BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c128469_g1_i1 len=107 path=[1:0-106]

Length=107
                                                                      Score     E

emb|CAB38831.1|  putative receptor-like protein kinase (fragment)     55.8    1e-07   Arabidopsis thaliana [mouse-ear cress]
gb|KFK32894.1|  hypothetical protein AALP_AA6G301900                  55.5    2e-07   
ref|XP_006295846.1|  hypothetical protein CARUB_v10024975mg           55.5    2e-07   
emb|CDY41962.1|  BnaA01g05340D                                        55.5    2e-07   
ref|XP_008461043.1|  PREDICTED: probable receptor-like protein ki...  54.7    4e-07   
ref|XP_010416895.1|  PREDICTED: probable receptor-like protein ki...  54.7    4e-07   
ref|XP_004135822.1|  PREDICTED: probable receptor-like protein ki...  54.3    5e-07   
ref|XP_011092822.1|  PREDICTED: probable receptor-like protein ki...  53.1    1e-06   
emb|CDY42608.1|  BnaC01g00200D                                        52.8    2e-06   
ref|NP_195622.1|  putative receptor-like protein kinase               52.8    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010526599.1|  PREDICTED: probable receptor-like protein ki...  52.8    2e-06   
ref|XP_002868886.1|  kinase family protein                            52.8    2e-06   
emb|CDX72717.1|  BnaC07g47390D                                        52.8    2e-06   
ref|XP_010446439.1|  PREDICTED: probable receptor-like protein ki...  52.8    2e-06   
ref|XP_006411710.1|  hypothetical protein EUTSA_v10024369mg           52.8    2e-06   
ref|XP_002880383.1|  kinase family protein                            52.8    2e-06   
emb|CDY56768.1|  BnaA06g40790D                                        52.8    2e-06   
ref|NP_179743.1|  Malectin/receptor-like protein kinase               52.8    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006285865.1|  hypothetical protein CARUB_v10007359mg           52.8    2e-06   
ref|XP_010431866.1|  PREDICTED: probable receptor-like protein ki...  52.8    2e-06   
ref|XP_006404596.1|  hypothetical protein EUTSA_v10000042mg           52.8    2e-06   
ref|XP_010555277.1|  PREDICTED: probable receptor-like protein ki...  52.8    2e-06   
ref|XP_010437013.1|  PREDICTED: probable receptor-like protein ki...  52.8    2e-06   
gb|KFK30495.1|  hypothetical protein AALP_AA7G268900                  52.8    2e-06   
ref|XP_008236946.1|  PREDICTED: probable receptor-like protein ki...  52.4    2e-06   
ref|XP_007199706.1|  hypothetical protein PRUPE_ppa001265mg           52.4    2e-06   
ref|XP_009373018.1|  PREDICTED: probable receptor-like protein ki...  52.4    2e-06   
ref|XP_004289649.1|  PREDICTED: probable receptor-like protein ki...  52.4    2e-06   
emb|CDY12121.1|  BnaC03g60370D                                        52.4    2e-06   
ref|XP_009348229.1|  PREDICTED: probable receptor-like protein ki...  52.4    2e-06   
ref|XP_008347402.1|  PREDICTED: probable receptor-like protein ki...  52.4    2e-06   
ref|XP_008382300.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...  52.4    3e-06   
emb|CDX90312.1|  BnaA08g16720D                                        52.4    3e-06   
ref|XP_009109497.1|  PREDICTED: probable receptor-like protein ki...  52.4    3e-06   
emb|CDO97018.1|  unnamed protein product                              52.0    3e-06   
gb|EYU42598.1|  hypothetical protein MIMGU_mgv1a001168mg              52.0    4e-06   
ref|XP_009784130.1|  PREDICTED: probable receptor-like protein ki...  51.6    5e-06   
ref|XP_009607769.1|  PREDICTED: probable receptor-like protein ki...  51.6    5e-06   
ref|XP_009140281.1|  PREDICTED: probable receptor-like protein ki...  51.2    6e-06   
emb|CDY15889.1|  BnaA04g12220D                                        51.2    6e-06   
ref|XP_010429059.1|  PREDICTED: probable receptor-like protein ki...  51.2    7e-06   
ref|XP_010416893.1|  PREDICTED: probable receptor-like protein ki...  51.2    7e-06   
ref|XP_010093273.1|  hypothetical protein L484_000347                 50.4    8e-06   
ref|XP_004248695.2|  PREDICTED: probable receptor-like protein ki...  50.8    8e-06   
ref|XP_007133803.1|  hypothetical protein PHAVU_011G210400g           50.8    8e-06   
ref|XP_003541604.1|  PREDICTED: probable receptor-like protein ki...  50.8    9e-06   
gb|KHN19465.1|  Putative receptor-like protein kinase                 50.8    1e-05   
ref|XP_003539634.1|  PREDICTED: probable receptor-like protein ki...  50.8    1e-05   
gb|KCW50956.1|  hypothetical protein EUGRSUZ_J00593                   50.4    1e-05   
ref|XP_010031593.1|  PREDICTED: probable receptor-like protein ki...  50.4    1e-05   
ref|XP_009150927.1|  PREDICTED: probable receptor-like protein ki...  50.4    1e-05   
ref|XP_003627741.1|  Kinase-like protein                              50.4    1e-05   
gb|AET02217.2|  malectin/receptor-like kinase family protein          50.4    1e-05   
ref|XP_011037463.1|  PREDICTED: probable receptor-like protein ki...  50.4    1e-05   
emb|CDX99588.1|  BnaC04g33450D                                        50.1    1e-05   
ref|XP_002512952.1|  kinase, putative                                 50.1    2e-05   Ricinus communis
ref|XP_010474399.1|  PREDICTED: probable receptor-like protein ki...  50.1    2e-05   
ref|XP_006360634.1|  PREDICTED: probable receptor-like protein ki...  50.1    2e-05   
gb|KDP41754.1|  hypothetical protein JCGZ_26772                       50.1    2e-05   
ref|XP_004510997.1|  PREDICTED: probable receptor-like protein ki...  49.3    2e-05   
ref|XP_002313029.1|  Pto-like kinase OGw family protein               49.3    3e-05   Populus trichocarpa [western balsam poplar]
ref|XP_004230878.1|  PREDICTED: probable receptor-like protein ki...  49.3    3e-05   
ref|XP_006362028.1|  PREDICTED: probable receptor-like protein ki...  49.3    3e-05   
ref|XP_002305446.1|  kinase family protein                            49.3    3e-05   Populus trichocarpa [western balsam poplar]
ref|XP_011047858.1|  PREDICTED: probable receptor-like protein ki...  49.3    3e-05   
ref|XP_009606962.1|  PREDICTED: probable receptor-like protein ki...  49.3    3e-05   
ref|XP_009765018.1|  PREDICTED: probable receptor-like protein ki...  49.3    3e-05   
ref|XP_003561111.2|  PREDICTED: probable receptor-like protein ki...  49.3    3e-05   
ref|XP_007042101.1|  Malectin/receptor-like protein kinase family...  49.3    3e-05   
ref|XP_010690828.1|  PREDICTED: probable receptor-like protein ki...  48.9    3e-05   
ref|XP_006423378.1|  hypothetical protein CICLE_v10030261mg           47.0    1e-04   
gb|KDO49453.1|  hypothetical protein CISIN_1g047569mg                 47.4    1e-04   
ref|XP_006487358.1|  PREDICTED: probable receptor-like protein ki...  47.4    1e-04   
gb|EPS69032.1|  hypothetical protein M569_05731                       47.4    1e-04   
ref|XP_008648764.1|  PREDICTED: probable receptor-like protein ki...  46.6    2e-04   
gb|EMT10975.1|  Putative receptor-like protein kinase                 46.6    2e-04   
gb|AFW75325.1|  putative receptor-like protein kinase family protein  46.6    2e-04   
ref|XP_004966605.1|  PREDICTED: probable receptor-like protein ki...  46.6    3e-04   
ref|XP_002437736.1|  hypothetical protein SORBIDRAFT_10g001580        46.6    3e-04   Sorghum bicolor [broomcorn]
dbj|BAC24825.1|  putative receptor-like protein kinase                46.6    3e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008659357.1|  PREDICTED: probable receptor-like protein ki...  46.2    3e-04   
ref|XP_002864728.1|  kinase family protein                            46.2    3e-04   
ref|XP_002280183.3|  PREDICTED: probable receptor-like protein ki...  46.2    3e-04   Vitis vinifera
ref|XP_010927482.1|  PREDICTED: probable receptor-like protein ki...  45.8    5e-04   
ref|XP_009410356.1|  PREDICTED: probable receptor-like protein ki...  45.4    6e-04   
ref|XP_009395911.1|  PREDICTED: probable receptor-like protein ki...  45.1    7e-04   
ref|XP_010260899.1|  PREDICTED: probable receptor-like protein ki...  45.1    9e-04   
ref|XP_008796520.1|  PREDICTED: probable receptor-like protein ki...  44.7    0.001   



>emb|CAB38831.1| putative receptor-like protein kinase (fragment) [Arabidopsis 
thaliana]
Length=573

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDWQ R+SFSSWLLP+HA D+TF
Sbjct  159  WKKRPQDWQKRNSFSSWLLPIHAGDSTF  186



>gb|KFK32894.1| hypothetical protein AALP_AA6G301900 [Arabis alpina]
Length=865

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDWQ R+SFSSWLLP+HA D+TF
Sbjct  459  WKKRPQDWQKRNSFSSWLLPIHAGDSTF  486



>ref|XP_006295846.1| hypothetical protein CARUB_v10024975mg [Capsella rubella]
 gb|EOA28744.1| hypothetical protein CARUB_v10024975mg [Capsella rubella]
Length=866

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDWQ R+SFSSWLLP+HA D+TF
Sbjct  458  WKKRPQDWQKRNSFSSWLLPIHAGDSTF  485



>emb|CDY41962.1| BnaA01g05340D [Brassica napus]
Length=859

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDWQ R+SFSSWLLP+HA D+TF
Sbjct  459  WKKRPQDWQKRNSFSSWLLPIHAGDSTF  486



>ref|XP_008461043.1| PREDICTED: probable receptor-like protein kinase At2g21480 [Cucumis 
melo]
Length=874

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W KR QDWQ R+SFSSWLLPVHA D++F
Sbjct  460  WHKRPQDWQKRNSFSSWLLPVHAGDSSF  487



>ref|XP_010416895.1| PREDICTED: probable receptor-like protein kinase At2g21480 isoform 
X3 [Camelina sativa]
Length=688

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 20/28 (71%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDWQ R+SFSSWLLP+H+ D+TF
Sbjct  281  WKKRPQDWQKRNSFSSWLLPIHSGDSTF  308



>ref|XP_004135822.1| PREDICTED: probable receptor-like protein kinase At4g39110-like 
[Cucumis sativus]
 ref|XP_004171284.1| PREDICTED: probable receptor-like protein kinase At4g39110-like 
[Cucumis sativus]
 gb|KGN45339.1| hypothetical protein Csa_7G440600 [Cucumis sativus]
Length=876

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W KR QDWQ R+SFSSWLLPVHA D++F
Sbjct  460  WHKRPQDWQKRNSFSSWLLPVHAGDSSF  487



>ref|XP_011092822.1| PREDICTED: probable receptor-like protein kinase At4g39110 [Sesamum 
indicum]
Length=849

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVHARDATFTNPNN  2
            V W+KR QDWQ R+SFSSWLLP+HA D++F + +N
Sbjct  446  VKWKKRPQDWQKRNSFSSWLLPIHAGDSSFMSSSN  480



>emb|CDY42608.1| BnaC01g00200D [Brassica napus]
Length=680

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDWQ R+SFSSWLLP+HA D+TF
Sbjct  452  WKKRPQDWQKRNSFSSWLLPIHAGDSTF  479



>ref|NP_195622.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 sp|Q9T020.1|Y4391_ARATH RecName: Full=Probable receptor-like protein kinase At4g39110; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB43626.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 emb|CAB80574.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 gb|AEE87020.1| putative receptor-like protein kinase [Arabidopsis thaliana]
Length=878

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDWQ R+SFSSWLLP+HA D+TF
Sbjct  464  WKKRPQDWQKRNSFSSWLLPIHAGDSTF  491



>ref|XP_010526599.1| PREDICTED: probable receptor-like protein kinase At4g39110 [Tarenaya 
hassleriana]
Length=884

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDWQ R+SFSSWLLP+HA D+TF
Sbjct  462  WKKRPQDWQKRNSFSSWLLPIHAGDSTF  489



>ref|XP_002868886.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45145.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=882

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDWQ R+SFSSWLLP+HA D+TF
Sbjct  464  WKKRPQDWQKRNSFSSWLLPIHAGDSTF  491



>emb|CDX72717.1| BnaC07g47390D [Brassica napus]
Length=855

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDWQ R+SFSSWLLP+HA D+TF
Sbjct  453  WKKRPQDWQKRNSFSSWLLPIHAGDSTF  480



>ref|XP_010446439.1| PREDICTED: probable receptor-like protein kinase At4g39110 [Camelina 
sativa]
Length=884

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDWQ R+SFSSWLLP+HA D+TF
Sbjct  464  WKKRPQDWQKRNSFSSWLLPIHAGDSTF  491



>ref|XP_006411710.1| hypothetical protein EUTSA_v10024369mg [Eutrema salsugineum]
 gb|ESQ53163.1| hypothetical protein EUTSA_v10024369mg [Eutrema salsugineum]
Length=881

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDWQ R+SFSSWLLP+HA D+TF
Sbjct  464  WKKRPQDWQKRNSFSSWLLPIHAGDSTF  491



>ref|XP_002880383.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56642.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=837

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDWQ R+SFSSWLLP+HA D+TF
Sbjct  429  WKKRPQDWQKRNSFSSWLLPIHAGDSTF  456



>emb|CDY56768.1| BnaA06g40790D [Brassica napus]
Length=855

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDWQ R+SFSSWLLP+HA D+TF
Sbjct  453  WKKRPQDWQKRNSFSSWLLPIHAGDSTF  480



>ref|NP_179743.1| Malectin/receptor-like protein kinase [Arabidopsis thaliana]
 sp|Q9SJT0.1|Y2214_ARATH RecName: Full=Probable receptor-like protein kinase At2g21480; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD23692.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEC07184.1| Malectin/receptor-like protein kinase [Arabidopsis thaliana]
Length=871

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDWQ R+SFSSWLLP+HA D+TF
Sbjct  463  WKKRPQDWQKRNSFSSWLLPIHAGDSTF  490



>ref|XP_006285865.1| hypothetical protein CARUB_v10007359mg [Capsella rubella]
 gb|EOA18763.1| hypothetical protein CARUB_v10007359mg [Capsella rubella]
Length=882

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDWQ R+SFSSWLLP+HA D+TF
Sbjct  464  WKKRPQDWQKRNSFSSWLLPIHAGDSTF  491



>ref|XP_010431866.1| PREDICTED: probable receptor-like protein kinase At4g39110 [Camelina 
sativa]
Length=922

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDWQ R+SFSSWLLP+HA D+TF
Sbjct  504  WKKRPQDWQKRNSFSSWLLPIHAGDSTF  531



>ref|XP_006404596.1| hypothetical protein EUTSA_v10000042mg [Eutrema salsugineum]
 gb|ESQ46049.1| hypothetical protein EUTSA_v10000042mg [Eutrema salsugineum]
Length=878

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDWQ R+SFSSWLLP+HA D+TF
Sbjct  466  WKKRPQDWQKRNSFSSWLLPIHAGDSTF  493



>ref|XP_010555277.1| PREDICTED: probable receptor-like protein kinase At4g39110 [Tarenaya 
hassleriana]
Length=879

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDWQ R+SFSSWLLP+HA D+TF
Sbjct  461  WKKRPQDWQKRNSFSSWLLPIHAGDSTF  488



>ref|XP_010437013.1| PREDICTED: probable receptor-like protein kinase At4g39110 [Camelina 
sativa]
Length=922

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDWQ R+SFSSWLLP+HA D+TF
Sbjct  504  WKKRPQDWQKRNSFSSWLLPIHAGDSTF  531



>gb|KFK30495.1| hypothetical protein AALP_AA7G268900 [Arabis alpina]
Length=880

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDWQ R+SFSSWLLP+HA D+TF
Sbjct  464  WKKRPQDWQKRNSFSSWLLPIHAGDSTF  491



>ref|XP_008236946.1| PREDICTED: probable receptor-like protein kinase At2g21480 [Prunus 
mume]
Length=893

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATFTNPNN  2
            WRKR QDWQ R+SFSSWLLPVHA D +F +  N
Sbjct  469  WRKRPQDWQKRNSFSSWLLPVHAGDNSFMSSKN  501



>ref|XP_007199706.1| hypothetical protein PRUPE_ppa001265mg [Prunus persica]
 gb|EMJ00905.1| hypothetical protein PRUPE_ppa001265mg [Prunus persica]
Length=867

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATFTNPNN  2
            WRKR QDWQ R+SFSSWLLPVHA D +F +  N
Sbjct  443  WRKRPQDWQKRNSFSSWLLPVHAGDNSFMSSKN  475



>ref|XP_009373018.1| PREDICTED: probable receptor-like protein kinase At4g39110 [Pyrus 
x bretschneideri]
Length=857

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            WRKR QDWQ R+SFSSWLLPVHA D +F
Sbjct  442  WRKRPQDWQKRNSFSSWLLPVHASDTSF  469



>ref|XP_004289649.1| PREDICTED: probable receptor-like protein kinase At4g39110-like 
[Fragaria vesca subsp. vesca]
Length=857

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATFTNPNN  2
            W+KR QDWQ R+SFSSWLLPVHA D +F +  N
Sbjct  443  WKKRPQDWQKRNSFSSWLLPVHAGDTSFMSSKN  475



>emb|CDY12121.1| BnaC03g60370D [Brassica napus]
Length=857

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDWQ R+SFSSWLLP+HA D TF
Sbjct  441  WKKRPQDWQKRNSFSSWLLPIHAGDTTF  468



>ref|XP_009348229.1| PREDICTED: probable receptor-like protein kinase At4g39110 [Pyrus 
x bretschneideri]
Length=857

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            WRKR QDWQ R+SFSSWLLPVHA D +F
Sbjct  442  WRKRPQDWQKRNSFSSWLLPVHAGDTSF  469



>ref|XP_008347402.1| PREDICTED: probable receptor-like protein kinase At4g39110 [Malus 
domestica]
Length=891

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            WRKR QDWQ R+SFSSWLLPVHA D +F
Sbjct  469  WRKRPQDWQKRNSFSSWLLPVHAGDTSF  496



>ref|XP_008382300.1| PREDICTED: LOW QUALITY PROTEIN: probable receptor-like protein 
kinase At2g21480 [Malus domestica]
Length=883

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            WRKR QDWQ R+SFSSWLLPVHA D +F
Sbjct  468  WRKRPQDWQKRNSFSSWLLPVHAADTSF  495



>emb|CDX90312.1| BnaA08g16720D [Brassica napus]
Length=857

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDWQ R+SFSSWLLP+HA D TF
Sbjct  441  WKKRPQDWQKRNSFSSWLLPIHAGDTTF  468



>ref|XP_009109497.1| PREDICTED: probable receptor-like protein kinase At4g39110 [Brassica 
rapa]
Length=879

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDWQ R+SFSSWLLP+HA D TF
Sbjct  463  WKKRPQDWQKRNSFSSWLLPIHAGDTTF  490



>emb|CDO97018.1| unnamed protein product [Coffea canephora]
Length=862

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVHARDATF  17
            V W+KR QDWQ R+SFSSWLLP+HA DA+F
Sbjct  441  VKWQKRPQDWQKRNSFSSWLLPLHAGDASF  470



>gb|EYU42598.1| hypothetical protein MIMGU_mgv1a001168mg [Erythranthe guttata]
Length=873

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVHARDATF  17
            V W+KR QDWQ R+SFSSWLLP+HA D +F
Sbjct  456  VKWKKRPQDWQKRNSFSSWLLPIHAGDTSF  485



>ref|XP_009784130.1| PREDICTED: probable receptor-like protein kinase At4g39110 [Nicotiana 
sylvestris]
Length=854

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVHARDATF  17
            V W+KR QDWQ R+SFSSWLLP+HA D TF
Sbjct  444  VKWQKRPQDWQKRNSFSSWLLPLHAGDTTF  473



>ref|XP_009607769.1| PREDICTED: probable receptor-like protein kinase At4g39110 [Nicotiana 
tomentosiformis]
Length=853

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVHARDATF  17
            V W+KR QDWQ R+SFSSWLLP+HA D TF
Sbjct  444  VKWQKRPQDWQKRNSFSSWLLPLHAGDTTF  473



>ref|XP_009140281.1| PREDICTED: probable receptor-like protein kinase At2g21480 [Brassica 
rapa]
Length=855

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATFTN  11
            W+KR QDWQ R+SFSSWLLP+H+ D TF++
Sbjct  451  WKKRPQDWQKRNSFSSWLLPIHSGDTTFSS  480



>emb|CDY15889.1| BnaA04g12220D [Brassica napus]
Length=855

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATFTN  11
            W+KR QDWQ R+SFSSWLLP+H+ D TF++
Sbjct  451  WKKRPQDWQKRNSFSSWLLPIHSGDTTFSS  480



>ref|XP_010429059.1| PREDICTED: probable receptor-like protein kinase At2g21480 [Camelina 
sativa]
Length=871

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDWQ R+SFSSWLLP+H+ D+TF
Sbjct  463  WKKRPQDWQKRNSFSSWLLPIHSGDSTF  490



>ref|XP_010416893.1| PREDICTED: probable receptor-like protein kinase At2g21480 isoform 
X1 [Camelina sativa]
 ref|XP_010416894.1| PREDICTED: probable receptor-like protein kinase At2g21480 isoform 
X2 [Camelina sativa]
Length=870

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDWQ R+SFSSWLLP+H+ D+TF
Sbjct  463  WKKRPQDWQKRNSFSSWLLPIHSGDSTF  490



>ref|XP_010093273.1| hypothetical protein L484_000347 [Morus notabilis]
 gb|EXC38344.1| hypothetical protein L484_000347 [Morus notabilis]
Length=518

 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVHARDATF  17
            + W KR QDWQ R+SFSSWLLPVHA D +F
Sbjct  431  IKWHKRPQDWQKRNSFSSWLLPVHASDTSF  460



>ref|XP_004248695.2| PREDICTED: probable receptor-like protein kinase At4g39110 [Solanum 
lycopersicum]
Length=847

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVHARDAT  20
            V W+KR QDWQ R+SFSSWLLPVHA D+T
Sbjct  438  VKWQKRPQDWQKRNSFSSWLLPVHAGDST  466



>ref|XP_007133803.1| hypothetical protein PHAVU_011G210400g [Phaseolus vulgaris]
 gb|ESW05797.1| hypothetical protein PHAVU_011G210400g [Phaseolus vulgaris]
Length=889

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVHARDATFTNPNN  2
            V W KR QDWQ R+SFSSWLLP+HA D +F +  N
Sbjct  459  VKWHKRPQDWQKRNSFSSWLLPLHAGDTSFMSSKN  493



>ref|XP_003541604.1| PREDICTED: probable receptor-like protein kinase At4g39110-like 
[Glycine max]
 gb|KHN37633.1| Putative receptor-like protein kinase [Glycine soja]
Length=869

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVHARDATFTNPN  5
            + W KR QDWQ R+SFSSWLLP+HA D +F + N
Sbjct  457  IKWHKRPQDWQKRNSFSSWLLPLHAGDTSFMSKN  490



>gb|KHN19465.1| Putative receptor-like protein kinase [Glycine soja]
Length=850

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVHARDATFTNPN  5
            + W KR QDWQ R+SFSSWLLP+HA D +F + N
Sbjct  432  IKWHKRPQDWQKRNSFSSWLLPLHAGDTSFMSKN  465



>ref|XP_003539634.1| PREDICTED: probable receptor-like protein kinase At4g39110-like 
[Glycine max]
Length=878

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVHARDATFTNPN  5
            + W KR QDWQ R+SFSSWLLP+HA D +F + N
Sbjct  462  IKWHKRPQDWQKRNSFSSWLLPLHAGDTSFMSKN  495



>gb|KCW50956.1| hypothetical protein EUGRSUZ_J00593 [Eucalyptus grandis]
Length=842

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W KR QDWQ R+SFSSWLLP+HA DA+F
Sbjct  433  WHKRPQDWQKRNSFSSWLLPLHAGDASF  460



>ref|XP_010031593.1| PREDICTED: probable receptor-like protein kinase At4g39110 [Eucalyptus 
grandis]
Length=869

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W KR QDWQ R+SFSSWLLP+HA DA+F
Sbjct  460  WHKRPQDWQKRNSFSSWLLPLHAGDASF  487



>ref|XP_009150927.1| PREDICTED: probable receptor-like protein kinase At4g39110 [Brassica 
rapa]
Length=862

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDWQ R+SFSS LLP+HA D+TF
Sbjct  459  WKKRPQDWQKRNSFSSCLLPIHAGDSTF  486



>ref|XP_003627741.1| Kinase-like protein [Medicago truncatula]
Length=848

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVHARDATFTNPNN  2
            + W KR QDWQ R+SFSSWLLP+HA D +F +  N
Sbjct  434  IKWHKRPQDWQKRNSFSSWLLPLHAGDTSFMSSKN  468



>gb|AET02217.2| malectin/receptor-like kinase family protein [Medicago truncatula]
Length=881

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVHARDATFTNPNN  2
            + W KR QDWQ R+SFSSWLLP+HA D +F +  N
Sbjct  467  IKWHKRPQDWQKRNSFSSWLLPLHAGDTSFMSSKN  501



>ref|XP_011037463.1| PREDICTED: probable receptor-like protein kinase At4g39110 [Populus 
euphratica]
Length=838

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W KR QDWQ R+SFSSWLLPVHA D++F
Sbjct  430  WHKRPQDWQKRNSFSSWLLPVHAGDSSF  457



>emb|CDX99588.1| BnaC04g33450D [Brassica napus]
Length=856

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATFTN  11
            W+KR QDWQ R+SFSSWLLP+H+ D TF++
Sbjct  452  WKKRPQDWQKRNSFSSWLLPMHSGDTTFSS  481



>ref|XP_002512952.1| kinase, putative [Ricinus communis]
 gb|EEF49455.1| kinase, putative [Ricinus communis]
Length=863

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVHARDATF  17
            + W KR QDWQ R+SFSSWLLP+HA D +F
Sbjct  448  IKWHKRPQDWQKRNSFSSWLLPIHAGDTSF  477



>ref|XP_010474399.1| PREDICTED: probable receptor-like protein kinase At2g21480 [Camelina 
sativa]
Length=860

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+K+ QDWQ R+SFSSWLLP+H+ D+TF
Sbjct  453  WKKKPQDWQKRNSFSSWLLPIHSGDSTF  480



>ref|XP_006360634.1| PREDICTED: probable receptor-like protein kinase At4g39110-like 
[Solanum tuberosum]
Length=847

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVHARDAT  20
            V W+KR QDWQ R+SFS+WLLPVHA D+T
Sbjct  438  VKWQKRPQDWQKRNSFSAWLLPVHAGDST  466



>gb|KDP41754.1| hypothetical protein JCGZ_26772 [Jatropha curcas]
Length=875

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVHARDATFTNPNN  2
            + W KR QDWQ ++SFSSWLLP+HA D++F    N
Sbjct  455  IKWHKRPQDWQKKNSFSSWLLPIHAGDSSFMASKN  489



>ref|XP_004510997.1| PREDICTED: probable receptor-like protein kinase At4g39110-like 
[Cicer arietinum]
Length=860

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVHARDATF  17
            + W KR QDWQ R+SFSSWLLP+HA D +F
Sbjct  453  IKWHKRPQDWQKRNSFSSWLLPLHAGDTSF  482



>ref|XP_002313029.1| Pto-like kinase OGw family protein [Populus trichocarpa]
 gb|EEE86984.1| Pto-like kinase OGw family protein [Populus trichocarpa]
Length=783

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W KR QDWQ R+SFSSWLLPVHA D +F
Sbjct  401  WHKRPQDWQKRNSFSSWLLPVHAGDHSF  428



>ref|XP_004230878.1| PREDICTED: probable receptor-like protein kinase At4g39110 [Solanum 
lycopersicum]
Length=876

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDWQ R+SFSSWLLP+HA D +F
Sbjct  461  WQKRPQDWQKRNSFSSWLLPLHAGDTSF  488



>ref|XP_006362028.1| PREDICTED: probable receptor-like protein kinase At4g39110-like 
[Solanum tuberosum]
Length=860

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDWQ R+SFSSWLLP+HA D +F
Sbjct  445  WQKRPQDWQKRNSFSSWLLPLHAGDTSF  472



>ref|XP_002305446.1| kinase family protein [Populus trichocarpa]
 gb|EEE85957.1| kinase family protein [Populus trichocarpa]
Length=814

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W KR QDWQ R+SFSSWLLPVHA D +F
Sbjct  430  WHKRPQDWQKRNSFSSWLLPVHAGDHSF  457



>ref|XP_011047858.1| PREDICTED: probable receptor-like protein kinase At4g39110 [Populus 
euphratica]
Length=873

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W KR QDWQ R+SFSSWLLPVHA D +F
Sbjct  454  WHKRPQDWQKRNSFSSWLLPVHAGDHSF  481



>ref|XP_009606962.1| PREDICTED: probable receptor-like protein kinase At4g39110 [Nicotiana 
tomentosiformis]
Length=879

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDWQ R+SFSSWLLP+HA D +F
Sbjct  465  WQKRPQDWQKRNSFSSWLLPLHAGDTSF  492



>ref|XP_009765018.1| PREDICTED: probable receptor-like protein kinase At4g39110 [Nicotiana 
sylvestris]
Length=882

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDWQ R+SFSSWLLP+HA D +F
Sbjct  468  WQKRPQDWQKRNSFSSWLLPLHAGDTSF  495



>ref|XP_003561111.2| PREDICTED: probable receptor-like protein kinase At2g21480 [Brachypodium 
distachyon]
Length=841

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 24/32 (75%), Gaps = 1/32 (3%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVHARDATFTN  11
            V W KR QDWQ R+SFSSWLLP+H    +F+N
Sbjct  438  VKWHKRPQDWQRRNSFSSWLLPIHT-GQSFSN  468



>ref|XP_007042101.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOX97932.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
Length=896

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVHARDATF  17
            + W++R QDWQ R+SFSSWLLP+HA D +F
Sbjct  483  IKWKRRPQDWQKRNSFSSWLLPLHAGDTSF  512



>ref|XP_010690828.1| PREDICTED: probable receptor-like protein kinase At2g21480 [Beta 
vulgaris subsp. vulgaris]
Length=863

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVHARDATFTNPNN  2
            + W KR QDWQ R+SFSSWLLP+HA D+T    +N
Sbjct  454  IKWHKRPQDWQRRNSFSSWLLPLHAGDSTVFGKSN  488



>ref|XP_006423378.1| hypothetical protein CICLE_v10030261mg, partial [Citrus clementina]
 gb|ESR36618.1| hypothetical protein CICLE_v10030261mg, partial [Citrus clementina]
Length=506

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVHARDATF  17
            + W KR QDWQ R+SFSSWLLP+H  D +F
Sbjct  445  IKWHKRPQDWQRRNSFSSWLLPLHTGDTSF  474



>gb|KDO49453.1| hypothetical protein CISIN_1g047569mg [Citrus sinensis]
Length=832

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVHARDATF  17
            + W KR QDWQ R+SFSSWLLP+H  D +F
Sbjct  420  IKWHKRPQDWQRRNSFSSWLLPLHTGDTSF  449



>ref|XP_006487358.1| PREDICTED: probable receptor-like protein kinase At4g39110-like 
[Citrus sinensis]
Length=847

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVHARDATF  17
            + W KR QDWQ R+SFSSWLLP+H  D +F
Sbjct  435  IKWHKRPQDWQRRNSFSSWLLPLHTGDTSF  464



>gb|EPS69032.1| hypothetical protein M569_05731, partial [Genlisea aurea]
Length=851

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 18/27 (67%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVHARD  26
            V W+KR +DWQ   SFSSWLLP+HA D
Sbjct  444  VKWKKRPEDWQKSKSFSSWLLPIHAGD  470



>ref|XP_008648764.1| PREDICTED: probable receptor-like protein kinase At2g21480 [Zea 
mays]
 gb|AFW75324.1| putative receptor-like protein kinase family protein [Zea mays]
Length=844

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVH  35
            V W KR QDW+ R SFSSWLLP+H
Sbjct  451  VKWYKRPQDWERRESFSSWLLPIH  474



>gb|EMT10975.1| Putative receptor-like protein kinase [Aegilops tauschii]
Length=592

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 24/32 (75%), Gaps = 1/32 (3%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVHARDATFTN  11
            V W +R QDW+ R+SFSSWLLP+H    +F+N
Sbjct  389  VKWHRRPQDWERRNSFSSWLLPIHT-GQSFSN  419



>gb|AFW75325.1| putative receptor-like protein kinase family protein [Zea mays]
Length=774

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVH  35
            V W KR QDW+ R SFSSWLLP+H
Sbjct  451  VKWYKRPQDWERRESFSSWLLPIH  474



>ref|XP_004966605.1| PREDICTED: probable receptor-like protein kinase At2g21480-like 
[Setaria italica]
Length=850

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVH  35
            V W KR QDW+ R+SFSSWLLP+H
Sbjct  446  VKWYKRPQDWERRNSFSSWLLPIH  469



>ref|XP_002437736.1| hypothetical protein SORBIDRAFT_10g001580 [Sorghum bicolor]
 gb|EER89103.1| hypothetical protein SORBIDRAFT_10g001580 [Sorghum bicolor]
Length=863

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVH  35
            V W KR QDW+ R SFSSWLLP+H
Sbjct  458  VKWYKRPQDWERRESFSSWLLPIH  481



>dbj|BAC24825.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAD67738.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 gb|EAY99482.1| hypothetical protein OsI_21449 [Oryza sativa Indica Group]
 gb|EAZ35672.1| hypothetical protein OsJ_19957 [Oryza sativa Japonica Group]
Length=845

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVH  35
            V W KR QDW+ R+SFSSWLLP+H
Sbjct  451  VKWYKRPQDWERRNSFSSWLLPIH  474



>ref|XP_008659357.1| PREDICTED: probable receptor-like protein kinase At2g21480 [Zea 
mays]
 gb|AFW86086.1| putative receptor-like protein kinase family protein [Zea mays]
Length=851

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVH  35
            V W KR QDW+ R SFSSWLLP+H
Sbjct  451  VKWYKRPQDWERRESFSSWLLPIH  474



>ref|XP_002864728.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40987.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=842

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 16/30 (53%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVHARDATF  17
            V W++R +DWQ ++SFSSWLLP+HA  +++
Sbjct  446  VRWQRRPKDWQKQNSFSSWLLPLHASHSSY  475



>ref|XP_002280183.3| PREDICTED: probable receptor-like protein kinase At4g39110 [Vitis 
vinifera]
Length=871

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVHARDATFTNPNN  2
            + W++R  DW+ R+SFSSWLLP+HA D +F    N
Sbjct  461  IKWQRRPHDWEKRNSFSSWLLPLHAGDTSFMTSKN  495



>ref|XP_010927482.1| PREDICTED: probable receptor-like protein kinase At2g21480 [Elaeis 
guineensis]
Length=852

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVHARDATFTN  11
            V W KR QDW+ R+SFSSWLLP+H   ++F N
Sbjct  438  VKWYKRPQDWERRNSFSSWLLPIHTGHSSFMN  469



>ref|XP_009410356.1| PREDICTED: probable receptor-like protein kinase At2g21480 [Musa 
acuminata subsp. malaccensis]
Length=866

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W KR  DWQ R SFSSWLLPVH  ++TF
Sbjct  451  WHKRPHDWQRRESFSSWLLPVHTGNSTF  478



>ref|XP_009395911.1| PREDICTED: probable receptor-like protein kinase At4g39110 [Musa 
acuminata subsp. malaccensis]
Length=860

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVHARDATF  17
            V W KR  DW+ R+SFSSWLLPVH  ++TF
Sbjct  444  VKWSKRPHDWERRNSFSSWLLPVHTGNSTF  473



>ref|XP_010260899.1| PREDICTED: probable receptor-like protein kinase At5g61350 [Nelumbo 
nucifera]
Length=883

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  100  WRKRSQDWQMRSSFSSWLLPVHARDATF  17
            W+KR QDW+ R+SFSSWLLP+H   ++F
Sbjct  473  WQKRPQDWEKRNSFSSWLLPIHVSQSSF  500



>ref|XP_008796520.1| PREDICTED: probable receptor-like protein kinase At2g21480 [Phoenix 
dactylifera]
Length=852

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -2

Query  106  VYWRKRSQDWQMRSSFSSWLLPVHARDATF  17
            V W KR QDW+ R+SFSSWLLP+H  +++F
Sbjct  438  VKWYKRPQDWERRNSFSSWLLPIHTGNSSF  467



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 525703048884