39%), Positives = 230/447 (51%), Gaps = 101/447 (23%)
 Frame = +1

Query  226   SDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  405
             S  +  A A+ GKTARACDSC++KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL
Sbjct  2     STAKNAAIAVGGKTARACDSCITKRARWYCAADDAFLCQACDSSVHSANPLARRHERVRL  61

Query  406   GtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEES  585
              T+S  +                   PP WH   T+K RTPR+ K ++           S
Sbjct  62    KTASYKSTDEQQQ------------QPPTWH---TKKARTPRHGKHSR-----------S  95

Query  586   VNPVLPFVPEMGSDDDYNNNNEI-DLFCQVPV----------------lldddlnallnd  714
              NP    VPE+GS++  +N      L  +VP+                      +     
Sbjct  96    SNP-FHLVPEVGSEEVNSNEENEEQLLYRVPIFDPFLAELCGTNSSSPSSVTSTDQGAAA  154

Query  715   gggddHMRGLEIPEF-------------LSSDVELAEFAADVETLLGD---------DDV  828
                +   +G++   F             L SD ELAEFAADVE+LLG          +D+
Sbjct  155   AVAEGENKGVQSNFFYQSNNEMENLHGMLPSDAELAEFAADVESLLGRGLENECVGMEDL  214

Query  829   G------EDKATAAVKIEIN-----------GGDCTEALNWSFGEEQEVEQKVMMTMLSG  957
             G      E+ +  + K+++            G D +  L++ +   +EV++ V       
Sbjct  215   GLIDAKEEECSEGSGKVKVEEESPEMEMEMVGRDVSFELSFDYETCEEVKENVCDLEFG-  273

Query  958   FDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDF  1137
                     +    +EE+ KK ++ L L+YE VI+AWASQ  PWT   +P+ DP+ CW   
Sbjct  274   --------KEEEKEEEMMKKKKISLQLDYESVITAWASQKSPWTTPHKPNLDPDECWHHC  325

Query  1138  M-----GGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEK  1302
             M     G D  +    G  +    +D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEK
Sbjct  326   MESCGTGMDDPYGEVGGFGIHPMINDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEK  385

Query  1303  RPRLKGRFVKRSSLFQPPPPFPNYLLN  1383
             RPR+KGRFVKR+S    PP FP  LLN
Sbjct  386   RPRMKGRFVKRASF--APPTFP--LLN  408



>ref|XP_009103068.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brassica 
rapa]
Length=408

 Score =   226 bits (577),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 172/426 (40%), Positives = 213/426 (50%), Gaps = 88/426 (21%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +  A+A+  KTARACDSC+ +RARW+C ADDAFLCQSCD  VHSANLLA RH+RV L ++
Sbjct  2     KSLASAVGAKTARACDSCVKRRARWYCAADDAFLCQSCDTLVHSANLLARRHERVLLKSA  61

Query  415   ssstaaasllssPKIVddddddSPP----AWHRGFTRKPRTPRNAKRTKKQNSGGVAVEE  582
             S  +      S           SPP     WH GFTRKPRTPR +   KK N        
Sbjct  62    SKHSNHNHNHSP---------SSPPHEAATWHHGFTRKPRTPRGS--GKKNN--------  102

Query  583   SVNPVLPFVPEMGSDDDYNNNN-EIDLFCQVPVlldddlnallndgggddHMRGLEIP--  753
              ++     VPE+  +D   +   E  L CQVPVL       +LND         +E P  
Sbjct  103   -LSIFHDLVPEISVEDQTESCELEEQLICQVPVLDPTVAEQILNDVVEAK----IEFPIM  157

Query  754   --------------------EFLSSDVELAEFAADVETLLGDDDVGEDKATAAV------  855
                                  F  +D+EL E+AADVETLLG     E  A   +      
Sbjct  158   RSGVMMDDQEDEDNAESCLNGFFPTDMELEEYAADVETLLGRGLDTESYAMEELGLSNKE  217

Query  856   --KIE-------INGGDCTE--------ALNWSFGEEQEVEQKVMMTMLSGFDessssme  984
               KIE       +N G C +         L++ +      E++V+  +    +      E
Sbjct  218   MFKIEKEEETKDMNIGICDDDRDATAPFELSFDYESHNTYEEEVIKNIEGSGECVKVKEE  277

Query  985   sgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDF-MGGD---  1149
                      +K+ ++L LNY+ VIS W  Q  PWT G  P  D +   WP   MGG+   
Sbjct  278   E--------QKNVLMLRLNYDSVISTWGGQCPPWTSGEPPERDIDISNWPFVSMGGNVRE  329

Query  1150  -HHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  1326
                 HH           D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRF
Sbjct  330   SQQKHHVGVCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  389

Query  1327  VKRSSL  1344
             VKR+SL
Sbjct  390   VKRASL  395



>gb|AAG52391.1|AC011915_5 putative B-box zinc finger protein; 52092-50677 [Arabidopsis 
thaliana]
Length=405

 Score =   226 bits (576),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 163/426 (38%), Positives = 217/426 (51%), Gaps = 82/426 (19%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +  A+A+ GKTARACDSC+ +RARW+C ADDAFLC +CD SVHSAN LA RH+RVRL ++
Sbjct  2     KSLASAVGGKTARACDSCVKRRARWYCAADDAFLCHACDGSVHSANPLARRHERVRLKSA  61

Query  415   ssstaaasllssPKIVddddddSPP---AWHRGFTRKPRTPRNAKR-------------T  546
             S                     SPP    WH+GFTRK RTPR  K+             +
Sbjct  62    S--------------AGKYRHASPPHQATWHQGFTRKARTPRGGKKSHTMVFHDLVPEMS  107

Query  547   KKQNSGGVAVEESVNPVLPFVPEMGSDDDYNNNNE-IDLFCQVPVlldddlnallndggg  723
              +  +    VEE +   +P +  M  +  +N + E  + F  +P+          ++   
Sbjct  108   TEDQAESYEVEEQLIFEVPVMNSMVEEQCFNQSLEKQNEFPMMPLSFKSSDEEDDDNAES  167

Query  724   ddHMRGLEIPEFLSSDVELAEFAADVETLLGDDD-----VGEDKATAAVKI---------  861
                + GL       +D+ELA+F ADVETLLG  D     + E      +KI         
Sbjct  168   C--LNGL-----FPTDMELAQFTADVETLLGGGDREFHSIEELGLGEMLKIEKEEVEEEG  220

Query  862   -------EINGGDCTEALNWSFGEE-----------QEVEQKVMMTMLSGFDessssmes  987
                    + + GD T     SF  E           ++ ++ VM  ++          E 
Sbjct  221   VVTREVHDQDEGDETSPFEISFDYEYTHKTTFDEGEEDEKEDVMKNVME-----MGVNEM  275

Query  988   gsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH-CWPDFMGGD-----  1149
                 +E  K+  ++L L+YE VIS W  QG PWT       D +  C+P    G+     
Sbjct  276   SGGIKEEKKEKALMLRLDYESVISTWGGQGIPWTARVPSEIDLDMVCFPTHTMGESGAEA  335

Query  1150  HHHHHPYGSAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  1326
             HHH+H  G  + +  + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRF
Sbjct  336   HHHNHFRGLGLHLGDAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  395

Query  1327  VKRSSL  1344
             VKRSS+
Sbjct  396   VKRSSI  401



>ref|NP_564932.1| zinc finger protein CONSTANS-LIKE 6 [Arabidopsis thaliana]
 sp|Q8LG76.2|COL6_ARATH RecName: Full=Zinc finger protein CONSTANS-LIKE 6 [Arabidopsis 
thaliana]
 gb|AAK96816.1| putative B-box zinc finger protein [Arabidopsis thaliana]
 gb|AAM10103.1| putative B-box zinc finger protein [Arabidopsis thaliana]
 gb|AEE34802.1| zinc finger protein CONSTANS-LIKE 6 [Arabidopsis thaliana]
Length=406

 Score =   226 bits (576),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 163/426 (38%), Positives = 217/426 (51%), Gaps = 82/426 (19%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +  A+A+ GKTARACDSC+ +RARW+C ADDAFLC +CD SVHSAN LA RH+RVRL ++
Sbjct  3     KSLASAVGGKTARACDSCVKRRARWYCAADDAFLCHACDGSVHSANPLARRHERVRLKSA  62

Query  415   ssstaaasllssPKIVddddddSPP---AWHRGFTRKPRTPRNAKR-------------T  546
             S                     SPP    WH+GFTRK RTPR  K+             +
Sbjct  63    S--------------AGKYRHASPPHQATWHQGFTRKARTPRGGKKSHTMVFHDLVPEMS  108

Query  547   KKQNSGGVAVEESVNPVLPFVPEMGSDDDYNNNNE-IDLFCQVPVlldddlnallndggg  723
              +  +    VEE +   +P +  M  +  +N + E  + F  +P+          ++   
Sbjct  109   TEDQAESYEVEEQLIFEVPVMNSMVEEQCFNQSLEKQNEFPMMPLSFKSSDEEDDDNAES  168

Query  724   ddHMRGLEIPEFLSSDVELAEFAADVETLLGDDD-----VGEDKATAAVKI---------  861
                + GL       +D+ELA+F ADVETLLG  D     + E      +KI         
Sbjct  169   C--LNGL-----FPTDMELAQFTADVETLLGGGDREFHSIEELGLGEMLKIEKEEVEEEG  221

Query  862   -------EINGGDCTEALNWSFGEE-----------QEVEQKVMMTMLSGFDessssmes  987
                    + + GD T     SF  E           ++ ++ VM  ++          E 
Sbjct  222   VVTREVHDQDEGDETSPFEISFDYEYTHKTTFDEGEEDEKEDVMKNVME-----MGVNEM  276

Query  988   gsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH-CWPDFMGGD-----  1149
                 +E  K+  ++L L+YE VIS W  QG PWT       D +  C+P    G+     
Sbjct  277   SGGIKEEKKEKALMLRLDYESVISTWGGQGIPWTARVPSEIDLDMVCFPTHTMGESGAEA  336

Query  1150  HHHHHPYGSAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  1326
             HHH+H  G  + +  + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRF
Sbjct  337   HHHNHFRGLGLHLGDAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  396

Query  1327  VKRSSL  1344
             VKRSS+
Sbjct  397   VKRSSI  402



>ref|XP_006391130.1| hypothetical protein EUTSA_v10018663mg [Eutrema salsugineum]
 gb|ESQ28416.1| hypothetical protein EUTSA_v10018663mg [Eutrema salsugineum]
Length=399

 Score =   226 bits (575),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 163/416 (39%), Positives = 212/416 (51%), Gaps = 69/416 (17%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +  ANA+ GKTARACDSC+ +RARW+C ADDAFLC SCD SVHSAN LA RH+RVRL +S
Sbjct  3     KSLANAVGGKTARACDSCVKRRARWYCAADDAFLCHSCDGSVHSANPLARRHERVRLKSS  62

Query  415   ssstaaasllssPKIVddddddSPP---AWHRGFTRKPRTPRNAKRTK-----------K  552
             SS     +              SPP    WH+GFTRK RTPR  K++             
Sbjct  63    SSGKHRHASS------------SPPHRATWHQGFTRKARTPRGGKKSHTMVFQDLVPVMS  110

Query  553   QNSGGVAVEESVNPVLPFVPEMGSDDDYNNNNEIDLFCQVPVlldddlnallndgggddH  732
                    VE+ +   +P +  M  +   N + E  +  + P++     ++   D   +  
Sbjct  111   SEDQSYEVEDQLIFQVPVLNPMVEEQCVNESMETKI--EFPMMPLCFKSSDEEDENAESC  168

Query  733   MRGLEIPEFLSSDVELAEFAADVETLLGD---------DDVG-----------EDKATAA  852
             + GL       +D+ELA+F ADVETLLG          +++G           E+ AT  
Sbjct  169   LNGL-----FPTDMELAQFTADVETLLGGGIEREIHDMEELGLGEMLKIEHEEEEVATRE  223

Query  853   VKIEINGGDCTEALNWSFGEEQEVEQKV----------MMTMLSGFDessssmesgscke  1002
             V    +  D T     SF  E   +             ++  ++G   +  S      K 
Sbjct  224   VCDLNDADDETSPFEISFDYEYSNKTASEEEGEEEKEDVIKNMTGVKVNEMSCTVKEEK-  282

Query  1003  eVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH--CWPDFMGGDHHHHHPYGS  1176
                K++  +L L+Y+ VIS W  QG PWT    P  D +   C P+     HH+H     
Sbjct  283   ---KENVPMLRLDYQAVISTWGGQGTPWTALEPPEIDLDMLCCSPNSTAHQHHNHFHGLG  339

Query  1177  AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
               M    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  340   LRMGDAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  395



>gb|EYU26768.1| hypothetical protein MIMGU_mgv1a006045mg [Erythranthe guttata]
Length=460

 Score =   228 bits (580),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 177/461 (38%), Positives = 236/461 (51%), Gaps = 96/461 (21%)
 Frame = +1

Query  217   MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  396
             M+SSD R  A+A+ GK+ RACD+C+ KRARW+C ADDAFLCQSCD SVHSAN LA RH+R
Sbjct  1     MISSD-RNMASAVGGKSVRACDNCVRKRARWYCAADDAFLCQSCDSSVHSANPLARRHER  59

Query  397   VRLGtss-sstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRT--KKQNSGG  567
             VRL T+S  S+   S    P+I        PP WH+GFTRK RTPR  K    K+++S G
Sbjct  60    VRLKTTSFKSSLDGSSDQLPQI-----QIPPPTWHQGFTRKARTPRQKKNNSNKQRSSFG  114

Query  568   VAVEESVN----------------------PVL-PFVPEMGS------DDDYNNNNEIDL  660
               V E  +                      P+  PFV E+ +      +++ NNNN I  
Sbjct  115   HLVPEICSEADNSNEEEEEEENEEQLLYRVPIFDPFVAELCTPFNNNNNNNNNNNNNIHN  174

Query  661   FCQVPVlldddlnallndgggddHMRGLEIPEFLSSDVELAEFAADVETLLG--------  816
               +      + + +    G   +H++G     FL S+++LAEFAADVE+LLG        
Sbjct  175   GTETCESKGELVISDGGFGEEMNHLQG-----FLPSEMDLAEFAADVESLLGKGLEDESF  229

Query  817   ----------DDDVGEDK----ATAAVKIEINGGDCTEALNWSFGEEQ-EVEQKVMMTML  951
                       DD+  + K     +  VK+E +  +C        G E  E+       + 
Sbjct  230   DMEGLGLLDCDDEREKLKWANLVSERVKVEDDDEECNNGEFIDIGRETFELNFDYNSPIT  289

Query  952   SGFDessssmesgsckeeVAKKS------------RMLLSLNYEEVISAWASQGCPWTDG  1095
                +E           E +A  +            ++ L L+Y+ V+S+W  +  PWT G
Sbjct  290   GEDEEEEEEDNKIENVEPIAMNNFEDSNSKMFDSKKIFLRLDYDGVLSSWDERKSPWTTG  349

Query  1096  TRPHFDPNHCWPDFMG--------GDHHHHHPYG----------SAMMMRRSDEGREARV  1221
              RP  D + CWPD  G        G+HHH               S  ++   D GR+ARV
Sbjct  350   ERPDLDSDECWPDCSGTCGKMHVYGNHHHDMGMMMMMMGGGGTHSGAVVASVDGGRQARV  409

Query  1222  SRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
             SRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++ 
Sbjct  410   SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  450



>ref|XP_006302328.1| hypothetical protein CARUB_v10020384mg [Capsella rubella]
 gb|EOA35226.1| hypothetical protein CARUB_v10020384mg [Capsella rubella]
Length=410

 Score =   225 bits (574),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 165/432 (38%), Positives = 204/432 (47%), Gaps = 89/432 (21%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +  A+A+ GKTARACDSC+ +RARW+C ADDAFLC  CD SVHSAN LA RH+RVRL ++
Sbjct  2     KSLASAVGGKTARACDSCVKRRARWYCAADDAFLCHGCDGSVHSANPLARRHERVRLKSA  61

Query  415   ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNP  594
             SS                     PP WH+GFTRK RTPR  K++                
Sbjct  62    SSGKH-----------RHVPTSPPPTWHQGFTRKARTPRGGKKSHTM------------V  98

Query  595   VLPFVPEMGSDDDYNNNN-EIDLFCQVPVlldddlnallndgggddHMRGLEIP------  753
                FVPEM ++D   +   E  L  +VPV+         N+         +E P      
Sbjct  99    FHDFVPEMSTEDQAESYEVEGQLIFEVPVMNPMVEEQCFNESVETK----IEFPMRPVCF  154

Query  754   ----------------EFLSSDVELAEFAADVETLLGD------DDVGEDKATAAVKI--  861
                                 +D+ELA+F ADVETLLG          GE      +KI  
Sbjct  155   KSSDEEDEDNAESCLNGLFPTDIELAQFTADVETLLGGGAERDFQPTGELGLGEMMKIEK  214

Query  862   ---------------EINGGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsc  996
                            +++  D T     SF  E   +            E          
Sbjct  215   EEVEEEEGVATRDMCDLDEVDETSPFEISFDYESASKTSTNEEEEEDEKEDVMKNVMDMG  274

Query  997   keeVAKKSR-------MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH--CWPDFMGGD  1149
               E++ K +       ++L LNYE VIS W  QG PWT       D +   C  D MG  
Sbjct  275   VNEMSGKIKEENKEKALMLRLNYESVISTWGGQGIPWTAQQPSEIDLDMVCCPTDSMGES  334

Query  1150  -----HHHHHPYGSAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRP  1308
                  HH++H  G  + M  +  D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRP
Sbjct  335   GVDQAHHYNHFRGLGLRMGEAHGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRP  394

Query  1309  RLKGRFVKRSSL  1344
             R+KGRFVKRSS+
Sbjct  395   RMKGRFVKRSSV  406



>gb|AAM61001.1| putative B-box zinc finger protein [Arabidopsis thaliana]
Length=405

 Score =   225 bits (573),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 162/426 (38%), Positives = 217/426 (51%), Gaps = 82/426 (19%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +  A+A+ GKTARACDSC+ +RARW+C ADDAFLC +CD SVHSAN LA RH+RVRL ++
Sbjct  2     KSLASAVGGKTARACDSCVKRRARWYCAADDAFLCHACDGSVHSANPLARRHERVRLKSA  61

Query  415   ssstaaasllssPKIVddddddSPP---AWHRGFTRKPRTPRNAKR-------------T  546
             S                     SPP    WH+GFTRK RTPR  K+             +
Sbjct  62    S--------------AGKYRHASPPHQATWHQGFTRKARTPRGGKKSHTMVFHDLVPEMS  107

Query  547   KKQNSGGVAVEESVNPVLPFVPEMGSDDDYNNNNE-IDLFCQVPVlldddlnallndggg  723
              +  +    VEE +   +P +  M  +  +N + E  + F  +P+          ++   
Sbjct  108   TEDQAESYEVEEQLIFEVPVMNSMVEEQCFNQSLEKQNEFPMMPLSFKSSDEEDDDNAES  167

Query  724   ddHMRGLEIPEFLSSDVELAEFAADVETLLGDDD-----VGEDKATAAVKI---------  861
                + GL       +D+ELA+F ADVETLLG  D     + E      +KI         
Sbjct  168   C--LNGL-----FPTDMELAQFTADVETLLGGGDREFHSIEELGLGEMLKIEKEEVEEEG  220

Query  862   -------EINGGDCTEALNWSFGEE-----------QEVEQKVMMTMLSGFDessssmes  987
                    + + GD T     SF  E           ++ ++ VM  ++          E 
Sbjct  221   VVTREVHDQDEGDETSPFEISFDYEYTHKTTFDEGEEDEKEDVMKNVME-----MGVNEM  275

Query  988   gsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH-CWPDFMGGD-----  1149
                 +E  K+  ++L L+YE VIS W  QG PWT       D +  C+P    G+     
Sbjct  276   SGGIKEEKKEKALMLRLDYESVISTWGGQGIPWTARVPSEIDLDMVCFPTHTMGESGAEA  335

Query  1150  HHHHHPYGSAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  1326
             HHH+H  G  + +  + D GREARVSRYREKRRTRLFSKKIRYEVRKLNA+KRPR+KGRF
Sbjct  336   HHHNHFRGLGLHLGDAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNADKRPRMKGRF  395

Query  1327  VKRSSL  1344
             VKRSS+
Sbjct  396   VKRSSI  401



>ref|XP_010477926.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Camelina 
sativa]
Length=419

 Score =   225 bits (573),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 171/424 (40%), Positives = 213/424 (50%), Gaps = 79/424 (19%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +  ANA+  KTARACDSC+ +RARW+C ADDAFLCQSCD  VHSAN LA RH+RVRL   
Sbjct  2     KSLANAVGAKTARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRL---  58

Query  415   ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNP  594
               + + A++  S              WH GFTRK RTPR +   KK N         ++ 
Sbjct  59    -KTASPAAVKHSSHSSSASPPHEAATWHHGFTRKARTPRGSG--KKNN---------LSI  106

Query  595   VLPFVPEMGSDDDYNNNN-EIDLFCQVPVl---ldddlnallndgggddHMRGLEIPE--  756
                 VPE+  +D  ++   E  L CQVPVL   + +     +     +  M  + I E  
Sbjct  107   FHDLVPEISVEDQTDSYELEEQLICQVPVLDPLVAEQFLNDVVAPKIEFPMISVMIDEEE  166

Query  757   ---------FLSSDVELAEFAADVETLLGD---------DDVG-----------------  831
                      F  +D+EL EFAADVETLLG          +D+G                 
Sbjct  167   DNAESCLNGFFPTDMELEEFAADVETLLGRGLDTESYAMEDLGFSNTEMFKVEKDEIEEE  226

Query  832   EDKATAAVKIEI------NGGDCTEALNWSFGEE---QEVEQKVMMTMLSGFDessssme  984
             E +   A+ +EI         D T     SF  E   +  E++VM  + S  +      E
Sbjct  227   EVEEKKAINMEIFDDDDRKDVDGTVPFELSFDYESSHKTSEEEVMKNVESSGECVVKVKE  286

Query  985   sgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDF----MGGD  1149
                      +K+ ++L LNY+ VIS W  QG PWT G  P  D +   WP       GGD
Sbjct  287   E-------EEKNVLMLRLNYDSVISTWGGQGRPWTSGEPPELDIDISSWPPVSMGEFGGD  339

Query  1150  HHHHHPYGSAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGR  1323
               H   Y    +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGR
Sbjct  340   QSHQKQYVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  399

Query  1324  FVKR  1335
             FVKR
Sbjct  400   FVKR  403



>ref|XP_007153446.1| hypothetical protein PHAVU_003G036000g [Phaseolus vulgaris]
 gb|ESW25440.1| hypothetical protein PHAVU_003G036000g [Phaseolus vulgaris]
Length=384

 Score =   220 bits (560),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 169/418 (40%), Positives = 215/418 (51%), Gaps = 68/418 (16%)
 Frame = +1

Query  220   MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  399
             MSS + K  NA+  KTARACDSC+  RARW+C ADDAFLCQ+CD SVHSAN LA RH RV
Sbjct  1     MSSTKNK-GNAVGAKTARACDSCIRNRARWYCAADDAFLCQACDSSVHSANPLARRHHRV  59

Query  400   RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKK---------  552
             RL   S   A     S           + P+WH+GFT+KPRTPR+ K   K         
Sbjct  60    RLKIVSHIEANKKSFSG--------TGNGPSWHKGFTKKPRTPRHGKNGNKALKNPFDVV  111

Query  553   -QNSGGVAVEESVNPVLPFVPEMGSDDD---YNNNNEIDLF-CQVPVlldddlnallndg  717
              +++   + EESV+ VL  VP   S +     ++   +DL  C+    +           
Sbjct  112   PEDTNSNSHEESVDEVLYRVPATPSAEQGVSVSDERRVDLLGCESAFEIAFSA-------  164

Query  718   ggddHMRGLEIPEFLSSDVELAEFAADVETLLGDDDVGEDKA------TAAVKIEIN---  870
                      ++   L   +E      +   L+G D+V E  +         +K+E     
Sbjct  165   ---------DVESLLREGLESECVGMEELGLVGTDEVEEHASWECCVGGGNMKVEEEAYE  215

Query  871   -GGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYE  1047
              G DC   LN+S   E EV++KV+     G D+    ++         KK  +LL L+YE
Sbjct  216   LGFDCGHELNFSLTCE-EVKEKVI-----GLDKRQEVVKEDDQ---RKKKKILLLRLDYE  266

Query  1048  EVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG-----DHHHHHPYGSAMMMRRSDEGRE  1212
              VI+AW SQ   WT   +P       WP  M       +H     +G    M  +D GRE
Sbjct  267   AVITAWTSQRSLWTTSHKPDLGTTQFWPHCMRTCGVEFEHRSGELFGCDAAM--ADGGRE  324

Query  1213  ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  1386
             ARVSRYREKRR RLFSKKIRYEVRKLNAEKRPR+KGRFVKR SL   PP FP  LLN+
Sbjct  325   ARVSRYREKRRKRLFSKKIRYEVRKLNAEKRPRMKGRFVKRPSL-ATPPIFP--LLNK  379



>gb|KGN63817.1| hypothetical protein Csa_1G023050 [Cucumis sativus]
Length=360

 Score =   217 bits (552),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 164/398 (41%), Positives = 205/398 (52%), Gaps = 72/398 (18%)
 Frame = +1

Query  241   TANAISG-KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtss  417
             T+ A++G +TAR CDSCL KRARWFC ADDAFLCQSCDVSVHSAN LA RH R+RL TSS
Sbjct  3     TSTAMTGGRTARVCDSCLCKRARWFCAADDAFLCQSCDVSVHSANQLARRHDRIRLETSS  62

Query  418   sstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPV  597
                            +  D   P  W +GFTRK RTPR+     K +S   +       V
Sbjct  63    --------------FNSTDHLPPTPWLKGFTRKARTPRSNNNNNKISSSKAS-------V  101

Query  598   LPFVPEMGSDDDYN-----NNNEIDLFC----QVPVlldddlnallndgggddHMRGLEI  750
                VPE+G+D++       N++E   F     +VPV      +  L      +       
Sbjct  102   FSIVPEIGNDNELGFSIDENDDEHHQFLGHQQEVPVFDPLFDDQKLLLTDELEDFGD---  158

Query  751   PEFLSSDVELAEFAADVETLLGDDDV---------GEDKATAAVKIEINGGDCTEALNWS  903
               FL S+V+LAEF ADVE LLG  D          G       VK E    DC    N  
Sbjct  159   -GFLPSEVDLAEFVADVENLLGRQDDEEQQQQDHDGNTNIIVKVKDEDLVQDCINKNNNH  217

Query  904   FGEEQEVEQKVMMTMLSGFDessssmesgsckeeVAKKSRML-LSLNYEEVISAWASQGC  1080
              G             L  +D      E    + ++  K  ++ L LNY+ VI+AW +Q  
Sbjct  218   NG------------YLMDWDFKEEIEEEEEEELKIKNKKNIISLRLNYDAVITAWDAQSS  265

Query  1081  PWTDGTRPHFDPNHCWPDFMG-----------GDHHHHHPYGSAMMMRRSDEGREARVSR  1227
             P+T G RP FD + CW ++ G            D        + +    S+E REARVSR
Sbjct  266   PYTTGNRPQFDLDDCWEEWSGVCSKGGRNVVVDDQEWRGRNNNGI----SNEEREARVSR  321

Query  1228  YREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  1341
             YREKRRTRLFSKKIRY+VRKLNAEKRPR+KGRFVKR++
Sbjct  322   YREKRRTRLFSKKIRYQVRKLNAEKRPRMKGRFVKRTT  359



>ref|XP_010470801.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1 
[Camelina sativa]
 ref|XP_010470802.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Camelina sativa]
Length=413

 Score =   218 bits (556),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 163/423 (39%), Positives = 215/423 (51%), Gaps = 69/423 (16%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +  A+A+ GKTARACDSC+ +RARW+C ADDAFLC  CD SVHSAN LA RH+RVRL T+
Sbjct  3     KSLASAVGGKTARACDSCVKRRARWYCAADDAFLCHCCDGSVHSANPLARRHERVRLKTA  62

Query  415   ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKR-------------TKKQ  555
             S+     +  SSP             WH+GFTRK RTPR  K+             + + 
Sbjct  63    STGKHRHASSSSPP--------HETTWHQGFTRKARTPRGGKKRHTMVFHDLVPEMSTED  114

Query  556   NSGGVAVEESVNPVLPFVPEMGSDDDYNNNNEIDLFCQVPVlldddlnallndgggddH-  732
              +    VE  +   +P +  M  +  +N + E  +  +VP++     ++   D    +  
Sbjct  115   QTESYEVEGQLIFEVPVMNPMVEEQCFNESVETKI--EVPMMPVCFKSSDEEDEDNAESC  172

Query  733   MRGLEIPEFLSSDVELAEFAADVETLLG---------DDDVGEDK---------------  840
             + GL       +D+ELA+F ADVETLLG          +D+G  +               
Sbjct  173   LNGL-----FPTDMELAQFTADVETLLGGGIERDFYPTEDLGLGEMLKIEKEEVEEEEGV  227

Query  841   ATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeeVAKKS  1020
             AT  V  ++N  D T     SF  E   +            E            E++ K 
Sbjct  228   ATRDV-CDLNEVDETSPFEISFDYEYASKSTYEEEEEEDEKEDVMKNVIDMGVNEMSGKI  286

Query  1021  R-------MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH--CWPDFMGGD-----HHH  1158
             +       ++L L+YE V+S W  QG PWT       D +   C  D MG       HH+
Sbjct  287   KEENKEKALMLRLDYESVLSTWGGQGIPWTAQEPSEIDLDMVCCPTDSMGESGADQAHHY  346

Query  1159  HHPYGSAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
             +H  G  + M  + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  347   NHFRGLGLHMGEAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  406

Query  1336  SSL  1344
             SS+
Sbjct  407   SSI  409



>ref|XP_008453390.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Cucumis melo]
Length=368

 Score =   214 bits (546),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 158/393 (40%), Positives = 195/393 (50%), Gaps = 82/393 (21%)
 Frame = +1

Query  268   ARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaaslls  447
             AR CDSCL KRARWFC ADDAFLCQSCDVSVHSAN LA RH R+RL              
Sbjct  21    ARVCDSCLCKRARWFCAADDAFLCQSCDVSVHSANQLARRHDRIRL-------------E  67

Query  448   sPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVPEMGSD  627
             +       D   P  W +GFTRK RTPR         S    +  S   V   VPE+G+D
Sbjct  68    TSSFNSTTDHLPPTPWLKGFTRKARTPR---------SNNNKISSSKASVFSIVPEIGND  118

Query  628   DDYN-----NNNEIDLFC----QVPVlldddlnallndgggddHMRGLEIPEFLSSDVEL  780
             ++       N++E   F     +VPV      +  L      +         FL S+V+L
Sbjct  119   NELGFSIDENDDEHHQFLGHQQEVPVFDPLFDDQKLLLTHELEDFGD----GFLPSEVDL  174

Query  781   AEFAADVETLLGD-----DDVGEDKATAAVKI--EINGGDCTEA--------LNWSFGEE  915
             AEF ADVE LLG           D  T  VK+  E    DC           ++W F EE
Sbjct  175   AEFVADVENLLGKEEEEEQQQQHDGNTIIVKVKDEELVQDCINKNNNHNGFWMDWDFKEE  234

Query  916   QEVEQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDG  1095
              E E++    +                 +   KK+ + L LNY+ VI+AW +Q  P+T G
Sbjct  235   IEEEEEDEEEL-----------------KIKNKKNIISLRLNYDAVITAWDAQSSPYTTG  277

Query  1096  TRPHFDPNHCWPDFMG-----------GDHHHHHPYGSAMMMRRSDEGREARVSRYREKR  1242
              RP FD + C  ++ G            D      Y   +    S+  REARVSRYREKR
Sbjct  278   NRPQFDLDDCLEEWSGICSKGGRNVAVDDQEWRRNYNGII----SNGEREARVSRYREKR  333

Query  1243  RTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  1341
             RTRLFSKKIRY+VRKLNAEKRPR+KGRFVKR++
Sbjct  334   RTRLFSKKIRYQVRKLNAEKRPRMKGRFVKRTT  366



>ref|XP_009109881.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brassica 
rapa]
Length=395

 Score =   215 bits (547),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 155/418 (37%), Positives = 205/418 (49%), Gaps = 85/418 (20%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +  AN +  KTAR CD+CL K+A WFC AD+AFLCQSCD SVHSANLLA RH+RVRL   
Sbjct  2     KSLANCVRAKTARTCDNCLKKQAHWFCAADEAFLCQSCDTSVHSANLLARRHERVRL---  58

Query  415   ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNP  594
                       +SP+          P W+RGFTRKPRTPR +   K+ NS         + 
Sbjct  59    -------KDSTSPQ-------QEAPTWYRGFTRKPRTPRGS--GKRNNS---------ST  93

Query  595   VLPFVPEMGSDDDYNNNN-EIDLFCQVPVlldddlnalln--dgggddHMRGLE------  747
                 VPE+ ++   +++  E  L CQVPVL    +   +          + G E      
Sbjct  94    FQDMVPEISAEGQTDSSEVEGPLICQVPVLGPMVVEPKIKFPTMRSGVMIDGHEDEDKDE  153

Query  748   --IPEFLSSDVELAEFAADVETLLG---------------------DDDVGEDKATAAVK  858
               +     +++E+ +FAADVETLLG                       D  EDK T A+ 
Sbjct  154   SCLNGIFPTNMEVEDFAADVETLLGHGLDKESYTMEELGLSNTEMFKKDEIEDKETKAMN  213

Query  859   IEINGG-------DCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeeVAKK  1017
             ++I  G       D T   + ++ +    E  +     SG              +E  KK
Sbjct  214   MDIEIGDDDQGNRDGTLPFDLNYPQNAYEEDAIKNVESSG---------ECVQAKEEKKK  264

Query  1018  SRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR--  1191
             + ++LSL+Y++VISAW  QG PWT G  P  D N      +       +   S    R  
Sbjct  265   NVLMLSLDYDQVISAWGGQGLPWTSGGPPELDINISGSPVVSKVSKRDNGRKSRKKRRVG  324

Query  1192  -------RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
                      D GREA VSRYREK++TR F+K IRYEVRKLNAE +PR+KGRFVKR+ L
Sbjct  325   GCLPSSVVGDGGREASVSRYREKKKTRSFTKTIRYEVRKLNAENKPRMKGRFVKRTPL  382



>ref|XP_009409257.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=411

 Score =   214 bits (545),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 158/426 (37%), Positives = 207/426 (49%), Gaps = 87/426 (20%)
 Frame = +1

Query  232   QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  411
             QR + +A+ GK ARAC  CL  RARW+C A  AFLCQ CD SVHSAN L  RHQRVRL T
Sbjct  8     QRPSPDAVGGKAARACYGCLRHRARWYCTAHHAFLCQICDSSVHSANPLVRRHQRVRLTT  67

Query  412   sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVA---VEE  582
             +S              +  +  +S P+W  GF RK RT R   RT    +G +    V+ 
Sbjct  68    TS--------------LVGEPGESSPSWLEGFERKARTSRPQHRTNMMAAGDLPEQLVDA  113

Query  583   SV-------------------NPVL-----PFVP-----EMGSDDDYNNNNEIDLFCQVP  675
             SV                   NP+      P  P        S DD      ++L    P
Sbjct  114   SVDEDDDGEQEEELSYCVPIRNPLFASFCSPPPPLDNSNATSSGDDAAAKTSVELSDNSP  173

Query  676   VlldddlnallndgggddHMRGLEIPEFLSSDVELAEFAADVETLLGDDDVGEDKATAAV  855
                                M G     FL+ D+E++EFAA +++LLG D VG D A    
Sbjct  174   ASPSTIN-----------KMDG-----FLTMDLEISEFAARIKSLLGGDLVGGDDAFCMA  217

Query  856   KIEI------NGGDCTE------ALNWSFGEEQEVEQKVMMTMLSGF-------Dessss  978
              +E+      N G   E       +     +E E + ++ + +   F       +     
Sbjct  218   NLELAEPVAENTGFSIEDDARHVKMEQPDRDEDESQGELELNLECSFPFTRGEEESEEDE  277

Query  979   mesgsckeeVAKKSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFM-----  1140
             +   + K E   + +  L L+YE +I AW+SQG  PWTDG RP  + ++CWPD+M     
Sbjct  278   VAGTAVKVEQGAEKKAKLRLDYESIIMAWSSQGSSPWTDGERPQINVDNCWPDYMDMWTG  337

Query  1141  GGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKG  1320
              G       +G  + +   D  REARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KG
Sbjct  338   SGMETERACHGGEIGVYLGDGKREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKG  397

Query  1321  RFVKRS  1338
             RFVKR+
Sbjct  398   RFVKRT  403



>ref|XP_010926126.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Elaeis 
guineensis]
Length=424

 Score =   214 bits (544),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 168/437 (38%), Positives = 215/437 (49%), Gaps = 101/437 (23%)
 Frame = +1

Query  226   SDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  405
             SD+ ++  A+ GKTA ACD CL +RARW+C ADDAFLC +CD SVHSAN LA RH R+RL
Sbjct  5     SDELRSPGALGGKTAHACDGCLRRRARWYCAADDAFLCMACDASVHSANTLALRHHRLRL  64

Query  406   GtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEES  585
                          SS   +  + DD+ P W  GF R+ RTPR     K   +G   +E  
Sbjct  65    ----------QTSSSSPPLSSNFDDALPPWLHGFKRRARTPR----VKPSPAGPPKLE--  108

Query  586   VNPVLPFVPEMGSDDDYNNNNE-----IDLFCQVPVlldddlnallndgggddHMRGLEI  750
                  P VP++ +D+      E     + +F  V             D   D+     ++
Sbjct  109   -----PLVPDLEADEKLYAEEEHLLHRVPIFDPVLAEFFSPPAINDADTLTDEAKPVAQL  163

Query  751   PE----------------FLSSDVELAEFAADVETLLG----------------DDDVGE  834
             PE                F  SD++L EFAA+VETLLG                D    +
Sbjct  164   PEHAHVPAPAAAAGSLAGFQPSDLDLDEFAANVETLLGRGLDDGTFCIDALGLIDSAKDD  223

Query  835   DKATAAVKIEINGGD---------------CTEALNWSFGE----EQEVEQKVMMTMLSG  957
             DK    V+++I+ G                 TE L+  FG     E+  EQKV       
Sbjct  224   DKGRVKVELDIDAGGGSDVVACNTDMEIDLSTETLDIDFGRRLRGEEHEEQKVA------  277

Query  958   FDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPD  1134
              +E++ +   G   E  A    M+L L+YE VI+AW+  GC PWTDG RP F+ +    D
Sbjct  278   -EEAAMASGGGGGVERAAAGRGMMLRLDYEAVIAAWSCNGCSPWTDGERPQFNLD----D  332

Query  1135  FM-----------GGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEV  1281
             FM           GG       YG  + M   + GREARV+RYREKRRTRLFSKKIRYEV
Sbjct  333   FMMMMWSGGSVREGGGWKVAPVYGE-VGMAAGNGGREARVTRYREKRRTRLFSKKIRYEV  391

Query  1282  RKLNAEKRPRLKGRFVK  1332
             RKLNAEKRPR+KGRFVK
Sbjct  392   RKLNAEKRPRMKGRFVK  408



>ref|XP_009410076.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Musa acuminata 
subsp. malaccensis]
Length=423

 Score =   211 bits (537),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 168/427 (39%), Positives = 221/427 (52%), Gaps = 83/427 (19%)
 Frame = +1

Query  259   GKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaas  438
             GKTARACD C  +RARW+C ADDAFLCQ+CD SVHSAN LA RH R+RL         A+
Sbjct  20    GKTARACDGCGRRRARWYCAADDAFLCQNCDSSVHSANPLARRHNRIRL-------KTAT  72

Query  439   llssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVPEM  618
                +P +   D DDS P+W RGF RK RTPR  +  K  +    A   +V    P + E 
Sbjct  73    SSGAPDV---DSDDSAPSWLRGFKRKARTPRPHQHAKTASEARTAHPTTV----PELVET  125

Query  619   GSDDDYNNNNEIDLFCQVPVlldddlnallndgggddHM-RGLE----------------  747
               D+  +   ++ ++C VPV               D +   G E                
Sbjct  126   SLDETEDEEQQL-IYC-VPVFDPAFAEFRSPPPLDDSNAPSGNEAKPTMDLQECTPASTP  183

Query  748   -------IPEFLSSDVELAEFAADVETLLGDDDVGEDKATAAVKIEING--GDCTEALNW  900
                    +  FL SD+E+AEFAA++E+LLG    G D +  +  +E  G      + +N+
Sbjct  184   TINTANRLTAFLPSDMEIAEFAANMESLLGG---GLDVSDGSFSMEKLGLVNSIEDGVNY  240

Query  901   SFGE------EQE-------VEQKVMM---TMLSGFDessssmes-----------gsck  999
               G+      EQ        VE  + M   T+   F+ + SS               + +
Sbjct  241   CLGDAGRLKTEQPDDTVGCPVELDIDMSRETLELDFNWTGSSTAEEEEFEEEKIMVATEQ  300

Query  1000  eeVAKKSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMG----GDHHHHH  1164
             ++V +K+R  LSL+YE VI AW+S G  PWTDG RP  + + CW D  G    G      
Sbjct  301   QQVTQKAR--LSLDYEAVIIAWSSHGSSPWTDGERPQINLDSCWHDCTGMWVEGADALGV  358

Query  1165  PYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
              +GS      +D GR+ARV+RYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+  
Sbjct  359   GHGSDTGGGYADVGRQARVTRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRA--  416

Query  1345  FQPPPPF  1365
               P P F
Sbjct  417   --PGPAF  421



>ref|XP_006829901.1| hypothetical protein AMTR_s00073p00061640 [Amborella trichopoda]
 gb|ERM97317.1| hypothetical protein AMTR_s00073p00061640 [Amborella trichopoda]
Length=390

 Score =   208 bits (529),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 152/399 (38%), Positives = 197/399 (49%), Gaps = 58/399 (15%)
 Frame = +1

Query  262   KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasl  441
             KT R CDSC   RARW+C ADDAFLC +CD ++HSAN +A RH RVRL TSSS      L
Sbjct  19    KTVRPCDSCGKGRARWYCAADDAFLCHACDGTIHSANSVARRHDRVRLKTSSSHRCEFVL  78

Query  442   lssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVPEMG  621
                            P+W RG  R  R   N K            +   NP++  VP+M 
Sbjct  79    ---------------PSWQRGKARSMRPHPNMKNPID------GAKPHANPLV--VPQMQ  115

Query  622   SDDDYNNNNEIDLFCQVPVlldddlnallndgggd-----------dHMRGLEIPEFLSS  768
              +   +  +E  L  QVPV      +   +                  M   +     S 
Sbjct  116   EESSPDEVDE-QLLYQVPVFEPMAADLRSSPARATPADCKPTIDTPAEMAVAKFSAIPSL  174

Query  769   DVELAEFAADVETLLGD---------------DDVGEDKATAAVKIEINGGDCTEALNWS  903
             D++LA+FAADVE+LLG                D+  E++   A ++++   +  + +   
Sbjct  175   DMDLADFAADVESLLGQGLDEDAFGIEGLGLLDNYREEEEGVASRVKVEEEEDEDGIFGC  234

Query  904   FGEEQEVEQKVMMTMLS---GFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQ  1074
                    E ++    L     +D  +++ E    K  +  +  + L L+YE VISAW   
Sbjct  235   SHHPDVAEVELSSETLEFNFDYDTPTTAGEDDEEKCRIVLEKSISLRLDYEAVISAWGRS  294

Query  1075  GCPWTDGTRPHFDPNHCWPD-FMGGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTR  1251
               PWT G RP F+P+ CWPD F G        Y        SD GREARVSRYREKRRTR
Sbjct  295   --PWTTGQRPEFNPDDCWPDPFTGNCVPEMSTYSEVGNATASDGGREARVSRYREKRRTR  352

Query  1252  LFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  1368
             LFSKKIRYEVRKLNAEKRPR+KGRFVKR+S   PP P+P
Sbjct  353   LFSKKIRYEVRKLNAEKRPRMKGRFVKRTSF--PPTPYP  389



>gb|AGI62036.1| CONSTANS-like 12 [Erycina pusilla]
Length=339

 Score =   205 bits (522),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 150/405 (37%), Positives = 182/405 (45%), Gaps = 115/405 (28%)
 Frame = +1

Query  238   KTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtss  417
             + A AI GKTARACD C+ +RARWFC ADDAFLC  CD  +HSAN LA RH R+RL    
Sbjct  13    QPAAAIGGKTARACDGCIRRRARWFCAADDAFLCDPCDSHIHSANQLAGRHHRLRL----  68

Query  418   sstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPV  597
                                  + P+WH GFTRKPRTPR+  +                  
Sbjct  69    -----------KSSSSTTLSVATPSWHHGFTRKPRTPRSHHK------------------  99

Query  598   LPFVPEMGSDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMRGLEIPEFLSSDVE  777
              P VP++             L  +VPV                      + P  +  D E
Sbjct  100   -PLVPDL-ESSVEEEEEGEQLLYRVPV---------------------FDPPSAVPPDTE  136

Query  778   LAEFAADVETLLGD--DDVGE---------------------DKATAAVKIE--------  864
               +F+AD+E+LLG   D  GE                     D A    KIE        
Sbjct  137   TEDFSADMESLLGREFDRGGEFCMEELGLGGAGGGAVAGVAGDPAEKKGKIEEKGEILGI  196

Query  865   -INGGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLN  1041
              I G  C E L   FGEE + E KV ++                          M LSL+
Sbjct  197   GIEGDLCRENLEIDFGEEIKEEIKVGIS------------------------KGMGLSLD  232

Query  1042  YEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMG--GDHHHHHPYGSAMMMRRSDEGRE  1212
             YE V  AW   G  PW  G RP       W + +G  G+           +++  D GRE
Sbjct  233   YEAVKEAWMVTGSSPWMTGERPRMGVEDYWHECLGKFGETGGEFIGSGTGIIQFMDLGRE  292

Query  1213  ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  1347
             ARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+ +F
Sbjct  293   ARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTDVF  337



>gb|EYU29978.1| hypothetical protein MIMGU_mgv1a007591mg [Erythranthe guttata]
Length=402

 Score =   207 bits (526),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 158/428 (37%), Positives = 209/428 (49%), Gaps = 83/428 (19%)
 Frame = +1

Query  220   MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  399
             M SD RK ++ I GK+ARACDSC+ KRARW+C ADDAFLCQSCD SVHSAN LA RH+RV
Sbjct  1     MDSD-RKLSDTIVGKSARACDSCIKKRARWYCAADDAFLCQSCDSSVHSANSLARRHERV  59

Query  400   RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  579
              L ++S            KI        P  WH+GFTRK RTPR+    KK      A+ 
Sbjct  60    LLKSASIH----------KI-----KSEPSNWHQGFTRKARTPRH----KKNGKAAAALF  100

Query  580   ESVNPVLPFVPEM---GSDDDYNNNNEIDLFCQVPVlldddlnallndgggddHM-----  735
              + N  LP VPE+     +      NE  L  +VP+               + ++     
Sbjct  101   SNTNHPLPLVPEINNSSEEKSNEEENEEQLLYRVPIFEPVSDFITHEANTSERNILAPPS  160

Query  736   -RGLEIPEFLS--------------SDVELAEFAADVET-------------LLGDDDVG  831
               G+++ EF                +++E   F  D +               L D+ V 
Sbjct  161   SSGMDLDEFAECLLGKGMDDFHESFNNMEGLGFLDDCDDENGGRGLSSNELFWLSDESVK  220

Query  832   EDKATAAVKIEINGGDCTEALNWSF--GEEQEVEQKVMMTMLSGFDessssmesgsckee  1005
              ++    +++E + G  T  LN+ F     +  EQ+     ++ F+              
Sbjct  221   VEENHHQIEVEFDMGRETFELNFDFDYSPTRGEEQEQEEEEIAAFN--------NFENFA  272

Query  1006  VAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHC-WPDFMG-----------GD  1149
             +    + LL L+Y  V+SAW     PWT G RP    + C WP+F G           G 
Sbjct  273   MENYEKTLLKLDYGGVMSAWDKHKSPWTTGERPPEPISGCHWPEFSGACGTMGVNGETGK  332

Query  1150  HHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFV  1329
              + + P  +       D GREARVSRYREKRR RLFSKKIRYEVRKLNAEKRPR+KGRFV
Sbjct  333   INENIPAAAT-----GDGGREARVSRYREKRRKRLFSKKIRYEVRKLNAEKRPRMKGRFV  387

Query  1330  KRSSLFQP  1353
             KR++L  P
Sbjct  388   KRANLEAP  395



>ref|XP_009381104.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Musa acuminata 
subsp. malaccensis]
Length=419

 Score =   207 bits (526),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 171/448 (38%), Positives = 225/448 (50%), Gaps = 87/448 (19%)
 Frame = +1

Query  217   MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  396
             M  +++++ A+A+  KTAR CD CL +RARWFC ADDAFLCQ+CDVSVHSAN LA RH+R
Sbjct  1     MGCTEKQRPASAVGAKTARPCDGCLRRRARWFCEADDAFLCQACDVSVHSANPLARRHRR  60

Query  397   VRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAV  576
             VRL T+S S   ++            D + PAW  G  RKPRTPR      K    G   
Sbjct  61    VRLKTASFSGFLSTTEDG------LGDHATPAWLHGCKRKPRTPRG-----KPGVAGAPT  109

Query  577   EESVNPVLPFVPEMGSDDDYNNNNEIDLFCQVPVll-----------------dddlnal  705
                V P++P +  + ++++  N  +  L C VP+L                   D     
Sbjct  110   AAKVEPLVPDLEALSAEENQFNEEDQLLHC-VPILDPVLAELLSQPHHDHANGSDTEAKP  168

Query  706   lndgggddHMRGLEIPE----FLSSDVELAEFAADVETLLGD---------DDVG-----  831
                     H+  +   +    F +SD+EL +FA+D+E LLG          D +G     
Sbjct  169   AVQLLEQAHVSAVPTADGLGGFHASDLELEQFASDMEVLLGSGLDNDSFCIDGLGWMNGT  228

Query  832   -EDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMTMLSGFDes-------------  969
              ED +   VK+E++      + N  F  E ++ +     +  GFD               
Sbjct  229   VEDDSDGQVKVEVDLDVARTSSN--FRMEMDLPK---WKLDLGFDSQMMAVEVDEHKPLQ  283

Query  970   sssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCP-WTDGTRPHFDPNHCWPDF---  1137
              +   S + + E A K +M+L L+YE VI+A +S     W DG RP FDPN  WPD    
Sbjct  284   QAETASDNYRAEAAAKRKMILRLDYEAVIAACSSNVLSLWIDGVRPDFDPNDSWPDVPAM  343

Query  1138  -----MGGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEK  1302
                     + H+      A     +DEGREARVSRYREKRR RLFSKKIRYEVRKLNAEK
Sbjct  344   AGGAAAMKEMHYQQEVAHA-----ADEGREARVSRYREKRRRRLFSKKIRYEVRKLNAEK  398

Query  1303  RPRLKGRFVKRSSLFQPPPPFPNYLLNR  1386
             RPR+KGRFVKR       P FP  L  R
Sbjct  399   RPRMKGRFVKR-------PAFPAALACR  419



>ref|XP_008445668.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
melo]
 gb|ADN34083.1| zinc finger (B-box type) family protein [Cucumis melo subsp. 
melo]
Length=335

 Score =   204 bits (519),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 160/406 (39%), Positives = 207/406 (51%), Gaps = 88/406 (22%)
 Frame = +1

Query  217   MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  396
             MMS  ++  ANA+ GKTARACDSC+ +RARW+C ADDAFLCQSCD +VHSAN LA RHQR
Sbjct  1     MMS--RKNIANAVGGKTARACDSCVRRRARWYCAADDAFLCQSCDTTVHSANPLARRHQR  58

Query  397   VRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAV  576
             +RL +S+S          P +       + P+W  GFTRKPRTPR   ++         +
Sbjct  59    LRLNSSNS----------PTL-------NSPSWVSGFTRKPRTPRPRPKSND------LI  95

Query  577   EESVNPVLPFVPEMGSDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMRGLEIPE  756
               SV      VPE  +DD  ++ +E                          H+    +  
Sbjct  96    HVSV------VPE--TDDATSHEDE--------------------------HLEDQLLYR  121

Query  757   FLSSDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKV  936
               + DV +++F  DVE  L  +    ++    VK+E +   C     W  GE  + +Q  
Sbjct  122   VPTLDVNVSDFGGDVEKNLEREWFDIEEELGFVKVEES---C-----WRIGEGFDSDQVD  173

Query  937   MMT---------MLSGFDessssmesgsckeeVAKKSRMLLSL--NYEEVISAWASQGCP  1083
              +          ++ G                  K  R +LSL  + E VI+AW +   P
Sbjct  174   FLMDFEEIKIPPLVVGVKNERHEDNEDDESGITNKNKRRVLSLRLDCEAVIAAWGNLQSP  233

Query  1084  WTDGTRPHFDPNHCWPDFMG------GDHHHHHPYGSAMMMRRSDEGREARVSRYREKRR  1245
             WT+G RP FDP+  WP+ M       G     H   +A M    D GREARVSRYREKRR
Sbjct  234   WTNGQRPDFDPDQPWPNSMEVCEVRYGQRCGEHGLRTAAM---GDGGREARVSRYREKRR  290

Query  1246  TRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLN  1383
             TRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+  F P P  P   +N
Sbjct  291   TRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTP-FPPQPTLPFITIN  335



>ref|XP_004982006.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Setaria 
italica]
Length=406

 Score =   204 bits (518),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 150/404 (37%), Positives = 193/404 (48%), Gaps = 74/404 (18%)
 Frame = +1

Query  220   MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  399
             M++    T   +  +TAR+CD C+ +RARW C ADDAFLCQ+CD SVHSAN LA RH RV
Sbjct  1     MTNAGAATGAVLGARTARSCDGCMRRRARWHCPADDAFLCQACDTSVHSANPLARRHHRV  60

Query  400   RLGtsssstaaasllssPKIVddddddSP--PAWHRGFTRKPRTPRNAKRTKKQNS---G  564
             RL               P          P  PAW  G  R+PRTPR+     K  +    
Sbjct  61    RL---------------PSASCSSPPRDPDAPAWLHGLKRRPRTPRSKPGVSKHETTPAS  105

Query  565   GVAVEESVNPVLPFVPEMGS----DDDYNN--NNEIDLFCQVPVlldddlnallndgggd  726
               A   +  P L      GS    D+DY+    ++ DL  +VPV                
Sbjct  106   IAAAVSAAVPDLEAEESAGSGIVGDNDYHGLEEDDEDLLYRVPVFDPMLAELYNPVADEG  165

Query  727   dHMRGLEI--------PEFLSS-------------DVELAEFAADVETLLGDDDVGEDKA  843
             +      +        PEF S              D+ELA FAAD+E+LL   D G D  
Sbjct  166   EQKPAACLISSLAETSPEFASGLAEADGLSGYDVPDMELASFAADMESLLMGVDEGFD--  223

Query  844   TAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeeVAKKSR  1023
                              +  F +E++ +  V    L   +  + ++ +    ++  K+  
Sbjct  224   -----------------DLGFLDEEKPQVNVD---LGSMNLETMAVPAPERDDKKRKRPE  263

Query  1024  MLLSLNYEEVISAWASQG-CPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSD  1200
             M+L LNY+ VI++WA  G  PW  G RPH DP+  W DF  G        G  +      
Sbjct  264   MILKLNYDGVIASWARDGGSPWFHGERPHLDPHESWSDFPAGSRGL---LGGTVTAVTGG  320

Query  1201  EGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVK  1332
             E REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVK
Sbjct  321   E-REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVK  363



>ref|NP_001051053.1| Os03g0711100 [Oryza sativa Japonica Group]
 gb|AAX95654.1| CCT motif, putative [Oryza sativa Japonica Group]
 gb|ABF98509.1| CCT motif family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF12967.1| Os03g0711100 [Oryza sativa Japonica Group]
 gb|EAY91607.1| hypothetical protein OsI_13241 [Oryza sativa Indica Group]
 dbj|BAH00071.1| unnamed protein product [Oryza sativa Japonica Group]
Length=421

 Score =   201 bits (512),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 162/403 (40%), Positives = 205/403 (51%), Gaps = 82/403 (20%)
 Frame = +1

Query  262   KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasl  441
             +TARACD C+ +RARW C ADDAFLCQ+CD SVHSAN LA RH RVRL ++SSS A++  
Sbjct  15    RTARACDGCMRRRARWHCPADDAFLCQACDASVHSANPLARRHHRVRLPSASSSPASSPR  74

Query  442   lssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGG---------VAVEESVNP  594
              ++      DD D+P AW  G  R+PRTPR      K   GG          A   S  P
Sbjct  75    SAAAPRAGSDDPDAP-AWLHGLKRRPRTPRT-----KPGGGGKHDASAATVAAAAASAVP  128

Query  595   VLPFVPEMG----SDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMRGLE-----  747
              L    E G    +D D    ++ DL  +VPV               D+  +  +     
Sbjct  129   DLE-AEESGIVGDTDHDVGEEDDEDLLYRVPVFDPMLAELYNPVAADDEEQQIEQKPAAR  187

Query  748   -------IPEFLSS-------------DVELAEFAADVETLL-----GDDDVG-EDKATA  849
                     PEF S              D+ELA FAAD+E+LL     G DD+G  D    
Sbjct  188   VVPFSEPSPEFASGSVEADGLSGFDVPDMELASFAADMESLLMGVDEGFDDLGFLDDEKP  247

Query  850   AVKIEINGGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeeVAKKSRML  1029
              VK++++      +++ +   E+E  ++                          K+  M+
Sbjct  248   HVKLDLDMDMDFASISPAPAPEREERKR--------------------------KRPEMI  281

Query  1030  LSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEG  1206
             L L+YE VI +WA  G  PW  G RP FDP+  WPDF  G        G+A+      E 
Sbjct  282   LKLDYEGVIDSWARDGASPWFHGERPRFDPSESWPDFPAGSRGG---LGAAVTAVTGGE-  337

Query  1207  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
             REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  338   REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  380



>ref|XP_003560836.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Brachypodium 
distachyon]
Length=436

 Score =   198 bits (504),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 163/438 (37%), Positives = 208/438 (47%), Gaps = 75/438 (17%)
 Frame = +1

Query  217   MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  396
             M SS  +  A A+  K ARACD CL +RARW+C ADDAFLCQ+CD SVHSAN LA RH+R
Sbjct  1     MSSSLAKAAAGAMGSKAARACDGCLRRRARWYCAADDAFLCQACDASVHSANPLARRHER  60

Query  397   VRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTP------------RNAK  540
             VRL     ++   +    P+    D+    PAW   F RKPRTP            R   
Sbjct  61    VRL---RPTSPLQAGAGGPRARRGDEVV--PAW---FKRKPRTPRGKSVIGHLLSSRRPV  112

Query  541   RTKKQNSGGVAVEE----------------SVNPVLPFVPEMGSDDDYNNNNEIDLFC-Q  669
                 + SGG    E                SV    P + E+ S     +  +    C +
Sbjct  113   VVPDEASGGEGSPEEHKLFEGETDEEELLYSVPVFDPALAELCSPSSPRHLEDYASCCNE  172

Query  670   VPVlldddlnallndgggddHMRGLEIPEFLSSDVELAEFAADVETLLG---DDDVGE--  834
               V++ +            D      +  F  +D EL EFAAD+E LLG   D+   E  
Sbjct  173   DRVVVLESPTEPAAPSLAVDQFFPDSVVSFGPTDAELMEFAADMEALLGRGLDEGTEEEP  232

Query  835   ---------------DKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMTMLS-GFDe  966
                            D A   VK+E +G      +  + G E+E E +V   ML   FD+
Sbjct  233   FCMEALGLIQPMVDVDGAGGRVKMETDGE--ARGMFLACGLEREPETEVSGNMLGIDFDD  290

Query  967   ssssmesgsckeeVA-KKSRML-----LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCW  1128
                S ++   +   +   +R L     L+LNYE +I  W  +  PW DG RP    + CW
Sbjct  291   DYGSPQATPDENAASGSAARFLPRSLSLNLNYEAIIDKW--EKSPWADGKRPDVKLDGCW  348

Query  1129  PD-------FMGGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRK  1287
             P         MGG    H          + D GR+ARVSRYREKRRTRLFSKKIRYEVRK
Sbjct  349   PHDYSMSVWMMGGVLVGHGTEELRTPRTKMDGGRDARVSRYREKRRTRLFSKKIRYEVRK  408

Query  1288  LNAEKRPRLKGRFVKRSS  1341
             LNAEKRPR+KGRFVKR++
Sbjct  409   LNAEKRPRMKGRFVKRAN  426



>ref|NP_001149548.1| CCT motif family protein [Zea mays]
 gb|ACG35795.1| CCT motif family protein [Zea mays]
 gb|AFW67846.1| CCT motif family protein [Zea mays]
 gb|AIB05334.1| C2C2-CO-like transcription factor, partial [Zea mays]
Length=413

 Score =   197 bits (501),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 153/422 (36%), Positives = 199/422 (47%), Gaps = 99/422 (23%)
 Frame = +1

Query  220   MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  399
             M+S    T  A+  +TAR+CD C+ +RARW C ADDAFLCQ+CDVSVHSAN LA RH RV
Sbjct  1     MTSAGAATGAALGARTARSCDGCMRRRARWHCPADDAFLCQTCDVSVHSANPLARRHHRV  60

Query  400   RLGtsssstaaasllssPKIVddddddSP--PAWHRGFTRKPRTPRNAKRTKKQNS----  561
             RL               P          P  P W  G  R+PRTPR+     K N     
Sbjct  61    RL---------------PSASCSSPPRDPDAPTWLHGLKRRPRTPRSKPGGSKSNKHEAT  105

Query  562   -------------GGVAVEESVNPVLPFVPEMGSDDDYNN---NNEIDLFCQVPVllddd  693
                            +  EES + +L      G +DD++    +++ DL  +VPV     
Sbjct  106   PSFIAAAASSAAVPDLEAEESGSGIL------GGNDDHHGFLQDDDEDLLYRVPVFDPML  159

Query  694   lnallndgggddHMRGLEI---------PEFLSS---------------DVELAEFAADV  801
                        +      +         PEF S                D+ELA FAAD+
Sbjct  160   AEFYNPVADEGEQKPACSLLMPSLAETSPEFASGGSAEADGLSVSFHVPDMELASFAADM  219

Query  802   ETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssm  981
             E+LL             + ++ +G DC   L+         E+K  +      D  +   
Sbjct  220   ESLL-------------MGVDDDGFDCLGFLD---------EEKPQVNA----DLDAIVA  253

Query  982   esgsckeeVAKKSRMLLSLNYEEVISAWASQG-CPWTDGTRPHFDPNHCWPD-FMGGDHH  1155
              +   +++  K+  M+L LNYE VI++W   G  PW  G RPH D +  W D F  G   
Sbjct  254   PAPEPEDKKRKRPEMILKLNYEGVIASWVRDGGSPWFHGERPHLDCHELWSDDFTTGSRE  313

Query  1156  HHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
                  G A+      E REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  314   L---LGGAVTPVTGGE-REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  369

Query  1336  SS  1341
             ++
Sbjct  370   AT  371



>ref|NP_177528.1| zinc finger protein CONSTANS-LIKE 7 [Arabidopsis thaliana]
 sp|Q9C9A9.1|COL7_ARATH RecName: Full=Zinc finger protein CONSTANS-LIKE 7 [Arabidopsis 
thaliana]
 gb|AAG52532.1|AC016662_26 hypothetical protein; 93964-92656 [Arabidopsis thaliana]
 gb|AAU84677.1| At1g73870 [Arabidopsis thaliana]
 gb|AAV43785.1| At1g73870 [Arabidopsis thaliana]
 gb|AEE35518.1| zinc finger protein CONSTANS-LIKE 7 [Arabidopsis thaliana]
Length=392

 Score =   196 bits (498),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 150/425 (35%), Positives = 199/425 (47%), Gaps = 82/425 (19%)
 Frame = +1

Query  217   MMSSDQRKTANAISGK-TARACDSCLSK-RARWFCVADDAFLCQSCDVSVHSANLLASRH  390
             M+   + +TA+    K  AR CD+C+ + RA W+C ADDAFLCQSCD S+HSAN LA RH
Sbjct  1     MVVDVESRTASVTGEKMAARGCDACMKRSRASWYCPADDAFLCQSCDASIHSANHLAKRH  60

Query  391   QRVRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGV  570
             +RVRL             SSP    +  D +   W+ GF RK RTPR         S   
Sbjct  61    ERVRL-----------QSSSP---TETADKTTSVWYEGFRRKARTPR---------SKSC  97

Query  571   AVEE--SVNPVLPFVPEMGSDDD-----YNNNNE----------------------IDLF  663
             A E+   +    P VPE+G D+D     +++  E                      I+ F
Sbjct  98    AFEKLLQIESNDPLVPELGGDEDDGFFSFSSVEETEESLNCCVPVFDPFSDMLIDDINGF  157

Query  664   CQVPVlldddlnallndgggddHMRGLEIPEFLSSDVELAEFAADVETLLGDD-------  822
             C VP  +++              M       F+  D++L +   DVE+LL ++       
Sbjct  158   CLVPDEVNNTTTNGELGEVEKAIMDDEGFMGFVPLDMDLEDLTMDVESLLEEEQLCLGFK  217

Query  823   ---DVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgs  993
                DVG  K    V  EIN  D            + V+ +      +  +   S      
Sbjct  218   EPNDVGVIKEENKVGFEINCKDL-----------KRVKDEDEEEEEAKCENGGSKDSDRE  266

Query  994   ckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPH--FDPNHCWPDFMGGDHHHHHP  1167
                +  +K+ + L L+Y  VISAW + G PW  G +P      N C P  +GG       
Sbjct  267   ASNDKDRKTSLFLRLDYGAVISAWDNHGSPWKTGIKPECMLGGNTCLPHVVGGYEKLMSS  326

Query  1168  YGSAMMMRRSDEG-----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVK  1332
              GS    +  D G     REARV RY+EKRRTRLFSKKIRYEVRKLNAE+RPR+KGRFVK
Sbjct  327   DGSVTRQQGRDGGGSDGEREARVLRYKEKRRTRLFSKKIRYEVRKLNAEQRPRIKGRFVK  386

Query  1333  RSSLF  1347
             R+SL 
Sbjct  387   RTSLL  391



>ref|XP_010416209.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like [Camelina 
sativa]
Length=401

 Score =   196 bits (499),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 155/426 (36%), Positives = 209/426 (49%), Gaps = 80/426 (19%)
 Frame = +1

Query  217   MMSSDQRKTANAISGKTA-RACDSCL--SKRARWFCVADDAFLCQSCDVSVHSANLLASR  387
             M+   + + A    GKTA R CD C+  S RA W+C ADDAFLCQSCD S+HSAN LA R
Sbjct  1     MVVEVESRAAGVTGGKTAARGCDVCMKRSSRASWYCPADDAFLCQSCDASIHSANNLAKR  60

Query  388   HQRVRLGtsssstaaasllssPKIVdddddd--SPPAWHRGFTRKPRTPRNAKRTKKQNS  561
             H+RVRL             SSP+++        +   W+ GF RK RTPR         S
Sbjct  61    HERVRL----------QSSSSPELLMKTKATDKTTSVWYEGFRRKARTPR---------S  101

Query  562   GGVAVEESVNPVLPFVPEMGSDDD------YNNNNEIDLFCQVPVlldddlnallndggg  723
               + ++   N   P VPE+G +++        + NE  L C VPV        + ++  G
Sbjct  102   KLLQIQHVNNSNDPLVPELGVEEEGVFSFSSTDENEESLNCCVPVFDPFSDMVIDDNSFG  161

Query  724   ddHMRGLEIPE---------------------FLSSDVELAEFAADVETLLGDDD----V  828
                  G++I                       FL  D++L E   DVE+LL ++     V
Sbjct  162   LVP-DGVDITTSSGDLGEIEKAIMDDDEGLIGFLPFDMDLGEIVMDVESLLEEEQPFLRV  220

Query  829   GE-DKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckee  1005
              E + ++  VK E N G   E  +      ++ E++ +     G D+ +   E       
Sbjct  221   KELNSSSGLVKEETNVG--FEFDSKDLKRVKDEEEEEVKCEHGGSDQETCEDED------  272

Query  1006  VAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFD--------PNHCWPDFMGGDHHHH  1161
               +K+ + L L+YE VISAW + G PW  G +P F+         N C    MGG     
Sbjct  273   --RKTTLFLRLDYEAVISAWDNHGSPWETGIKPEFNLDGCLLGGNNTCPSHVMGGFEELA  330

Query  1162  HPYGSAMMMRRSDEG-----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  1326
                GS    +  D G     REAR+ RYREKRRTRLF+KKIRYEVRKLNAE+RPR+KGRF
Sbjct  331   SAVGSVTRQQGRDRGGSDVEREARMLRYREKRRTRLFAKKIRYEVRKLNAEQRPRIKGRF  390

Query  1327  VKRSSL  1344
             VKR+SL
Sbjct  391   VKRTSL  396



>ref|XP_008801158.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Phoenix dactylifera]
Length=381

 Score =   194 bits (494),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 150/403 (37%), Positives = 203/403 (50%), Gaps = 61/403 (15%)
 Frame = +1

Query  223   SSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVR  402
             S  Q+  A+AI+GK ARACD C+ +RARW+C ADD FLCQSCD SVHSAN +A RHQR R
Sbjct  14    SEKQQSAASAIAGKMARACDGCVRRRARWYCAADDVFLCQSCDSSVHSANPVARRHQRDR  73

Query  403   LGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTK-----------  549
             L  ++S  ++     + +++          W     RK RTPR  ++TK           
Sbjct  74    LKPATSYYSSFMEAKTEELIL--------GW---LKRKARTPRPRQQTKPAQPLAPDLLE  122

Query  550   KQNSGGVAVEESV---NPVL-PFVPEMGSDDDYNNNNEIDLFCQVPVlldddlnallndg  717
                 G  + EE +    PV  P + E+ S    N++N      ++ V    D        
Sbjct  123   SSTDGNCSEEEQLLYCVPVFDPMLAELCSPPSLNDSNSSGEDTKLAVAQLPDNAITYISP  182

Query  718   ggddHMRGLEIPEFLSSDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALN  897
                    G     F+ SD ELAEFA  +E+LLG    G D          N  + +E   
Sbjct  183   VDAT---GSGTVGFVPSDDELAEFATKMESLLGR---GLD----------NSKNSSE---  223

Query  898   WSFGEEQEVEQKVMMTM------LSGFDessssmesgsckeeVAKKSRMLLSLNYEEVIS  1059
                G + E++  + M        LS   +S    E     E+     ++ L L+YE ++ 
Sbjct  224   --HGTKPELDNDMKMATSRERPDLSFSCQSMKKGEEAEEGEKAGSSKKVALRLDYEAIME  281

Query  1060  AWASQGCPWTDGTRPHFDPNHC-WPDFMGGDHHHHHPYGSAMMMRRSDEGREARVSRYRE  1236
             AW+S   PWT+G RP F+ N C WP    GD       G         +GREA+V+RYRE
Sbjct  282   AWSSS--PWTNGERPQFNLNVCRWP----GDMGMWVGEGGEEDKGGGRQGREAKVTRYRE  335

Query  1237  KRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPF  1365
             KRRTR+F+KKIRYEVR+LNAE+RPR+KGRFVKR +   P P F
Sbjct  336   KRRTRMFAKKIRYEVRRLNAEQRPRMKGRFVKR-AFVTPTPAF  377



>ref|XP_010428333.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like [Camelina 
sativa]
Length=403

 Score =   195 bits (495),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 153/427 (36%), Positives = 202/427 (47%), Gaps = 80/427 (19%)
 Frame = +1

Query  217   MMSSDQRKTANAISGKTA-RACDSCL--SKRARWFCVADDAFLCQSCDVSVHSANLLASR  387
             M+   + + A     KTA R CD C+  S RA W+C ADDAFLCQSCD S+HSAN LA R
Sbjct  1     MVVEVESRAAGVTGVKTAARGCDVCMKRSSRASWYCPADDAFLCQSCDASIHSANNLAKR  60

Query  388   HQRVRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGG  567
             H+RVRL + SS        ++ K        +   W+ GF RK RTPR+ +     NS  
Sbjct  61    HERVRLQSPSSPELLMKTKATDK--------TTSVWYEGFRRKARTPRSKQLQDVNNSND  112

Query  568   VAVEESVNPVLPFVPEMGSDD----------DYNNNNEIDLFCQVPVlldddlna-----  702
                        P VPE+G ++             + NE  L C VPV             
Sbjct  113   -----------PLVPELGVEEEEEEEGVFSFSSTDENEESLNCCVPVFDPFSDMVIDDNS  161

Query  703   -------llndgggddHMRGLE---------IPEFLSSDVELAEFAADVETLLGDDD---  825
                    +         +  +E         +  FL  D++L E   DVE+LL ++    
Sbjct  162   FGLVPDGVDITTSTSADLGEIEKAIMDDDEGLIGFLPFDMDLGEIVMDVESLLEEEQPFL  221

Query  826   -VGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgscke  1002
              V E  ++  VK E N G   E  +      ++ E++V+     G D+ +   E      
Sbjct  222   RVKELNSSGLVKEETNVG--FEFDSKDLKRVKDEEEEVVKCEHGGSDQEACEDED-----  274

Query  1003  eVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFD--------PNHCWPDFMGGDHHH  1158
                +K+ + L L+YE VISAW + G PW  G +P F+         N C    MGG    
Sbjct  275   ---RKASLFLRLDYEAVISAWDNHGSPWETGIKPEFNLDGCLLGGNNTCPSHVMGGFEEL  331

Query  1159  HHPYGSAMMMRRSDEG-----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGR  1323
                  S    +  D G     REARV RYREKRRTRLF+KKIRYEVRKLNAE+RPR+KGR
Sbjct  332   ASAVRSVTRQQGRDGGGSDVEREARVLRYREKRRTRLFAKKIRYEVRKLNAEQRPRIKGR  391

Query  1324  FVKRSSL  1344
             FVKR+SL
Sbjct  392   FVKRTSL  398



>ref|XP_010907326.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Elaeis 
guineensis]
Length=367

 Score =   191 bits (485),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 145/404 (36%), Positives = 211/404 (52%), Gaps = 73/404 (18%)
 Frame = +1

Query  232   QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  411
             Q+  A+AI+GK  RACD C+ ++ARW+C ADD FLCQ CD SVHS N +A RHQR+RL  
Sbjct  17    QQSAASAIAGKMTRACDGCVRRQARWYCSADDVFLCQICDSSVHSPNPVARRHQRLRLKP  76

Query  412   sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKK---------QNS-  561
             ++SS +++ + +  + +          W     RK RTPR  ++ K          +NS 
Sbjct  77    ATSSYSSSDVEAKTEELIF-------GW---LKRKARTPRPHQQAKPAQPLVPDLLENSP  126

Query  562   -GGVAVEESVNPVLPFVPEMGSD-------DDYNNNNEIDLFCQVPVlldddlnallndg  717
              G  + EE +   +P    M ++       +D+N+++E       P L+   L       
Sbjct  127   DGNCSEEEQLLYCVPVFDPMPAELCSPPCLNDWNSSDED------PKLVAAQLPDNAITY  180

Query  718   ggddHMRGLEIPEFLSSDVELAEFAADVETLLGDD-DVGEDKATAAVKIEINGGDCTEAL  894
                    G  +  F+ SD ELAEFAA++E+LLG   D  E+ +    K E++ G      
Sbjct  181   TSPVDATGSRLVGFVPSDDELAEFAANMESLLGKGLDNSENPSEHGTKAELDNG------  234

Query  895   NWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQ  1074
                            M M +         +S    E+   + ++ L L+YE +++AW+S 
Sbjct  235   ---------------MEMATS-------RQSMKKGEKAVSRKKVALRLDYEAIMAAWSSS  272

Query  1075  GCPWTDGTRPHFDPNHC-WPDFMGGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTR  1251
               PWT+G RP F+ + C WPD MG                   + RE++V+RYREKRRTR
Sbjct  273   --PWTNGARPQFNLDVCSWPD-MG-----MWAGEGGEDKGGGRQERESKVTRYREKRRTR  324

Query  1252  LFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLN  1383
             LF+KKIRYEVR+LNAEKRPR+KGRFVKR+S+  P P F   +L+
Sbjct  325   LFAKKIRYEVRRLNAEKRPRMKGRFVKRASM-APTPAFAGPVLD  367



>ref|XP_009381448.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Musa acuminata 
subsp. malaccensis]
Length=422

 Score =   192 bits (488),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 164/423 (39%), Positives = 217/423 (51%), Gaps = 80/423 (19%)
 Frame = +1

Query  244   ANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtssss  423
             ++A++GKTARACD C  +RARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL      
Sbjct  15    SSAVAGKTARACDGCARRRARWYCPADDAFLCQNCDFSVHSANPLARRHRRVRL------  68

Query  424   taaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLP  603
                       +  D D ++S P+W RGF RK RTPR A + +K  SG   +  +    +P
Sbjct  69    ----------RAADVDSEESSPSWLRGFKRKARTPR-AHQHEKTTSGARRLRPTT---VP  114

Query  604   FVPEMGSDDDYNNNNEIDL-----------FCQVPVlldddlnallndgggddHMRGL--  744
              + E   D+      ++             FC  P+L D +  +        D   G   
Sbjct  115   ELIETSVDETEEEEEQLLYCVPVVDPALAEFCSPPMLDDSNTCSGDETKPTMDSTDGTPA  174

Query  745   ---------EIPEFLSSDVELAEFAADVETLLG------DDDVGEDKATAAVKIEINGGD  879
                       +  FL S  +LAEFAAD+E+LLG      D     +K      +E N   
Sbjct  175   STSTVDTANRLAPFLPSVTDLAEFAADMESLLGGGLDSRDGSFSMEKLGLVNSMEDNVDY  234

Query  880   CTEALNWSFGEE-QEVEQ--------KVMMTMLSGFDessssmes-----------gsck  999
             C ++      E+  + EQ        K   T+    D   SS               S +
Sbjct  235   CLDSAGRLKTEQPDDTEQCPVELDIDKSRETLELDLDWPGSSTAKEEELEEENMEVASEQ  294

Query  1000  eeVAKKSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMGGDHHHHHP---  1167
             ++V KK++  L L+YE VISAW+S G  PWTDG RP  + ++ WPD+MG           
Sbjct  295   QQVTKKAK--LRLDYEAVISAWSSYGSSPWTDGERPQINLDYYWPDYMGVRVEVGGGGRG  352

Query  1168  ------YGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFV  1329
                   +GS   +   D GR+ARV+RYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFV
Sbjct  353   ETPGTGHGSDTGVGFVDVGRQARVTRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFV  412

Query  1330  KRS  1338
             KR+
Sbjct  413   KRA  415



>ref|XP_006302335.1| hypothetical protein CARUB_v10020393mg [Capsella rubella]
 gb|EOA35233.1| hypothetical protein CARUB_v10020393mg [Capsella rubella]
Length=407

 Score =   192 bits (487),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 150/422 (36%), Positives = 209/422 (50%), Gaps = 63/422 (15%)
 Frame = +1

Query  217   MMSSDQRKTANAISGKTA-RACDSCLSK-RARWFCVADDAFLCQSCDVSVHSANLLASRH  390
             M+   + +  +   GKTA R CD C+ + RA W+C ADDAFLCQSCD S+HSAN LA RH
Sbjct  1     MVVDVESRAPSVTGGKTAARGCDLCMKRSRASWYCPADDAFLCQSCDASIHSANSLAKRH  60

Query  391   QRVRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGV  570
             +RVRL +SSS        ++ K        +   W+ GF RK RTPRN            
Sbjct  61    ERVRLQSSSSPELPMKTKTAEK--------TTSVWYEGFRRKARTPRNKL---------F  103

Query  571   AVEE-SVNPVLPFVPEMGSDDDYN--------NNNEIDLFCQVPV---------------  678
              +E+ + N   P VP++G +++ +        + N+  L C VPV               
Sbjct  104   QIEDVNKNSNDPLVPDLGVEEEEDGVFSFSSTDENDASLSCCVPVFDPFSDMVIDDDSFG  163

Query  679   ----lldddlnallndgggddHMRGLEIPEFLSSDVELAEFAADVETLLGDDD----VGE  834
                  +    ++          M    +  FL  D++L E   DVE+LL ++     V E
Sbjct  164   LVPDGVHITNSSGEFGEIEKAIMDDEGLVGFLPFDMDLEEIVMDVESLLEEEQPSLGVKE  223

Query  835   DKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeeVAK  1014
               +   VK E N G   ++ +    +++E  Q+     +      S+        E+  +
Sbjct  224   LNSIGVVKEETNVGFEFDSKDLKRVKDEEEAQEEEEEEVKCEHGESTEGSDREACEDEDR  283

Query  1015  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHC------WPD-FMGGDHHHHHPYG  1173
             K+ + L L+YE VISAW + G PW    +P F+ + C      +P   MGG        G
Sbjct  284   KTSLFLRLDYEAVISAWDNHGSPWKTEIKPEFNLDDCLLEGNTYPSHVMGGFEEWTSAVG  343

Query  1174  SAMMMRRSDEG-----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  1338
             S    +  D G     REARV RYREKRRTRLF+KKIRYEVRKLNAE+RPR+KGRFVKR+
Sbjct  344   SVTRRQGRDGGGSDVEREARVLRYREKRRTRLFAKKIRYEVRKLNAEQRPRIKGRFVKRT  403

Query  1339  SL  1344
             SL
Sbjct  404   SL  405



>ref|XP_010471465.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Camelina sativa]
Length=402

 Score =   192 bits (487),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 156/424 (37%), Positives = 212/424 (50%), Gaps = 75/424 (18%)
 Frame = +1

Query  217   MMSSDQRKTANAISGKTA-RACDSCL--SKRARWFCVADDAFLCQSCDVSVHSANLLASR  387
             M+   + + A    GKTA R CD C+  S RA WFC ADDAFLCQSCD S+HSAN LA R
Sbjct  1     MVVEVESRAAGVTGGKTAARGCDVCMKRSSRASWFCPADDAFLCQSCDASIHSANSLAKR  60

Query  388   HQRVRLGtsssstaaasllssPKIVdddddd--SPPAWHRGFTRKPRTPRNAKRTKKQNS  561
             H+RVRL             SSP+++        +   W+ GF RK RTPR +K  + Q+ 
Sbjct  61    HERVRL----------QSPSSPELLMKTKATDKTTSVWYEGFRRKARTPR-SKLLQIQD-  108

Query  562   GGVAVEESVNPVLPFVPEMGSDDDYN----NNNEIDLFCQVPVlldddlnallndgggdd  729
                 V  S +P++P +     +  ++    + NE  L C VPV        + ++  G  
Sbjct  109   ----VNNSNDPLVPELGVEEEEGVFSFSSTDENEESLNCCVPVFDPFSDMVIDDNSFGLV  164

Query  730   HMRGLEIPE---------------------FLSSDVELAEFAADVETLLGDDD----VGE  834
                G++I                       FL  D++L E   DVE+LL ++     V E
Sbjct  165   P-DGVDITTSSGDLGEIEKAIMDDDEGLIGFLPFDMDLGEIFMDVESLLEEEHPFLRVKE  223

Query  835   -DKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeeVA  1011
              + ++A VK E N G   E  +      ++ E++ +     G D+ +   E         
Sbjct  224   LNSSSALVKEETNVG--FEFDSKDLKRVKDEEEEEVKCEHGGSDQETCEDED--------  273

Query  1012  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFD--------PNHCWPDFMGGDHHHHHP  1167
             +K+ + L L+YE VISAW + G PW  G +P F+         N C    MGG       
Sbjct  274   RKASLFLRLDYEAVISAWDNHGSPWETGIKPEFNLDCCLLGGNNTCPSHVMGGFDELESA  333

Query  1168  YGSAMMMRRSDEG-----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVK  1332
              GS    +  D G     REARV RYR+KRRTRLF+KKIRYEVRKLNAE+RPR+KGRFVK
Sbjct  334   VGSVTRQQGRDGGGSDVEREARVLRYRDKRRTRLFAKKIRYEVRKLNAEQRPRIKGRFVK  393

Query  1333  RSSL  1344
             R+SL
Sbjct  394   RTSL  397



>ref|XP_002466587.1| hypothetical protein SORBIDRAFT_01g010420 [Sorghum bicolor]
 gb|EER93585.1| hypothetical protein SORBIDRAFT_01g010420 [Sorghum bicolor]
Length=420

 Score =   190 bits (482),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 147/418 (35%), Positives = 187/418 (45%), Gaps = 116/418 (28%)
 Frame = +1

Query  271   RACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasllss  450
             R+CD C+ +RARW C ADDAFLCQ+CDVSVHSAN LA RH RVRL               
Sbjct  19    RSCDGCMRRRARWHCPADDAFLCQTCDVSVHSANPLARRHHRVRL---------------  63

Query  451   PKIVddddddSP--PAWHRGFTRKPRTPRNAKRTKKQNSG--------------GVAVEE  582
             P          P  P W  G  R+PRTPR+     K  +                +  EE
Sbjct  64    PSASCSSPPCDPDAPTWLHGLKRRPRTPRSKPGGGKHEATTPNSMAAAASAAVPDLEAEE  123

Query  583   SVNPVLPFVPEMGSDDDYN--NNNEIDLFCQVPVlldddlnallndgggddHMRGLEI--  750
             S + ++      G +DD+    +++ DL  +VPV                +     E   
Sbjct  124   SGSGIV------GDNDDHGFLVDDDEDLLYRVPVFDPMLAEFYNPVADEGEQKPLAEFYN  177

Query  751   ---------------------PEFLSS--------------DVELAEFAADVETLL----  813
                                  PEF S               D+ELA FAAD+E+LL    
Sbjct  178   LVADEGEQKPACLMPPLVETSPEFASGGLAEADGLSGFDVPDMELASFAADMESLLMGVH  237

Query  814   -GDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesg  990
              G DD+G        K ++N     EA+     E ++ ++                    
Sbjct  238   DGFDDLG---FLDEEKPQVNADAYLEAMAAPVPEREDKKR--------------------  274

Query  991   sckeeVAKKSRMLLSLNYEEVISAWASQ-GCPWTDGTRPHFDPNHCWPDFMGGDHHHHHP  1167
                    K+  M+L LNY+ VI++W    G PW  G RPH DP   W DF  G       
Sbjct  275   -------KRPEMILKLNYDGVIASWVRDGGSPWFHGERPHLDPYELWSDFPAGSRGL---  324

Query  1168  YGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  1341
              G A+      E REARVSRYREKRRTRLF+KKIRYEVRK+NAEKRPR+KGRFVKR++
Sbjct  325   LGGAVTAVTGGE-REARVSRYREKRRTRLFAKKIRYEVRKVNAEKRPRMKGRFVKRTT  381



>dbj|BAK01505.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=432

 Score =   188 bits (478),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 153/441 (35%), Positives = 207/441 (47%), Gaps = 91/441 (21%)
 Frame = +1

Query  217   MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  396
             M  S +     A+  K ARACD CL +RARW+C ADDAFLCQ CD SVHSAN LA RH+R
Sbjct  1     MSCSGKAAADGAMGSKAARACDGCLRRRARWYCAADDAFLCQGCDTSVHSANPLARRHER  60

Query  397   VRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKR----------T  546
             VRL  +S             +         PAW   F RK RTPR+  +           
Sbjct  61    VRLRPTSPLAPRERRRGDEVV---------PAW---FKRKARTPRSQAKGVGRLLSRRLV  108

Query  547   KKQNSGGVAVEES-----------------VNPVL-----PFVPEMGSDDDYNNNNEIDL  660
               ++SGG + EE                   +P L     P   E  +    +  NE  +
Sbjct  109   VPESSGGESPEEHKCDVETDEEELLYRVPIFDPALAELCSPLSLEEATAAVASCCNEDGV  168

Query  661   FCQVPVlldddlnallndgggddHMRGLEIPEFLSSDVELAEFAADVETLLGD---DDVG  831
               + P      + +        D +  L       +D EL EFAAD+E LLG    DD  
Sbjct  169   VLENPTKPTTAMPSPAAVEFFPDSLVNLG-----PTDAELMEFAADMEALLGRPGMDDGN  223

Query  832   EDK-----ATAAVK-IEINGGDCTEALN--WSFGEEQEVEQKVMMTMLS---GFDessss  978
             E++     A   ++ +++ GG     ++   + G EQ+ E    M  +     +D    +
Sbjct  224   EEEPFCMEALGLIEPMDVEGGRVKLEIDPMRACGLEQKPEVSGDMFDIDFDYHYDSPQGT  283

Query  979   mesgsckeeVAKKSR-----MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG  1143
              +  +     +  ++     + L+LNY+ ++  W S   PW DG RP+   + CWP    
Sbjct  284   PDENAGSSGASADAQFTPRSLALNLNYDAIMENWGSS--PWADGERPNVKLDDCWP----  337

Query  1144  GDHHHHHPYGSAMMMR---------------RSDEGREARVSRYREKRRTRLFSKKIRYE  1278
               H ++  +  A MM                R D GREARVSRYREKRRTRLFSKKIRYE
Sbjct  338   --HDYYSLHEGAWMMGGVVGHGGEGLGTPRPRMDGGREARVSRYREKRRTRLFSKKIRYE  395

Query  1279  VRKLNAEKRPRLKGRFVKRSS  1341
             VRKLNAEKRPR+KGRFVKR++
Sbjct  396   VRKLNAEKRPRMKGRFVKRAN  416



>ref|XP_002887511.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63770.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=391

 Score =   185 bits (469),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 148/426 (35%), Positives = 200/426 (47%), Gaps = 85/426 (20%)
 Frame = +1

Query  217   MMSSDQRKTANAISGK-TARACDSCLSK-RARWFCVADDAFLCQSCDVSVHSANLLASRH  390
             M+   +R+ A+   GK  AR CD+C+ + RA W+C ADDAFLCQSCD S+HSAN LA RH
Sbjct  1     MVVDVERRAASVPGGKMVARGCDACMKRSRASWYCPADDAFLCQSCDSSIHSANHLAKRH  60

Query  391   QRVRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGV  570
             +RVRL +SS +                   +   W+ GF RK RTPRN          G+
Sbjct  61    ERVRLQSSSWTETTEK--------------TTSVWYEGFRRKARTPRNK---------GL  97

Query  571   AVEE--SVNPVLPFVPEMGSDDD--------YNNNNE-------------------IDLF  663
             A E+   +    P VP++G +++           N E                   I+ F
Sbjct  98    ASEKLLQMEANDPLVPDLGGEEEEVFFSFSSVEENEESLNCCVPVFDPFSDMVIDDINGF  157

Query  664   CQVPVlldddlnallndgggddHMRGLE-IPEFLSSDVELAEFAADVETLLGD-------  819
             C VP  + ++       G  +  +   E    FL  D++L +   DVE LL +       
Sbjct  158   CLVPDEVINNTTNGEELGELEREVIDDEGFIGFLPLDMDLEDLTMDVERLLKEGQLCLGL  217

Query  820   ---DDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesg  990
                +D+G  K    V  EI+  D                 K      +  +   S    G
Sbjct  218   KEPNDIGVIKEENNVGFEIDCKDLKRV-------------KDEEEEEAKCENGRSKDSDG  264

Query  991   sckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPH--FDPNHCWPDFMGGDHHHHH  1164
                ++  +K+ + LSL+YE VI+AW + G PW  G +       N C    +GG      
Sbjct  265   EASKDEDRKTSLFLSLDYEAVITAWDNHGSPWKTGIKSECLLGGNTCPSHAVGGFDELVS  324

Query  1165  PYGSAMMMRRSDEG-----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFV  1329
               GS    +  D G     REARV RY+EKRRTRLFSKKIRYEVRKLNAE+RPR+KGRFV
Sbjct  325   TVGSVTRQQVKDGGGSDGEREARVLRYKEKRRTRLFSKKIRYEVRKLNAEQRPRIKGRFV  384

Query  1330  KRSSLF  1347
             KR+SL 
Sbjct  385   KRTSLL  390



>ref|XP_010519197.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 isoform X2 [Tarenaya 
hassleriana]
Length=448

 Score =   185 bits (469),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 172/444 (39%), Positives = 222/444 (50%), Gaps = 74/444 (17%)
 Frame = +1

Query  232   QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  411
             + + AN + GKTARACD+C+ +RA WFC ADDAFLCQ+CD S+HSAN LA RH+RVRL T
Sbjct  4     ETQAANVMGGKTARACDACMRRRAHWFCAADDAFLCQTCDSSIHSANQLAIRHERVRLRT  63

Query  412   sssstaaasllssPKIVddddddSPPA--WHRGFTRKPRTPRNAKRT---KKQNSGGVA-  573
              S S +++   S    ++     +     W+ GFTRK RTPR   R    KK+    +A 
Sbjct  64    CSMSPSSSFSSSVHSQIEKSTGVNAGTLVWYEGFTRKTRTPRRLLRRSLQKKKVVNAIAN  123

Query  574   --------VEESVNPVLPFVPEMGSDDDY-----NNNNEIDLFCQVPVlldddlnallnd  714
                     +  + N   P VPE+GS+++         NE +L CQVPV    D+    ND
Sbjct  124   DDLDFDLDLNSTSNSNEPVVPELGSEEELFLFPSMVENEENLNCQVPVFDFSDMEMEAND  183

Query  715   gggddHMRGLE-------------------IPEFLSSDVELAEFAADVETLLGDDDVGED  837
                D++  G                     +  FL  D++LAE   DVE+LLG++     
Sbjct  184   INKDENSFGFAPDSDKIGGGCHEEEQMENGLNGFLPFDMDLAELTMDVESLLGEESCMGI  243

Query  838   KATAA----------------VKIEINGGDCTEALNWSF--------GEEQEVEQKVMMT  945
             K   A                VK E       E   W+         G+ +EVE      
Sbjct  244   KEPGALEFKEDEEKIGLTLRTVKDEEEEEGLGETCRWNLDNGSSVSGGKREEVEDVNGKK  303

Query  946   MLSGFDessssmesgsc-keeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH  1122
              L   D      E      +E AKK  + L L+YE V+ AW S+  PWT G  P F P++
Sbjct  304   GLRSEDNYEEEGEEEERCADEKAKKQSLFLRLDYEAVMIAWDSECSPWTTGRCPDFRPSN  363

Query  1123  CWPDFMG----GDHHHHHPYGSAMMMRR-----SDEGREARVSRYREKRRTRLFSKKIRY  1275
              W D +G    G        GS  M RR     SD  REARV RYREKRR RLF+KKIRY
Sbjct  364   FWLDCLGFVIDGSEEATPAVGS--MPRRQGRGGSDGEREARVLRYREKRRRRLFAKKIRY  421

Query  1276  EVRKLNAEKRPRLKGRFVKRSSLF  1347
             EVRKLNAEKRPR+KGRFV+R+S +
Sbjct  422   EVRKLNAEKRPRIKGRFVRRTSSY  445



>ref|XP_010519196.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 isoform X1 [Tarenaya 
hassleriana]
Length=450

 Score =   182 bits (463),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 169/444 (38%), Positives = 221/444 (50%), Gaps = 72/444 (16%)
 Frame = +1

Query  232   QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  411
             + + AN + GKTARACD+C+ +RA WFC ADDAFLCQ+CD S+HSAN LA RH+RVRL T
Sbjct  4     ETQAANVMGGKTARACDACMRRRAHWFCAADDAFLCQTCDSSIHSANQLAIRHERVRLRT  63

Query  412   sssstaaasllssPKIVddddddSPP--AWHRGFTRKPRTPRNAKRT---KKQNSGGVA-  573
              S S +++   S    ++     +     W+ GFTRK RTPR   R    KK+    +A 
Sbjct  64    CSMSPSSSFSSSVHSQIEKSTGVNAGTLVWYEGFTRKTRTPRRLLRRSLQKKKVVNAIAN  123

Query  574   --------VEESVNPVLPFVPEMGSDDDY-----NNNNEIDLFCQVPVlldddlnallnd  714
                     +  + N   P VPE+GS+++         NE +L CQVPV    D+    ND
Sbjct  124   DDLDFDLDLNSTSNSNEPVVPELGSEEELFLFPSMVENEENLNCQVPVFDFSDMEMEAND  183

Query  715   gggddHMRGLE-------------------IPEFLSSDVELAEFAADVETLLGDDDVGED  837
                D++  G                     +  FL  D++LAE   DVE+LLG++     
Sbjct  184   INKDENSFGFAPDSDKIGGGCHEEEQMENGLNGFLPFDMDLAELTMDVESLLGEESCMGI  243

Query  838   KATAA----------------VKIEINGGDCTEALNWSF--------GEEQEVEQKVMMT  945
             K   A                VK E       E   W+         G+ +EVE      
Sbjct  244   KEPGALEFKEDEEKIGLTLRTVKDEEEEEGLGETCRWNLDNGSSVSGGKREEVEDVNGKK  303

Query  946   MLSGFDessssmesgsc-keeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH  1122
              L   D      E      +E AKK  + L L+YE V+ AW S+  PWT G  P F P++
Sbjct  304   GLRSEDNYEEEGEEEERCADEKAKKQSLFLRLDYEAVMIAWDSECSPWTTGRCPDFRPSN  363

Query  1123  CWPD-----FMGGDHHHHHPYGSAMMMRR----SDEGREARVSRYREKRRTRLFSKKIRY  1275
              W D     F+        P   +M  R+    SD  REARV RYREKRR RLF+KKIRY
Sbjct  364   FWLDCLLQGFVIDGSEEATPAVGSMPRRQGRGGSDGEREARVLRYREKRRRRLFAKKIRY  423

Query  1276  EVRKLNAEKRPRLKGRFVKRSSLF  1347
             EVRKLNAEKRPR+KGRFV+R+S +
Sbjct  424   EVRKLNAEKRPRIKGRFVRRTSSY  447



>ref|XP_008393304.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Malus domestica]
Length=349

 Score =   178 bits (451),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 132/358 (37%), Positives = 180/358 (50%), Gaps = 83/358 (23%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +K ANA+ G TARACDSCL KRARWFC ADDAFLCQ CD SVHSAN LASRH+RVRL  S
Sbjct  5     KKAANAMGGNTARACDSCLVKRARWFCXADDAFLCQRCDASVHSANQLASRHERVRLQGS  64

Query  415   ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEE----  582
             S            + +    D + PAWH GF RK R PR+       N  G AV+E    
Sbjct  65    SFKAN--------EPMQLTADQATPAWHNGFKRKARXPRH------NNKPGFAVKEEQEK  110

Query  583   -SVNPVLPFVPEMGSD-----DDYNNNNEIDLFCQVPVl--------------ldddlna  702
               ++P LPFVPE+G +     ++  N +   L  +VP+                 ++   
Sbjct  111   LGLHPPLPFVPEIGCEEANLMEBEENEDLEQLLYRVPIYDPFAAKLCNISSTDQVENNTD  170

Query  703   llndgggddHMRGL------------EIPEFLSSDVELAEFAADVETLLG---DDDVGED  837
              +N    +  +R +            ++  FL +D+ELAEFAADVE LLG   D+D  + 
Sbjct  171   XINLDDEEIEIRNMGNNHEGVQDDLDKLGGFLPTDMELAEFAADVENLLGGGLDEDCSDI  230

Query  838   KATAAV--------------KIEINGGDCTEALNWSFGEEQ-----------EVEQKVMM  942
             K    +               +E N       L+WS   +Q           + E++  +
Sbjct  231   KGVLGLLDEGKEVKVEEEVEGMEFN----PSILDWSLDYDQSSAVPVQMGSEDKEEEEKL  286

Query  943   TMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDP  1116
              +L+G  +SS  M     K+ V K+ ++ L L+YE  I+AWASQG PWT+GTRP  +P
Sbjct  287   VLLTGA-QSSDEMAFMENKQMVMKRKKICLRLDYETXITAWASQGSPWTNGTRPELNP  343



>emb|CDY36106.1| BnaA08g19420D [Brassica napus]
Length=384

 Score =   177 bits (449),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 135/373 (36%), Positives = 184/373 (49%), Gaps = 58/373 (16%)
 Frame = +1

Query  235   RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
             +  AN +  KTAR CD+CL K+A WFC AD+AFLCQSCD SVHSANLLA RH+RVRL   
Sbjct  2     KSLANCVRAKTARTCDNCLKKQAHWFCAADEAFLCQSCDTSVHSANLLARRHERVRL---  58

Query  415   ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNP  594
                       +SP+          P W+ GFTRKPRTPR +   K+ NS         + 
Sbjct  59    -------KDSTSPQ-------QEAPTWYHGFTRKPRTPRGS--GKRNNS---------ST  93

Query  595   VLPFVPEMGSDDDYNNNN-EIDLFCQVPVlldddlnalln--dgggddHMRGLE------  747
                 VPE+ ++   +++  E  L CQVPVL    +   +          + G E      
Sbjct  94    FQDMVPEISAEGQTDSSEVEGPLICQVPVLGPTVVEPKIKFPTMRSGVMIDGHEDEDKDE  153

Query  748   --IPEFLSSDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQE  921
               +     +++E+ +FAADVETLLG    G DK +    +E  G   TE       E++E
Sbjct  154   SCLNGIFPTNMEVEDFAADVETLLGH---GLDKESYT--LEELGLSNTEMFKKDEIEDKE  208

Query  922   VEQKVMMTMLSGFDessssmesgsckeeVA----KKSRMLLSLNYEEVISAWASQGCPWT  1089
               + + M +  G D+  +   +   +   A    KK+ ++LSL+Y++VIS W  QG PWT
Sbjct  209   T-KAMNMDIEIGDDDQGNRDGTLPGECVQAKEEKKKNVLMLSLDYDQVISTWGGQGLPWT  267

Query  1090  DGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR---------RSDEGREARVSRYREKR  1242
              G  P  D N      +       +   S    R           D GREA VSRYREK+
Sbjct  268   SGGPPELDINISGSPVVSKVSKRDNGRKSRKKRRVGGCLPSSVVGDGGREASVSRYREKK  327

Query  1243  RTRLFSKKIRYEV  1281
             +TR F+K IRYE 
Sbjct  328   KTRSFTKTIRYET  340



>dbj|BAK04456.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=410

 Score =   177 bits (449),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 149/406 (37%), Positives = 194/406 (48%), Gaps = 89/406 (22%)
 Frame = +1

Query  277   CDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasllssPK  456
             CD C+ +RARW C ADDA+LCQ+CD SVHSAN LA RH RVRL +SSS  A         
Sbjct  16    CDGCMRRRARWHCAADDAYLCQACDASVHSANPLARRHHRVRLPSSSSPAA--------T  67

Query  457   IVddddddSPPAWHRGFTRKPRTPRNAKRT-------------------KKQNSG-----  564
                   D   PAW  G  R+PRTPR+   T                   + ++SG     
Sbjct  68    SSLQHADPDEPAWVHGLKRRPRTPRSKPGTVSKHCAPAKAAAASAVPDLEAEDSGSGIVG  127

Query  565   ------GVAVEES--------VNPVLPFVPEMGSDDDYNNNNEID--LFCQVPVlldddl  696
                   G+ VE+          +P+L  +      DD+    E    + C   +      
Sbjct  128   DNDDGHGIEVEDEDLLYRVPVFDPMLAELYNPMPVDDFREPLEQKPAVCCFSSLACQPSS  187

Query  697   nallndgggddHMRGLEIPEFLSSDVELAEFAADVETLL------GDDDV---GEDKATA  849
             +      G  D   G ++      D+ELA FAAD+E+LL      G DD+    E+K   
Sbjct  188   DYASGVAGAADGFTGFDV----VPDMELASFAADMESLLMGGVEEGYDDLRFLDEEKPQL  243

Query  850   AVKIEINGGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeeVAKKSRML  1029
              +  ++   D  ++ + +   EQE+E +      SG                      M+
Sbjct  244   NLDFDMADFD-DQSQSAAPAPEQELEDRKRKRSDSG----------------------MI  280

Query  1030  LSLNYEEVISAWASQG-CPWTDGTRPHFDP-NHCWPDFMGGDHHHHHPYGSAMMMRRSDE  1203
             L L+YE VI +WA  G  PW  G RPH DP +  W D   G        G+A+      E
Sbjct  281   LKLDYERVIDSWAHDGGSPWFYGERPHIDPTDDSWLDMPAGSRGFG--LGAAVTAVTGGE  338

Query  1204  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  1341
              REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  339   -REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTA  383



>ref|NP_001140584.1| uncharacterized protein LOC100272654 [Zea mays]
 gb|ACN28503.1| unknown [Zea mays]
 gb|AFW76935.1| hypothetical protein ZEAMMB73_075677 [Zea mays]
 gb|AIB05431.1| C2C2-CO-like transcription factor, partial [Zea mays]
Length=452

 Score =   176 bits (446),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 151/432 (35%), Positives = 198/432 (46%), Gaps = 91/432 (21%)
 Frame = +1

Query  277   CDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasllssPK  456
             CD CL +RARW+C ADDAFLCQ CD SVHSAN LA RH+R+RL  +S         ++  
Sbjct  24    CDGCLRRRARWYCAADDAFLCQGCDTSVHSANPLARRHERLRLCPASPLQTPPDRSAAAA  83

Query  457   IVdddd-----ddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVPEMG  621
                 +      + + PAW   F RK RTPR       ++ G VA+   +  V+P      
Sbjct  84    ATATNKRERHDEVAVPAW---FGRKARTPRGGH---AKSVGQVALSRRL--VVPHAAGGD  135

Query  622   SD--DDYNNNNEIDLFCQVPVlldddlnallndgggddHMRGLEIP--------------  753
             SD  D+ N   E  L  +VP+L              D     L+                
Sbjct  136   SDSPDERNGGEEEQLLYRVPILDPALAEFCSPPPLEDAAGLALDASVCNEDGAIEDPAKP  195

Query  754   ----------------EFLSSDVELAEFAADVETLLG---DD------------------  822
                              F  +D EL EFAAD+E LLG   DD                  
Sbjct  196   DPAAPLAQFCPVSGHFNFGPTDAELREFAADMEALLGHGLDDGNEEDSSFYMETLGLLDP  255

Query  823   -DVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsck  999
              +VG+D     V+ + +   C  +   + G E ++E    M  +  FD +S    +   +
Sbjct  256   MEVGDDATQVKVETDGSSACCEASGTLACGLELDLEASDEMLDID-FDYASPQDTATDER  314

Query  1000  eeVAK--------KSRMLLSLNYEEVISAWASQGCPWTDG-TRPHFDPNHCWP-DFMG--  1143
                +         ++ + L+LNYE +I +W S   PWT G  RPH   +  WP D+    
Sbjct  315   AASSDTGADAQFLQTSLSLTLNYEAIIQSWGSS--PWTGGGERPHVKLDTRWPHDYTNMW  372

Query  1144  ------GDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKR  1305
                   G      P    + M   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKR
Sbjct  373   VVGGVVGHGGEDLPGTPRLGM---DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKR  429

Query  1306  PRLKGRFVKRSS  1341
             PR+KGRFVKR++
Sbjct  430   PRMKGRFVKRAT  441



>dbj|BAJ87752.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=498

 Score =   171 bits (433),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 147/417 (35%), Positives = 194/417 (47%), Gaps = 77/417 (18%)
 Frame = +1

Query  277   CDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasllssPK  456
             CD C+ +RARW+C ADDAFLCQ C+ SVHSAN LA RH+R+RL          +     +
Sbjct  88    CDGCMRRRARWYCAADDAFLCQGCETSVHSANPLARRHERLRL--------RVTSPLPAE  139

Query  457   IVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVP--EMGSDD  630
              V      SP    +     P  P+   RT++     V    S   V+P V   E  + D
Sbjct  140   GVATAVKGSPATTSKCLDVAPAWPKRKARTRRPTVKSVGQLLSRRLVVPEVGAGESSTSD  199

Query  631   DYNNNNEIDLFCQVPVlldddln---------allndgggddHMRGL-------------  744
             +     E  L  +VPV                A+       + + G              
Sbjct  200   ERRAPEEEQLLYRVPVFDPALGEFCSPPPIDDAVAATSRHGEDVEGAVEDAKELMDTPSP  259

Query  745   --EIPE----FLSSDVELAEFAADVETLLGD--DDVGEDKAT----------------AA  852
               E+P+    F  +D +L EFAAD+E LLG   DD  E + +                  
Sbjct  260   VQELPDCFASFGPTDADLREFAADMEALLGQGLDDGNELEDSFYMEALGLISPPAEHGGR  319

Query  853   VKIEINGGDCTEALNWSFGEEQEVEQKVMM---TMLSGFDessssmesgsckeeVAK---  1014
             VK+E +GG  + + N       +++++      T++   D       S S  + V     
Sbjct  320   VKVEADGGLVSRS-NGVLAAGHDLKREFSGSPPTLVDDDDSFEHKTSSASNGDAVDGAQF  378

Query  1015  -KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYG------  1173
              K  + L LNYE VI++WAS   PWTDG RP   P     D +  DH      G      
Sbjct  379   LKRSLDLRLNYEAVIASWASS--PWTDGRRP---PGQQLDDLLLNDHAGMWTAGGGGRQG  433

Query  1174  -SAMMMR-RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  1338
              +A   R R+D  REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  434   EAAWPARPRTDGWREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRT  490



>gb|KHN32039.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=436

 Score =   169 bits (429),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 130/359 (36%), Positives = 188/359 (52%), Gaps = 67/359 (19%)
 Frame = +1

Query  226   SDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  405
             +++ K A+A+  +TARAC+SCL  RARW+C ADDAFLC  CD  VHSAN LASRH+RV+L
Sbjct  2     TNEMKEASALGARTARACESCLKVRARWYCAADDAFLCHGCDNMVHSANQLASRHERVKL  61

Query  406   GtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPR-NAKRTKKQNS-------  561
                 ++++  +   +PK+          AWH GFTRK RTPR N K +  Q         
Sbjct  62    ---QTASSKVNYSVTPKV----------AWHSGFTRKARTPRSNNKHSSLQQQQQKPLHE  108

Query  562   -----GGVAVEESVNPVLPFVPEMGSDDD-YNNNNEIDLFCQVPVlldddlnallndggg  723
                    V    ++  V P VPE+GS++   N+  E  L C+VPV  D +L ++ N+   
Sbjct  109   EQGEEEEVFFNNTIISVQPLVPELGSEEPLLNDETEEQLLCRVPV-FDAELCSIYNEVKD  167

Query  724   ddHMRGLEIP--------EFLSSDVELAEFAADVETLLG---DDDVGEDKATAAVKIEIN  870
             + ++ G E+         EFL +D++LAEF+ADVE+LLG   D+D    K +  V ++  
Sbjct  168   EVNVAGGEVAFDLENFSSEFLPTDMDLAEFSADVESLLGNGVDEDSPVKKGSELVLLDCK  227

Query  871   --GGDCTEALNWSFGEEQEVEQKV---------------------MMTMLSGFDessssm  981
               G D  +A     G  ++   KV                     M +    ++ + S  
Sbjct  228   EEGDDEMDACVNGIGANKDAMVKVKDEEELDADDDTACHLDSILDMNSEAFNWNIAESES  287

Query  982   esgsckeeVAK----KSRMLLSLNYEEVISAWASQGCPWTDGTRP-HFDPNHCWPDFMG  1143
              + + ++EV+K    K  + L LNYEEVI+AWASQG PWT GT P  F+ + CW D   
Sbjct  288   PAQAQEDEVSKVGTNKKDIFLRLNYEEVITAWASQGSPWTTGTPPKFFNSDDCWLDLFS  346



>ref|NP_001239992.1| uncharacterized protein LOC100802113 [Glycine max]
 gb|ACU23240.1| unknown [Glycine max]
Length=350

 Score =   165 bits (417),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 119/314 (38%), Positives = 154/314 (49%), Gaps = 87/314 (28%)
 Frame = +1

Query  595   VLPFVPEMGSDDDY-NNNNEIDLFCQVPVlldd--dlnallndgggddHMRGLEI----P  753
             +LP VPE+GS++   N+  E  L C+VPV   +   +   + D         L++     
Sbjct  48    LLPLVPELGSEEPLLNDETEEQLLCRVPVFDAELCSIYNEVKDEVVAAGEEALDLENFSS  107

Query  754   EFLSSDVELAEFAADVETLLG--------DDD----------------------------  825
             EFL SD +LAEF ADV++ LG        DDD                            
Sbjct  108   EFLPSDTDLAEFTADVKSFLGNGADEDSPDDDEHVKESELLILDCKEEEGDEEMDECIDG  167

Query  826   --VGEDKATAAVK------------------IEINGGDCTEALNWSFGEEQEVEQKVMMT  945
               +G   A   VK                  +++NG    EA NW+  E +   Q     
Sbjct  168   VLIGAKDAMVKVKDEEELDADDDTACHLDSILDMNG----EAFNWNIVESESPAQ-----  218

Query  946   MLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRP-HFDPNH  1122
                                +V  K  + L LNYEEVI+AWASQG PWT+GT P  F+ + 
Sbjct  219   ------------AQEDEVSKVGTKKDIFLRLNYEEVITAWASQGSPWTNGTPPKFFNSDD  266

Query  1123  CWPDFMGGDHHHHHP-YGSAMMMR-RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNA  1296
             CW DF+G +  +    YG+   +R  +D GREARVSRYREKRRTRLF+KKIRYEVRKLNA
Sbjct  267   CWLDFLGSNGGNVQCCYGAVGSLRVHADGGREARVSRYREKRRTRLFAKKIRYEVRKLNA  326

Query  1297  EKRPRLKGRFVKRS  1338
             EKRPR+KGRFVKR+
Sbjct  327   EKRPRMKGRFVKRT  340



>ref|XP_006468698.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Citrus 
sinensis]
 gb|KDO76999.1| hypothetical protein CISIN_1g012558mg [Citrus sinensis]
Length=461

 Score =   165 bits (418),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 92/126 (73%), Gaps = 9/126 (7%)
 Frame = +1

Query  1024  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-----GDHHHHHPYGSAMMM  1188
             +LLSL+YE VI+ WASQG PWT G RP+FDP+ CWPD MG     G  +  HPYG    +
Sbjct  332   ILLSLDYEAVINTWASQGSPWTTGDRPNFDPDECWPDCMGTCGTEGHKYLQHPYGDFSGI  391

Query  1189  ----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  1356
                    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S    P
Sbjct  392   GAHPATVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASFAGGP  451

Query  1357  PPFPNY  1374
             P FP +
Sbjct  452   PAFPLF  457


 Score =   138 bits (348),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 95/236 (40%), Positives = 124/236 (53%), Gaps = 59/236 (25%)
 Frame = +1

Query  226  SDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  405
            S  +  ANA+ GKTARACD+C+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL
Sbjct  2    SSNKNVANAVGGKTARACDNCIKKRARWYCAADDAFLCQACDASVHSANPLARRHERVRL  61

Query  406  GtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEES  585
             T+S+ ++ +  LS    V        P+WHRGFTRK RTPR   +  +           
Sbjct  62   KTASNKSSGSESLSDNTHV--------PSWHRGFTRKARTPRKTGKPIR-----------  102

Query  586  VNPVLPFVPEMGSDDDYNNNNEIDLF---CQVPV----------------------lldd  690
             N  LP VPE+G+D+  +  NE D     C+VP                           
Sbjct  103  -NVTLPLVPEVGADELSHEENEEDQLLYNCRVPTYDPFVAELCTSTANSNEAAEHNNATA  161

Query  691  dlnallndgggddHMRGLE--------------IPEFLSSDVELAEFAADVETLLG  816
              +A  ++   DD + G E              +  FL SD++LAEFAADVE++LG
Sbjct  162  KTDAHDDESTADDAVNGSESKPVRACYNGDVDSLHGFLPSDMDLAEFAADVESMLG  217



>ref|XP_006448477.1| hypothetical protein CICLE_v10015173mg [Citrus clementina]
 gb|ESR61717.1| hypothetical protein CICLE_v10015173mg [Citrus clementina]
Length=461

 Score =   165 bits (418),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 92/126 (73%), Gaps = 9/126 (7%)
 Frame = +1

Query  1024  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-----GDHHHHHPYGSAMMM  1188
             +LLSL+YE VI +WASQG PWT+G RP+FDP  CWPD MG     G  +  HPYG    +
Sbjct  332   ILLSLDYESVIKSWASQGSPWTNGDRPNFDPEECWPDCMGTCGTEGHKYLQHPYGDFSGI  391

Query  1189  ----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  1356
                    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S    P
Sbjct  392   GAHPATVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASFAGGP  451

Query  1357  PPFPNY  1374
             P FP +
Sbjct  452   PAFPLF  457


 Score =   132 bits (332),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 95/154 (62%), Gaps = 23/154 (15%)
 Frame = +1

Query  226  SDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  405
            S  +  ANA+ GKTARACD+C+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL
Sbjct  2    SSNKNVANAVGGKTARACDNCIKKRARWYCAADDAFLCQACDASVHSANPLARRHERVRL  61

Query  406  GtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEES  585
             T+S+ ++ +  LS    V        P+WHRGFTRK RTPR   +  +           
Sbjct  62   KTASNKSSGSESLSDNTHV--------PSWHRGFTRKARTPRKTGKPIR-----------  102

Query  586  VNPVLPFVPEMGSDDDYNNNNEIDLF---CQVPV  678
             N  LP VPE+G+D+  +  NE D     C+VP 
Sbjct  103  -NVTLPLVPEVGADELSHEENEEDQLLYNCRVPT  135



>ref|XP_002311458.2| zinc finger family protein [Populus trichocarpa]
 gb|ABK95116.1| unknown [Populus trichocarpa]
 gb|EEE88825.2| zinc finger family protein [Populus trichocarpa]
Length=444

 Score =   162 bits (409),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 91/116 (78%), Gaps = 6/116 (5%)
 Frame = +1

Query  1015  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-GDHHHHHPYGSAMMMR  1191
             K ++LLSL+YE V++AWASQG PWT+G RP FDP+ CWPD MG      HHPYG  +   
Sbjct  326   KRKILLSLDYEAVMTAWASQGSPWTNGNRPDFDPDECWPDCMGICGAQLHHPYGDMISGL  385

Query  1192  RS-----DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
              +     D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++L
Sbjct  386   GAHPAMVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTTL  441


 Score =   143 bits (361),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 90/229 (39%), Positives = 119/229 (52%), Gaps = 50/229 (22%)
 Frame = +1

Query  235  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
            + +ANA+ GKTARACDSC+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL   
Sbjct  5    KSSANAVGGKTARACDSCIKKRARWYCAADDAFLCQACDSSVHSANPLARRHERVRL---  61

Query  415  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESV-N  591
                      S   +     ++S P+WH GFTRK RTPR+ K   +       + E++ N
Sbjct  62   -------KTASLKSLDLCSKENSVPSWHGGFTRKARTPRHGKPVSQSK-----IAETIRN  109

Query  592  PVLPFVPEMGSDD-DYNNNNEIDLFCQVPV------------------lldddlnallnd  714
              +P VPE+GSD+  + +N E  L  +VP+                              
Sbjct  110  IPIPLVPEVGSDEISHEDNEEEHLLYRVPIFDPFVADLCASTTISNEAGAIVPAGGNDGT  169

Query  715  gggddHMRGLE---------------IPEFLSSDVELAEFAADVETLLG  816
                    G+E               +P FL SD++LAEFAAD+E+LLG
Sbjct  170  DQRVADSNGVESKILIGAIERRDVESLPGFLPSDMDLAEFAADMESLLG  218



>ref|XP_007210807.1| hypothetical protein PRUPE_ppa017267mg [Prunus persica]
 gb|EMJ12006.1| hypothetical protein PRUPE_ppa017267mg [Prunus persica]
Length=440

 Score =   161 bits (407),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 107/243 (44%), Positives = 133/243 (55%), Gaps = 63/243 (26%)
 Frame = +1

Query  748   IPEFLSSDVELAEFAADVETLLG----DDDVGEDKATAAV----KIEINGG--------D  879
             +P FL SD+ELAEFAADVE L+G    D+D G+ K    +    K+E NGG        D
Sbjct  209   LPGFLPSDMELAEFAADVENLIGGGLDDEDSGDIKGVLGLLDDSKLEGNGGVDVCMKNVD  268

Query  880   CTE-------------------ALNWSFGEEQEV----------EQKVMMTMLSGFDess  972
               E                    L+W+   E  +          E+KV+  M       S
Sbjct  269   INEDRKAVKVEEEAEGMEFNPSMLDWNSDYELRLSSSPLPMGGEEEKVVFLM----GARS  324

Query  973   ssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDH  1152
             S   +    +++  K ++ L L+YE +I+AWA+QG PWT GTRP  +P+  W D MGG  
Sbjct  325   SDEVALMDNKQMMMKRKICLRLDYEAIITAWANQGSPWTTGTRPELNPDDGWLDCMGG--  382

Query  1153  HHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVK  1332
                         R  D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVK
Sbjct  383   ------------RGDDRGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVK  430

Query  1333  RSS  1341
             R+S
Sbjct  431   RTS  433


 Score =   138 bits (348),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 96/136 (71%), Gaps = 15/136 (11%)
 Frame = +1

Query  232  QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  411
            ++K ANA+ G TARACDSCL KRARWFC ADDAFLCQ CD SVHSAN LASRH+RV+L  
Sbjct  4    EKKAANAVGGNTARACDSCLIKRARWFCAADDAFLCQRCDGSVHSANQLASRHERVKLQA  63

Query  412  sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKR---TKKQNSGGVAVEE  582
            +SS +  ++LL++ +        SPPAWH+GFTRK RTPR+  +     K +   V    
Sbjct  64   ASSKSNQSTLLAADQ--------SPPAWHKGFTRKARTPRHNNKPPFMAKDDKEKV----  111

Query  583  SVNPVLPFVPEMGSDD  630
            S+NP LPFVPE+G ++
Sbjct  112  SLNPPLPFVPEIGCEE  127



>gb|KHN05568.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=242

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 107/246 (43%), Positives = 133/246 (54%), Gaps = 46/246 (19%)
 Frame = +1

Query  757   FLSSDVELAEFAADVETLLG----DDDVGEDK-------------ATAAVKIE-------  864
              L SD ELAEFAADVE+LLG    ++ VG ++              +  VK+E       
Sbjct  7     MLPSDAELAEFAADVESLLGRGLENECVGMEELGLVDAKEEECSVGSGKVKMEDQEESPL  66

Query  865   -------INGGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeeVAKKSR  1023
                    + G D  ++   SF  E   E KV    L                ++  K+ +
Sbjct  67    VEMEMDMVVGRD-DQSFELSFDYETCEEVKVCDLGLGN-----ELGAKKENDDDEVKRKK  120

Query  1024  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG-DHHHHHPYGS----AMMM  1188
             + L L+YE +I AWASQ  PWT   +P+ DP+ CW   MG  +  +HHP G      +  
Sbjct  121   VSLQLDYEAIIIAWASQKSPWTTADKPNLDPDECWKQCMGSCETAYHHPCGEMGGFGIHP  180

Query  1189  RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  1368
                D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S    PP FP
Sbjct  181   VIIDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF--APPTFP  238

Query  1369  NYLLNR  1386
               LLN+
Sbjct  239   --LLNK  242



>ref|XP_010103762.1| Zinc finger protein CONSTANS-LIKE 16 [Morus notabilis]
 gb|EXB97040.1| Zinc finger protein CONSTANS-LIKE 16 [Morus notabilis]
Length=464

 Score =   155 bits (393),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 92/129 (71%), Gaps = 10/129 (8%)
 Frame = +1

Query  1024  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGD-----HHHHHPYGSAMMM  1188
             +LL L+YE VI+AWASQG PWT G RP FDP+ CWPD MG       HHH +   S + +
Sbjct  338   ILLRLDYEAVITAWASQGSPWTTGDRPDFDPDACWPDCMGTYYPTQLHHHQYMDLSGVEL  397

Query  1189  R---RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPP  1359
                  +D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFV R+S     P
Sbjct  398   NPAILADGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVNRASF--AGP  455

Query  1360  PFPNYLLNR  1386
              FP  L+ +
Sbjct  456   TFPAMLITK  464


 Score =   137 bits (345),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 87/212 (41%), Positives = 118/212 (56%), Gaps = 29/212 (14%)
 Frame = +1

Query  250  AISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtssssta  429
             + GKTARACD+C+ KRARW+C ADDAFLCQ+CD+SVHSAN LA RH+RVRL        
Sbjct  16   VVGGKTARACDNCVKKRARWYCAADDAFLCQACDLSVHSANSLARRHERVRL------KT  69

Query  430  aasllssPKIVddddddSPPAWHRGFTRKPRTPRNAK----RTKKQNSGGVAVEESVNPV  597
            A+S      +  ++ D + P WHRGFTRK RTPRN K      K Q +            
Sbjct  70   ASSSSLIKPLPTEESDLTAPTWHRGFTRKARTPRNGKNHVTHPKLQKNQSRDHHHHHQQF  129

Query  598  LPFVPEMGSDDDYNNNNEIDLFCQVPV-------------------lldddlnallndgg  720
             P VPE+ SD+  +  NE  L  +VP+                   +    ++  +ND G
Sbjct  130  DPLVPEICSDETSHEENEDQLLYRVPIFDPFVAELCTANSANSNGLIESKAVSPSVNDCG  189

Query  721  gddHMRGLEIPEFLSSDVELAEFAADVETLLG  816
            G   +    + +FL ++++LAEFAADV++LLG
Sbjct  190  GAHEVENTNMQQFLPTEMDLAEFAADVDSLLG  221



>ref|XP_011007910.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Populus euphratica]
Length=445

 Score =   155 bits (391),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 88/117 (75%), Gaps = 6/117 (5%)
 Frame = +1

Query  1012  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-GDHHHHHPYG-----  1173
             KK R LLSL+Y+ V++AWASQG PWT+G RP FD + CWPD MG      H PYG     
Sbjct  326   KKRRTLLSLDYDAVMTAWASQGSPWTNGYRPDFDADECWPDCMGICGAQLHQPYGDVSGL  385

Query  1174  SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
             +A      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++ 
Sbjct  386   AAHPAALVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTTF  442


 Score =   140 bits (352),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 92/231 (40%), Positives = 124/231 (54%), Gaps = 53/231 (23%)
 Frame = +1

Query  232  QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  411
             +  ANA+ G+TARACDSC+ KRARW+C ADDAFLCQ+CD SVHSANLLA RH+RVRL +
Sbjct  4    NKSLANAVGGRTARACDSCIKKRARWYCAADDAFLCQACDSSVHSANLLARRHERVRLKS  63

Query  412  sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESV-  588
            +S  ++               ++S P+WH GFTRK RTPR+ K   +       +E++  
Sbjct  64   ASHKSSG----------AGSQENSMPSWHGGFTRKARTPRHGKPVSQSK-----IEKTKR  108

Query  589  NPVLPFVPEMGSDD-DYNNNNEIDLFCQVPVlldddlnallndgggddHMRGLEIPE---  756
            N  +P VPE+GSD+    +N E  L  +VP+   D   A L       +  G  +P+   
Sbjct  109  NIPIPLVPEVGSDEISLEDNEEEHLLYRVPI--FDPFAAELCTSTTVSNEAGAVVPDGGT  166

Query  757  -------------------------------FLSSDVELAEFAADVETLLG  816
                                           FL SD++LAEFAAD+E+LLG
Sbjct  167  DTDQRAADSSGTESKVLLGGSEGKDVESLHGFLPSDMDLAEFAADMESLLG  217



>ref|XP_002315940.1| Zinc finger protein CONSTANS-LIKE 6 [Populus trichocarpa]
 gb|EEF02111.1| Zinc finger protein CONSTANS-LIKE 6 [Populus trichocarpa]
Length=447

 Score =   154 bits (389),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 88/119 (74%), Gaps = 8/119 (7%)
 Frame = +1

Query  1012  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDF--MG-GDHHHHHPYG---  1173
             KK R LLSL+YE V++AWASQG PWT+G RP FD + CWPD   MG      HHPYG   
Sbjct  326   KKRRTLLSLDYEAVMTAWASQGSPWTNGYRPDFDADECWPDADCMGICGAQLHHPYGDVS  385

Query  1174  --SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
                A      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++ 
Sbjct  386   GLGAHPAALVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTTF  444


 Score =   140 bits (352),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 91/229 (40%), Positives = 122/229 (53%), Gaps = 49/229 (21%)
 Frame = +1

Query  232  QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  411
             +  ANA+ G+TARACDSC+ KRA W+C ADDAFLCQ+CD SVHSANLLA RH+RVRL +
Sbjct  4    NKSLANAVGGRTARACDSCIKKRASWYCAADDAFLCQACDSSVHSANLLARRHERVRLKS  63

Query  412  sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESV-  588
            +S  ++               ++S P+WH GFTRK RTPR+ K   +       +EE+  
Sbjct  64   ASLKSSD----------AGSKENSMPSWHGGFTRKARTPRHGKPVSRSK-----IEETTR  108

Query  589  NPVLPFVPEMGSDD-DYNNNNEIDLFCQVPV--------------------------lld  687
            N  +P VPE+GSD+    +N E  L  +VP+                             
Sbjct  109  NIPIPLVPEVGSDEISLEDNEEEHLLYRVPIFDPFAAELCTSTTVSNEAGAVVPAGGTDT  168

Query  688  ddlnallndgggddHMRGLE------IPEFLSSDVELAEFAADVETLLG  816
            D   A  +       + G E      +  FL SD++LAEFAAD+E+LLG
Sbjct  169  DQRAADSSGTESKVLLGGSEGKDVESLHGFLPSDMDLAEFAADMESLLG  217



>ref|XP_002531628.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30756.1| conserved hypothetical protein [Ricinus communis]
Length=468

 Score =   154 bits (390),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 91/130 (70%), Gaps = 11/130 (8%)
 Frame = +1

Query  1012  KKSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMGG-DHHHHHPYGSAMM  1185
             KK ++LLSL+YE VI+AWA+QG  PWTDGTR   DP+ CW D MG      HHPYG    
Sbjct  335   KKRKILLSLDYEAVITAWATQGTSPWTDGTRRDVDPDECWQDCMGTCGAEFHHPYGDTNG  394

Query  1186  MRR---------SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  1338
             +           +  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  395   LGGVGGGGNPAMAGGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA  454

Query  1339  SLFQPPPPFP  1368
             +    P  FP
Sbjct  455   TFAGGPSAFP  464


 Score =   149 bits (376),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 96/227 (42%), Positives = 119/227 (52%), Gaps = 40/227 (18%)
 Frame = +1

Query  232  QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  411
             +  ANA++GKTARACDSC+ KRARW+C ADDAFLCQSCD SVHSAN LA RH+RVRL  
Sbjct  4    NKNVANAVAGKTARACDSCVRKRARWYCAADDAFLCQSCDSSVHSANPLARRHERVRLKI  63

Query  412  sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVN  591
            SS  +          I       + P+WH+GFTRK RTPRN    K   S     E+S N
Sbjct  64   SSLKSLDI-------ISKGSSVITVPSWHQGFTRKARTPRNGHGNKPLLSLLKIEEKSRN  116

Query  592  PVLPFVPEMGSDDDY---NNNNEIDLFCQVPVll------------------------dd  690
            P+ P VPE+GSDD     +NN E  L  +VP+                            
Sbjct  117  PI-PLVPEVGSDDQISHEDNNEEEQLLYRVPIFDPFVAELCTPTTISNEADQTTTAPFTA  175

Query  691  dlnallndgggddHMRGLE-----IPEFLSSDVELAEFAADVETLLG  816
                  +         G+E     +  FL S+ +LA+FAADVE+LLG
Sbjct  176  GGGNGNDTDQTVAGANGIESKASYLHGFLPSETDLADFAADVESLLG  222



>ref|XP_002894160.1| hypothetical protein ARALYDRAFT_891757 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70419.1| hypothetical protein ARALYDRAFT_891757 [Arabidopsis lyrata subsp. 
lyrata]
Length=326

 Score =   151 bits (381),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 128/376 (34%), Positives = 176/376 (47%), Gaps = 71/376 (19%)
 Frame = +1

Query  247   NAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssst  426
             N    K  RAC+ C +K A W+C +DDAFLC  CD SVHSAN +A++H+RV L T+  S 
Sbjct  5     NQTDVKQQRACELCKNKHAVWYCASDDAFLCHVCDESVHSANHVATKHERVCLRTNEISN  64

Query  427   aaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPF  606
                               S P WH GF RK RTPR   R +K+    +  E  +    P 
Sbjct  65    -----------YVLRGTTSNPVWHSGFRRKARTPR--VRCEKKPQEKIDDERRIED--PR  109

Query  607   VPEMGSDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMRGLEIPEFLSSDVELAE  786
             VPE+G         E+  F   P                DD M  L +PEF        E
Sbjct  110   VPEIGG--------EVMFFIPEP---------------NDDDMTSL-VPEF--------E  137

Query  787   FAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVE--------QKVMM  942
                ++   L + + G ++ T     E +  D  E L ++  +E+EV+        ++ +M
Sbjct  138   GFTEMGFFLNNHN-GTEETTKQFNFE-DEIDAKEDLCYNGEDEEEVKTDGAEACPEQYLM  195

Query  943   TMLSGFDessssmesgsckeeV----AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHF  1110
             +    +D   +        E+     A++  MLL LNYE VI+AW  Q  P       + 
Sbjct  196   SCKKDYDNVITVSAKTEEIEDCYENKARQRNMLLKLNYENVIAAWDKQESPINQTEFNNT  255

Query  1111  DPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKL  1290
                   P   G +           +  RS+  REARV RYR+KR+ RLF KKIRYEVRK+
Sbjct  256   SNLQLVPPLQGIEEKR--------VSNRSE--REARVWRYRDKRKNRLFEKKIRYEVRKV  305

Query  1291  NAEKRPRLKGRFVKRS  1338
             NA+KRPR+KGRFV+RS
Sbjct  306   NADKRPRIKGRFVRRS  321



>ref|XP_006393307.1| hypothetical protein EUTSA_v10011633mg [Eutrema salsugineum]
 gb|ESQ30593.1| hypothetical protein EUTSA_v10011633mg [Eutrema salsugineum]
Length=326

 Score =   150 bits (380),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 126/371 (34%), Positives = 161/371 (43%), Gaps = 71/371 (19%)
 Frame = +1

Query  262   KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasl  441
             K  R C+ CL+K A WFC +DDAFLC  CD SVHSAN +A++H+RV L T+  S      
Sbjct  10    KAQRDCELCLNKHAVWFCASDDAFLCHLCDESVHSANQVATKHERVCLRTNEIS------  63

Query  442   lssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLP------  603
                  I       S P WH GF RK RTPR A+  KK            +P +P      
Sbjct  64    -----IRVLQGTTSKPVWHSGFRRKARTPR-ARCEKKPQENIDDERRREDPRVPEIGGQR  117

Query  604   --FVPEMGSDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMRGLEIPEFLSSDVE  777
               F+PE   DD      + DL   VP                     G    EF  S+ +
Sbjct  118   MFFIPETNDDD-----GDEDLTSLVP------------------EFHGFIEMEFFLSNYD  154

Query  778   LAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMTMLSG  957
              +E          + D  ED            GD            +    + +M+  + 
Sbjct  155   GSEETTRPFNFEDEIDAMEDLCYNEDGEAKTDGD------------KACPDQSLMSSKNN  202

Query  958   FDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQ----GCPWTDGTRPHFDPNHC  1125
                 ++  E     E  AK+  MLL LNYE VI+AW  Q    G P  +           
Sbjct  203   VIAITTKKEEMEDYESNAKQMNMLLRLNYENVIAAWDKQESPRGAPINET----------  252

Query  1126  WPDFMGGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKR  1305
               +F         P G+      S   REARV RYR+KR+ RLF KKIRYEVRK+NA+KR
Sbjct  253   --EFNNISTFQLVPPGTEEKKMSSKSEREARVWRYRDKRKNRLFEKKIRYEVRKVNADKR  310

Query  1306  PRLKGRFVKRS  1338
             PR+KGRFV+RS
Sbjct  311   PRMKGRFVRRS  321



>ref|XP_006393308.1| hypothetical protein EUTSA_v10011633mg [Eutrema salsugineum]
 dbj|BAJ34092.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ30594.1| hypothetical protein EUTSA_v10011633mg [Eutrema salsugineum]
Length=339

 Score =   150 bits (380),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 126/371 (34%), Positives = 161/371 (43%), Gaps = 71/371 (19%)
 Frame = +1

Query  262   KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasl  441
             K  R C+ CL+K A WFC +DDAFLC  CD SVHSAN +A++H+RV L T+  S      
Sbjct  23    KAQRDCELCLNKHAVWFCASDDAFLCHLCDESVHSANQVATKHERVCLRTNEIS------  76

Query  442   lssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLP------  603
                  I       S P WH GF RK RTPR A+  KK            +P +P      
Sbjct  77    -----IRVLQGTTSKPVWHSGFRRKARTPR-ARCEKKPQENIDDERRREDPRVPEIGGQR  130

Query  604   --FVPEMGSDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMRGLEIPEFLSSDVE  777
               F+PE   DD      + DL   VP                     G    EF  S+ +
Sbjct  131   MFFIPETNDDD-----GDEDLTSLVP------------------EFHGFIEMEFFLSNYD  167

Query  778   LAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMTMLSG  957
              +E          + D  ED            GD            +    + +M+  + 
Sbjct  168   GSEETTRPFNFEDEIDAMEDLCYNEDGEAKTDGD------------KACPDQSLMSSKNN  215

Query  958   FDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQ----GCPWTDGTRPHFDPNHC  1125
                 ++  E     E  AK+  MLL LNYE VI+AW  Q    G P  +           
Sbjct  216   VIAITTKKEEMEDYESNAKQMNMLLRLNYENVIAAWDKQESPRGAPINET----------  265

Query  1126  WPDFMGGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKR  1305
               +F         P G+      S   REARV RYR+KR+ RLF KKIRYEVRK+NA+KR
Sbjct  266   --EFNNISTFQLVPPGTEEKKMSSKSEREARVWRYRDKRKNRLFEKKIRYEVRKVNADKR  323

Query  1306  PRLKGRFVKRS  1338
             PR+KGRFV+RS
Sbjct  324   PRMKGRFVRRS  334



>gb|AGM20692.1| COL6-2 [Populus tomentosa]
Length=447

 Score =   152 bits (385),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 87/119 (73%), Gaps = 8/119 (7%)
 Frame = +1

Query  1012  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDF--MG-GDHHHHHPYGSAM  1182
             KK R LLSL+YE V+SAWASQG PWT+G RP FD + CWPD   MG      HHPYG   
Sbjct  326   KKRRTLLSLDYEAVMSAWASQGSPWTNGYRPDFDADECWPDADCMGICGAQLHHPYGDVS  385

Query  1183  MMRRS-----DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
              +        D  REARVSRYREKRRTRLFSKK+RYEVRKLNAEKRPR+KGRFVKR++ 
Sbjct  386   GLGADPAALVDGAREARVSRYREKRRTRLFSKKLRYEVRKLNAEKRPRMKGRFVKRTTF  444


 Score =   132 bits (331),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 89/229 (39%), Positives = 119/229 (52%), Gaps = 49/229 (21%)
 Frame = +1

Query  232  QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  411
             +  ANA+ G+TARACDSC+ KRA W+C ADDAFLCQ+CD SVHSANLLA RH+RVRL +
Sbjct  4    NKSLANAVRGRTARACDSCIKKRASWYCAADDAFLCQACDSSVHSANLLARRHERVRLKS  63

Query  412  sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESV-  588
            +S  ++               ++S P+ H GFTRK RTPR+ K   +       +EE+  
Sbjct  64   ASLKSSD----------AGSKENSMPSGHGGFTRKARTPRHGKPVSRSK-----IEETTR  108

Query  589  NPVLPFVPEMGSDD-DYNNNNEIDLFCQVPV--------------------------lld  687
            N  +P VPE+GSD+    +N E  L   VP+                             
Sbjct  109  NIPIPLVPEVGSDELSLEDNEEEHLLYSVPIFDPFAAELCTSTTVSNEAGAVVPAGGTDT  168

Query  688  ddlnallndgggddHMRGLE------IPEFLSSDVELAEFAADVETLLG  816
            D   A  +       + G E      +  FL SD++LAEFAAD+E+ LG
Sbjct  169  DQRAADSSGTESKVLLGGSEGKDVESLHGFLPSDMDLAEFAADMESSLG  217



>ref|XP_009144991.1| PREDICTED: zinc finger protein CONSTANS-LIKE 8 [Brassica rapa]
 emb|CDY66242.1| BnaA05g36570D [Brassica napus]
Length=314

 Score =   149 bits (377),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 127/365 (35%), Positives = 171/365 (47%), Gaps = 71/365 (19%)
 Frame = +1

Query  262   KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasl  441
             K  R C+ CL+K A W+C +DDAFLC  CD SVH AN +A++H RV L T+  S      
Sbjct  10    KRPRDCELCLNKHAVWYCASDDAFLCHVCDESVHRANQVATKHDRVCLKTNEISNGVLQG  69

Query  442   lssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVPEMG  621
              +             P WH  F RKPRTPR   R +++  G V  E       P VPE+G
Sbjct  70    TARK-----------PVWHSWFRRKPRTPR--VRCERKPQGKVDDERRREG--PHVPEIG  114

Query  622   SDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMRG-LEIPEFLS----SDVELAE  786
              + +  + N   L   VP                    +G +E+  FL+    S+  + +
Sbjct  115   GETNEEDENLTSL---VP------------------EFQGFIEMEFFLNNHDGSEETMRQ  153

Query  787   FAADVETLLGDDDVGEDKATAAVKIEINGGD-CTEALNWSFGEEQEVEQKVMMTMLSGFD  963
             F  D ET     D  ED      + + NG + C E    S   E ++   ++ T      
Sbjct  154   FNVDHET-----DEMEDLCYIEEEGKTNGDEACHEQSLTSCKNEYDINPTLVTTKTE---  205

Query  964   essssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG  1143
                          E AK+  +LL LNYE VI+AW  Q  P    T   ++ N    +F  
Sbjct  206   -------------ENAKQRNLLLRLNYENVIAAWDKQESP----TTATWNQN----EFSN  244

Query  1144  GDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGR  1323
               +    P G       +   REARV RYR+KR+ RLF KKIRYEVRK+NA+KRPR+KGR
Sbjct  245   TSNFQLVPPGIEEEKVSNRSEREARVWRYRDKRKNRLFEKKIRYEVRKVNADKRPRIKGR  304

Query  1324  FVKRS  1338
             FV+RS
Sbjct  305   FVRRS  309



>ref|XP_010500456.1| PREDICTED: zinc finger protein CONSTANS-LIKE 8-like isoform X2 
[Camelina sativa]
Length=330

 Score =   149 bits (376),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 122/378 (32%), Positives = 163/378 (43%), Gaps = 81/378 (21%)
 Frame = +1

Query  262   KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasl  441
             K  R CD CL+K A W+C +DDAFLC  CD SVHSAN +A++H+RV L            
Sbjct  10    KQPRPCDLCLNKHAVWYCASDDAFLCHVCDESVHSANHVATKHERVCL----------RT  59

Query  442   lssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVPEMG  621
                P  V      S P WH GF RK RTPR+    K Q      +++      P VPE+G
Sbjct  60    NEIPNNVLQGTT-SHPVWHSGFRRKARTPRSRCEKKTQQK----IDDERRGEDPRVPEIG  114

Query  622   SDDDY----NNNNEIDLFCQVPVlldddlnallndgggddHMRGLEIPE--FLSSDVELA  783
              +  +     N++E D    VP                     G  + E  F SS+    
Sbjct  115   GEAMFFIPEANDDENDTTSLVP------------------EFEGFTVTEMGFFSSN----  152

Query  784   EFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKV---------  936
                                 T     + N  D  +A+   +  E+E   K          
Sbjct  153   -----------------HNGTQETTKQFNFEDEIDAMEDLYYNEEEKAAKTNGAEARPGQ  195

Query  937   -MMTMLSGFDessssmesgsckeeV---AKKSRMLLSLNYEEVISAWASQGCPWTDGTRP  1104
              +M   + +D   +        E+    A++  MLL LNYE VI+AW  Q  P  +  R 
Sbjct  196   SLMNCKNDYDNVIAISAKREETEDYEDNARQGNMLLRLNYENVIAAWDKQESP-REAARN  254

Query  1105  HFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVR  1284
                      +     +    P G       S   REARV RYR+K++ RLF KKIRYEVR
Sbjct  255   Q-------TELFNTSNFQLVPLGIEEKRVTSRSEREARVWRYRDKKKNRLFEKKIRYEVR  307

Query  1285  KLNAEKRPRLKGRFVKRS  1338
             K+NA+KRPR+KGRFV+RS
Sbjct  308   KVNADKRPRMKGRFVRRS  325



>ref|XP_011007901.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X1 [Populus euphratica]
Length=447

 Score =   150 bits (378),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 88/119 (74%), Gaps = 8/119 (7%)
 Frame = +1

Query  1012  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPD--FMG-GDHHHHHPYG---  1173
             KK R LLSL+Y+ V++AWASQG PWT+G RP FD + CWPD   MG      H PYG   
Sbjct  326   KKRRTLLSLDYDAVMTAWASQGSPWTNGYRPDFDADECWPDPDCMGICGAQLHQPYGDVS  385

Query  1174  --SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
               +A      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++ 
Sbjct  386   GLAAHPAALVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTTF  444


 Score =   139 bits (351),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 92/231 (40%), Positives = 124/231 (54%), Gaps = 53/231 (23%)
 Frame = +1

Query  232  QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  411
             +  ANA+ G+TARACDSC+ KRARW+C ADDAFLCQ+CD SVHSANLLA RH+RVRL +
Sbjct  4    NKSLANAVGGRTARACDSCIKKRARWYCAADDAFLCQACDSSVHSANLLARRHERVRLKS  63

Query  412  sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESV-  588
            +S  ++               ++S P+WH GFTRK RTPR+ K   +       +E++  
Sbjct  64   ASHKSSG----------AGSQENSMPSWHGGFTRKARTPRHGKPVSQSK-----IEKTKR  108

Query  589  NPVLPFVPEMGSDD-DYNNNNEIDLFCQVPVlldddlnallndgggddHMRGLEIPE---  756
            N  +P VPE+GSD+    +N E  L  +VP+   D   A L       +  G  +P+   
Sbjct  109  NIPIPLVPEVGSDEISLEDNEEEHLLYRVPI--FDPFAAELCTSTTVSNEAGAVVPDGGT  166

Query  757  -------------------------------FLSSDVELAEFAADVETLLG  816
                                           FL SD++LAEFAAD+E+LLG
Sbjct  167  DTDQRAADSSGTESKVLLGGSEGKDVESLHGFLPSDMDLAEFAADMESLLG  217



>ref|XP_010500455.1| PREDICTED: zinc finger protein CONSTANS-LIKE 8-like isoform X1 
[Camelina sativa]
Length=336

 Score =   146 bits (369),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 124/384 (32%), Positives = 167/384 (43%), Gaps = 87/384 (23%)
 Frame = +1

Query  262   KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasl  441
             K  R CD CL+K A W+C +DDAFLC  CD SVHSAN +A++H+RV L            
Sbjct  10    KQPRPCDLCLNKHAVWYCASDDAFLCHVCDESVHSANHVATKHERVCL----------RT  59

Query  442   lssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVPEMG  621
                P  V      S P WH GF RK RTPR+    K Q      +++      P VPE+G
Sbjct  60    NEIPNNV-LQGTTSHPVWHSGFRRKARTPRSRCEKKTQQK----IDDERRGEDPRVPEIG  114

Query  622   SDDDY----NNNNEIDLFCQVPVlldddlnallndgggddHMRGLEIPE--FLSSDVELA  783
              +  +     N++E D    VP                     G  + E  F SS+    
Sbjct  115   GEAMFFIPEANDDENDTTSLVP------------------EFEGFTVTEMGFFSSN----  152

Query  784   EFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKV---------  936
                                 T     + N  D  +A+   +  E+E   K          
Sbjct  153   -----------------HNGTQETTKQFNFEDEIDAMEDLYYNEEEKAAKTNGAEARPGQ  195

Query  937   -MMTMLSGFDessssmesgsckeeV---AKKSRMLLSLNYEEVISAWASQGCPWTDGTRP  1104
              +M   + +D   +        E+    A++  MLL LNYE VI+AW  Q  P  +  R 
Sbjct  196   SLMNCKNDYDNVIAISAKREETEDYEDNARQGNMLLRLNYENVIAAWDKQESP-REAARN  254

Query  1105  HFDPNHCWPDFMGGDHHHHHPYGSAMMM----RR--SDEGREARVSRYREKRRTRLFSKK  1266
                      +     +    P  S +M     +R  S   REARV RYR+K++ RLF KK
Sbjct  255   Q-------TELFNTSNFQLVPLTSIVMQGIEEKRVTSRSEREARVWRYRDKKKNRLFEKK  307

Query  1267  IRYEVRKLNAEKRPRLKGRFVKRS  1338
             IRYEVRK+NA+KRPR+KGRFV+RS
Sbjct  308   IRYEVRKVNADKRPRMKGRFVRRS  331



>emb|CDY07383.1| BnaA07g24620D [Brassica napus]
Length=230

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 110/254 (43%), Positives = 141/254 (56%), Gaps = 40/254 (16%)
 Frame = +1

Query  604   FVPEMGSDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMRGLEIPEFLSSDVELA  783
              VPEM S+D      E  L  +VPVL   D N           + GL       +++ELA
Sbjct  6     LVPEMSSEDQRYEVEE-QLIFEVPVLNPMDDNTESC-------LNGL-----FPTEMELA  52

Query  784   EFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMTMLSGFD  963
             +F+ADVETLLG    G D+   A++               FGE  ++E++ +        
Sbjct  53    QFSADVETLLGG---GTDREFHAME------------EIGFGEMLKIEKEEVKEEEE---  94

Query  964   essssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH--CWPDF  1137
                ++ E     +E  K+  ++L L+YE VIS W SQG PWT       D +   C  + 
Sbjct  95    --VATREVTGRIKEEKKEKVLMLRLDYETVISTWGSQGTPWTALKPSEIDLDMLCCQTNS  152

Query  1138  M---GGD-HHHHHPYGSAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEK  1302
             M   GG+ HHH+H  G  + MR + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEK
Sbjct  153   MCESGGEAHHHNHFPGLGLHMREAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEK  212

Query  1303  RPRLKGRFVKRSSL  1344
             RPR+KGRFVKRSS+
Sbjct  213   RPRMKGRFVKRSSI  226



>gb|KDP29405.1| hypothetical protein JCGZ_18326 [Jatropha curcas]
Length=438

 Score =   145 bits (367),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 92/221 (42%), Positives = 120/221 (54%), Gaps = 38/221 (17%)
 Frame = +1

Query  232  QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  411
             +  ANA+ GKTARACDSC+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL T
Sbjct  4    HKNVANAVGGKTARACDSCIRKRARWYCAADDAFLCQACDSSVHSANSLARRHERVRLKT  63

Query  412  sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVN  591
            +S  +       S   V        P+WH+GFTRK RTPR+ K     +      EE + 
Sbjct  64   ASLKSLNLFSKESTSCV--------PSWHQGFTRKARTPRHGKSVNFISKN----EEKIR  111

Query  592  PVLPFVPEMGSDDDYN-NNNEIDLFCQVPVl----------ldddlnallndgggddHMR  738
              +PFVPE+GSD+  N  N+E  L  +VP+              +    +        + 
Sbjct  112  NHIPFVPELGSDETSNEENDEEQLLYRVPIFDPFVAELCAPTVSNEAETIIADRTVGDVN  171

Query  739  GLE--IPEF-------------LSSDVELAEFAADVETLLG  816
            G+E   P               + SD++LAEF+ADVE+LLG
Sbjct  172  GVESKTPSLGCDVGQSLHGCGIMPSDMDLAEFSADVESLLG  212


 Score =   140 bits (354),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 81/116 (70%), Gaps = 7/116 (6%)
 Frame = +1

Query  1039  NYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG--GDHHHHHPYGS-----AMMMRRS  1197
             +YE VI+AWASQG PW  G +P  +P+ CW D MG  G    HH YG       +    +
Sbjct  320   DYEAVITAWASQGSPWITGNQPDINPDDCWLDCMGIYGAEVLHHSYGDHNGGIGIQPAMT  379

Query  1198  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPF  1365
             D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++   P  P 
Sbjct  380   DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANFAAPVFPL  435



>ref|XP_010546462.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like, partial 
[Tarenaya hassleriana]
Length=258

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 96/229 (42%), Positives = 119/229 (52%), Gaps = 45/229 (20%)
 Frame = +1

Query  235  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
            + +ANA+ GKTARACDSC+ +RARW+C +DDAFLCQ+CD SVHSAN LA RH+RVRL   
Sbjct  2    KSSANAVGGKTARACDSCVKRRARWYCPSDDAFLCQACDGSVHSANPLARRHERVRL---  58

Query  415  ssstaaasllssPKIVddddddSPPA---WHRGFTRKPRTPRNAKRTKKQNSGGVAVEES  585
               +A++S    P  V      SPP    WH GFTRK RTPR +    K N   V   + 
Sbjct  59   --KSASSSRTHRPTTV------SPPGTAKWHHGFTRKARTPRGSGSAGKPNQRAVFFHD-  109

Query  586  VNPVLPFVPEMGSDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMRGLEIPE---  756
                   VPE+  +D   N  E  L  QVPVL         +D   +    G  +PE   
Sbjct  110  ------LVPEISVEDQTENYEEEQLIFQVPVLDPTVSEQYRDDAIEEK--TGFPLPELIK  161

Query  757  -------------------FLSSDVELAEFAADVETLLGDDDVGEDKAT  846
                               F  +D+ELAEFAADV+TLLG +   E  AT
Sbjct  162  FADMNEENDEDNAESCLDRFFPTDMELAEFAADVDTLLGHNLETESFAT  210



>ref|XP_010543105.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Tarenaya 
hassleriana]
Length=311

 Score =   141 bits (356),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 96/229 (42%), Positives = 119/229 (52%), Gaps = 45/229 (20%)
 Frame = +1

Query  235  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
            + +ANA+ GKTARACDSC+ +RARW+C +DDAFLCQ+CD SVHSAN LA RH+RVRL   
Sbjct  2    KSSANAVGGKTARACDSCVKRRARWYCPSDDAFLCQACDGSVHSANPLARRHERVRL---  58

Query  415  ssstaaasllssPKIVddddddSPPA---WHRGFTRKPRTPRNAKRTKKQNSGGVAVEES  585
               +A++S    P  V      SPP    WH GFTRK RTPR +    K N   V   + 
Sbjct  59   --KSASSSRTHRPTTV------SPPGTAKWHHGFTRKARTPRGSGSAGKPNQRAVFFHD-  109

Query  586  VNPVLPFVPEMGSDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMRGLEIPE---  756
                   VPE+  +D   N  E  L  QVPVL         +D   +    G  +PE   
Sbjct  110  ------LVPEISVEDQTENYEEEQLIFQVPVLDPTVSEQYRDDAIEEK--TGFPLPELIK  161

Query  757  -------------------FLSSDVELAEFAADVETLLGDDDVGEDKAT  846
                               F  +D+ELAEFAADV+TLLG +   E  AT
Sbjct  162  FADMNEENDEDNAESCLDRFFPTDMELAEFAADVDTLLGHNLETESFAT  210



>ref|XP_003637430.1| Zinc finger protein CONSTANS-like protein [Medicago truncatula]
Length=166

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 85/124 (69%), Gaps = 9/124 (7%)
 Frame = +1

Query  1015  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG--GDHHHHH-----PYG  1173
             K ++ L L+Y+ VI AW SQ CPWT+G +P  D +  WPD MG  G   H+       YG
Sbjct  43    KRKISLQLDYDAVIIAWDSQKCPWTNGDKPILDADENWPDCMGTFGTEVHYAYGEFGGYG  102

Query  1174  SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  1353
                +M   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S   P
Sbjct  103   CHPVM--VDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASFAVP  160

Query  1354  PPPF  1365
               P 
Sbjct  161   TFPL  164



>ref|XP_006656860.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Oryza brachyantha]
Length=336

 Score =   139 bits (351),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 100/225 (44%), Positives = 119/225 (53%), Gaps = 35/225 (16%)
 Frame = +1

Query  757   FLSSDVELAEFAADVETLLG---DDDVGEDK--------------ATAAVKIEINGGDCT  885
             F  +D EL EFAAD+E LLG   DD   ED                   VK+E +G D  
Sbjct  108   FGPTDAELREFAADMEALLGRGLDDGNDEDSFCMETLGLIEPGGDDGGRVKVEADG-DAG  166

Query  886   EALNWSFGEEQEVEQKVMMTMLSGFD-----essssmesgsckeeVAKKSRMLLSLNYEE  1050
               L W    + E     M+ +   FD      ++   +  S     A +S + LSLNYE 
Sbjct  167   LTLPWCNDLDPETSSGEMLDI--DFDCGSPQAATPDEKVASSGAADALQSSLALSLNYEA  224

Query  1051  VISAWASQGCPWTDGTRPHFDPNHCWP-DFMG-----GDHHHHHPYGSAMMMRRS--DEG  1206
             +I +W S   PWTDG RPH   N  WP D+ G          H     A+  R    D G
Sbjct  225   IIESWGSS--PWTDGERPHVKLNDSWPHDYSGVWMAAAGVFGHGEEQQALTPRLQGMDGG  282

Query  1207  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  1341
             REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  283   REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAT  327



>ref|XP_004299078.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Fragaria 
vesca subsp. vesca]
Length=450

 Score =   139 bits (351),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 116/211 (55%), Gaps = 41/211 (19%)
 Frame = +1

Query  253  ISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaa  432
            + GKTARACDSC+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL T+SS  + 
Sbjct  19   VGGKTARACDSCIKKRARWYCAADDAFLCQACDSSVHSANQLARRHERVRLKTASSIKST  78

Query  433  asllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVP  612
             +  S  K          P+WHRGFTRKPRTPR   ++    +             P VP
Sbjct  79   TNSGSCDK-------SEVPSWHRGFTRKPRTPRGQGKSAAPRN-----------RFPLVP  120

Query  613  EMGSDD-DYNNNNEIDLFCQVPVll-------dddlnallndgggddHMRGLEIPEF---  759
            E+G+DD  Y  N E  L  +VP+             +  +++    +  + + +P +   
Sbjct  121  EVGADDLSYEENEEEQLLYRVPIYDPFVAELCTSPNSNAVSNDLNGNESKAVSMPNYYGV  180

Query  760  ------------LSSDVELAEFAADVETLLG  816
                        L SD++LAEFAADV++LLG
Sbjct  181  GNRNSPSSHGFDLPSDMDLAEFAADVDSLLG  211


 Score =   134 bits (338),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 87/129 (67%), Gaps = 11/129 (9%)
 Frame = +1

Query  1012  KKSRMLLSLNYEEVISAWASQ--GCPWTDGTRPHFDPNHCWPDFMG---GDHHHHHPYGS  1176
             KK ++ L L+Y+EVI+ W SQ  G P+  G RP  D + C PDFMG   G    H+PYG 
Sbjct  319   KKRKIFLRLDYDEVITKWDSQSNGSPFAFGDRPDIDYD-CLPDFMGTASGAELLHYPYGD  377

Query  1177  -----AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  1341
                   +    +D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S
Sbjct  378   LNRVIGLHPTMTDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAS  437

Query  1342  LFQPPPPFP  1368
                    FP
Sbjct  438   FAATGSTFP  446



>ref|XP_009409258.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=346

 Score =   137 bits (346),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 114/355 (32%), Positives = 158/355 (45%), Gaps = 82/355 (23%)
 Frame = +1

Query  232   QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  411
             QR + +A+ GK ARAC  CL  RARW+C A  AFLCQ CD SVHSAN L  RHQRVRL T
Sbjct  8     QRPSPDAVGGKAARACYGCLRHRARWYCTAHHAFLCQICDSSVHSANPLVRRHQRVRLTT  67

Query  412   sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVA---VEE  582
             +S              +  +  +S P+W  GF RK RT R   RT    +G +    V+ 
Sbjct  68    TS--------------LVGEPGESSPSWLEGFERKARTSRPQHRTNMMAAGDLPEQLVDA  113

Query  583   SV-------------------NPVL-----PFVP-----EMGSDDDYNNNNEIDLFCQVP  675
             SV                   NP+      P  P        S DD      ++L    P
Sbjct  114   SVDEDDDGEQEEELSYCVPIRNPLFASFCSPPPPLDNSNATSSGDDAAAKTSVELSDNSP  173

Query  676   VlldddlnallndgggddHMRGLEIPEFLSSDVELAEFAADVETLLGDDDVGEDKATAAV  855
                              + M G     FL+ D+E++EFAA +++LLG D VG D A    
Sbjct  174   A-----------SPSTINKMDG-----FLTMDLEISEFAARIKSLLGGDLVGGDDAFCMA  217

Query  856   KIEI------NGGDCTE------ALNWSFGEEQEVEQKVMMTMLSGF-------Dessss  978
              +E+      N G   E       +     +E E + ++ + +   F       +     
Sbjct  218   NLELAEPVAENTGFSIEDDARHVKMEQPDRDEDESQGELELNLECSFPFTRGEEESEEDE  277

Query  979   mesgsckeeVAKKSRMLLSLNYEEVISAWASQG-CPWTDGTRPHFDPNHCWPDFM  1140
             +   + K E   + +  L L+YE +I AW+SQG  PWTDG RP  + ++CWPD+M
Sbjct  278   VAGTAVKVEQGAEKKAKLRLDYESIIMAWSSQGSSPWTDGERPQINVDNCWPDYM  332



>ref|XP_010551268.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Tarenaya 
hassleriana]
Length=424

 Score =   139 bits (349),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 101/207 (49%), Gaps = 37/207 (18%)
 Frame = +1

Query  235  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
            +  +NA+  KTARACDSC+ +RARW+C ADDAFLCQ CD SVHSAN LA RH+RVRL   
Sbjct  2    KSLSNAVGAKTARACDSCVKRRARWYCAADDAFLCQVCDGSVHSANPLARRHERVRL---  58

Query  415  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNP  594
                         K         P  WH GF RK RTPR     KK N   +  +     
Sbjct  59   -------------KSASSVPPPGPATWHHGFARKARTPRGGGGRKKTNHRAIFHD-----  100

Query  595  VLPFVPEMGSDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMRGLE---------  747
                VPE+ ++D   N  E  L CQVPVL      +  +                     
Sbjct  101  ---LVPEISAEDQTENYEEEQLICQVPVLDHPMAESNTSFPLPVRMKFADIKDKDDDQDN  157

Query  748  ----IPEFLSSDVELAEFAADVETLLG  816
                +  F  SD+ELAEFAADVETLLG
Sbjct  158  AESCLNGFFPSDMELAEFAADVETLLG  184


 Score =   135 bits (340),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 78/111 (70%), Gaps = 4/111 (4%)
 Frame = +1

Query  1024  MLLSLNYEEVISAWASQGCPWTDGTRPHFD-PNHCWPDFMG---GDHHHHHPYGSAMMMR  1191
             ++L L+YE VIS+W  QG PWT G  P  D  N  WP  MG   G  +     G  + M 
Sbjct  303   LMLRLDYESVISSWGGQGPPWTAGEPPELDLKNDSWPISMGEVNGGQYGSGICGVGLTMA  362

Query  1192  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
               D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+SL
Sbjct  363   MGDVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASL  413



>gb|ADK63396.1| B-box type zinc finger protein [Brassica rapa]
Length=265

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 77/110 (70%), Gaps = 4/110 (4%)
 Frame = +1

Query  1027  LLSLNYEEVISAWASQGCPWTDGTRPHFDPNH-CWP-DFM--GGDHHHHHPYGSAMMMRR  1194
             +L L+YE VIS W  QG PWT    P  D N  C P D M   G   HHH Y   + +  
Sbjct  152   MLRLDYESVISTWGGQGTPWTARETPQIDLNMLCCPTDSMVESGGEAHHHNYVRGLGLHM  211

Query  1195  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
              + GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  212   GEAGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  261



>ref|XP_004140861.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
sativus]
 ref|XP_004172358.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
sativus]
 gb|KGN45963.1| hypothetical protein Csa_6G039540 [Cucumis sativus]
Length=334

 Score =   136 bits (343),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 92/221 (42%), Positives = 117/221 (53%), Gaps = 28/221 (13%)
 Frame = +1

Query  769   DVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEE---------QE  921
             DV +++F  DVE  L  +    ++    VK+E    DC     W  GE           +
Sbjct  126   DVNVSDFGGDVERNLEREWFDIEEELGLVKVE---EDC-----WRIGEGFDSDQVDFFMD  177

Query  922   VEQKVMMTMLSGFDessssmesgsckeeVAKKSRML-LSLNYEEVISAWASQGCPWTDGT  1098
              E+  M  ++ G        E          K R+L L L+ E VI+AW +   PWT+G 
Sbjct  178   FEEIKMPPLVVGVKNERHEDEGDESGITDKNKRRVLSLRLDCEAVIAAWGNLQSPWTNGQ  237

Query  1099  RPHFDPNHCWPDFMG------GDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFS  1260
             RP FDP+  WP+ M       G     + + +A +    D GREARVSRYREKRRTRLFS
Sbjct  238   RPDFDPDQPWPNSMDLCEVRYGQRCGEYGFRTAAI---GDGGREARVSRYREKRRTRLFS  294

Query  1261  KKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLN  1383
             KKIRYEVRKLNAEKRPR+KGRFVKR+  F P P  P   +N
Sbjct  295   KKIRYEVRKLNAEKRPRMKGRFVKRTP-FAPQPTLPIITIN  334


 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 2/63 (3%)
 Frame = +1

Query  217  MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  396
            MMS  ++  ANA+ GKTARACDSC+ KRARW+C ADDAFLCQSCD +VHSAN LA RHQR
Sbjct  1    MMS--RKNIANAVGGKTARACDSCVRKRARWYCAADDAFLCQSCDTTVHSANPLARRHQR  58

Query  397  VRL  405
            +RL
Sbjct  59   LRL  61



>gb|AAF69700.1|AC016041_5 F27J15.10 [Arabidopsis thaliana]
Length=313

 Score =   133 bits (335),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 118/365 (32%), Positives = 165/365 (45%), Gaps = 72/365 (20%)
 Frame = +1

Query  262   KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasl  441
             K  RAC+ CL+K A W+C +DDAFLC  CD SVHSAN +A++H+RV L T+  S      
Sbjct  10    KQPRACELCLNKHAVWYCASDDAFLCHVCDESVHSANHVATKHERVCLRTNEISNDVRGG  69

Query  442   lssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVPEMG  621
              +   +           WH GF RK RTPR+    K Q      +++      P VPE+G
Sbjct  70    TTLTSV-----------WHSGFRRKARTPRSRYEKKPQQK----IDDERRREDPRVPEIG  114

Query  622   SDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMRGLEIPEFLSSDVELAEFAADV  801
                      E+  F  +P                DD M  L +PEF     E+  F ++ 
Sbjct  115   G--------EVMFF--IP-------------EANDDDMTSL-VPEF-EGFTEMGFFLSNH  149

Query  802   ETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVE------QKVMMTMLSGFD  963
                      G ++ T     E    D  E L ++  EE + +       + +M+    +D
Sbjct  150   N--------GTEETTKQFNFE-EEADTMEDLYYNGEEEDKTDGAEACPGQYLMSCKKDYD  200

Query  964   essssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG  1143
                +  E     E+  + +     LNYE VI+AW  Q  P                  + 
Sbjct  201   NVITVSEKTEEIEDCYENN-ARHRLNYENVIAAWDKQESPRD----------------VK  243

Query  1144  GDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGR  1323
              +          +  +R    REARV RYR+KR+ RLF KKIRYEVRK+NA+KRPR+KGR
Sbjct  244   NNTSSFQLVPPGIEEKRVRSEREARVWRYRDKRKNRLFEKKIRYEVRKVNADKRPRMKGR  303

Query  1324  FVKRS  1338
             FV+RS
Sbjct  304   FVRRS  308



>ref|NP_001031160.1| zinc finger protein CONSTANS-LIKE 8 [Arabidopsis thaliana]
 sp|Q9M9B3.2|COL8_ARATH RecName: Full=Zinc finger protein CONSTANS-LIKE 8 [Arabidopsis 
thaliana]
 dbj|BAH20052.1| AT1G49130 [Arabidopsis thaliana]
 gb|AEE32394.1| zinc finger protein CONSTANS-LIKE 8 [Arabidopsis thaliana]
Length=319

 Score =   131 bits (330),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 119/366 (33%), Positives = 167/366 (46%), Gaps = 74/366 (20%)
 Frame = +1

Query  262   KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasl  441
             K  RAC+ CL+K A W+C +DDAFLC  CD SVHSAN +A++H+RV L T+  S      
Sbjct  16    KQPRACELCLNKHAVWYCASDDAFLCHVCDESVHSANHVATKHERVCLRTNEISNDVRGG  75

Query  442   lssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVPEMG  621
              +   +           WH GF RK RTPR+    K Q      +++      P VPE+G
Sbjct  76    TTLTSV-----------WHSGFRRKARTPRSRYEKKPQQK----IDDERRREDPRVPEIG  120

Query  622   SDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMRGLEIPEFLSSDVELAEFAADV  801
                      E+  F  +P                DD M  L +PEF        E   ++
Sbjct  121   G--------EVMFF--IP-------------EANDDDMTSL-VPEF--------EGFTEM  148

Query  802   ETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVE------QKVMMTMLSGFD  963
                L + + G ++ T     E    D  E L ++  EE + +       + +M+    +D
Sbjct  149   GFFLSNHN-GTEETTKQFNFE-EEADTMEDLYYNGEEEDKTDGAEACPGQYLMSCKKDYD  206

Query  964   essssmesgsckeeVAK-KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFM  1140
                +  E     E+  +  +R  L  NYE VI+AW  Q  P                  +
Sbjct  207   NVITVSEKTEEIEDCYENNARHRL--NYENVIAAWDKQESPRD----------------V  248

Query  1141  GGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKG  1320
               +          +  +R    REARV RYR+KR+ RLF KKIRYEVRK+NA+KRPR+KG
Sbjct  249   KNNTSSFQLVPPGIEEKRVRSEREARVWRYRDKRKNRLFEKKIRYEVRKVNADKRPRMKG  308

Query  1321  RFVKRS  1338
             RFV+RS
Sbjct  309   RFVRRS  314



>gb|EAZ36554.1| hypothetical protein OsJ_20892 [Oryza sativa Japonica Group]
Length=448

 Score =   134 bits (336),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 97/229 (42%), Positives = 118/229 (52%), Gaps = 41/229 (18%)
 Frame = +1

Query  757   FLSSDVELAEFAADVETLLG---DDDVGEDK--------------ATAAVKIEINGGDCT  885
             F  +D EL EFAAD+E LLG   DD   ED                   VK+E +G D  
Sbjct  210   FGPTDAELREFAADMEALLGRGLDDGNDEDSFCMETLGLIEPVDDDAGRVKVEADG-DAG  268

Query  886   EALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeeVA------------KKSRML  1029
               L W    + E     M+ +   FD  S    +   ++  +            ++S + 
Sbjct  269   MTLAWCHELDTETSSGEMLDI--DFDCGSPQAATTPDEKVGSSGPAAADDDAQLQQSNLA  326

Query  1030  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWP-DFMG-----GDHHHHHPYGSAMMMR  1191
             LSLNYE +I +W +   PWTDG RPH   +  WP D+ G          H     A+  R
Sbjct  327   LSLNYEAIIESWGTS--PWTDGERPHVKLDDSWPRDYSGVWMAAAGVFGHGGEEQALTPR  384

Query  1192  RS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
                D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  385   LGMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  433


 Score = 83.2 bits (204),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 55/88 (63%), Gaps = 8/88 (9%)
 Frame = +1

Query  271  RACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasllss  450
            RACD CL +RARW+C ADDAFLCQ CD SVHSAN LA RH+R+RL       ++   L  
Sbjct  19   RACDGCLRRRARWYCAADDAFLCQGCDTSVHSANPLARRHERLRL-----RPSSPPPLVP  73

Query  451  PKIVddddddSPPAWHRGFTRKPRTPRN  534
            P      D+  P AW   F RK RTPR+
Sbjct  74   PSGSGRRDEAVPAAW---FKRKARTPRS  98



>emb|CDY04230.1| BnaC06g25850D [Brassica napus]
Length=230

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 87/208 (42%), Positives = 111/208 (53%), Gaps = 66/208 (32%)
 Frame = +1

Query  757   FLSSDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKV  936
                + +ELA+F+ADVETLL +++V   + +  +K                   +E ++KV
Sbjct  73    LFPTQMELAQFSADVETLL-EEEVATREMSGRIK-------------------EEEKEKV  112

Query  937   MMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDP  1116
             +M                             L L+YE VISAW S   PWT       +P
Sbjct  113   LM-----------------------------LRLDYENVISAWGSHRTPWTA-----LEP  138

Query  1117  NHCWPDFM----------GGD-HHHHHPYGSAMMMRRS-DEGREARVSRYREKRRTRLFS  1260
             +    D +          GG+ HHH+H  G  + MR + D GREARVSRYREKRRTRLFS
Sbjct  139   SEIDLDMLRRQTNSVCESGGEAHHHNHFRGLGLHMREAGDGGREARVSRYREKRRTRLFS  198

Query  1261  KKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
             KKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  199   KKIRYEVRKLNAEKRPRMKGRFVKRSSI  226



>ref|XP_006415872.1| hypothetical protein EUTSA_v10007685mg [Eutrema salsugineum]
 dbj|BAJ34058.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ34225.1| hypothetical protein EUTSA_v10007685mg [Eutrema salsugineum]
Length=433

 Score =   132 bits (333),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 80/118 (68%), Gaps = 7/118 (6%)
 Frame = +1

Query  1012  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDFM----GGDHHHHHPYGS  1176
             +K+ ++L LNY+ VIS W  QG PWT G  P  D +   WP       GG+ HH   Y  
Sbjct  303   QKNVLMLRLNYDSVISTWGGQGPPWTSGDPPELDIDISGWPAISMVGNGGESHHQKQYVG  362

Query  1177  AMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
               +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+SL
Sbjct  363   GCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASL  420


 Score =   122 bits (305),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 89/217 (41%), Positives = 112/217 (52%), Gaps = 37/217 (17%)
 Frame = +1

Query  235  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
            +  ANA+  KTARACDSC+ +RARW+C ADDAFLCQSCD  VHSAN LA RH+RVRL +S
Sbjct  2    KSVANAVGAKTARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRLKSS  61

Query  415  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNP  594
            +S   +    +          ++   WH GFTRK RTPR + +               +P
Sbjct  62   ASPKHSNHNHNHSASSSSPLHEA-ATWHHGFTRKARTPRGSGKKS-------------HP  107

Query  595  VL--PFVPEMGSDDDYNNNN-EIDLFCQVPVlldddlnallndgggdd----HMR-GLEI  750
             +    VPE+  +D  ++   E  L CQVPVL        LND          MR G+ I
Sbjct  108  SIFHDLVPEISVEDQTDSYELEEQLICQVPVLDPMVAEQFLNDVVEPKIEFPTMRSGVMI  167

Query  751  PE---------------FLSSDVELAEFAADVETLLG  816
             E               F  +D+EL EFAADVE LLG
Sbjct  168  HEDQEDEDNNAESCLNGFFPTDMELEEFAADVEILLG  204



>ref|NP_175339.2| zinc finger protein CONSTANS-LIKE 8 [Arabidopsis thaliana]
 gb|AEE32393.1| zinc finger protein CONSTANS-LIKE 8 [Arabidopsis thaliana]
Length=326

 Score =   130 bits (326),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 123/366 (34%), Positives = 170/366 (46%), Gaps = 74/366 (20%)
 Frame = +1

Query  262   KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasl  441
             K  RAC+ CL+K A W+C +DDAFLC  CD SVHSAN +A++H+RV L T+  S      
Sbjct  23    KQPRACELCLNKHAVWYCASDDAFLCHVCDESVHSANHVATKHERVCLRTNEISNDVRGG  82

Query  442   lssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVPEMG  621
              +   +           WH GF RK RTPR+    K Q      +++      P VPE+G
Sbjct  83    TTLTSV-----------WHSGFRRKARTPRSRYEKKPQQK----IDDERRREDPRVPEIG  127

Query  622   SDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMRGLEIPEFLSSDVELAEFAADV  801
                      E+  F  +P                DD M  L +PEF        E   ++
Sbjct  128   G--------EVMFF--IP-------------EANDDDMTSL-VPEF--------EGFTEM  155

Query  802   ETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVE------QKVMMTMLSGFD  963
                L + + G ++ T     E    D  E L ++  EE + +       + +M+    +D
Sbjct  156   GFFLSNHN-GTEETTKQFNFE-EEADTMEDLYYNGEEEDKTDGAEACPGQYLMSCKKDYD  213

Query  964   essssmesgsckeeVAK-KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFM  1140
                +  E     E+  +  +R  L+  YE VI+AW  Q  P         D  +    F 
Sbjct  214   NVITVSEKTEEIEDCYENNARHRLN--YENVIAAWDKQESPR--------DVKNNTSSFQ  263

Query  1141  GGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKG  1320
                     P G      RS+  REARV RYR+KR+ RLF KKIRYEVRK+NA+KRPR+KG
Sbjct  264   LV------PPGIEEKRVRSE--REARVWRYRDKRKNRLFEKKIRYEVRKVNADKRPRMKG  315

Query  1321  RFVKRS  1338
             RFV+RS
Sbjct  316   RFVRRS  321



>ref|XP_002888669.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64928.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=412

 Score =   130 bits (328),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 82/117 (70%), Gaps = 6/117 (5%)
 Frame = +1

Query  1012  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH-CWPDFMGGD----HHHHHPYGS  1176
             K+  ++L L+YE VIS W  QG PWTD      D +  C P    G+    HHH+H  G 
Sbjct  292   KEKALMLRLDYESVISTWNGQGIPWTDREPSEIDLDMVCCPTHSLGESGEAHHHNHFRGL  351

Query  1177  AMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
              + M  + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  352   GLHMGEAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  408


 Score =   122 bits (305),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/210 (37%), Positives = 108/210 (51%), Gaps = 31/210 (15%)
 Frame = +1

Query  235  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
            +  A+A+ GKTARACDSC+ +RARW+C ADDAFLC +CD SVHSAN LA RH+RVRL   
Sbjct  3    KSLASAVGGKTARACDSCVKRRARWYCAADDAFLCHACDGSVHSANPLARRHERVRL---  59

Query  415  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRT---------------K  549
                  ++     +            WH+GFTRK RTPR  K++                
Sbjct  60   -----KSASSGKHRHASSSSPSHQSTWHQGFTRKARTPRGGKKSHTMVFHDLVPEMSTEN  114

Query  550  KQNSGGVAVEESVNPVLPFVPEMGSDDDYNNNNEIDL-FCQVPVlldddlnallndgggd  726
            +  S  V VEE +   +P +  M  +  ++ + E  + F  +P+          ++    
Sbjct  115  QAESYEVEVEEQLIFEVPVMNPMVKEQCFHQSVETKVEFPMMPLSFKCSDEEDEDNAESC  174

Query  727  dHMRGLEIPEFLSSDVELAEFAADVETLLG  816
              + GL       +D+ELA+F ADVETLLG
Sbjct  175  --LNGL-----FPTDMELAQFTADVETLLG  197



>gb|EEE59794.1| hypothetical protein OsJ_12314 [Oryza sativa Japonica Group]
Length=201

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 77/109 (71%), Gaps = 5/109 (5%)
 Frame = +1

Query  1012  KKSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMM  1188
             K+  M+L L+YE VI +WA  G  PW  G RP FDP+  WPDF  G        G+A+  
Sbjct  22    KRPEMILKLDYEGVIDSWARDGASPWFHGERPRFDPSESWPDFPAGSRGG---LGAAVTA  78

Query  1189  RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
                 E REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  79    VTGGE-REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  126



>gb|EAZ00428.1| hypothetical protein OsI_22452 [Oryza sativa Indica Group]
Length=447

 Score =   130 bits (326),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 93/228 (41%), Positives = 113/228 (50%), Gaps = 38/228 (17%)
 Frame = +1

Query  757   FLSSDVELAEFAADVETLLG---DDDVGEDK--------------ATAAVKIEINGGDCT  885
             F  +D EL EFAAD+E LLG   DD   ED                   VK+E + GD  
Sbjct  210   FGPTDAELREFAADMEALLGRGLDDGNDEDSFCMETLGLIEPVDDDAGRVKVEAD-GDAG  268

Query  886   EALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeeVA-----------KKSRMLL  1032
               L W    + E     M+ +   +    ++                      ++S + L
Sbjct  269   MTLAWCHELDTETSSGEMLDIDFDYGSPQAATTPDEKVGSSGPAAAADDDAQFQQSSLAL  328

Query  1033  SLNYEEVISAWASQGCPWTDGTRPHFDPNHCWP-DFMG-----GDHHHHHPYGSAMMMRR  1194
             SLNYE +I +W +   PWTDG RP    +  WP D+ G          H     A+  R 
Sbjct  329   SLNYEAIIESWGTS--PWTDGERPRVKLDDSWPRDYSGVWMAAAGVFGHGGEEQALTPRL  386

Query  1195  S-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
               D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  387   GMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  434


 Score = 83.2 bits (204),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 55/88 (63%), Gaps = 8/88 (9%)
 Frame = +1

Query  271  RACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasllss  450
            RACD CL +RARW+C ADDAFLCQ CD SVHSAN LA RH+R+RL       ++   L  
Sbjct  19   RACDGCLRRRARWYCAADDAFLCQGCDTSVHSANPLARRHERLRL-----RPSSPPPLVP  73

Query  451  PKIVddddddSPPAWHRGFTRKPRTPRN  534
            P      D+  P AW   F RK RTPR+
Sbjct  74   PSGSGRRDEAVPAAW---FKRKARTPRS  98



>ref|XP_002890690.1| hypothetical protein ARALYDRAFT_472829 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66949.1| hypothetical protein ARALYDRAFT_472829 [Arabidopsis lyrata subsp. 
lyrata]
Length=419

 Score =   129 bits (324),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 92/217 (42%), Positives = 114/217 (53%), Gaps = 45/217 (21%)
 Frame = +1

Query  235  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
            +  ANA+  KTARACDSC+ +RARW+C ADDAFLCQSCD  VHSAN LA RH+RVRL   
Sbjct  2    KSLANAVGAKTARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRL---  58

Query  415  ssstaaasllssPKIVdddddd------SPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAV  576
                      +SP +V   +            WH GFTRK RTPR +   KK NS     
Sbjct  59   --------KTASPAVVKHSNHSSSSPPHEAATWHHGFTRKARTPRGS--GKKNNS-----  103

Query  577  EESVNPVLPFVPEMGSDDDYNNNN-EIDLFCQVPV----lldddlnallndgggddHMR-  738
                +     VPE+  +D  ++   E  L CQVPV    + +  LN ++        MR 
Sbjct  104  ----SIFHDLVPEISVEDQTDSYELEEQLICQVPVLDPLVAEQFLNDVVEPKIEFPMMRS  159

Query  739  GLEIPE-----------FLSSDVELAEFAADVETLLG  816
            G+ I E           F  +D+EL EFAADVETLLG
Sbjct  160  GVMIEEEEDNAESCLNGFFPTDMELEEFAADVETLLG  196


 Score =   122 bits (306),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 76/115 (66%), Gaps = 7/115 (6%)
 Frame = +1

Query  1012  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDFM----GGDHHHHHPYGS  1176
             +K+ +LL LNY+ VIS W  QG PW+ G  P  D +   WP       GG+  H   Y  
Sbjct  288   QKNVLLLRLNYDSVISTWGGQGPPWSSGVPPERDMDISGWPAVSMGENGGECTHKKQYVG  347

Query  1177  AMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
               +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  348   GCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  402



>gb|EMS53816.1| Zinc finger protein CONSTANS-LIKE 16 [Triticum urartu]
Length=282

 Score =   126 bits (317),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 90/224 (40%), Positives = 120/224 (54%), Gaps = 40/224 (18%)
 Frame = +1

Query  766   SDVELAEFAADVETLLG-----DDDVGEDKATAAVKI----EINGGDCTEALN--WSFGE  912
             +D EL EFAAD+E LLG     D D  E     A+ +    +++GG     ++   + G 
Sbjct  51    TDAELMEFAADMEALLGRPGMDDGDEEEPFCMEALGLIEPMDVDGGRVKLEIDPMRACGL  110

Query  913   EQEVE-QKVMMTMLSGFDessssmesgsckeeVAKKSR-----MLLSLNYEEVISAWASQ  1074
             EQ+ E    M  +   +D    + +  +     + +++     + L+LNYE ++  W S 
Sbjct  111   EQKPEVSGDMFDIDFDYDSPLGTPDENAASSGASAEAQFTPRSLALNLNYEAIMENWGSS  170

Query  1075  GCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR---------------RSDEGR  1209
               PW DG RPH   + CWP      H ++     A MM                R D GR
Sbjct  171   --PWADGERPHVKLDDCWP------HDYYSLQEGAWMMGGVVGHGGEGLGTPRLRMDGGR  222

Query  1210  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  1341
             EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  223   EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN  266



>gb|EMT27110.1| hypothetical protein F775_43077 [Aegilops tauschii]
Length=343

 Score =   126 bits (317),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 90/224 (40%), Positives = 119/224 (53%), Gaps = 40/224 (18%)
 Frame = +1

Query  766   SDVELAEFAADVETLLG-----DDDVGEDKATAAVKI----EINGGDCTEALN--WSFGE  912
             +D EL EFAAD+E LLG     D D  E     A+ +    +++GG     ++   + G 
Sbjct  112   TDAELMEFAADMEALLGRPGMDDGDEEEPFCMEALGLIEPMDVDGGRVKLEIDPMRACGL  171

Query  913   EQEVE-QKVMMTMLSGFDessssmesgsckeeVAKKSR-----MLLSLNYEEVISAWASQ  1074
             EQ+ E    M  +   +D    + +  +     +  ++     + L+LNYE ++  W S 
Sbjct  172   EQKPEVSGDMFDIDFDYDSPLGTPDENAASSGASADAQFTPRSLALNLNYEAIMENWGSS  231

Query  1075  GCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR---------------RSDEGR  1209
               PW DG RPH   + CWP      H ++     A MM                R D GR
Sbjct  232   --PWADGERPHVKLDDCWP------HDYYSLQEGAWMMGGVVGHGGEGLGTPRLRMDGGR  283

Query  1210  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  1341
             EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  284   EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN  327



>ref|XP_003559520.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Brachypodium 
distachyon]
Length=423

 Score =   127 bits (320),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 114/216 (53%), Gaps = 43/216 (20%)
 Frame = +1

Query  760   LSSDVELAEFAADVETLL-----GDDDVG-------EDKATAAVKIEINGGDCTEALNWS  903
             L  D+ELA FAAD+E+LL     G DD+G       +        ++ +    T A    
Sbjct  216   LVPDMELASFAADMESLLMGVDSGYDDLGFLDDEKPQMNHLGFDDMQDDFDQSTVAPPAP  275

Query  904   FGEEQEVEQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQGC-  1080
               EEQ+ ++K                          +  +M+L L+YE VIS+W   G  
Sbjct  276   QEEEQQEDRKR------------------------KRPDQMILKLDYEGVISSWTHDGAS  311

Query  1081  PWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFS  1260
             PW  G RPH D +  W DF  G        G+A+      E REARVSRYREKRRTRLF+
Sbjct  312   PWFYGERPHLDSSDSWLDFPAGSGRGFG-LGAAVTAVTGGE-REARVSRYREKRRTRLFA  369

Query  1261  KKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  1368
             KKIRYEVRKLNAEKRPR+KGRFVKR++L    PP P
Sbjct  370   KKIRYEVRKLNAEKRPRMKGRFVKRAAL----PPLP  401


 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +1

Query  250  AISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  405
            A+  +TARACD C+ +RARW C ADDA+LCQ+CD SVHSAN LA RH RVRL
Sbjct  7    ALGARTARACDGCMRRRARWHCAADDAYLCQACDASVHSANPLARRHHRVRL  58



>dbj|BAH19571.1| AT1G68520 [Arabidopsis thaliana]
Length=280

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 111/214 (52%), Gaps = 38/214 (18%)
 Frame = +1

Query  235  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
            +  A+A+ GKTARACDSC+ +RARW+C ADDAFLC +CD SVHSAN LA RH+RVRL ++
Sbjct  3    KSLASAVGGKTARACDSCVKRRARWYCAADDAFLCHACDGSVHSANPLARRHERVRLKSA  62

Query  415  ssstaaasllssPKIVddddddSPP---AWHRGFTRKPRTPRNAKR-------------T  546
            S                     SPP    WH+GFTRK RTPR  K+             +
Sbjct  63   S--------------AGKYRHASPPHQATWHQGFTRKARTPRGGKKSHTMVFHDLVPEMS  108

Query  547  KKQNSGGVAVEESVNPVLPFVPEMGSDDDYNNNNE-IDLFCQVPVlldddlnallndggg  723
             +  +    VEE +   +P +  M  +  +N + E  + F  +P+          ++   
Sbjct  109  TEDQAESYEVEEQLIFEVPVMNSMVEEQCFNQSLEKQNEFPMMPLSFKSSDEEDDDNAES  168

Query  724  ddHMRGLEIPEFLSSDVELAEFAADVETLLGDDD  825
               + GL       +D+ELA+F ADVETLLG  D
Sbjct  169  C--LNGL-----FPTDMELAQFTADVETLLGGGD  195



>emb|CDX77359.1| BnaC08g04040D [Brassica napus]
Length=160

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 74/112 (66%), Gaps = 1/112 (1%)
 Frame = +1

Query  1012  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDFMGGDHHHHHPYGSAMMM  1188
             KK+ ++L LNY+ VIS W  QG PWT G  P  D +   WP            +      
Sbjct  36    KKNVLMLRLNYDSVISTWGGQGPPWTSGEPPERDIDISSWPFVSMRKSAEASRWWMFTFE  95

Query  1189  RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
                D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+SL
Sbjct  96    WVWDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASL  147



>gb|ABF98510.1| CCT motif family protein, expressed [Oryza sativa Japonica Group]
Length=345

 Score =   125 bits (314),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 77/109 (71%), Gaps = 5/109 (5%)
 Frame = +1

Query  1012  KKSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMM  1188
             K+  M+L L+YE VI +WA  G  PW  G RP FDP+  WPDF  G        G+A+  
Sbjct  200   KRPEMILKLDYEGVIDSWARDGASPWFHGERPRFDPSESWPDFPAGSRGG---LGAAVTA  256

Query  1189  RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
                 E REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  257   VTGGE-REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  304


 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 65/91 (71%), Gaps = 1/91 (1%)
 Frame = +1

Query  262  KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasl  441
            +TARACD C+ +RARW C ADDAFLCQ+CD SVHSAN LA RH RVRL ++SSS A++  
Sbjct  15   RTARACDGCMRRRARWHCPADDAFLCQACDASVHSANPLARRHHRVRLPSASSSPASSPR  74

Query  442  lssPKIVddddddSPPAWHRGFTRKPRTPRN  534
             ++      DD D+ PAW  G  R+PRTPR 
Sbjct  75   SAAAPRAGSDDPDA-PAWLHGLKRRPRTPRT  104



>ref|XP_010415472.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Camelina 
sativa]
Length=427

 Score =   126 bits (316),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 81/119 (68%), Gaps = 8/119 (7%)
 Frame = +1

Query  1012  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH--CWPDFMGGD-----HHHHHPY  1170
             K+  ++L L+YE V+S W  QG PWT       D +   C  D MG       HH++H  
Sbjct  305   KEKALMLRLDYESVLSTWGGQGIPWTAQEPSEIDLDMVCCPTDSMGETGADQAHHYNHFR  364

Query  1171  GSAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
             G  + M  + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  365   GLGLHMGEAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  423


 Score =   124 bits (311),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 111/208 (53%), Gaps = 29/208 (14%)
 Frame = +1

Query  235  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
            +  A+A+ GKTARACDSC+ +RARW+C ADDAFLC +CD SVHSAN LA RH+RVRL T+
Sbjct  3    KSLASAVGGKTARACDSCVKRRARWYCAADDAFLCHTCDGSVHSANPLARRHERVRLKTA  62

Query  415  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKR-------------TKKQ  555
            S+     +  SSP             WH+GFTRK RTPR  K+             + + 
Sbjct  63   STGKHRHASSSSPP--------HQATWHQGFTRKARTPRGGKKSHTMVFHDLVPEMSTED  114

Query  556  NSGGVAVEESVNPVLPFVPEMGSDDDYNNNNEIDL-FCQVPVlldddlnallndgggddH  732
             +    VE  +   +P +  M  +  +N + E  + F  +PV          ++      
Sbjct  115  QTESYEVEGQLIFEVPVMNPMVEEQCFNESVETKIEFPMMPVCFKSSDEEDEDNAESC--  172

Query  733  MRGLEIPEFLSSDVELAEFAADVETLLG  816
            + GL       +D+ELA+F ADVETLLG
Sbjct  173  LNGL-----FPTDMELAQFTADVETLLG  195



>gb|EEC73943.1| hypothetical protein OsI_08813 [Oryza sativa Indica Group]
Length=324

 Score =   124 bits (310),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 95/241 (39%), Positives = 124/241 (51%), Gaps = 49/241 (20%)
 Frame = +1

Query  757   FLSSDVELAEFAADVETLLGD--DDVGEDK----------------ATAAVKIEINGGDC  882
             F  +D EL EFAAD+E LLG   DD  E +                 ++ VK+E++GG  
Sbjct  88    FEPTDAELREFAADMEALLGQGLDDSNELQDSFYMETLGLITPPVEESSRVKMELDGGVA  147

Query  883   TEA-----LNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeeVAKKSRML-----L  1032
             + +        +  + ++VE   ++ +   F+ +S   +  S     A  S+       L
Sbjct  148   SSSRVSLPSCRAHPKPEDVESADVLDI--DFNCTSPDEQKSSASNGAAADSQFFHRSLDL  205

Query  1033  SLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSA----------M  1182
              LNYE +I +W +   PWTDG  PH   +  WP+    DHH+      A          M
Sbjct  206   RLNYEAIIESWGNS--PWTDGRPPHGQLDDFWPN----DHHYSVRVVGAGGGGHGAEVGM  259

Query  1183  MM---RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  1353
             M    R    GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR S    
Sbjct  260   MTVRPRMDGPGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRPSAAAA  319

Query  1354  P  1356
             P
Sbjct  320   P  320



>ref|NP_001048022.1| Os02g0731700 [Oryza sativa Japonica Group]
 dbj|BAD15938.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAD16131.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAF09936.1| Os02g0731700 [Oryza sativa Japonica Group]
 gb|EEE57750.1| hypothetical protein OsJ_08268 [Oryza sativa Japonica Group]
Length=323

 Score =   123 bits (309),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 94/240 (39%), Positives = 124/240 (52%), Gaps = 48/240 (20%)
 Frame = +1

Query  757   FLSSDVELAEFAADVETLLGD--DDVGEDK----------------ATAAVKIEINGGDC  882
             F  +D EL EFAAD+E LLG   DD  E +                 +  VK+E++GG  
Sbjct  88    FEPTDAELREFAADMEALLGQGLDDSNELQDSFYMETLGLITPPVEESGRVKMELDGGVA  147

Query  883   TEA-----LNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeeVAKKSRML-----L  1032
             + +        +  + ++VE   ++ +   F+ +S   +  S     A  S+       L
Sbjct  148   SNSRVSLPSCRAHPKPEDVESADVLDI--DFNCTSPDEQKSSASNGAAADSQFFHRSLDL  205

Query  1033  SLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSA---------MM  1185
              LNYE +I +W +   PWTDG  PH   +  WP+    DHH+   + +          MM
Sbjct  206   RLNYEAIIESWGNS--PWTDGRPPHGQLDDFWPN----DHHYSGLWAAGGGGHGAEVGMM  259

Query  1186  M---RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  1356
                 R    GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR S    P
Sbjct  260   TVRPRMDGPGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRPSAAAAP  319



>ref|XP_010511849.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1 
[Camelina sativa]
Length=415

 Score =   124 bits (312),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 84/211 (40%), Positives = 113/211 (54%), Gaps = 33/211 (16%)
 Frame = +1

Query  235  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
            +  A+A+ GKTARACDSC+ +RARW+C ADDAFLC  CD SVHSAN LA RH+RVRL T+
Sbjct  3    KSLASAVGGKTARACDSCVKRRARWYCAADDAFLCHGCDGSVHSANPLARRHERVRLKTA  62

Query  415  ssstaaasllssPKIVddddddSPP---AWHRGFTRKPRTPRNAKR-------------T  546
            S+     + +SSP         SPP    WH+GFTRK RTPR  K+             +
Sbjct  63   STGKHRHADVSSP---------SPPHQATWHQGFTRKARTPRGGKKGHTMVFHDLVPEMS  113

Query  547  KKQNSGGVAVEESVNPVLPFVPEMGSDDDYNNNNEIDL-FCQVPVlldddlnallndggg  723
             +       VE  +   +P +  M  +  +N + E  + F  +PV          ++   
Sbjct  114  TEDQMESYEVEGQLIFEVPVMNPMVEEQCFNESVETKIEFPMMPVCFKSSDEEDEDNAES  173

Query  724  ddHMRGLEIPEFLSSDVELAEFAADVETLLG  816
               + GL       +D+ELA+F ADVETLLG
Sbjct  174  C--LNGL-----FPTDMELAQFTADVETLLG  197


 Score =   124 bits (311),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 78/115 (68%), Gaps = 8/115 (7%)
 Frame = +1

Query  1024  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH--CWPDFMGGD-----HHHHHPYGSAM  1182
             ++L L+YE V+S W  QG PWT       D +   C  D MG       HH++H  G   
Sbjct  297   LMLRLDYESVLSTWGGQGIPWTAQKPSEIDLDMVCCPTDSMGESGADQAHHYNHFRGLGF  356

Query  1183  MMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
              M  + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  357   HMGEAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  411



>gb|AFK49208.1| unknown [Medicago truncatula]
Length=197

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 76/116 (66%), Gaps = 5/116 (4%)
 Frame = +1

Query  1015  KSRMLLSLNYEEVISAWASQGCP--WTDGTRPHFD-PNHCWPDFMG--GDHHHHHPYGSA  1179
             K    L LNYEEVI+ W+ QG P  WT    P F+  +  W + +G  G           
Sbjct  70    KRERFLRLNYEEVITEWSRQGSPSPWTTANPPKFNCDDDSWQNLLGSSGVEGEVRSLRGQ  129

Query  1180  MMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  1347
             +M    D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR++ F
Sbjct  130   LMGSGGDGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTACF  185



>ref|XP_010511850.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Camelina sativa]
Length=411

 Score =   124 bits (311),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 84/211 (40%), Positives = 113/211 (54%), Gaps = 33/211 (16%)
 Frame = +1

Query  235  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  414
            +  A+A+ GKTARACDSC+ +RARW+C ADDAFLC  CD SVHSAN LA RH+RVRL T+
Sbjct  3    KSLASAVGGKTARACDSCVKRRARWYCAADDAFLCHGCDGSVHSANPLARRHERVRLKTA  62

Query  415  ssstaaasllssPKIVddddddSPP---AWHRGFTRKPRTPRNAKR-------------T  546
            S+     + +SSP         SPP    WH+GFTRK RTPR  K+             +
Sbjct  63   STGKHRHADVSSP---------SPPHQATWHQGFTRKARTPRGGKKGHTMVFHDLVPEMS  113

Query  547  KKQNSGGVAVEESVNPVLPFVPEMGSDDDYNNNNEIDL-FCQVPVlldddlnallndggg  723
             +       VE  +   +P +  M  +  +N + E  + F  +PV          ++   
Sbjct  114  TEDQMESYEVEGQLIFEVPVMNPMVEEQCFNESVETKIEFPMMPVCFKSSDEEDEDNAES  173

Query  724  ddHMRGLEIPEFLSSDVELAEFAADVETLLG  816
               + GL       +D+ELA+F ADVETLLG
Sbjct  174  C--LNGL-----FPTDMELAQFTADVETLLG  197


 Score =   110 bits (275),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 70/107 (65%), Gaps = 8/107 (7%)
 Frame = +1

Query  1024  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH--CWPDFMGGD-----HHHHHPYGSAM  1182
             ++L L+YE V+S W  QG PWT       D +   C  D MG       HH++H  G   
Sbjct  297   LMLRLDYESVLSTWGGQGIPWTAQKPSEIDLDMVCCPTDSMGESGADQAHHYNHFRGLGF  356

Query  1183  MMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKG  1320
              M  + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KG
Sbjct  357   HMGEAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKG  403



>ref|NP_001057333.2| Os06g0264200 [Oryza sativa Japonica Group]
 dbj|BAD54363.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAF19247.2| Os06g0264200 [Oryza sativa Japonica Group]
Length=481

 Score =   125 bits (313),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 96/262 (37%), Positives = 120/262 (46%), Gaps = 74/262 (28%)
 Frame = +1

Query  757   FLSSDVELAEFAADVETLLG---DDDVGEDK--------------ATAAVKIEINGGDCT  885
             F  +D EL EFAAD+E LLG   DD   ED                   VK+E +G D  
Sbjct  210   FGPTDAELREFAADMEALLGRGLDDGNDEDSFCMETLGLIEPVDDDAGRVKVEADG-DAG  268

Query  886   EALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeeVA------------KKSRML  1029
               L W    + E     M+ +   FD  S    +   ++  +            ++S + 
Sbjct  269   MTLAWCHELDTETSSGEMLDI--DFDCGSPQAATTPDEKVGSSGPAAADDDAQLQQSNLA  326

Query  1030  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWP-----------DFMGGDHHHHHPYGS  1176
             LSLNYE +I +W +   PWTDG RPH   +  WP            +       H+  G+
Sbjct  327   LSLNYEAIIESWGTS--PWTDGERPHVKLDDSWPRDYSVRATPCTPYASSHRILHNLAGT  384

Query  1177  AMMMRRS-----------------------------DEGREARVSRYREKRRTRLFSKKI  1269
               ++RR                              D GREARVSRYREKRRTRLFSKKI
Sbjct  385   DDLLRRRAAVQGVWMAAAGVFGHGGEEQALTPRLGMDGGREARVSRYREKRRTRLFSKKI  444

Query  1270  RYEVRKLNAEKRPRLKGRFVKR  1335
             RYEVRKLNAEKRPR+KGRFVKR
Sbjct  445   RYEVRKLNAEKRPRMKGRFVKR  466


 Score = 83.2 bits (204),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 55/88 (63%), Gaps = 8/88 (9%)
 Frame = +1

Query  271  RACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasllss  450
            RACD CL +RARW+C ADDAFLCQ CD SVHSAN LA RH+R+RL       ++   L  
Sbjct  19   RACDGCLRRRARWYCAADDAFLCQGCDTSVHSANPLARRHERLRL-----RPSSPPPLVP  73

Query  451  PKIVddddddSPPAWHRGFTRKPRTPRN  534
            P      D+  P AW   F RK RTPR+
Sbjct  74   PSGSGRRDEAVPAAW---FKRKARTPRS  98



>dbj|BAD15937.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAD16130.1| zinc finger protein-like [Oryza sativa Japonica Group]
Length=452

 Score =   124 bits (312),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 94/240 (39%), Positives = 124/240 (52%), Gaps = 48/240 (20%)
 Frame = +1

Query  757   FLSSDVELAEFAADVETLLGD--DDVGEDK----------------ATAAVKIEINGGDC  882
             F  +D EL EFAAD+E LLG   DD  E +                 +  VK+E++GG  
Sbjct  217   FEPTDAELREFAADMEALLGQGLDDSNELQDSFYMETLGLITPPVEESGRVKMELDGGVA  276

Query  883   TEALNW-----SFGEEQEVEQKVMMTMLSGFDessssmesgsckeeVAKKSRML-----L  1032
             + +        +  + ++VE   ++ +   F+ +S   +  S     A  S+       L
Sbjct  277   SNSRVSLPSCRAHPKPEDVESADVLDI--DFNCTSPDEQKSSASNGAAADSQFFHRSLDL  334

Query  1033  SLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSA---------MM  1185
              LNYE +I +W +   PWTDG  PH   +  WP+    DHH+   + +          MM
Sbjct  335   RLNYEAIIESWGNS--PWTDGRPPHGQLDDFWPN----DHHYSGLWAAGGGGHGAEVGMM  388

Query  1186  M---RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  1356
                 R    GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR S    P
Sbjct  389   TVRPRMDGPGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRPSAAAAP  448


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  277  CDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  405
            CDSCL +RARW+C ADDAFLCQ CD SVHSAN LA RH+R+RL
Sbjct  20   CDSCLRRRARWYCAADDAFLCQGCDTSVHSANPLARRHERLRL  62



>ref|XP_006649016.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Oryza brachyantha]
Length=331

 Score =   122 bits (306),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 74/114 (65%), Gaps = 17/114 (15%)
 Frame = +1

Query  1030  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPY------------G  1173
             L LNYEE+I +W S   PWTDG RPH    H   DF   DHH+   +             
Sbjct  212   LRLNYEEIIESWGS--SPWTDGRRPH---GHQLDDFWPNDHHYQGLWAAGGGGHGAEAGT  266

Query  1174  SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
             + M  R    GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  267   TVMRPRMDGPGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  320



>ref|XP_004138344.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Cucumis 
sativus]
Length=273

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 104/195 (53%), Gaps = 34/195 (17%)
 Frame = +1

Query  259  GKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaas  438
            G+TAR CDSCL KRARWFC ADDAFLCQSCDVSVHSAN LA RH R+RL TSS       
Sbjct  4    GRTARVCDSCLCKRARWFCAADDAFLCQSCDVSVHSANQLARRHDRIRLETSS-------  56

Query  439  llssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVPEM  618
                    +  D   P  W +GFTRK RTPR+     K +S   +       V   VPE+
Sbjct  57   -------FNSTDHLPPTPWLKGFTRKARTPRSNNNNNKISSSKAS-------VFSIVPEI  102

Query  619  GSDDDYN-----NNNEIDLFC----QVPVlldddlnallndgggddHMRGLEIPEFLSSD  771
            G+D++       N++E   F     +VPV      +  L      +         FL S+
Sbjct  103  GNDNELGFSIDENDDEHHQFLGHQQEVPVFDPLFDDQKLLLTDELEDFG----DGFLPSE  158

Query  772  VELAEFAADVETLLG  816
            V+LAEF ADVE LLG
Sbjct  159  VDLAEFVADVENLLG  173


 Score = 88.2 bits (217),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +1

Query  1195  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  1341
             S+E REARVSRYREKRRTRLFSKKIRY+VRKLNAEKRPR+KGRFVKR++
Sbjct  224   SNEEREARVSRYREKRRTRLFSKKIRYQVRKLNAEKRPRMKGRFVKRTT  272



>ref|XP_004965182.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Setaria 
italica]
Length=445

 Score =   124 bits (310),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 96/236 (41%), Positives = 118/236 (50%), Gaps = 48/236 (20%)
 Frame = +1

Query  757   FLSSDVELAEFAADVETLLGD-------------------DDVGEDKATAAVKIEINGGD  879
             F  +D EL EFAAD+E LLG                    D V +D   A VK+EI+GG 
Sbjct  206   FEPTDAELREFAADMEALLGRGLDDGNEDSSFYMETLGLLDPVDDDAGVARVKLEIDGGG  265

Query  880   CTEALNW-SFGEEQEVEQKVMMTMLSGFDessssmesgsckeeVAK----------KSRM  1026
               +A    + G + E E    M  +  FD  S                        ++ +
Sbjct  266   AFDASGTPACGVQLEAEASDEMLDID-FDYGSPQETPDDKAASSDTSAAATDAQFLQTSL  324

Query  1027  LLSLNYEEVISAWASQGCPWT-DGTRPHFDPNHCWP-DFMG------GDHHHHHPYGS--  1176
              L+LNYE +I +W S   PWT  G RPH   +  WP D+           H     G+  
Sbjct  325   SLTLNYEAIIQSWGSS--PWTGSGERPHVKLDGSWPHDYTSMWVVGGMVGHVGEELGTPR  382

Query  1177  -AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  1341
               MM    D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  383   LGMM----DGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRAT  434


 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  277  CDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  405
            CD CL +RARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL
Sbjct  24   CDGCLRRRARWYCAADDAFLCQACDTSVHSANPLARRHERVRL  66



>ref|NP_001149457.1| zinc finger protein CONSTANS-LIKE 16 [Zea mays]
 gb|ACG35514.1| zinc finger protein CONSTANS-LIKE 16 [Zea mays]
Length=456

 Score =   122 bits (307),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 93/253 (37%), Positives = 123/253 (49%), Gaps = 77/253 (30%)
 Frame = +1

Query  757   FLSSDVELAEFAADVETLLG---DD-------------------DVGEDKATAAVKIEIN  870
             F  +D EL EFAAD+E LLG   DD                   +VGED +   VK+E +
Sbjct  212   FGPTDAELREFAADMEALLGYGLDDGNEESSSFCMETLGLLEPVEVGEDASR--VKVETD  269

Query  871   GGDCTEA---------------------LNWSFGEEQEVE--QKVMMTMLSGFDessssm  981
              G   EA                     +++++G  Q+    +    +  +G D      
Sbjct  270   AGSACEASGTLACALELLDPDASDEMLDIDFNYGSPQDTTTTENAASSSHTGTDGQFL--  327

Query  982   esgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGT-RPHFDPNHCWP---------  1131
                        ++ + L+LNYE +I +W S   PWT G  RPH   +  WP         
Sbjct  328   -----------QTSLSLTLNYEAIIQSWGSS--PWTGGAERPHVKLDDSWPHDCTNMWVV  374

Query  1132  --DFMGGDHHHHHPYGSAMMMRRSDE-GREARVSRYREKRRTRLFSKKIRYEVRKLNAEK  1302
                 +G  H      G+  + +  D+ GREARVSRYREKRRTRLFSKKIRYEVRKLNAEK
Sbjct  375   GRGMVG--HGGEDLLGTPRLGQGMDDVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEK  432

Query  1303  RPRLKGRFVKRSS  1341
             RPR+KGRFVKR++
Sbjct  433   RPRMKGRFVKRAT  445


 Score = 93.6 bits (231),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 63/99 (64%), Gaps = 4/99 (4%)
 Frame = +1

Query  244  ANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtssss  423
            A A+ GK ARACD+CL +RARW+C ADDAFLCQ+CD SVHSAN LA RH+R+RL   +S 
Sbjct  13   AAAVGGKEARACDACLRRRARWYCAADDAFLCQACDTSVHSANSLARRHERLRL-RPTSP  71

Query  424  taaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAK  540
                   +      +  D+  PAW   F RK RTPR  +
Sbjct  72   LQTPPPPTPASAKRESHDEVVPAW---FKRKARTPRGGR  107



>gb|AFW87599.1| zinc finger protein CONSTANS-LIKE 16 [Zea mays]
Length=456

 Score =   122 bits (307),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 93/253 (37%), Positives = 123/253 (49%), Gaps = 77/253 (30%)
 Frame = +1

Query  757   FLSSDVELAEFAADVETLLG---DD-------------------DVGEDKATAAVKIEIN  870
             F  +D EL EFAAD+E LLG   DD                   +VGED +   VK+E +
Sbjct  212   FGPTDAELREFAADMEALLGYGLDDGNEESSSFCMETLGLLEPVEVGEDASR--VKVETD  269

Query  871   GGDCTEA---------------------LNWSFGEEQEVE--QKVMMTMLSGFDessssm  981
              G   EA                     +++++G  Q+    +    +  +G D      
Sbjct  270   AGSACEASGTLACALELLDPDASDEMLDIDFNYGSPQDTTTTENAASSSHTGTDGQFL--  327

Query  982   esgsckeeVAKKSRMLLSLNYEEVISAWASQGCPWTDGT-RPHFDPNHCWP---------  1131
                        ++ + L+LNYE +I +W S   PWT G  RPH   +  WP         
Sbjct  328   -----------QTSLSLTLNYEAIIQSWGSS--PWTGGAERPHVKLDDSWPHDCTNMWVV  374

Query  1132  --DFMGGDHHHHHPYGSAMMMRRSDE-GREARVSRYREKRRTRLFSKKIRYEVRKLNAEK  1302
                 +G  H      G+  + +  D+ GREARVSRYREKRRTRLFSKKIRYEVRKLNAEK
Sbjct  375   GRGMVG--HGGEDLLGTPRLGQGMDDVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEK  432

Query  1303  RPRLKGRFVKRSS  1341
             RPR+KGRFVKR++
Sbjct  433   RPRMKGRFVKRAT  445


 Score = 92.4 bits (228),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 62/99 (63%), Gaps = 4/99 (4%)
 Frame = +1

Query  244  ANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtssss  423
            A A+ GK ARACD+CL +RARW+C ADDAFLCQ CD SVHSAN LA RH+R+RL   +S 
Sbjct  13   AAAVGGKEARACDACLRRRARWYCAADDAFLCQVCDTSVHSANSLARRHERLRL-RPTSP  71

Query  424  taaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAK  540
                   +      +  D+  PAW   F RK RTPR  +
Sbjct  72   LQTPPPPTPASANRESHDEVVPAW---FKRKARTPRGGR  107



>ref|XP_004953821.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X2 [Setaria italica]
Length=441

 Score =   121 bits (304),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 91/218 (42%), Positives = 113/218 (52%), Gaps = 33/218 (15%)
 Frame = +1

Query  757   FLSSDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKV  936
             F  +D EL EFAAD+E LLG      ++   +  +E  G   T   +     + E +  V
Sbjct  214   FGPTDAELREFAADMEALLGQGLDDGNQLDESFYMESLGLMTTPTEDGGRVLKMEPDSIV  273

Query  937   M----MTML----SGFDessssmesgsckeeVAKKSRML-----LSLNYEEVISAWASQG  1077
             +    M  L    +      S+ ++ +    VA  ++ L     L LNYE VI +W S  
Sbjct  274   VSHGDMGALGRSPAEVKPEESAEKASAASNGVAADAQFLKRSLDLRLNYEAVIESWGSS-  332

Query  1078  CPWTDGTRPHFDPNHCWPDFMGGDHHHHHPY----------GSAMMMR--RSDEGREARV  1221
              PWTDG RP    +  WP      HH HH            G A+  R      GREARV
Sbjct  333   -PWTDGQRPDVQLDDFWP------HHAHHSGVWMAGGGRLGGEALTPRLGMGGGGREARV  385

Query  1222  SRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
             SRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  386   SRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  423


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  277  CDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  405
            CDSCL +RARW+C ADDAFLCQ CD SVHSAN LA RH+R+RL
Sbjct  21   CDSCLRRRARWYCAADDAFLCQGCDASVHSANPLARRHERLRL  63



>ref|XP_002436824.1| hypothetical protein SORBIDRAFT_10g009480 [Sorghum bicolor]
 gb|EER88191.1| hypothetical protein SORBIDRAFT_10g009480 [Sorghum bicolor]
Length=474

 Score =   122 bits (305),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 94/235 (40%), Positives = 118/235 (50%), Gaps = 42/235 (18%)
 Frame = +1

Query  757   FLSSDVELAEFAADVETLLG---DDDVGEDKA-----------------TAAVKIEINGG  876
             F  +D EL EFAAD+E LLG   DD   ED +                    VK+E +GG
Sbjct  230   FEPTDAELREFAADMEALLGHGLDDGNEEDSSFYMETLGLLDPVEVGDDATRVKVETDGG  289

Query  877   DC------TEALNWSFGEEQEVEQKVM---MTMLSGFDessssmesgsckeeVAKKSRML  1029
                     T A      +  EV  +++       S  D      ++ S     A  ++ L
Sbjct  290   SACGEASGTLACALELLDPAEVSDEMLDIDFNYGSPLDTMMDDEKAASSDTGGADDAQFL  349

Query  1030  -----LSLNYEEVISAWASQGCPWT-DGTRPHFDPNHCWPDF-MGGDHHHHHPYGSAMMM  1188
                  L+LNYE +I +W S   PWT  G RPH   +  WP   M          G  +++
Sbjct  350   QTSLSLTLNYEAIIQSWGSS--PWTAGGERPHVKLDDSWPHTNMWVVGGVAGHGGEDLLL  407

Query  1189  RRS----DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  1341
               +    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  408   GTARLGMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAT  462


 Score = 85.5 bits (210),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 72/127 (57%), Gaps = 16/127 (13%)
 Frame = +1

Query  271  RACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasllss  450
            RACD CL +RARW+C ADDAFLCQ CD SVHSAN LA RH+R+RL    ++ +++ L + 
Sbjct  23   RACDGCLRRRARWYCAADDAFLCQGCDTSVHSANPLARRHERLRL--QPAAASSSPLHTP  80

Query  451  PKIVddddddSP------PAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEES--VNPVLPF  606
            P+     ++         PAW   F RK RTPR       ++ GG A+  S  +  V+P 
Sbjct  81   PRTGAAANNKRERHDEVVPAW---FRRKARTPRGG---HAKSVGGQALSRSRRLGVVVPH  134

Query  607  VPEMGSD  627
                G D
Sbjct  135  AAAGGGD  141



>ref|XP_004953820.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X1 [Setaria italica]
Length=465

 Score =   120 bits (301),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 94/243 (39%), Positives = 116/243 (48%), Gaps = 59/243 (24%)
 Frame = +1

Query  757   FLSSDVELAEFAADVETLLGD------------------------DDVGEDKATAAVKIE  864
             F  +D EL EFAAD+E LLG                         +D G         I 
Sbjct  214   FGPTDAELREFAADMEALLGQGLDDGNQLDESFYMESLGLMTTPTEDGGRVLKMEPDSIV  273

Query  865   INGGDCTEALNWSFGEEQEVEQKVMM---------TMLSGFDessssmesgsckeeVAKK  1017
             ++ GD   AL  S  E +  E   ++         T++   ++     ++ +    VA  
Sbjct  274   VSHGD-MGALGRSPAEVKPEESAEVLDIDFNCSSPTVIDNDEDYCFEQKASAASNGVAAD  332

Query  1018  SRML-----LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPY----  1170
             ++ L     L LNYE VI +W S   PWTDG RP    +  WP      HH HH      
Sbjct  333   AQFLKRSLDLRLNYEAVIESWGSS--PWTDGQRPDVQLDDFWP------HHAHHSGVWMA  384

Query  1171  ------GSAMMMR--RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  1326
                   G A+  R      GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRF
Sbjct  385   GGGRLGGEALTPRLGMGGGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRF  444

Query  1327  VKR  1335
             VKR
Sbjct  445   VKR  447


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  277  CDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  405
            CDSCL +RARW+C ADDAFLCQ CD SVHSAN LA RH+R+RL
Sbjct  21   CDSCLRRRARWYCAADDAFLCQGCDASVHSANPLARRHERLRL  63



>ref|XP_004953822.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X3 [Setaria italica]
Length=440

 Score =   120 bits (300),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 91/218 (42%), Positives = 116/218 (53%), Gaps = 34/218 (16%)
 Frame = +1

Query  757   FLSSDVELAEFAADVETLLG---DDDVGEDKATAAVKIEI------NGGDCT----EALN  897
             F  +D EL EFAAD+E LLG   DD    D++     + +      +GG       +++ 
Sbjct  214   FGPTDAELREFAADMEALLGQGLDDGNQLDESFYMESLGLMTTPTEDGGRVLKMEPDSIV  273

Query  898   WSFGEEQEVEQKVMMTMLSGFDessssmesgsckeeVAKKSRMLLSLNYEEVISAWASQG  1077
              S G+   + +           E+S++    +   +  K+S + L LNYE VI +W S  
Sbjct  274   VSHGDMGALGRSPAEVKPEESAEASAASNGVAADAQFLKRS-LDLRLNYEAVIESWGSS-  331

Query  1078  CPWTDGTRPHFDPNHCWPDFMGGDHHHHHPY----------GSAMMMR--RSDEGREARV  1221
              PWTDG RP    +  WP      HH HH            G A+  R      GREARV
Sbjct  332   -PWTDGQRPDVQLDDFWP------HHAHHSGVWMAGGGRLGGEALTPRLGMGGGGREARV  384

Query  1222  SRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
             SRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  385   SRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  422


 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  277  CDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  405
            CDSCL +RARW+C ADDAFLCQ CD SVHSAN LA RH+R+RL
Sbjct  21   CDSCLRRRARWYCAADDAFLCQGCDASVHSANPLARRHERLRL  63



>gb|AFX97569.1| K, partial [Hordeum vulgare subsp. vulgare]
Length=182

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 77/116 (66%), Gaps = 13/116 (11%)
 Frame = +1

Query  1015  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYG-------  1173
             K  + L LNYE VI++WAS   PWTDG RP   P     D +  DH      G       
Sbjct  64    KRSLDLRLNYEAVIASWAS--SPWTDGRRP---PGQQLDDLLLNDHAGMWTAGGGGRQGE  118

Query  1174  SAMMMR-RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  1338
             +A   R R+D  REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  119   AAWPARPRTDGWREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRT  174



>gb|AFX97570.1| K, partial [Hordeum vulgare subsp. vulgare]
Length=182

 Score =   112 bits (280),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 76/117 (65%), Gaps = 13/117 (11%)
 Frame = +1

Query  1015  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYG-------  1173
             K  + L LNYE VI +WAS   PWTDG RP   P     D +  DH      G       
Sbjct  64    KRSLDLRLNYEAVIESWASS--PWTDGRRP---PGQQLDDLLLNDHAGMWTAGGGGRQGE  118

Query  1174  SAMMMR-RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  1341
             +A   R R+D  REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+ 
Sbjct  119   AAWPARPRTDGWREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTG  175



>ref|XP_003573014.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brachypodium 
distachyon]
 ref|XP_010236028.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brachypodium 
distachyon]
Length=448

 Score =   115 bits (289),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 92/242 (38%), Positives = 117/242 (48%), Gaps = 55/242 (23%)
 Frame = +1

Query  745   EIPE----FLSSDVELAEFAADVETLLGDDDV-------------------------GED  837
             E+P+    F  +D EL EFAAD+E LLG  D                          G+ 
Sbjct  218   ELPDCFASFGPTDAELREFAADMEALLGGQDALGGNEQLMAEDSFYMEALGLVSPLSGDH  277

Query  838   KATAA---VKIEINGGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeeV  1008
             K   A   VK+E +GG             +     ++      F+  +++   G   +  
Sbjct  278   KGVDAGRPVKVETDGG-----------ARRSSPPTLVDDDDGSFEHKAATASYGEAADAG  326

Query  1009  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPY-----G  1173
               K  + L LNYE VI  W S   PWTDG RPH        D +  DH++   +     G
Sbjct  327   FLKRSLDLRLNYEAVIEGWGSS--PWTDGRRPH---GGQLDDLLLHDHYYSGMWTAAAGG  381

Query  1174  SAMMMRRSDEG--REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  1347
                    +D+G  REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR +  
Sbjct  382   GRAARPAADDGGWREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRPAGA  441

Query  1348  QP  1353
              P
Sbjct  442   AP  443


 Score = 82.4 bits (202),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  271  RACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  405
            RACD C+ +RARW+C ADDAFLCQSCD SVHSAN LA RH+R+RL
Sbjct  24   RACDGCMRRRARWYCAADDAFLCQSCDTSVHSANPLARRHERLRL  68



>ref|XP_004155029.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Cucumis 
sativus]
Length=202

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 96/186 (52%), Gaps = 34/186 (18%)
 Frame = +1

Query  259  GKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaas  438
            G+TAR CDSCL KRARWFC ADDAFLCQSCDVSVHSAN LA RH R+RL TSS       
Sbjct  4    GRTARVCDSCLCKRARWFCAADDAFLCQSCDVSVHSANQLARRHDRIRLETSS-------  56

Query  439  llssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVPEM  618
                    +  D   P  W +GFTRK RTPR+     K +S   +++E+ +    F+   
Sbjct  57   -------FNSTDHLPPTPWLKGFTRKARTPRSNNNNNKISS-RFSIDENDDEHHQFLGHQ  108

Query  619  GSDDDYNNNNEIDLFCQVPVlldddlnallndgggddHMRGLEIPEFLSSDVELAEFAAD  798
                            +VPV      +  L      +         FL S+V+LAEF AD
Sbjct  109  Q---------------EVPVFDPLFDDQKLLLTDELEDFGD----GFLPSEVDLAEFVAD  149

Query  799  VETLLG  816
            VE LLG
Sbjct  150  VENLLG  155



>gb|ACF84125.1| unknown [Zea mays]
Length=226

 Score =   110 bits (276),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 77/122 (63%), Gaps = 21/122 (17%)
 Frame = +1

Query  1015  KSRMLLSLNYEEVISAWASQGCPWTDG-TRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  1191
             ++ + L+LNYE +I +W S   PWT G  RPH   +  WP      H + + +    ++ 
Sbjct  102   QTSLSLTLNYEAIIQSWGSS--PWTGGGERPHVKLDTRWP------HDYTNMWVVGGVVG  153

Query  1192  RS------------DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
                           D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  154   HGGEDLPGTPRLGMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  213

Query  1336  SS  1341
             ++
Sbjct  214   AT  215



>gb|ACL53155.1| unknown [Zea mays]
Length=157

 Score =   108 bits (271),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 77/122 (63%), Gaps = 21/122 (17%)
 Frame = +1

Query  1015  KSRMLLSLNYEEVISAWASQGCPWTDGT-RPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  1191
             ++ + L+LNYE +I +W S   PWT G  RPH   +  WP      H + + +    ++ 
Sbjct  33    QTSLSLTLNYEAIIQSWGS--SPWTGGGERPHVKLDTRWP------HDYTNMWVVGGVVG  84

Query  1192  RS------------DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
                           D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  85    HGGEDLPGTPRLGMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  144

Query  1336  SS  1341
             ++
Sbjct  145   AT  146



>ref|XP_002452605.1| hypothetical protein SORBIDRAFT_04g028920 [Sorghum bicolor]
 gb|EES05581.1| hypothetical protein SORBIDRAFT_04g028920 [Sorghum bicolor]
Length=488

 Score =   114 bits (286),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 93/245 (38%), Positives = 116/245 (47%), Gaps = 54/245 (22%)
 Frame = +1

Query  757   FLSSDVELAEFAADVETLLGD--------------DDVG--------EDKATAAVKIEIN  870
             F  +D EL EFAAD+E LLG               + +G        ED     VK+E N
Sbjct  228   FGPTDAELREFAADMEALLGQGLGDSNELDESFYMESLGLMTTTQQAEDVDVGRVKMEPN  287

Query  871   GGDCTEALNWS---FG-------EEQEVEQKVM---------MTMLSGFDessssmesgs  993
             G   + +       FG       E    E  V+           M+   DE S   ++ +
Sbjct  288   GSVISRSRGEGAPGFGPAELMKPEASSAEVLVLDIDFNCSSPTVMMDHEDEDSFEHKASA  347

Query  994   ckeeVAK------KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWP-----DFM  1140
                + A       K  + LSLNYE +I +W S   PWTDG RP+   +  WP      +M
Sbjct  348   SNGDAAAAGTQFLKRSLDLSLNYEAIIESWGSS--PWTDGQRPNVQLDDFWPHAHLTGWM  405

Query  1141  GGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKG  1320
              G         +         GREARV+RYREKRRTRLF+KKIRYEVRKLNAEKRPR+KG
Sbjct  406   AGGGRLGGEAAAVSPRLGMVGGREARVTRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKG  465

Query  1321  RFVKR  1335
             RFVKR
Sbjct  466   RFVKR  470


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  277  CDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  405
            CDSCL +RARW+C ADDAFLCQ CD SVHSAN LA RH+R+RL
Sbjct  22   CDSCLRRRARWYCAADDAFLCQGCDASVHSANPLARRHERLRL  64



>ref|XP_008646195.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Zea mays]
 gb|AFW73247.1| hypothetical protein ZEAMMB73_807545 [Zea mays]
 gb|AIB05540.1| C2C2-CO-like transcription factor, partial [Zea mays]
Length=496

 Score =   113 bits (282),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 74/114 (65%), Gaps = 12/114 (11%)
 Frame = +1

Query  1015  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWP-----DFMGGDHHHHHPYGSA  1179
             K  + LSLNYE +I +W S   PWTDG RP    +  WP      +M G        G A
Sbjct  334   KRSLDLSLNYEAIIESWGSS--PWTDGQRPSVQLDDFWPHAHLTGWMAGGGRLG---GEA  388

Query  1180  MMMRR--SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
              +  R     GREARV+RYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  389   AVTPRLGMGGGREARVTRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  442


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  277  CDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  405
            CDSCL +RARW+C ADDAFLCQ CD SVHSAN LA RH+R+RL
Sbjct  19   CDSCLRRRARWYCAADDAFLCQGCDASVHSANPLARRHERLRL  61



>gb|EMT01944.1| hypothetical protein F775_21198 [Aegilops tauschii]
Length=340

 Score =   110 bits (274),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 93/237 (39%), Positives = 121/237 (51%), Gaps = 46/237 (19%)
 Frame = +1

Query  745   EIPEFLSS----DVELAEFAADVETLLGD--DDVGEDKAT----------------AAVK  858
             E+P+  +S    D +L EFAAD+E LLG   DD  E + +                  VK
Sbjct  99    ELPDCFASFGPTDADLREFAADMEALLGQGLDDGNEMEDSFYMEALGLISPPGEHDGRVK  158

Query  859   IEINGGDCTEALNWSFGEEQEVEQKVMM---TMLSGFDessssmesgsckeeVAK----K  1017
             +E +GG  + + N       +++++      T++   D       S S  + V      K
Sbjct  159   VEADGGLVSRS-NGVLASGHDLKREFSGSPPTLVDDDDSFEHKTSSASNGDAVDDAQFLK  217

Query  1018  SRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR--  1191
               + L LNYE V+ +W S   PWTDG RP   P     D +  DH      G     R  
Sbjct  218   RSLDLRLNYEAVMESWGSS--PWTDGRRP---PGQL-DDLLLHDHAGMWTAGGGGGGRHG  271

Query  1192  --------RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  1338
                     R+DE REARVSRYR+KRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  272   EAAWPPRPRTDEWREARVSRYRKKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRT  328



>ref|XP_002961709.1| hypothetical protein SELMODRAFT_438000 [Selaginella moellendorffii]
 gb|EFJ36969.1| hypothetical protein SELMODRAFT_438000 [Selaginella moellendorffii]
Length=448

 Score =   108 bits (270),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 79/125 (63%), Gaps = 19/125 (15%)
 Frame = +1

Query  1021  RMLLSLNYEEVISAWASQGCPWTDGTRPH-------FDPNHCW-----PDFMGGDHHHHH  1164
             ++ L L+YE+V++AW+ +G  WT+G RP        FDP         PDF   +     
Sbjct  320   KITLKLDYEDVLNAWSDRGPFWTEGPRPQTVPDDSLFDPASTLDYGLVPDFCM-ESTEVE  378

Query  1165  PYGSAMMMRRSDE------GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  1326
               G   ++   ++      GREARV RYREKRRTRLFSKKIRYEVRKLNAE+RPRLKGRF
Sbjct  379   AVGQVPVVNFGEDRLTPQGGREARVMRYREKRRTRLFSKKIRYEVRKLNAERRPRLKGRF  438

Query  1327  VKRSS  1341
             VKR++
Sbjct  439   VKRTN  443


 Score = 75.5 bits (184),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +1

Query  241  TANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLG  408
            TA AI+G+  R CD C  +RA+WFC AD+A+LC++CD SVH AN ++ RH+R R+G
Sbjct  17   TAMAIAGRALRPCDVCGRERAKWFCKADEAYLCENCDGSVHGANAVSLRHERFRMG  72



>ref|XP_002964778.1| hypothetical protein SELMODRAFT_266834 [Selaginella moellendorffii]
 gb|EFJ33616.1| hypothetical protein SELMODRAFT_266834 [Selaginella moellendorffii]
Length=448

 Score =   108 bits (270),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 79/125 (63%), Gaps = 19/125 (15%)
 Frame = +1

Query  1021  RMLLSLNYEEVISAWASQGCPWTDGTRPH-------FDPNHCW-----PDFMGGDHHHHH  1164
             ++ L L+YE+V++AW+ +G  WT+G RP        FDP         PDF   +     
Sbjct  320   KITLKLDYEDVLNAWSDRGPFWTEGPRPQTVPDDSLFDPASTLDYGLVPDFCM-ESTEVE  378

Query  1165  PYGSAMMMRRSDE------GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  1326
               G   ++   ++      GREARV RYREKRRTRLFSKKIRYEVRKLNAE+RPRLKGRF
Sbjct  379   AVGQVPVVNFGEDRLTPRGGREARVMRYREKRRTRLFSKKIRYEVRKLNAERRPRLKGRF  438

Query  1327  VKRSS  1341
             VKR++
Sbjct  439   VKRTN  443


 Score = 75.9 bits (185),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +1

Query  241  TANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLG  408
            TA AI+G+  R CD C  +RA+WFC AD+A+LC++CD SVH AN ++ RH+R R+G
Sbjct  17   TAMAIAGRALRPCDVCGRERAKWFCKADEAYLCENCDGSVHGANAVSLRHERFRMG  72



>ref|XP_001771896.1| predicted protein [Physcomitrella patens]
 gb|EDQ63325.1| predicted protein [Physcomitrella patens]
Length=475

 Score =   108 bits (269),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 72/108 (67%), Gaps = 5/108 (5%)
 Frame = +1

Query  1027  LLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGD----HHHHHPYGSAMMMRR  1194
             LL LN+++V+SAW+ +   WTDG RP   P+       G D       +  Y     +  
Sbjct  365   LLRLNFDDVLSAWSDRSL-WTDGRRPQTVPDDSSEAVGGTDVGLVPDINTQYAQGATLAA  423

Query  1195  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  1338
              D+GRE RV RY+EKRRTRLFSKKIRYEVRKLNAE+RPR+KGRFVK++
Sbjct  424   GDKGREFRVMRYKEKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVKQT  471


 Score = 73.9 bits (180),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  241  TANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  405
            TA AI+G+ +RACD C   RARW+C  D+A LC+ CD +VHSAN LA  H+RVRL
Sbjct  17   TAMAIAGRDSRACDVCGLHRARWYCSVDNAHLCRRCDQNVHSANALALHHERVRL  71



>ref|XP_001769011.1| predicted protein [Physcomitrella patens]
 gb|EDQ66209.1| predicted protein [Physcomitrella patens]
Length=495

 Score =   107 bits (268),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 72/116 (62%), Gaps = 19/116 (16%)
 Frame = +1

Query  1027  LLSLNYEEVISAWASQGCPWTDGTRPHFDPNHC-----------WPDFMGGDHHHHHPYG  1173
             LL LN+++V+SAW+ +   WTDG RP   P+              PD   G        G
Sbjct  385   LLRLNFDDVLSAWSDRSL-WTDGKRPQTVPDDSSEAVGGLDLGLVPDLSKGCAQGQPGTG  443

Query  1174  SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  1341
                     D GREARV RYREKRRTRLFSKKIRYEVRKLNAE+RPR+KGRFVKR++
Sbjct  444   G-------DRGREARVLRYREKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVKRTT  492


 Score = 82.0 bits (201),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  241  TANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  405
            TA AI+G+ +RACD C S+RARW+C AD+A+LC  CD +VHSAN LA RH+RVRL
Sbjct  16   TAMAIAGRASRACDVCGSQRARWYCNADNAYLCYRCDQNVHSANALALRHERVRL  70



>ref|XP_008665284.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Zea mays]
 tpg|DAA50967.1| TPA: hypothetical protein ZEAMMB73_914054 [Zea mays]
 gb|AIB05335.1| C2C2-CO-like transcription factor, partial [Zea mays]
Length=454

 Score =   105 bits (261),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 89/219 (41%), Positives = 119/219 (54%), Gaps = 24/219 (11%)
 Frame = +1

Query  733   MRGLEIPEFLSSDVELAEFAADVETLL-GDDDVGEDKA-TAAVKIEINGGDCTEALNWSF  906
             + G ++P     D++LA FAAD+E+LL G DD  +D       K ++N     EA+    
Sbjct  201   LSGFDVP-----DMDLASFAADMESLLMGVDDGFDDLGFLDEQKPQVNADVDLEAMAAPE  255

Query  907   GEEQEVEQKVMMTMLSGF------------DessssmesgsckeeVAKKSRMLLSLNYEE  1050
              E ++ ++K       GF            D  +        +++  K++ M+L LNYE 
Sbjct  256   PEREDKKRKRDGFDYLGFLDEEKPQVNADVDLEAMVAPEPEREDKKRKRTDMILKLNYEG  315

Query  1051  VISAWASQG-CPWTDGTRPHFD-PNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGREARVS  1224
             VI++W   G  PW  G RPH D P   W +F          +G  M      E REARVS
Sbjct  316   VIASWVRDGGSPWYHGERPHLDDPYELWLEFPATGSRGL--FGGTMTAVTGGE-REARVS  372

Query  1225  RYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  1341
             RYREKRR RLF+KKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  373   RYREKRRRRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTT  411


 Score = 92.0 bits (227),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 55/93 (59%), Gaps = 17/93 (18%)
 Frame = +1

Query  262  KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasl  441
            +TAR+CDSC+ +RARW C AD+AFLCQSCDVSVHSAN LA RH RVRL            
Sbjct  15   RTARSCDSCMRRRARWHCPADNAFLCQSCDVSVHSANPLARRHHRVRL------------  62

Query  442  lssPKIVddddddSP--PAWHRGFTRKPRTPRN  534
               P          P  P W  G  R+PRTPR+
Sbjct  63   ---PSASCSSPPRDPDAPTWLHGLKRRPRTPRS  92



>ref|XP_008354841.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X2 
[Malus domestica]
Length=234

 Score = 99.4 bits (246),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 70/108 (65%), Gaps = 12/108 (11%)
 Frame = +1

Query  1012  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  1191
             KK ++ L+LNY+EV+ AW+ +G  W D          C    M  + ++    G   +M 
Sbjct  138   KKVQLNLNLNYQEVMDAWSDRGTLWADD---------CSLSSMASNGNY---IGEVPVME  185

Query  1192  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
                  REARV RY+EKR++RLFSKKIRY+VRKLNA+KRPRLKGRFVKR
Sbjct  186   EEKARREARVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRLKGRFVKR  233



>ref|XP_007206389.1| hypothetical protein PRUPE_ppa018053mg [Prunus persica]
 gb|EMJ07588.1| hypothetical protein PRUPE_ppa018053mg [Prunus persica]
Length=241

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 90/165 (55%), Gaps = 29/165 (18%)
 Frame = +1

Query  892   LNWSF--------GEE-QEVEQKVMMTM-LSGFDessssmesgsckeeVA-------KKS  1020
             LNW F        GEE +E+EQKV  T     F++ S         E VA       K+ 
Sbjct  86    LNWDFMDWDEFPKGEEGEEIEQKVFQTADRCFFEDESYYERKVVKSESVAFWDEDDEKRV  145

Query  1021  RMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSD  1200
              + L+LNY+EV+ AW+ +G  W D          C    M  + ++    G   +M    
Sbjct  146   HLNLNLNYQEVLDAWSDRGPLWADD---------CSRSSMASNGNY---MGEVPIMEEDR  193

Query  1201  EGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
               REA V RYREKR++RLFSKKIRY+VRKLNA+KRPRLKGRFVKR
Sbjct  194   TRREASVLRYREKRQSRLFSKKIRYQVRKLNADKRPRLKGRFVKR  238



>emb|CBI15893.3| unnamed protein product [Vitis vinifera]
Length=101

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 63/102 (62%), Gaps = 14/102 (14%)
 Frame = +1

Query  1030  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGR  1209
             L+LNY+EV+ AW+ +G  W D          C   F    +    P     +M      R
Sbjct  6     LNLNYQEVLEAWSDRGSLWAD---------DCSLSFKNTSYMGEVP-----VMEEEKTRR  51

Query  1210  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
             EA V RY+EKR+TRLFSKKIRY+VRKLNA+KRPRLKGRFVKR
Sbjct  52    EASVLRYKEKRQTRLFSKKIRYQVRKLNADKRPRLKGRFVKR  93



>ref|XP_009354295.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X2 
[Pyrus x bretschneideri]
 ref|XP_009341688.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X2 
[Pyrus x bretschneideri]
Length=234

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 69/108 (64%), Gaps = 12/108 (11%)
 Frame = +1

Query  1012  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  1191
             KK R+ L+LNY+EV+ AW+ +G  W D          C    M  + ++    G   +M 
Sbjct  138   KKVRLNLNLNYQEVMDAWSDRGTLWADD---------CSLSSMASNGNY---IGEVPVME  185

Query  1192  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
                  REARV RY+EKR++RLFSKKIRY+VRKLNA+KRPR KGRFVKR
Sbjct  186   DEKARREARVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRFKGRFVKR  233



>ref|XP_008233500.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Prunus mume]
Length=241

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 78/208 (38%), Positives = 107/208 (51%), Gaps = 35/208 (17%)
 Frame = +1

Query  763   SSDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSF--------GEE-  915
             + D  + +   D E +LG   + E++        + GG     LNW F        GEE 
Sbjct  49    NGDDHVVDIMDDWERILG---IEEEEDGKLPSENMYGG---HKLNWDFMDWDEFPKGEEG  102

Query  916   QEVEQKVMMTMLSGF--DessssmesgsckeeV------AKKSRMLLSLNYEEVISAWAS  1071
             +E+EQKV  T    F  DES    +    +  V       K+ ++ L+LNY+EV+ AW+ 
Sbjct  103   EEIEQKVFQTADRCFFEDESYYERKVVKSESVVFWDEDDEKRVQLNLNLNYQEVLDAWSD  162

Query  1072  QGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTR  1251
             +G  W D          C    M  + ++    G   +M      REA V RYREKR++R
Sbjct  163   RGPLWAD---------DCSRSSMASNGNY---MGEVPIMEEERTRREASVLRYREKRQSR  210

Query  1252  LFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
             LFSKKIRY+VRKLNA+KRPRLKGRFV+R
Sbjct  211   LFSKKIRYQVRKLNADKRPRLKGRFVRR  238



>ref|XP_010685899.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Beta vulgaris 
subsp. vulgaris]
Length=231

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 67/109 (61%), Gaps = 12/109 (11%)
 Frame = +1

Query  1015  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRR  1194
             K+ + L+LNYEEV+ AW+++G  W     P           M  +H+     G    +  
Sbjct  126   KTSLNLNLNYEEVLEAWSNRGSLWAHNHHPSLS--------MSSNHY----MGEVPNLEE  173

Query  1195  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  1341
                 RE  V RY+EKRR+RLFSKKIRYEVRKLNA+KRPRLKGRFVKR S
Sbjct  174   ERTRRETSVLRYKEKRRSRLFSKKIRYEVRKLNADKRPRLKGRFVKRIS  222



>gb|AGI62031.1| CONSTANS-like 7 [Erycina pusilla]
Length=314

 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  220  MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  399
            +S   R  ANA+ G TARACD CL KRARW+C ADDAFLCQSCD SVHSAN LA RHQR+
Sbjct  4    LSRKHRSAANAVGGSTARACDGCLRKRARWYCGADDAFLCQSCDSSVHSANPLARRHQRL  63

Query  400  RL  405
            RL
Sbjct  64   RL  65


 Score = 92.4 bits (228),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 67/113 (59%), Gaps = 19/113 (17%)
 Frame = +1

Query  1021  RMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFM-----GGDHHHHHPYGSAMM  1185
             +M L L+Y+ VI AW   G           D N   P         G       +G+   
Sbjct  205   KMGLRLDYDAVIDAWTRIGA--------QIDSNGSLPSSGMAMSDSGTKWSRGKWGA---  253

Query  1186  MRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
                + E REARV+RYREKRRTRLFSKKIRY+VRKLNAEKRPR+KGRFVKR++L
Sbjct  254   ---NGEEREARVTRYREKRRTRLFSKKIRYQVRKLNAEKRPRMKGRFVKRTTL  303



>gb|EPS70096.1| hypothetical protein M569_04666, partial [Genlisea aurea]
Length=81

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 64/105 (61%), Gaps = 24/105 (23%)
 Frame = +1

Query  217  MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  396
            M+SS   + ANA++G+TARACD C+  RARW+C ADDAFLCQSCD +VHS++    RH R
Sbjct  1    MVSS---RAANAVAGRTARACDYCVKTRARWYCAADDAFLCQSCDSTVHSSS-AKRRHHR  56

Query  397  VRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPR  531
            VRL T+S                       P W  GFTRKPRTPR
Sbjct  57   VRLKTTSVLV--------------------PKWESGFTRKPRTPR  81



>ref|XP_004294775.1| PREDICTED: uncharacterized protein LOC101310098 [Fragaria vesca 
subsp. vesca]
Length=236

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 69/110 (63%), Gaps = 9/110 (8%)
 Frame = +1

Query  1012  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  1191
             KK ++ L+LNY+EV+ AW+ +G  W +    H        ++MG            +M  
Sbjct  136   KKVQLNLNLNYQEVLDAWSDRGSLWAEDCSSHSSMAASNGNYMGE---------VPVMEE  186

Query  1192  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  1341
                  REA V RYREKR++RLFSKKIRY+VRKLNA+KRPRLKGRFVKR S
Sbjct  187   EKSIRREASVLRYREKRQSRLFSKKIRYQVRKLNADKRPRLKGRFVKRVS  236



>ref|XP_006488582.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Citrus sinensis]
Length=246

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 70/109 (64%), Gaps = 12/109 (11%)
 Frame = +1

Query  1009  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMM  1188
             A   ++ L+LNY++V+ AW+ +G  WTD       P+H +  +MG             +M
Sbjct  149   ASSLKLNLNLNYQQVLDAWSDRGPLWTDDFSLSSVPSHSY--YMG----------EVPVM  196

Query  1189  RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
                   REA V RYREKR++RLFSK+IRY+VRKLNA+KRPRLKGRFVKR
Sbjct  197   EEDKTRREASVLRYREKRQSRLFSKRIRYQVRKLNADKRPRLKGRFVKR  245



>gb|KDP45740.1| hypothetical protein JCGZ_17347 [Jatropha curcas]
Length=238

 Score = 96.7 bits (239),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 65/104 (63%), Gaps = 12/104 (12%)
 Frame = +1

Query  1030  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGR  1209
             L+LNY+EV+ AW+ +G  W          N C       + ++    G   +M      R
Sbjct  147   LNLNYQEVLDAWSDRGSLWA---------NDCSASMATSNTYYM---GEVPVMEEEKTRR  194

Query  1210  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  1341
             EA V RY+EKR+TRLFSKKIRY+VRKLNA+KRPRLKGRFVKR S
Sbjct  195   EASVMRYKEKRQTRLFSKKIRYQVRKLNADKRPRLKGRFVKRVS  238



>ref|XP_006425148.1| hypothetical protein CICLE_v10029146mg [Citrus clementina]
 gb|ESR38388.1| hypothetical protein CICLE_v10029146mg [Citrus clementina]
 gb|KDO67018.1| hypothetical protein CISIN_1g025320mg [Citrus sinensis]
Length=244

 Score = 97.1 bits (240),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 70/108 (65%), Gaps = 12/108 (11%)
 Frame = +1

Query  1012  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  1191
             + S + L+LNY++V+ AW+ +G  WTD       P+H +  +MG             +M 
Sbjct  148   RASSLNLNLNYQQVLDAWSDRGPLWTDDFSLSSVPSHGY--YMG----------EVPVME  195

Query  1192  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
                  REA V RYREKR++RLFSK+IRY+VRKLNA+KRPRLKGRFVKR
Sbjct  196   EDKTRREASVLRYREKRQSRLFSKRIRYQVRKLNADKRPRLKGRFVKR  243



>ref|XP_008384739.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Malus 
domestica]
Length=234

 Score = 96.3 bits (238),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 69/108 (64%), Gaps = 12/108 (11%)
 Frame = +1

Query  1012  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  1191
             KK ++ L+LNY+EV+ AW+ +G  W D          C    M  + ++    G   +M 
Sbjct  138   KKVQLNLNLNYQEVLDAWSDRGSLWADD---------CSLSSMASNGNYM---GEVPVME  185

Query  1192  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
                  REA V RY+EKR++RLFSKKIRY+VRKLNA+KRPRLKGRFVKR
Sbjct  186   EDKTRREASVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRLKGRFVKR  233



>ref|XP_009369559.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2 [Pyrus x bretschneideri]
Length=234

 Score = 96.3 bits (238),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 69/108 (64%), Gaps = 12/108 (11%)
 Frame = +1

Query  1012  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  1191
             KK ++ L+LNY+EV+ AW+ +G  W D          C    M  + ++    G   +M 
Sbjct  138   KKVQLNLNLNYQEVLDAWSDRGSLWADD---------CSLSSMASNGNYM---GEVPVME  185

Query  1192  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
                  REA V RY+EKR++RLFSKKIRY+VRKLNA+KRPRLKGRFVKR
Sbjct  186   EDKTRREASVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRLKGRFVKR  233



>ref|XP_011003377.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Populus euphratica]
Length=207

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 69/110 (63%), Gaps = 13/110 (12%)
 Frame = +1

Query  1012  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  1191
             K+  + L+LNY+EV+ AW+ +G    D           +   MG + ++    G   +M 
Sbjct  111   KRVSLNLNLNYQEVLDAWSDRGSLLADD----------YSLSMGSNCYYK---GEVPVME  157

Query  1192  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  1341
                  REA V RYREKR+TRLFSKKIRY+VRKLNA+KRPRLKGRFVKR S
Sbjct  158   EDRTRREASVLRYREKRQTRLFSKKIRYQVRKLNADKRPRLKGRFVKRVS  207



>dbj|BAJ89584.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=430

 Score = 98.6 bits (244),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 101/350 (29%), Positives = 141/350 (40%), Gaps = 69/350 (20%)
 Frame = +1

Query  277   CDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasllssPK  456
             CD C+ +RARW+C ADDAFLCQ C+ SVHSAN LA RH+R+RL          +     +
Sbjct  88    CDGCMRRRARWYCAADDAFLCQGCETSVHSANPLARRHERLRL--------RVTSPLPAE  139

Query  457   IVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFV--PEMGSDD  630
              V      SP    +     P  P+   RT++     V    S   V+P V   E  + D
Sbjct  140   GVATAVKGSPATTSKCLDVAPAWPKRKARTRRPTVKSVGQLLSRRLVVPEVGAGESSTSD  199

Query  631   DYNNNNEIDLFCQVPVlldddln------allndgggddHMRGL----------------  744
             +     E  L  +VPV                       H   +                
Sbjct  200   ERRAPEEEQLLYRVPVFDPALGEFCSPPPIDDAVAATSRHGEDVEGAVEDAKELMDTPSP  259

Query  745   --EIPE----FLSSDVELAEFAADVETLLGD--DDVGEDKAT----------------AA  852
               E+P+    F  +D +L EFAAD+E LLG   DD  E + +                  
Sbjct  260   VQELPDCFASFGPTDADLREFAADMEALLGQGLDDGNELEDSFYMEALGLISPPAEHGGR  319

Query  853   VKIEINGGDCTEALNWSFGEEQEVEQKVM---MTMLSGFDessssmesgsckeeVAK---  1014
             VK+E +GG  + + N       +++++      T++   D       S S  + V     
Sbjct  320   VKVEADGGLVSRS-NGVLAAGHDLKREFSGSPPTLVDDDDSFEHKTSSASNGDAVDGAQF  378

Query  1015  -KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHH  1161
              K  + L LNYE VI++WAS   PWTDG RP   P     D +  DH  H
Sbjct  379   LKRSLDLRLNYEAVIASWASS--PWTDGRRP---PGQQLDDLLLNDHAVH  423



>ref|XP_002274679.2| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Vitis vinifera]
Length=218

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 63/102 (62%), Gaps = 14/102 (14%)
 Frame = +1

Query  1030  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGR  1209
             L+LNY+EV+ AW+ +G  W D          C   F    +    P     +M      R
Sbjct  123   LNLNYQEVLEAWSDRGSLWAD---------DCSLSFKNTSYMGEVP-----VMEEEKTRR  168

Query  1210  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
             EA V RY+EKR+TRLFSKKIRY+VRKLNA+KRPRLKGRFVKR
Sbjct  169   EASVLRYKEKRQTRLFSKKIRYQVRKLNADKRPRLKGRFVKR  210



>ref|XP_007016977.1| CCT motif family protein isoform 2, partial [Theobroma cacao]
 gb|EOY34596.1| CCT motif family protein isoform 2, partial [Theobroma cacao]
Length=240

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 68/110 (62%), Gaps = 13/110 (12%)
 Frame = +1

Query  1012  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  1191
             K+  + L+LNY++V+ AW+ +G  W D             D+      + +  G   +M 
Sbjct  144   KRVSLNLNLNYQDVLDAWSDRGSLWAD-------------DYSISKASNGYYMGEVPVME  190

Query  1192  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  1341
                  REA V RY+EKR+TRLFSKKIRY+VRKLNA+KRPRLKGRFVKR S
Sbjct  191   EERARREASVLRYKEKRQTRLFSKKIRYQVRKLNADKRPRLKGRFVKRVS  240



>ref|XP_008797174.1| PREDICTED: uncharacterized protein LOC103712429 [Phoenix dactylifera]
Length=232

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 70/115 (61%), Gaps = 17/115 (15%)
 Frame = +1

Query  1024  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPY-----GSAMMM  1188
             + L L+YE+V++AW+ +G  + DG  P   P           HH   P       +   +
Sbjct  126   LSLKLDYEDVLTAWSDRGSLYIDGDGPQVVPEL---------HHTASPVMVEVGSTGWRV  176

Query  1189  RRSDE---GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  1344
               SD     REARV RY+EKRR+RLFSK++RYEVRKLNAE+RPRLKGRFVKR  +
Sbjct  177   PESDREAGNREARVMRYKEKRRSRLFSKRVRYEVRKLNAERRPRLKGRFVKRKDV  231



>ref|XP_008354834.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X1 
[Malus domestica]
Length=235

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 70/109 (64%), Gaps = 13/109 (12%)
 Frame = +1

Query  1012  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  1191
             KK ++ L+LNY+EV+ AW+ +G  W D          C    M  + ++    G   +M 
Sbjct  138   KKVQLNLNLNYQEVMDAWSDRGTLWADD---------CSLSSMASNGNY---IGEVPVME  185

Query  1192  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLK-GRFVKR  1335
                  REARV RY+EKR++RLFSKKIRY+VRKLNA+KRPRLK GRFVKR
Sbjct  186   EEKARREARVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRLKQGRFVKR  234



>dbj|BAE98863.1| hypothetical protein [Arabidopsis thaliana]
Length=245

 Score = 94.7 bits (234),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 83/262 (32%), Positives = 115/262 (44%), Gaps = 64/262 (24%)
 Frame = +1

Query  217  MMSSDQRKTANAISGK-TARACDSCLSK-RARWFCVADDAFLCQSCDVSVHSANLLASRH  390
            M+   + +TA+    K  AR CD+C+ + RA W+C ADDAFLCQSCD S+HSAN LA RH
Sbjct  1    MVVDVESRTASVTGEKMAARGCDACMKRSRASWYCPADDAFLCQSCDASIHSANHLAKRH  60

Query  391  QRVRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGV  570
            +RVRL +SS                +  D +   W+ GF RK RTPR         S   
Sbjct  61   ERVRLQSSSP--------------TETADKTTSVWYEGFRRKARTPR---------SKSC  97

Query  571  AVEE--SVNPVLPFVPEMGSDDD-----YNNNNE----------------------IDLF  663
            A E+   +    P VPE+G D+D     +++  E                      I+ F
Sbjct  98   AFEKLLQIESNDPLVPELGGDEDDGFFSFSSVEETEESLNCCVPVFDPFSDMLIDDINGF  157

Query  664  CQVPVlldddlnallndgggddHMRGLEIPEFLSSDVELAEFAADVETLLGDD-------  822
            C VP  +++              M       F+  D++L +   DVE+LL ++       
Sbjct  158  CLVPDEVNNTTTNGELGEVEKAIMDDEGFMGFVPLDMDLEDLTMDVESLLEEEQLCLGFK  217

Query  823  ---DVGEDKATAAVKIEINGGD  879
               DVG  K    V  EIN  D
Sbjct  218  EPNDVGVIKEENKVGFEINCKD  239



>gb|KHN40106.1| Protein CHLOROPLAST IMPORT APPARATUS 2 [Glycine soja]
Length=220

 Score = 94.0 bits (232),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 65/102 (64%), Gaps = 12/102 (12%)
 Frame = +1

Query  1030  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGR  1209
             L+LNY+EV+ AW+ +G  W D     F  N+ +  +MG             ++      R
Sbjct  130   LNLNYQEVLDAWSDRGSLWADDCSLSFPTNNAY--YMG----------EVPVLEEERARR  177

Query  1210  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
             EA V RY+EKR+ RLFSKKIRY+VRKLNA+KRPR+KGRFVKR
Sbjct  178   EASVLRYKEKRQNRLFSKKIRYQVRKLNADKRPRIKGRFVKR  219



>gb|EPS70097.1| hypothetical protein M569_04667, partial [Genlisea aurea]
Length=74

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  1195  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
             +D GREARVSRYREKRR RLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  26    ADGGREARVSRYREKRRMRLFSKKIRYEVRKLNAEKRPRIKGRFVKR  72



>ref|XP_006574444.1| PREDICTED: uncharacterized protein LOC100803772 isoform X1 [Glycine 
max]
Length=217

 Score = 93.6 bits (231),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 65/102 (64%), Gaps = 12/102 (12%)
 Frame = +1

Query  1030  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGR  1209
             L+LNY+EV+ AW+ +G  W D     F  N+ +  +MG             ++      R
Sbjct  127   LNLNYQEVLDAWSDRGSLWADDCSLSFATNNAY--YMG----------EVPVLEEERARR  174

Query  1210  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
             EA V RY+EKR+ RLFSKKIRY+VRKLNA+KRPR+KGRFVKR
Sbjct  175   EACVLRYKEKRQNRLFSKKIRYQVRKLNADKRPRIKGRFVKR  216



>ref|XP_009354286.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009341687.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X1 
[Pyrus x bretschneideri]
Length=235

 Score = 94.0 bits (232),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 69/109 (63%), Gaps = 13/109 (12%)
 Frame = +1

Query  1012  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  1191
             KK R+ L+LNY+EV+ AW+ +G  W D          C    M  + ++    G   +M 
Sbjct  138   KKVRLNLNLNYQEVMDAWSDRGTLWADD---------CSLSSMASNGNY---IGEVPVME  185

Query  1192  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLK-GRFVKR  1335
                  REARV RY+EKR++RLFSKKIRY+VRKLNA+KRPR K GRFVKR
Sbjct  186   DEKARREARVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRFKQGRFVKR  234



>ref|XP_003544900.2| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 
X1 [Glycine max]
Length=240

 Score = 94.0 bits (232),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 65/102 (64%), Gaps = 12/102 (12%)
 Frame = +1

Query  1030  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGR  1209
             L+LNY+EV+ AW+ +G  W D     F  N+ +  +MG             ++      R
Sbjct  150   LNLNYQEVLDAWSDRGSLWADDCSLSFPTNNAY--YMG----------EVPVLEEERARR  197

Query  1210  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  1335
             EA V RY+EKR+ RLFSKKIRY+VRKLNA+KRPR+KGRFVKR
Sbjct  198   EASVLRYKEKRQNRLFSKKIRYQVRKLNADKRPRIKGRFVKR  239



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5085976925088