BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c12819_g1_i1 len=580 path=[187:0-71 93:72-579]

Length=580
                                                                      Score     E

ref|XP_006447043.1|  hypothetical protein CICLE_v10017400mg           64.7    1e-10   
ref|XP_009606513.1|  PREDICTED: uncharacterized protein LOC104100866  64.7    1e-10   
gb|KDO39368.1|  hypothetical protein CISIN_1g039872mg                 64.7    1e-10   
gb|EYU34816.1|  hypothetical protein MIMGU_mgv1a023280mg              64.3    2e-10   
gb|EYU45418.1|  hypothetical protein MIMGU_mgv1a025760mg              65.5    2e-10   
ref|XP_011098905.1|  PREDICTED: uncharacterized protein LOC105177438  63.5    3e-10   
ref|XP_006470082.1|  PREDICTED: uncharacterized protein LOC102613711  64.7    5e-10   
ref|XP_004231770.1|  PREDICTED: uncharacterized protein LOC101265785  64.3    5e-10   
ref|XP_006338705.1|  PREDICTED: uncharacterized protein LOC102579469  64.3    6e-10   
gb|KHN48794.1|  hypothetical protein glysoja_030564                   63.2    7e-10   
ref|XP_007161715.1|  hypothetical protein PHAVU_001G092300g           62.8    7e-10   
ref|XP_003553938.1|  PREDICTED: uncharacterized protein LOC100795123  62.4    7e-10   
gb|KDP46267.1|  hypothetical protein JCGZ_10107                       62.4    7e-10   
ref|XP_008231102.1|  PREDICTED: uncharacterized protein LOC103330323  62.0    1e-09   
dbj|BAD45503.1|  hypothetical protein                                 62.0    1e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010112380.1|  hypothetical protein L484_010785                 61.6    1e-09   
ref|XP_010695381.1|  PREDICTED: uncharacterized protein LOC104908027  61.6    1e-09   
ref|XP_006604976.1|  PREDICTED: uncharacterized protein LOC100799722  64.7    2e-09   
ref|XP_010250672.1|  PREDICTED: uncharacterized protein LOC104592858  61.2    2e-09   
gb|EPS58439.1|  hypothetical protein M569_16374                       62.8    2e-09   
ref|XP_010028990.1|  PREDICTED: uncharacterized protein LOC104419133  62.4    2e-09   
gb|KCW55821.1|  hypothetical protein EUGRSUZ_I01638                   60.8    3e-09   
ref|XP_010112382.1|  hypothetical protein L484_010787                 60.8    3e-09   
ref|XP_010663762.1|  PREDICTED: uncharacterized protein LOC100247554  60.8    3e-09   
ref|XP_009612663.1|  PREDICTED: uncharacterized protein LOC104105934  60.5    4e-09   
emb|CDP13357.1|  unnamed protein product                              60.1    5e-09   
ref|XP_009597109.1|  PREDICTED: uncharacterized protein LOC104093100  60.1    6e-09   
emb|CDP16707.1|  unnamed protein product                              60.1    6e-09   
ref|XP_004967907.1|  PREDICTED: uncharacterized protein LOC101762316  60.1    6e-09   
emb|CBI15682.3|  unnamed protein product                              61.2    6e-09   
gb|ABR25956.1|  unknown                                               60.8    6e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_009771781.1|  PREDICTED: uncharacterized protein LOC104222266  59.7    6e-09   
ref|XP_006591443.1|  PREDICTED: uncharacterized protein LOC100787382  59.7    6e-09   
gb|KCW44914.1|  hypothetical protein EUGRSUZ_L01505                   60.8    7e-09   
ref|NP_001054393.1|  Os05g0103300                                     59.7    7e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010026396.1|  PREDICTED: uncharacterized protein LOC104416742  59.7    8e-09   
ref|XP_003549169.1|  PREDICTED: uncharacterized protein LOC100816029  59.3    9e-09   
ref|XP_004503745.1|  PREDICTED: uncharacterized protein LOC101508777  59.3    9e-09   
gb|KDO63902.1|  hypothetical protein CISIN_1g035267mg                 59.3    9e-09   
ref|XP_010024172.1|  PREDICTED: uncharacterized protein LOC104414708  59.3    9e-09   
emb|CDY28499.1|  BnaC02g36610D                                        59.3    1e-08   
ref|XP_007217459.1|  hypothetical protein PRUPE_ppa026813mg           60.8    1e-08   
ref|XP_006447044.1|  hypothetical protein CICLE_v10018377mg           59.3    1e-08   
ref|XP_010026362.1|  PREDICTED: uncharacterized protein LOC104416706  59.7    1e-08   
ref|XP_010037403.1|  PREDICTED: uncharacterized protein LOC104426149  59.3    1e-08   
ref|XP_007216168.1|  hypothetical protein PRUPE_ppa015651mg           59.3    1e-08   
ref|XP_009375198.1|  PREDICTED: uncharacterized protein LOC103964039  59.3    1e-08   
ref|XP_004306304.1|  PREDICTED: uncharacterized protein LOC101306369  59.3    1e-08   
ref|XP_010503500.1|  PREDICTED: uncharacterized protein LOC104780677  58.9    1e-08   
gb|AFK41617.1|  unknown                                               58.9    1e-08   
ref|XP_008346681.1|  PREDICTED: uncharacterized protein LOC103409651  58.9    1e-08   
gb|EPS61900.1|  hypothetical protein M569_12894                       58.9    1e-08   
ref|XP_009594856.1|  PREDICTED: uncharacterized protein LOC104091270  58.9    1e-08   
ref|XP_004138623.1|  PREDICTED: uncharacterized protein LOC101212375  58.9    1e-08   
ref|XP_008341296.1|  PREDICTED: uncharacterized protein LOC103404186  58.9    1e-08   
ref|XP_004515981.1|  PREDICTED: uncharacterized protein LOC101493411  58.9    1e-08   
ref|XP_009780342.1|  PREDICTED: uncharacterized protein LOC104229393  58.9    1e-08   
ref|XP_006470081.1|  PREDICTED: uncharacterized protein LOC102613424  58.9    1e-08   
ref|XP_009771783.1|  PREDICTED: uncharacterized protein LOC104222267  58.9    2e-08   
ref|XP_010545946.1|  PREDICTED: uncharacterized protein LOC104818180  58.5    2e-08   
ref|XP_004297598.1|  PREDICTED: uncharacterized protein LOC101294753  58.5    2e-08   
ref|XP_007163777.1|  hypothetical protein PHAVU_001G263200g           58.5    2e-08   
ref|XP_003553935.1|  PREDICTED: uncharacterized protein LOC100793543  58.5    2e-08   
ref|XP_004502278.1|  PREDICTED: uncharacterized protein LOC101503082  58.5    2e-08   
ref|XP_002304675.2|  hypothetical protein POPTR_0003s16890g           59.3    2e-08   Populus trichocarpa [western balsam poplar]
gb|ACG27155.1|  hypothetical protein                                  58.5    2e-08   Zea mays [maize]
ref|XP_002514896.1|  conserved hypothetical protein                   58.5    2e-08   Ricinus communis
ref|XP_008361851.1|  PREDICTED: uncharacterized protein LOC103425537  58.5    2e-08   
ref|XP_010044830.1|  PREDICTED: uncharacterized protein LOC104433689  58.5    2e-08   
gb|ABK23540.1|  unknown                                               58.2    2e-08   Picea sitchensis
ref|XP_011071240.1|  PREDICTED: uncharacterized protein LOC105156717  58.5    2e-08   
ref|XP_009629695.1|  PREDICTED: uncharacterized protein LOC104119810  58.5    2e-08   
ref|XP_010086969.1|  hypothetical protein L484_010115                 58.5    2e-08   
ref|XP_003553183.1|  PREDICTED: uncharacterized protein LOC100527578  58.5    2e-08   
ref|XP_009802034.1|  PREDICTED: uncharacterized protein LOC104247662  58.5    2e-08   
gb|KFK34166.1|  hypothetical protein AALP_AA5G109200                  58.2    2e-08   
ref|XP_003549178.1|  PREDICTED: uncharacterized protein LOC100527861  58.2    2e-08   
gb|KDP22604.1|  hypothetical protein JCGZ_26435                       58.2    2e-08   
ref|XP_009359419.1|  PREDICTED: uncharacterized protein LOC103949996  58.2    2e-08   
ref|XP_008441320.1|  PREDICTED: uncharacterized protein LOC103485470  58.2    2e-08   
ref|XP_006447042.1|  hypothetical protein CICLE_v10017402mg           58.2    2e-08   
gb|KEH21021.1|  transmembrane protein, putative                       58.2    2e-08   
gb|AFK47378.1|  unknown                                               58.2    3e-08   
ref|XP_002455353.1|  hypothetical protein SORBIDRAFT_03g009090        58.2    3e-08   Sorghum bicolor [broomcorn]
ref|XP_007038005.1|  Uncharacterized protein TCM_014660               60.1    3e-08   
ref|XP_002321710.2|  hypothetical protein POPTR_0015s11020g           58.2    3e-08   Populus trichocarpa [western balsam poplar]
dbj|BAB62632.1|  P0402A09.15                                          62.4    3e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008360750.1|  PREDICTED: uncharacterized protein LOC103424445  58.2    3e-08   
ref|XP_008441322.1|  PREDICTED: uncharacterized protein LOC103485472  57.8    3e-08   
ref|XP_006493216.1|  PREDICTED: uncharacterized protein LOC102619374  57.8    3e-08   
ref|XP_003631356.1|  PREDICTED: uncharacterized protein LOC100852958  57.8    3e-08   
ref|XP_004306303.1|  PREDICTED: uncharacterized protein LOC101306079  59.3    3e-08   
ref|XP_006352171.1|  PREDICTED: uncharacterized protein LOC102585729  57.8    3e-08   
ref|XP_003575014.1|  PREDICTED: uncharacterized protein LOC100827399  57.8    3e-08   
ref|XP_011044119.1|  PREDICTED: uncharacterized protein LOC105139404  57.8    3e-08   
ref|XP_010660745.1|  PREDICTED: uncharacterized protein LOC100246292  57.8    4e-08   
ref|XP_010682737.1|  PREDICTED: uncharacterized protein LOC104897542  57.8    4e-08   
emb|CDY34185.1|  BnaA02g28550D                                        57.8    4e-08   
ref|XP_008379099.1|  PREDICTED: uncharacterized protein LOC103442121  57.8    4e-08   
ref|XP_009597111.1|  PREDICTED: uncharacterized protein LOC104093102  57.8    4e-08   
gb|EYU42082.1|  hypothetical protein MIMGU_mgv1a017524mg              57.8    4e-08   
ref|XP_007225875.1|  hypothetical protein PRUPE_ppa014446mg           57.8    4e-08   
ref|XP_010090641.1|  hypothetical protein L484_017443                 59.3    4e-08   
ref|XP_009129454.1|  PREDICTED: uncharacterized protein LOC103854272  57.8    4e-08   
ref|XP_009606515.1|  PREDICTED: uncharacterized protein LOC104100868  57.4    4e-08   
ref|XP_009129453.1|  PREDICTED: uncharacterized protein LOC103854271  57.4    4e-08   
emb|CDP13356.1|  unnamed protein product                              57.4    4e-08   
ref|XP_009372260.1|  PREDICTED: uncharacterized protein LOC103961442  57.4    5e-08   
gb|KCW60623.1|  hypothetical protein EUGRSUZ_H03348                   57.4    5e-08   
ref|XP_003575013.1|  PREDICTED: uncharacterized protein LOC100827089  57.4    5e-08   
ref|XP_007031907.1|  Uncharacterized protein TCM_017236               58.5    5e-08   
ref|XP_004239230.1|  PREDICTED: uncharacterized protein LOC101249266  57.4    6e-08   
ref|XP_006438001.1|  hypothetical protein CICLE_v10033268mg           57.0    6e-08   
ref|XP_010425441.1|  PREDICTED: uncharacterized protein LOC104710521  57.0    6e-08   
ref|XP_002298634.2|  hypothetical protein POPTR_0001s33660g           57.4    6e-08   Populus trichocarpa [western balsam poplar]
ref|XP_003601753.1|  hypothetical protein MTR_3g085020                57.0    6e-08   
ref|XP_007043959.1|  Uncharacterized protein TCM_008722               58.5    6e-08   
ref|XP_010028987.1|  PREDICTED: uncharacterized protein LOC104419131  57.0    7e-08   
ref|XP_010249051.1|  PREDICTED: uncharacterized protein LOC104591752  57.0    7e-08   
emb|CDY52400.1|  BnaC07g48990D                                        57.0    7e-08   
gb|AFW75090.1|  hypothetical protein ZEAMMB73_968611                  58.2    7e-08   
ref|XP_006405409.1|  hypothetical protein EUTSA_v10028016mg           57.0    7e-08   
ref|XP_006436859.1|  hypothetical protein CICLE_v10033156mg           57.8    7e-08   
ref|XP_006292430.1|  hypothetical protein CARUB_v10018645mg           57.0    7e-08   
ref|XP_008222189.1|  PREDICTED: uncharacterized protein LOC103322090  57.0    7e-08   
ref|XP_010556293.1|  PREDICTED: uncharacterized protein LOC104825630  57.0    8e-08   
gb|ACG41546.1|  hypothetical protein                                  57.0    8e-08   Zea mays [maize]
ref|XP_004138041.1|  PREDICTED: uncharacterized protein LOC101212373  56.6    8e-08   
gb|AFK45116.1|  unknown                                               57.0    8e-08   
ref|XP_006373211.1|  hypothetical protein POPTR_0017s09690g           56.6    8e-08   
ref|XP_003528798.1|  PREDICTED: uncharacterized protein LOC100305821  56.6    8e-08   
ref|XP_006373210.1|  hypothetical protein POPTR_0017s09680g           56.6    8e-08   
ref|XP_011020769.1|  PREDICTED: uncharacterized protein LOC105123025  58.2    9e-08   
ref|XP_010550223.1|  PREDICTED: uncharacterized protein LOC104821134  56.6    9e-08   
ref|XP_004231769.1|  PREDICTED: uncharacterized protein LOC101265494  56.6    9e-08   
ref|XP_006292149.1|  hypothetical protein CARUB_v10018353mg           56.6    9e-08   
ref|XP_011000976.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  57.8    9e-08   
emb|CDX84422.1|  BnaC03g50780D                                        56.6    1e-07   
ref|XP_008341294.1|  PREDICTED: uncharacterized protein LOC103404184  56.6    1e-07   
emb|CDP16705.1|  unnamed protein product                              56.6    1e-07   
ref|XP_006404231.1|  hypothetical protein EUTSA_v10010885mg           56.6    1e-07   
ref|XP_002511164.1|  conserved hypothetical protein                   56.6    1e-07   Ricinus communis
ref|XP_006605561.1|  PREDICTED: uncharacterized protein LOC102669109  56.6    1e-07   
gb|ACG27375.1|  hypothetical protein                                  56.2    1e-07   Zea mays [maize]
ref|XP_006447040.1|  hypothetical protein CICLE_v10017398mg           56.2    1e-07   
emb|CDY13678.1|  BnaA06g32450D                                        56.2    1e-07   
ref|XP_010680015.1|  PREDICTED: uncharacterized protein LOC104895255  56.2    1e-07   
ref|XP_006848292.1|  hypothetical protein AMTR_s00013p00100030        56.2    1e-07   
ref|XP_006580125.1|  PREDICTED: uncharacterized protein LOC102662714  56.2    1e-07   
dbj|BAD42942.1|  hypothetical protein                                 56.2    1e-07   Arabidopsis thaliana [mouse-ear cress]
gb|KFK28060.1|  hypothetical protein AALP_AA8G466600                  56.2    1e-07   
ref|XP_006338707.1|  PREDICTED: uncharacterized protein LOC102580109  56.2    1e-07   
ref|XP_011009186.1|  PREDICTED: uncharacterized protein LOC105114364  56.2    1e-07   
ref|XP_002298636.2|  hypothetical protein POPTR_0001s33630g           56.2    1e-07   Populus trichocarpa [western balsam poplar]
ref|XP_007161717.1|  hypothetical protein PHAVU_001G092500g           56.2    1e-07   
gb|EMS67281.1|  hypothetical protein TRIUR3_17967                     56.2    1e-07   
ref|XP_004138621.1|  PREDICTED: uncharacterized protein LOC101211888  57.4    1e-07   
ref|XP_010112378.1|  hypothetical protein L484_010783                 55.8    2e-07   
ref|XP_010530564.1|  PREDICTED: uncharacterized protein LOC104807141  55.8    2e-07   
gb|KFK33626.1|  hypothetical protein AALP_AA5G038000                  55.8    2e-07   
ref|XP_011098907.1|  PREDICTED: uncharacterized protein LOC105177440  55.8    2e-07   
gb|KCW55823.1|  hypothetical protein EUGRSUZ_I01640                   55.8    2e-07   
gb|AFK46474.1|  unknown                                               55.8    2e-07   
ref|XP_006594529.1|  PREDICTED: uncharacterized protein LOC102664775  55.8    2e-07   
ref|XP_004234309.1|  PREDICTED: uncharacterized protein LOC101248948  55.8    2e-07   
ref|XP_004515982.1|  PREDICTED: uncharacterized protein LOC101493732  55.8    2e-07   
gb|KHN41505.1|  hypothetical protein glysoja_039206                   56.2    2e-07   
gb|KEH18682.1|  transmembrane protein, putative                       56.6    2e-07   
ref|XP_006351515.1|  PREDICTED: uncharacterized protein LOC102599395  55.8    2e-07   
emb|CDY13677.1|  BnaA06g32460D                                        55.8    2e-07   
ref|XP_007031906.1|  Uncharacterized protein TCM_017235               55.8    2e-07   
ref|XP_010656087.1|  PREDICTED: uncharacterized protein LOC100262494  55.8    2e-07   
gb|AEW08927.1|  hypothetical protein CL2309Contig1_03                 55.8    2e-07   
gb|ACG35954.1|  hypothetical protein                                  55.5    2e-07   Zea mays [maize]
ref|XP_006582287.1|  PREDICTED: uncharacterized protein LOC102670423  55.5    2e-07   
ref|XP_008360131.1|  PREDICTED: uncharacterized protein LOC103423825  55.5    2e-07   
ref|XP_009149804.1|  PREDICTED: uncharacterized protein LOC103873125  55.5    2e-07   
ref|XP_009151994.1|  PREDICTED: uncharacterized protein LOC103875252  57.0    2e-07   
ref|XP_003544184.1|  PREDICTED: uncharacterized protein LOC100776055  55.5    2e-07   
ref|XP_004516406.1|  PREDICTED: uncharacterized protein LOC101504054  55.5    2e-07   
gb|KEH21985.1|  transmembrane protein, putative                       56.6    2e-07   
ref|XP_003631357.1|  PREDICTED: uncharacterized protein LOC100852987  55.5    2e-07   
ref|NP_201155.1|  uncharacterized protein                             55.5    2e-07   Arabidopsis thaliana [mouse-ear cress]
gb|KEH20614.1|  transmembrane protein, putative                       55.5    2e-07   
ref|XP_002321709.2|  hypothetical protein POPTR_0015s11010g           56.2    2e-07   Populus trichocarpa [western balsam poplar]
gb|AFK45356.1|  unknown                                               55.5    2e-07   
ref|XP_006373209.1|  hypothetical protein POPTR_0017s09670g           55.5    3e-07   
ref|XP_002877012.1|  hypothetical protein ARALYDRAFT_322830           56.6    3e-07   
ref|XP_006438002.1|  hypothetical protein CICLE_v10033318mg           55.5    3e-07   
ref|XP_002455352.1|  hypothetical protein SORBIDRAFT_03g009080        55.5    3e-07   Sorghum bicolor [broomcorn]
ref|XP_004967908.1|  PREDICTED: uncharacterized protein LOC101762723  55.5    3e-07   
ref|NP_189339.1|  uncharacterized protein                             56.6    3e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_190435.1|  uncharacterized protein                             55.8    3e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006395489.1|  hypothetical protein EUTSA_v10005506mg           57.0    3e-07   
emb|CDY11729.1|  BnaC06g13370D                                        55.1    3e-07   
gb|KCW61925.1|  hypothetical protein EUGRSUZ_H04621                   55.1    3e-07   
emb|CAN77119.1|  hypothetical protein VITISV_037262                   55.1    3e-07   Vitis vinifera
emb|CDX83043.1|  BnaA01g20430D                                        55.1    3e-07   
ref|XP_009150403.1|  PREDICTED: uncharacterized protein LOC103873762  55.1    3e-07   
ref|XP_007038004.1|  Uncharacterized protein TCM_014659               55.1    3e-07   
ref|XP_008351734.1|  PREDICTED: uncharacterized protein LOC103415161  55.1    3e-07   
gb|KDP26825.1|  hypothetical protein JCGZ_17983                       55.1    3e-07   
ref|XP_009372258.1|  PREDICTED: uncharacterized protein LOC103961441  55.1    3e-07   
ref|XP_002875914.1|  hypothetical protein ARALYDRAFT_323459           55.5    3e-07   
ref|XP_002449524.1|  hypothetical protein SORBIDRAFT_05g017500        55.1    3e-07   Sorghum bicolor [broomcorn]
ref|XP_008341292.1|  PREDICTED: uncharacterized protein LOC103404182  55.1    3e-07   
ref|XP_010660746.1|  PREDICTED: uncharacterized protein LOC100256574  55.1    3e-07   
ref|XP_009150183.1|  PREDICTED: uncharacterized protein LOC103873522  55.1    3e-07   
ref|XP_010680010.1|  PREDICTED: uncharacterized protein LOC104895250  55.1    3e-07   
ref|XP_008807446.1|  PREDICTED: uncharacterized protein LOC103719...  56.2    4e-07   
gb|KDP46268.1|  hypothetical protein JCGZ_10108                       55.1    4e-07   
ref|XP_010682738.1|  PREDICTED: uncharacterized protein LOC104897543  55.1    4e-07   
ref|XP_008678124.1|  PREDICTED: uncharacterized protein LOC100277266  56.6    4e-07   
ref|XP_010556291.1|  PREDICTED: uncharacterized protein LOC104825629  55.1    4e-07   
ref|XP_010456447.1|  PREDICTED: uncharacterized protein LOC104737892  55.1    4e-07   
ref|XP_002300114.1|  hypothetical protein POPTR_0001s33640g           54.7    4e-07   Populus trichocarpa [western balsam poplar]
ref|XP_010322518.1|  PREDICTED: uncharacterized protein LOC101251388  54.7    4e-07   
gb|ACG32653.1|  hypothetical protein                                  54.7    4e-07   Zea mays [maize]
gb|ADE76945.1|  unknown                                               54.7    4e-07   
ref|XP_006347392.1|  PREDICTED: uncharacterized protein LOC102602710  54.7    4e-07   
ref|XP_010027269.1|  PREDICTED: uncharacterized protein LOC104417744  57.4    4e-07   
ref|XP_003568948.1|  PREDICTED: uncharacterized protein LOC100830110  54.7    4e-07   
ref|XP_003531203.1|  PREDICTED: uncharacterized protein LOC100777861  54.7    4e-07   
ref|XP_009344919.1|  PREDICTED: uncharacterized protein LOC103936777  56.2    4e-07   
ref|XP_002456863.1|  hypothetical protein SORBIDRAFT_03g044200        55.1    5e-07   Sorghum bicolor [broomcorn]
ref|XP_008810234.1|  PREDICTED: uncharacterized protein LOC103721704  54.7    5e-07   
ref|NP_198913.1|  uncharacterized protein                             54.7    5e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002270989.1|  PREDICTED: uncharacterized protein LOC100251434  54.3    5e-07   Vitis vinifera
ref|XP_009771784.1|  PREDICTED: uncharacterized protein LOC104222268  54.3    6e-07   
ref|XP_009421065.1|  PREDICTED: uncharacterized protein LOC104000686  54.3    6e-07   
ref|NP_001044809.1|  Os01g0849500                                     54.3    6e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010232759.1|  PREDICTED: uncharacterized protein LOC100824068  56.2    6e-07   
ref|XP_008347999.1|  PREDICTED: uncharacterized protein LOC103411121  55.5    6e-07   
ref|XP_004979312.1|  PREDICTED: uncharacterized protein LOC101758057  54.3    6e-07   
ref|XP_007031908.1|  Uncharacterized protein TCM_017237               55.1    6e-07   
gb|KDP46266.1|  hypothetical protein JCGZ_10106                       55.1    6e-07   
ref|XP_007160023.1|  hypothetical protein PHAVU_002G286200g           54.3    7e-07   
ref|XP_007161716.1|  hypothetical protein PHAVU_001G092400g           54.3    7e-07   
ref|XP_006284885.1|  hypothetical protein CARUB_v10006177mg           54.3    7e-07   
ref|XP_009597110.1|  PREDICTED: uncharacterized protein LOC104093101  54.3    7e-07   
ref|NP_001067936.1|  Os11g0496500                                     54.3    7e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010528162.1|  PREDICTED: uncharacterized protein LOC104805325  55.5    7e-07   
ref|XP_004515066.1|  PREDICTED: uncharacterized protein LOC101492296  54.3    7e-07   
ref|XP_008441325.1|  PREDICTED: uncharacterized protein LOC103485474  54.3    7e-07   
ref|XP_008231104.1|  PREDICTED: uncharacterized protein LOC103330325  53.9    8e-07   
ref|XP_004236928.1|  PREDICTED: uncharacterized protein LOC101264206  53.9    8e-07   
ref|XP_010551939.1|  PREDICTED: uncharacterized protein LOC104822418  53.9    8e-07   
ref|XP_009415891.1|  PREDICTED: uncharacterized protein LOC103996657  53.9    8e-07   
ref|XP_004504402.1|  PREDICTED: uncharacterized protein LOC101504831  55.5    8e-07   
ref|XP_007158672.1|  hypothetical protein PHAVU_002G172700g           53.9    8e-07   
ref|XP_009131063.1|  PREDICTED: uncharacterized protein LOC103855781  53.9    8e-07   
ref|XP_006580126.1|  PREDICTED: uncharacterized protein LOC102662841  53.9    9e-07   
ref|XP_002297848.1|  hypothetical protein POPTR_0001s13690g           53.9    9e-07   Populus trichocarpa [western balsam poplar]
ref|XP_010423099.1|  PREDICTED: uncharacterized protein LOC104708251  54.7    9e-07   
gb|EMS57713.1|  hypothetical protein TRIUR3_30382                     53.9    9e-07   
ref|XP_003575012.1|  PREDICTED: uncharacterized protein LOC100826781  53.9    9e-07   
emb|CDY67025.1|  BnaCnng53210D                                        53.9    9e-07   
ref|XP_002509501.1|  conserved hypothetical protein                   53.5    9e-07   Ricinus communis
ref|XP_009419370.1|  PREDICTED: uncharacterized protein LOC103999354  53.9    1e-06   
ref|XP_004151235.1|  PREDICTED: uncharacterized protein LOC101208994  53.9    1e-06   
ref|XP_010028988.1|  PREDICTED: uncharacterized protein LOC104419132  53.5    1e-06   
ref|XP_010112381.1|  hypothetical protein L484_010786                 53.9    1e-06   
gb|ACG48702.1|  hypothetical protein                                  53.5    1e-06   Zea mays [maize]
emb|CBI21334.3|  unnamed protein product                              53.9    1e-06   
ref|XP_008798931.1|  PREDICTED: uncharacterized protein LOC103713699  53.5    1e-06   
ref|XP_006447045.1|  hypothetical protein CICLE_v10017396mg           53.5    1e-06   
ref|XP_010491472.1|  PREDICTED: uncharacterized protein LOC104769048  54.3    1e-06   
gb|KEH22004.1|  transmembrane protein, putative                       53.5    1e-06   
ref|XP_008347996.1|  PREDICTED: uncharacterized protein LOC103411119  53.5    1e-06   
ref|XP_009125729.1|  PREDICTED: uncharacterized protein LOC103850696  53.5    1e-06   
ref|NP_001046925.2|  Os02g0508100                                     53.5    1e-06   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001045237.1|  Os01g0923200                                     53.5    1e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008798930.1|  PREDICTED: uncharacterized protein LOC103713698  53.5    1e-06   
ref|XP_002453888.1|  hypothetical protein SORBIDRAFT_04g020640        53.5    1e-06   Sorghum bicolor [broomcorn]
ref|XP_003577555.1|  PREDICTED: uncharacterized protein LOC100843401  53.5    1e-06   
ref|XP_002304676.1|  hypothetical protein POPTR_0003s16900g           53.5    1e-06   Populus trichocarpa [western balsam poplar]
ref|XP_010250673.1|  PREDICTED: uncharacterized protein LOC104592859  53.5    1e-06   
gb|EYU34815.1|  hypothetical protein MIMGU_mgv11b019743mg             53.5    1e-06   
gb|KFK25206.1|  hypothetical protein AALP_AA8G080900                  53.5    1e-06   
emb|CBI21336.3|  unnamed protein product                              53.5    1e-06   
gb|ABA93771.1|  expressed protein                                     53.5    1e-06   
ref|XP_002871323.1|  hypothetical protein ARALYDRAFT_487673           53.1    1e-06   
gb|EMS62568.1|  hypothetical protein TRIUR3_03662                     53.5    1e-06   
ref|XP_007158670.1|  hypothetical protein PHAVU_002G172500g           53.5    1e-06   
ref|XP_006848286.1|  hypothetical protein AMTR_s00013p00095520        53.5    1e-06   
ref|XP_004971095.1|  PREDICTED: uncharacterized protein LOC101772582  53.5    1e-06   
ref|XP_008346680.1|  PREDICTED: uncharacterized protein LOC103409650  53.1    2e-06   
ref|XP_002439094.1|  hypothetical protein SORBIDRAFT_09g000370        53.1    2e-06   
ref|XP_007216210.1|  hypothetical protein PRUPE_ppa016180mg           53.1    2e-06   
dbj|BAD23191.1|  unknown protein                                      53.1    2e-06   
gb|KFK37650.1|  hypothetical protein AALP_AA3G010700                  53.1    2e-06   
ref|XP_009125166.1|  PREDICTED: uncharacterized protein LOC103850201  53.1    2e-06   
ref|NP_001054394.1|  Os05g0103400                                     53.1    2e-06   
ref|XP_006284883.1|  hypothetical protein CARUB_v10006174mg           53.1    2e-06   
ref|XP_003579615.1|  PREDICTED: uncharacterized protein LOC100836824  53.1    2e-06   
ref|XP_002300115.2|  hypothetical protein POPTR_0001s33620g           53.1    2e-06   
ref|XP_006436858.1|  hypothetical protein CICLE_v10033493mg           53.1    2e-06   
ref|XP_008810232.1|  PREDICTED: uncharacterized protein LOC103721701  52.8    2e-06   
ref|XP_011097274.1|  PREDICTED: uncharacterized protein LOC105176239  52.8    2e-06   
dbj|BAK05783.1|  predicted protein                                    52.8    2e-06   
ref|XP_004304527.1|  PREDICTED: uncharacterized protein LOC101292234  52.8    2e-06   
gb|ACG43521.1|  hypothetical protein                                  53.1    2e-06   
ref|XP_004515979.1|  PREDICTED: uncharacterized protein LOC101492304  52.8    2e-06   
gb|KFK25642.1|  hypothetical protein AALP_AA8G141200                  52.8    2e-06   
ref|XP_009402174.1|  PREDICTED: uncharacterized protein LOC103986032  52.8    3e-06   
ref|XP_008806424.1|  PREDICTED: uncharacterized protein LOC103719121  52.8    3e-06   
ref|XP_011098904.1|  PREDICTED: uncharacterized protein LOC105177437  52.4    3e-06   
gb|ACF80966.1|  unknown                                               52.4    3e-06   
ref|XP_008798929.1|  PREDICTED: uncharacterized protein LOC103713697  52.4    3e-06   
ref|XP_003525413.1|  PREDICTED: uncharacterized protein LOC100805083  53.1    3e-06   
ref|XP_008459846.1|  PREDICTED: uncharacterized protein LOC103498846  52.4    3e-06   
ref|XP_002270842.1|  PREDICTED: uncharacterized protein LOC100261...  53.9    3e-06   
ref|XP_006399920.1|  hypothetical protein EUTSA_v10015204mg           52.4    3e-06   
ref|XP_009404758.1|  PREDICTED: uncharacterized protein LOC103987996  52.4    3e-06   
ref|XP_002509499.1|  conserved hypothetical protein                   52.4    3e-06   
ref|XP_006405410.1|  hypothetical protein EUTSA_v10028018mg           52.4    3e-06   
ref|XP_009151995.1|  PREDICTED: uncharacterized protein LOC103875253  52.4    3e-06   
ref|XP_008341295.1|  PREDICTED: uncharacterized protein LOC103404185  52.4    4e-06   
ref|XP_008790764.1|  PREDICTED: uncharacterized protein LOC103707858  52.4    4e-06   
ref|XP_010680016.1|  PREDICTED: uncharacterized protein LOC104895256  52.0    4e-06   
gb|EMS45582.1|  hypothetical protein TRIUR3_17661                     52.4    4e-06   
ref|XP_002297849.2|  hypothetical protein POPTR_0001s13680g           52.8    4e-06   
ref|NP_198912.1|  uncharacterized protein                             52.0    4e-06   
emb|CDM85796.1|  unnamed protein product                              52.4    4e-06   
dbj|BAK05016.1|  predicted protein                                    52.0    4e-06   
gb|EMT04963.1|  hypothetical protein F775_27729                       52.0    4e-06   
dbj|BAK06202.1|  predicted protein                                    52.0    4e-06   
ref|XP_004138622.1|  PREDICTED: uncharacterized protein LOC101212134  52.0    4e-06   
ref|XP_003553936.1|  PREDICTED: uncharacterized protein LOC100794064  52.0    4e-06   
ref|NP_001119192.1|  uncharacterized protein                          52.0    4e-06   
ref|XP_009131386.1|  PREDICTED: uncharacterized protein LOC103856060  52.0    4e-06   
dbj|BAJ92955.1|  predicted protein                                    52.0    4e-06   
ref|XP_010250671.1|  PREDICTED: uncharacterized protein LOC104592857  52.0    5e-06   
gb|ABK25714.1|  unknown                                               52.0    5e-06   
ref|XP_002459730.1|  hypothetical protein SORBIDRAFT_02g009520        52.0    5e-06   
ref|XP_003549176.1|  PREDICTED: uncharacterized protein LOC100820286  52.0    5e-06   
ref|XP_008341293.1|  PREDICTED: uncharacterized protein LOC103404183  51.6    5e-06   
emb|CDX70542.1|  BnaC03g06260D                                        52.0    5e-06   
ref|XP_008652274.1|  PREDICTED: uncharacterized protein LOC103632238  52.0    5e-06   
ref|XP_004960934.1|  PREDICTED: uncharacterized protein LOC101766876  51.6    5e-06   
emb|CDX78560.1|  BnaA03g04720D                                        51.6    6e-06   
emb|CDX77093.1|  BnaC04g38880D                                        51.6    6e-06   
ref|XP_002868622.1|  hypothetical protein ARALYDRAFT_916123           51.6    6e-06   
ref|XP_008379108.1|  PREDICTED: uncharacterized protein LOC103442131  51.6    6e-06   
ref|XP_006645248.1|  PREDICTED: uncharacterized protein LOC102707917  51.6    6e-06   
ref|XP_009344918.1|  PREDICTED: uncharacterized protein LOC103936776  51.6    7e-06   
gb|EMT23663.1|  hypothetical protein F775_26540                       51.6    7e-06   
ref|XP_011098906.1|  PREDICTED: uncharacterized protein LOC105177439  51.6    7e-06   
gb|EMT07012.1|  hypothetical protein F775_42741                       52.0    7e-06   
ref|XP_004173967.1|  PREDICTED: uncharacterized protein LOC101232695  51.2    7e-06   
ref|XP_004960935.1|  PREDICTED: uncharacterized protein LOC101767288  51.2    8e-06   
ref|XP_003549164.1|  PREDICTED: uncharacterized protein LOC100306597  51.2    8e-06   
ref|XP_009344922.1|  PREDICTED: uncharacterized protein LOC103936782  51.2    9e-06   
ref|XP_009121695.1|  PREDICTED: uncharacterized protein LOC103846509  51.2    9e-06   
emb|CDY58411.1|  BnaC09g54570D                                        51.2    9e-06   
ref|XP_011097269.1|  PREDICTED: uncharacterized protein LOC105176235  51.2    9e-06   
ref|NP_001052628.1|  Os04g0387600                                     51.2    9e-06   
dbj|BAD23654.1|  hypothetical protein                                 51.2    1e-05   
ref|XP_010680018.1|  PREDICTED: uncharacterized protein LOC104895258  50.8    1e-05   
ref|XP_003549157.1|  PREDICTED: uncharacterized protein LOC100809615  50.8    1e-05   
gb|EMS45275.1|  hypothetical protein TRIUR3_20548                     50.8    1e-05   
emb|CDY68347.1|  BnaAnng27000D                                        50.8    1e-05   
ref|XP_003553939.1|  PREDICTED: uncharacterized protein LOC100526927  50.8    1e-05   
gb|ACG31176.1|  hypothetical protein                                  50.8    1e-05   
gb|AFW77189.1|  hypothetical protein ZEAMMB73_086897                  50.8    1e-05   
ref|XP_007161713.1|  hypothetical protein PHAVU_001G092100g           50.8    1e-05   
gb|EYU34817.1|  hypothetical protein MIMGU_mgv1a018707mg              50.8    1e-05   
ref|XP_006395490.1|  hypothetical protein EUTSA_v10005242mg           50.8    1e-05   
ref|XP_009416571.1|  PREDICTED: uncharacterized protein LOC103997149  50.8    1e-05   
ref|NP_198914.1|  uncharacterized protein                             50.8    1e-05   
ref|XP_009125964.1|  PREDICTED: uncharacterized protein LOC103850916  50.8    1e-05   
gb|EMT15753.1|  hypothetical protein F775_43850                       51.6    1e-05   
ref|XP_009125167.1|  PREDICTED: uncharacterized protein LOC103850202  50.4    1e-05   
ref|XP_010420033.1|  PREDICTED: uncharacterized protein LOC104705680  50.8    1e-05   
ref|XP_006447041.1|  hypothetical protein CICLE_v10017392mg           50.8    1e-05   
ref|XP_006299323.1|  hypothetical protein CARUB_v10015480mg           50.8    1e-05   
gb|EYU45420.1|  hypothetical protein MIMGU_mgv1a017520mg              50.4    2e-05   
ref|XP_010249052.1|  PREDICTED: uncharacterized protein LOC104591753  50.4    2e-05   
ref|XP_003601754.1|  Katanin p80 subunit-like protein                 50.4    2e-05   
ref|XP_003553940.1|  PREDICTED: uncharacterized protein LOC100796180  50.4    2e-05   
ref|XP_003564612.2|  PREDICTED: uncharacterized protein LOC100824890  50.4    2e-05   
ref|NP_001118713.1|  uncharacterized protein                          50.4    2e-05   
ref|XP_004304526.1|  PREDICTED: uncharacterized protein LOC101291944  50.4    2e-05   
ref|XP_009788053.1|  PREDICTED: uncharacterized protein LOC104235919  50.4    2e-05   
ref|XP_009406320.1|  PREDICTED: uncharacterized protein LOC103989242  50.1    2e-05   
ref|XP_002456636.1|  hypothetical protein SORBIDRAFT_03g039900        50.1    2e-05   
ref|XP_009390391.1|  PREDICTED: uncharacterized protein LOC103976791  50.1    2e-05   
ref|XP_006402079.1|  hypothetical protein EUTSA_v10015879mg           50.1    2e-05   
ref|XP_009606511.1|  PREDICTED: uncharacterized protein LOC104100865  50.1    2e-05   
ref|XP_002884251.1|  hypothetical protein ARALYDRAFT_477317           50.1    2e-05   
ref|XP_001760825.1|  predicted protein                                50.1    2e-05   
ref|XP_004975405.1|  PREDICTED: uncharacterized protein LOC101768729  50.1    2e-05   
emb|CDX85612.1|  BnaA02g02010D                                        53.5    2e-05   
ref|XP_006285635.1|  hypothetical protein CARUB_v10007088mg           50.1    2e-05   
gb|EMS52236.1|  hypothetical protein TRIUR3_01824                     50.1    2e-05   
gb|EMT00249.1|  hypothetical protein F775_21667                       50.1    3e-05   
gb|EMS49217.1|  hypothetical protein TRIUR3_07383                     50.4    3e-05   
gb|EMS47260.1|  hypothetical protein TRIUR3_27395                     49.7    3e-05   
dbj|BAK02583.1|  predicted protein                                    49.7    3e-05   
ref|NP_186844.1|  uncharacterized protein                             49.7    3e-05   
ref|XP_007161714.1|  hypothetical protein PHAVU_001G092200g           49.7    3e-05   
ref|XP_002873649.1|  hypothetical protein ARALYDRAFT_909368           49.7    3e-05   
ref|XP_004231771.1|  PREDICTED: uncharacterized protein LOC101266083  49.7    3e-05   
ref|XP_006292147.1|  hypothetical protein CARUB_v10018351mg           49.7    3e-05   
gb|ABK28273.1|  unknown                                               49.7    3e-05   
gb|EMS52235.1|  hypothetical protein TRIUR3_01823                     49.7    3e-05   
gb|AAB07877.1|  localized according to blastn similarity to EST s...  49.7    3e-05   
ref|XP_007216639.1|  hypothetical protein PRUPE_ppb025443mg           49.7    3e-05   
gb|EMS48358.1|  hypothetical protein TRIUR3_06279                     49.7    3e-05   
ref|XP_008231103.1|  PREDICTED: uncharacterized protein LOC103330324  49.3    4e-05   
ref|NP_196915.1|  uncharacterized protein                             49.7    4e-05   
emb|CDX71672.1|  BnaC09g27130D                                        49.3    4e-05   
ref|XP_010024171.1|  PREDICTED: uncharacterized protein LOC104414707  49.3    4e-05   
ref|XP_009107435.1|  PREDICTED: uncharacterized protein LOC103833087  49.3    4e-05   
ref|XP_004955990.1|  PREDICTED: uncharacterized protein LOC101770220  49.7    4e-05   
emb|CDP16708.1|  unnamed protein product                              49.3    5e-05   
ref|XP_010249053.1|  PREDICTED: uncharacterized protein LOC104591754  49.3    5e-05   
ref|XP_010680011.1|  PREDICTED: uncharacterized protein LOC104895252  49.3    5e-05   
ref|XP_001763506.1|  predicted protein                                48.5    6e-05   
gb|EPS58440.1|  hypothetical protein M569_16375                       48.9    6e-05   
gb|EPS62813.1|  hypothetical protein M569_11976                       48.9    6e-05   
emb|CDP06286.1|  unnamed protein product                              52.0    7e-05   
dbj|BAJ97857.1|  predicted protein                                    48.5    7e-05   
gb|KCW60621.1|  hypothetical protein EUGRSUZ_H03346                   49.3    7e-05   
ref|XP_008239629.1|  PREDICTED: uncharacterized protein LOC103338223  48.5    7e-05   
ref|XP_001751826.1|  predicted protein                                48.9    7e-05   
ref|XP_004502277.1|  PREDICTED: uncharacterized protein LOC101502767  48.5    7e-05   
ref|XP_008669105.1|  PREDICTED: uncharacterized protein LOC103646162  49.3    8e-05   
ref|XP_004515980.1|  PREDICTED: uncharacterized protein LOC101493085  48.5    9e-05   
ref|XP_009129455.1|  PREDICTED: uncharacterized protein LOC103854274  48.1    1e-04   
emb|CDY05817.1|  BnaA10g06030D                                        48.1    1e-04   
ref|XP_006365032.1|  PREDICTED: uncharacterized protein LOC102587038  48.1    1e-04   
ref|XP_004233289.1|  PREDICTED: uncharacterized protein LOC101246593  48.1    1e-04   
ref|XP_009415890.1|  PREDICTED: uncharacterized protein LOC103996656  47.8    1e-04   
ref|XP_011097273.1|  PREDICTED: uncharacterized protein LOC105176238  47.8    1e-04   
ref|XP_004970580.1|  PREDICTED: uncharacterized protein LOC101778421  47.8    2e-04   
gb|KEH21990.1|  AT.I.24-6 protein, putative                           47.8    2e-04   
ref|XP_006657625.1|  PREDICTED: uncharacterized protein LOC102711082  47.8    2e-04   
ref|XP_011071239.1|  PREDICTED: uncharacterized protein LOC105156716  47.4    2e-04   
ref|XP_009410640.1|  PREDICTED: uncharacterized protein LOC103992590  47.4    2e-04   
ref|XP_004152116.1|  PREDICTED: uncharacterized protein LOC101215245  47.4    2e-04   
ref|NP_001175149.1|  Os07g0298400                                     47.4    2e-04   
gb|EMT10577.1|  hypothetical protein F775_16458                       47.4    3e-04   
ref|XP_004231772.1|  PREDICTED: uncharacterized protein LOC101266377  47.0    3e-04   
ref|XP_011086005.1|  PREDICTED: senescence-specific cysteine prot...  50.1    3e-04   
ref|XP_006373212.1|  hypothetical protein POPTR_0017s09700g           47.0    3e-04   
gb|AFK41536.1|  unknown                                               47.0    4e-04   
ref|XP_009381336.1|  PREDICTED: uncharacterized protein LOC103969512  47.0    4e-04   
ref|XP_009601177.1|  PREDICTED: uncharacterized protein LOC104096500  46.6    4e-04   
gb|EYU45419.1|  hypothetical protein MIMGU_mgv1a026268mg              46.6    5e-04   
ref|XP_006338704.1|  PREDICTED: uncharacterized protein LOC102579145  46.6    5e-04   
emb|CDY11730.1|  BnaC06g13380D                                        46.2    5e-04   
ref|XP_010112379.1|  hypothetical protein L484_010784                 46.6    5e-04   
emb|CDY52401.1|  BnaC07g49000D                                        49.3    6e-04   
ref|XP_008347997.1|  PREDICTED: uncharacterized protein LOC103411120  46.2    7e-04   



>ref|XP_006447043.1| hypothetical protein CICLE_v10017400mg [Citrus clementina]
 gb|ESR60283.1| hypothetical protein CICLE_v10017400mg [Citrus clementina]
 gb|KDO63903.1| hypothetical protein CISIN_1g035278mg [Citrus sinensis]
Length=69

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I  VLFVLLQPGL+ Q+PG  RL+EF +MKT+ KAI VHTL
Sbjct  3    DWGPVVIGVVLFVLLQPGLLFQLPGHSRLLEFGSMKTNGKAISVHTL  49



>ref|XP_009606513.1| PREDICTED: uncharacterized protein LOC104100866 [Nicotiana tomentosiformis]
 ref|XP_009788054.1| PREDICTED: uncharacterized protein LOC104235920 [Nicotiana sylvestris]
Length=69

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI  VLF+LLQPGL+ QIPG  R +EF +MKT+ KAI VHTL
Sbjct  3    DWGPVLIGVVLFILLQPGLLFQIPGNNRTLEFGSMKTNGKAIAVHTL  49



>gb|KDO39368.1| hypothetical protein CISIN_1g039872mg [Citrus sinensis]
Length=69

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I  VLFVLLQPGL+ Q+PG  RL+EF +MKT+ KAI VHTL
Sbjct  3    DWGPVVIGVVLFVLLQPGLLFQLPGHNRLLEFGSMKTNGKAISVHTL  49



>gb|EYU34816.1| hypothetical protein MIMGU_mgv1a023280mg [Erythranthe guttata]
Length=69

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI  VLF+LLQPGL+ +IPG  R +EF TMKT+ KAI VHTL
Sbjct  3    DWGPVLIGVVLFILLQPGLLFEIPGNNRHVEFGTMKTNGKAIAVHTL  49



>gb|EYU45418.1| hypothetical protein MIMGU_mgv1a025760mg [Erythranthe guttata]
Length=139

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI  VLF+LLQPGL+ QIPG+ R +EF TMKT+ KAI VHTL
Sbjct  73   DWGPVLIGVVLFILLQPGLLFQIPGKNRHVEFGTMKTNGKAIAVHTL  119



>ref|XP_011098905.1| PREDICTED: uncharacterized protein LOC105177438 [Sesamum indicum]
Length=69

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI  VLF+LLQPGL+ Q+PG  R +EF +MKT+ KAI VHTL
Sbjct  3    DWGPVLIGVVLFILLQPGLLFQLPGNNRQVEFGSMKTNGKAIAVHTL  49



>ref|XP_006470082.1| PREDICTED: uncharacterized protein LOC102613711 [Citrus sinensis]
Length=140

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I  VLFVLLQPGL+ Q+PG  RL+EF +MKT+ KAI VHTL
Sbjct  74   DWGPVVIGVVLFVLLQPGLLFQLPGHSRLLEFGSMKTNGKAISVHTL  120


 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  +  VLF+LL PGL++Q+PG  R  EF   +TS  +I VH++
Sbjct  3    DWGPVFVGVVLFILLSPGLLIQVPGRNRFFEFGNFQTSGASILVHSI  49



>ref|XP_004231770.1| PREDICTED: uncharacterized protein LOC101265785 [Solanum lycopersicum]
Length=144

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI  VLF+LLQPGL+ QIPG  R +EF +MKT+ KAI VHTL
Sbjct  78   DWGPVLIGVVLFILLQPGLLFQIPGNNRTLEFGSMKTNGKAIAVHTL  124



>ref|XP_006338705.1| PREDICTED: uncharacterized protein LOC102579469 [Solanum tuberosum]
Length=142

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI  VLF+LLQPGL+ QIPG  R +EF +MKT+ KAI VHTL
Sbjct  76   DWGPVLIGVVLFILLQPGLLFQIPGNNRTLEFGSMKTNGKAIAVHTL  122



>gb|KHN48794.1| hypothetical protein glysoja_030564 [Glycine soja]
Length=84

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI  VLFVLLQPGL+   PG +  +EF +MKT+ KAIF+HTL
Sbjct  3    DWAPVLIGVVLFVLLQPGLLFSFPGNREQLEFGSMKTNGKAIFIHTL  49



>ref|XP_007161715.1| hypothetical protein PHAVU_001G092300g [Phaseolus vulgaris]
 gb|ESW33709.1| hypothetical protein PHAVU_001G092300g [Phaseolus vulgaris]
Length=69

 Score = 62.8 bits (151),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI  VLFVLLQPGL+   PG  + +EF +MKT+ KAIF+HTL
Sbjct  3    DWAPVLIGVVLFVLLQPGLLFSFPGNGKQLEFGSMKTNGKAIFIHTL  49



>ref|XP_003553938.1| PREDICTED: uncharacterized protein LOC100795123 [Glycine max]
 gb|KHN20824.1| hypothetical protein glysoja_043697 [Glycine soja]
Length=69

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI  VLFVLLQPGL+   PG  + +EF +MKT+ KAIF+HTL
Sbjct  3    DWAPVLIGVVLFVLLQPGLLFSFPGNGKQLEFGSMKTNGKAIFIHTL  49



>gb|KDP46267.1| hypothetical protein JCGZ_10107 [Jatropha curcas]
Length=69

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI  VLFVLL PGL+ QIPG  R +EF +MKT+ KAI VHTL
Sbjct  3    DWGPVLIGVVLFVLLTPGLLFQIPGNSRQLEFGSMKTNGKAIAVHTL  49



>ref|XP_008231102.1| PREDICTED: uncharacterized protein LOC103330323 [Prunus mume]
Length=69

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI  VLF+LLQPGL+  +PG  R +EF +MKT+ KAI VHTL
Sbjct  3    DWGPILIGVVLFILLQPGLLFSLPGNSRQVEFGSMKTNGKAIAVHTL  49



>dbj|BAD45503.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAY72170.1| hypothetical protein OsI_00019 [Oryza sativa Indica Group]
 gb|EAZ10189.1| hypothetical protein OsJ_00016 [Oryza sativa Japonica Group]
Length=72

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = +2

Query  329  GDWLPFLISAVLFVLLQPGLIVQIPGEK-RLIEFRTMKTSFKAIFVHTL  472
            GDW P LI+ VLFVLL PGL+ QIPG   R+ EF +M+TS  +IFVH L
Sbjct  4    GDWGPVLIALVLFVLLTPGLLCQIPGSNGRVAEFHSMRTSVASIFVHAL  52



>ref|XP_010112380.1| hypothetical protein L484_010785 [Morus notabilis]
 gb|EXC33375.1| hypothetical protein L484_010785 [Morus notabilis]
Length=69

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI  VLFVLLQPGL+ Q+PG  R +EF +MKT+ K+I VHTL
Sbjct  3    DWGPVLIGVVLFVLLQPGLLFQLPGHSRPMEFGSMKTNGKSIAVHTL  49



>ref|XP_010695381.1| PREDICTED: uncharacterized protein LOC104908027 [Beta vulgaris 
subsp. vulgaris]
Length=69

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ QIPG  R+IEF +M+TS  +I VHT+
Sbjct  3    DWGPVVIAVVLFVLLTPGLLFQIPGRGRIIEFGSMQTSGASILVHTI  49



>ref|XP_006604976.1| PREDICTED: uncharacterized protein LOC100799722 [Glycine max]
Length=250

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  329  GDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
             DW P LI  VLFVLLQPGL+   PG +  +EF +MKT+ KAIF+HTL
Sbjct  2    SDWAPVLIGVVLFVLLQPGLLFSFPGNREQLEFGSMKTNGKAIFIHTL  49



>ref|XP_010250672.1| PREDICTED: uncharacterized protein LOC104592858 [Nelumbo nucifera]
Length=69

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI  +LFVLL PGL+ QIPG  R +EF + KT+ KA+FVHT+
Sbjct  3    DWAPVLIGVLLFVLLSPGLLFQIPGNNRPVEFGSFKTNGKAVFVHTV  49



>gb|EPS58439.1| hypothetical protein M569_16374 [Genlisea aurea]
Length=141

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  329  GDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
             DW P LI  VLF+LLQPGL+ QIPG  R +EF +MKT+ KAI +HTL
Sbjct  74   ADWGPVLIGVVLFILLQPGLLFQIPGNNRPVEFGSMKTNGKAIALHTL  121


 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  ++ VLFV+L PGL++Q+PG  R +EF   +TS  +I VH +
Sbjct  3    DWGPVFVAVVLFVMLTPGLLIQVPGRSRYVEFGNFQTSGVSILVHAV  49



>ref|XP_010028990.1| PREDICTED: uncharacterized protein LOC104419133 [Eucalyptus grandis]
Length=142

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  RRGDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            R  DW P LI  VLFVLLQPGL+  IPGE + +EF  MKT+ KAI  HTL
Sbjct  73   RMADWAPVLIGVVLFVLLQPGLLFAIPGEGKQLEFGKMKTNGKAIAFHTL  122


 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  ++ VLFVLL PGL++QIPG+ R IEF   +TS  ++ VH++
Sbjct  3    DWGPVFVAMVLFVLLTPGLLIQIPGKHRFIEFGNFQTSGASVLVHSI  49



>gb|KCW55821.1| hypothetical protein EUGRSUZ_I01638 [Eucalyptus grandis]
Length=69

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI  VLFVLLQPGL+  IPGE + +EF  MKT+ KAI  HTL
Sbjct  3    DWAPVLIGVVLFVLLQPGLLFAIPGEGKQLEFGKMKTNGKAIAFHTL  49



>ref|XP_010112382.1| hypothetical protein L484_010787 [Morus notabilis]
 gb|EXC33377.1| hypothetical protein L484_010787 [Morus notabilis]
Length=69

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI+ VLFVLL PGLI Q+PG  R ++F   +TS  +IFVHTL
Sbjct  3    DWGPVLIAVVLFVLLMPGLICQVPGNSRAVDFCNRQTSGISIFVHTL  49



>ref|XP_010663762.1| PREDICTED: uncharacterized protein LOC100247554 [Vitis vinifera]
Length=69

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI+ VLFVLL PGL+ Q+PG+ R++EF +M TS  +I VHT+
Sbjct  3    DWGPVLIAVVLFVLLTPGLLFQVPGKNRVVEFGSMHTSGASILVHTI  49



>ref|XP_009612663.1| PREDICTED: uncharacterized protein LOC104105934 [Nicotiana tomentosiformis]
 ref|XP_009793453.1| PREDICTED: uncharacterized protein LOC104240321 [Nicotiana sylvestris]
Length=69

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI+ VLFVLL PGL+ Q+PG  +++EF  M+TS  AI VHT+
Sbjct  3    DWGPVLIAVVLFVLLSPGLLFQLPGRGKVVEFGGMQTSGAAILVHTV  49



>emb|CDP13357.1| unnamed protein product [Coffea canephora]
Length=69

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL++Q+PG  R++EF  M+TS  +I VHT+
Sbjct  3    DWGPVVIAVVLFVLLSPGLLIQLPGRSRVVEFGNMQTSGLSILVHTI  49



>ref|XP_009597109.1| PREDICTED: uncharacterized protein LOC104093100 [Nicotiana tomentosiformis]
Length=69

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I  VLF+LLQPGL+ QIPG  R +E   MKT+ KAI VHTL
Sbjct  3    DWGPVIIGVVLFILLQPGLLFQIPGNGRSLEVGGMKTNGKAIAVHTL  49



>emb|CDP16707.1| unnamed protein product [Coffea canephora]
Length=69

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI  VLFVLLQPGL+ Q PG  + +EF +MKT+ K+I VHTL
Sbjct  3    DWGPVLIGVVLFVLLQPGLLFQFPGNNKNLEFGSMKTNGKSIAVHTL  49



>ref|XP_004967907.1| PREDICTED: uncharacterized protein LOC101762316 [Setaria italica]
Length=70

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGE-KRLIEFRTMKTSFKAIFVHTL  472
            DW P LI+ + FVLL PGLI QIPG   RL EF +M+TS  AIFVHTL
Sbjct  3    DWGPVLIAVLFFVLLTPGLICQIPGSGGRLPEFHSMRTSGMAIFVHTL  50



>emb|CBI15682.3| unnamed protein product [Vitis vinifera]
Length=138

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI+ VLFVLL PGL+ Q+PG+ R++EF +M TS  +I VHT+
Sbjct  24   DWGPVLIAVVLFVLLTPGLLFQVPGKNRVVEFGSMHTSGASILVHTI  70



>gb|ABR25956.1| unknown [Oryza sativa Indica Group]
Length=105

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LIS VLF+LL PGL+ QIPG+ RLIEF   +TS  +I VHT+
Sbjct  36   DWGPVLISWVLFILLSPGLLFQIPGKCRLIEFGKFQTSVVSILVHTI  82



>ref|XP_009771781.1| PREDICTED: uncharacterized protein LOC104222266 [Nicotiana sylvestris]
Length=69

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I  VLF+LLQPGL+ QIPG  R +E   MKT+ KAI VHTL
Sbjct  3    DWGPVVIGVVLFILLQPGLLFQIPGNGRSLEVGGMKTNGKAIAVHTL  49



>ref|XP_006591443.1| PREDICTED: uncharacterized protein LOC100787382 [Glycine max]
 gb|KHN44452.1| hypothetical protein glysoja_014493 [Glycine soja]
Length=69

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ Q+PG+ R++EF  M+TS  +I VHT+
Sbjct  3    DWGPVVIAVVLFVLLSPGLVFQLPGKSRVVEFGNMQTSAVSILVHTI  49



>gb|KCW44914.1| hypothetical protein EUGRSUZ_L01505 [Eucalyptus grandis]
Length=121

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ QIPG  R++EF  M+TS  +I VHT+
Sbjct  55   DWGPVVIAVVLFVLLSPGLLFQIPGRHRVVEFGNMETSGASILVHTI  101



>ref|NP_001054393.1| Os05g0103300 [Oryza sativa Japonica Group]
 gb|AAS88826.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16307.1| Os05g0103300 [Oryza sativa Japonica Group]
 gb|EAY96207.1| hypothetical protein OsI_18094 [Oryza sativa Indica Group]
 dbj|BAG88512.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92546.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62008.1| hypothetical protein OsJ_16790 [Oryza sativa Japonica Group]
Length=72

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LIS VLF+LL PGL+ QIPG+ RLIEF   +TS  +I VHT+
Sbjct  3    DWGPVLISWVLFILLSPGLLFQIPGKCRLIEFGKFQTSVVSILVHTI  49



>ref|XP_010026396.1| PREDICTED: uncharacterized protein LOC104416742 [Eucalyptus grandis]
 ref|XP_010040800.1| PREDICTED: uncharacterized protein LOC104429649 [Eucalyptus grandis]
 gb|KCW83143.1| hypothetical protein EUGRSUZ_B00099 [Eucalyptus grandis]
Length=69

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ QIPG  R++EF  M+TS  +I VHT+
Sbjct  3    DWGPVVIAVVLFVLLSPGLLFQIPGRHRVVEFGNMETSGASILVHTI  49



>ref|XP_003549169.1| PREDICTED: uncharacterized protein LOC100816029 [Glycine max]
Length=69

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW   LI  VLFVLLQPGL+   PG  + +EF +MKT+ KAIF+HTL
Sbjct  3    DWATVLIGVVLFVLLQPGLLFSFPGNGKQLEFGSMKTNGKAIFIHTL  49



>ref|XP_004503745.1| PREDICTED: uncharacterized protein LOC101508777 [Cicer arietinum]
Length=69

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ QIPG  R+IEF  M+TS  +I VH +
Sbjct  3    DWGPVIIAVVLFVLLSPGLLFQIPGRGRVIEFGNMQTSGASILVHAI  49



>gb|KDO63902.1| hypothetical protein CISIN_1g035267mg [Citrus sinensis]
Length=69

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I  +LFVLLQPGL+ Q+PG  R +EF +MKT+ KAI VH+L
Sbjct  3    DWGPVVIGVLLFVLLQPGLLFQLPGHNRQLEFGSMKTNGKAIAVHSL  49



>ref|XP_010024172.1| PREDICTED: uncharacterized protein LOC104414708 [Eucalyptus grandis]
 gb|KCW60622.1| hypothetical protein EUGRSUZ_H03347 [Eucalyptus grandis]
Length=69

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI  VLFVLLQPGL+ Q+PG  R ++F  MKT+ K+I VHTL
Sbjct  3    DWGPVLIGVVLFVLLQPGLLFQLPGHHRHLDFGGMKTNGKSIAVHTL  49



>emb|CDY28499.1| BnaC02g36610D [Brassica napus]
Length=69

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P L+  VLFV+L PGL+  IPG  R+++F  +KT+ KAI VHTL
Sbjct  3    DWAPVLVGVVLFVILSPGLLFSIPGNNRVVDFGNLKTNGKAIAVHTL  49



>ref|XP_007217459.1| hypothetical protein PRUPE_ppa026813mg [Prunus persica]
 gb|EMJ18658.1| hypothetical protein PRUPE_ppa026813mg [Prunus persica]
Length=139

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI  VLF+LLQPGL+  +PG  R +EF +MKT+ KAI VHTL
Sbjct  73   DWGPILIGVVLFILLQPGLLFSLPGNSRQVEFGSMKTNGKAIAVHTL  119


 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  I+ VLF+LL PGL++Q+PG+ R +EF   +TS  +I VH++
Sbjct  3    DWGPVFIAVVLFILLTPGLLIQMPGKSRFVEFGNFQTSGISILVHSI  49



>ref|XP_006447044.1| hypothetical protein CICLE_v10018377mg [Citrus clementina]
 gb|ESR60284.1| hypothetical protein CICLE_v10018377mg [Citrus clementina]
 gb|KDO63904.1| hypothetical protein CISIN_1g035029mg [Citrus sinensis]
Length=75

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW   LI+A LF  L PGL+VQ+P + R ++F  MKTS  AIFVHT+
Sbjct  3    DWAAPLIAAALFAFLSPGLVVQMPAKNRAVDFLNMKTSIAAIFVHTV  49



>ref|XP_010026362.1| PREDICTED: uncharacterized protein LOC104416706 [Eucalyptus grandis]
Length=96

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ +LFVLL PGL+ QIPG  R +EF  M+TS  +IFVHT+
Sbjct  30   DWGPVVIAVLLFVLLSPGLLFQIPGRHRFVEFGNMETSGASIFVHTI  76



>ref|XP_010037403.1| PREDICTED: uncharacterized protein LOC104426149 [Eucalyptus grandis]
Length=69

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  329  GDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            GDW P +I+ VLFVLL PGL+ QIPG  R++EF  M+TS  ++ VH +
Sbjct  2    GDWGPVIIAVVLFVLLSPGLLFQIPGRHRVVEFGNMQTSGASVIVHAV  49



>ref|XP_007216168.1| hypothetical protein PRUPE_ppa015651mg [Prunus persica]
 ref|XP_008231100.1| PREDICTED: uncharacterized protein LOC103330321 [Prunus mume]
 gb|EMJ17367.1| hypothetical protein PRUPE_ppa015651mg [Prunus persica]
Length=69

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ Q+PG  R++EF  M+TS  +I VHT+
Sbjct  3    DWGPVVIAVVLFVLLTPGLLFQLPGNSRVVEFNNMQTSGVSILVHTI  49



>ref|XP_009375198.1| PREDICTED: uncharacterized protein LOC103964039 [Pyrus x bretschneideri]
 ref|XP_009344273.1| PREDICTED: uncharacterized protein LOC103936158 [Pyrus x bretschneideri]
Length=69

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ QIPG  RL+EF  M+TS  +I VH +
Sbjct  3    DWGPVVIAVVLFVLLTPGLLFQIPGRGRLVEFGNMQTSAASIVVHAI  49



>ref|XP_004306304.1| PREDICTED: uncharacterized protein LOC101306369 [Fragaria vesca 
subsp. vesca]
Length=72

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI+  LFVLL PGL+ Q+PG+ R++EF  M+TS  +I VHT+
Sbjct  3    DWGPVLIAVALFVLLTPGLLFQLPGKSRVVEFNNMQTSGVSILVHTI  49



>ref|XP_010503500.1| PREDICTED: uncharacterized protein LOC104780677 [Camelina sativa]
Length=69

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ +LFVLL PGL+ QIPG  R++EF  M+TS  +I VHT+
Sbjct  3    DWGPVVIAVILFVLLTPGLLFQIPGRGRVVEFGNMQTSGASILVHTI  49



>gb|AFK41617.1| unknown [Medicago truncatula]
 gb|KEH22000.1| transmembrane protein, putative [Medicago truncatula]
Length=69

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I  VLFV LQPGL+   PG  + +EF  MKT+ KAIF+HTL
Sbjct  3    DWAPVVIGVVLFVFLQPGLLFSFPGNGKQLEFGGMKTNGKAIFIHTL  49



>ref|XP_008346681.1| PREDICTED: uncharacterized protein LOC103409651 [Malus domestica]
Length=69

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ QIPG  RL+EF  M+TS  +I VH +
Sbjct  3    DWGPVVIAVVLFVLLTPGLLFQIPGRGRLVEFGNMQTSGASIVVHAI  49



>gb|EPS61900.1| hypothetical protein M569_12894 [Genlisea aurea]
Length=69

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI+ VLFVLL PGL+ Q+PG  R+++F TM TS  +I VHT+
Sbjct  3    DWGPVLIATVLFVLLTPGLLFQLPGRNRVVDFGTMHTSGLSILVHTV  49



>ref|XP_009594856.1| PREDICTED: uncharacterized protein LOC104091270 [Nicotiana tomentosiformis]
Length=69

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI+ VLFVLL PGL+ Q+PG  +++EF  M+TS  +I VHT+
Sbjct  3    DWGPVLIAVVLFVLLTPGLLFQLPGRGKVVEFGNMQTSGASILVHTI  49



>ref|XP_004138623.1| PREDICTED: uncharacterized protein LOC101212375 [Cucumis sativus]
 ref|XP_004158498.1| PREDICTED: uncharacterized protein LOC101226364 [Cucumis sativus]
 gb|KGN63158.1| hypothetical protein Csa_2G406080 [Cucumis sativus]
Length=69

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  326  RGDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
             GDW P LI+ +LFV+L PG++ Q+PG  R+++F  M+TS  ++FVH++
Sbjct  1    MGDWAPVLIAVILFVVLSPGVLFQLPGNDRVVQFINMQTSAISVFVHSI  49



>ref|XP_008341296.1| PREDICTED: uncharacterized protein LOC103404186 [Malus domestica]
 ref|XP_009344923.1| PREDICTED: uncharacterized protein LOC103936783 [Pyrus x bretschneideri]
Length=69

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ Q+PG  R++EF  M+TS  +I VHT+
Sbjct  3    DWGPVVIAVVLFVLLTPGLLFQLPGNSRVVEFNNMQTSGVSILVHTI  49



>ref|XP_004515981.1| PREDICTED: uncharacterized protein LOC101493411 [Cicer arietinum]
Length=69

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I  VLFVL QPGL+   PG  + +EF  MKT+ KAIF+HTL
Sbjct  3    DWAPVVIGVVLFVLFQPGLLFSFPGNGKQLEFGGMKTNGKAIFIHTL  49



>ref|XP_009780342.1| PREDICTED: uncharacterized protein LOC104229393 [Nicotiana sylvestris]
Length=69

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI+ VLFVLL PGL+ Q+PG  +++EF  M+TS  +I VHT+
Sbjct  3    DWGPVLIAVVLFVLLTPGLLFQLPGRGKVVEFGNMQTSGASILVHTI  49



>ref|XP_006470081.1| PREDICTED: uncharacterized protein LOC102613424 [Citrus sinensis]
 gb|KDO63905.1| hypothetical protein CISIN_1g035029mg [Citrus sinensis]
Length=68

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW   LI+A LF  L PGL+VQ+P + R ++F  MKTS  AIFVHT+
Sbjct  3    DWAAPLIAAALFAFLSPGLVVQMPAKNRAVDFLNMKTSIAAIFVHTV  49



>ref|XP_009771783.1| PREDICTED: uncharacterized protein LOC104222267 [Nicotiana sylvestris]
Length=69

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  326  RGDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
              DW P LI+ VLFVLL PGL+ Q+PG  R IEF   +TS  +IF+HT+
Sbjct  1    MADWGPVLIAVVLFVLLTPGLLFQLPGNSRSIEFANFQTSVISIFIHTV  49



>ref|XP_010545946.1| PREDICTED: uncharacterized protein LOC104818180 [Tarenaya hassleriana]
Length=69

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ QIPG  R++EF  M+TS  +I VH +
Sbjct  3    DWGPVVIAVVLFVLLSPGLLFQIPGRGRVVEFGNMQTSGASILVHAI  49



>ref|XP_004297598.1| PREDICTED: uncharacterized protein LOC101294753 [Fragaria vesca 
subsp. vesca]
Length=69

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ QIPG+ R++EF  M+TS  +I VH +
Sbjct  3    DWGPVIIAVVLFVLLTPGLLFQIPGKGRVVEFGNMQTSGASIVVHAI  49



>ref|XP_007163777.1| hypothetical protein PHAVU_001G263200g [Phaseolus vulgaris]
 gb|ESW35771.1| hypothetical protein PHAVU_001G263200g [Phaseolus vulgaris]
Length=69

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ Q+PG+ R++EF  M+TS  +I VHT+
Sbjct  3    DWGPVVIAVVLFVLLSPGLLFQLPGKNRVVEFGKMQTSGVSILVHTI  49



>ref|XP_003553935.1| PREDICTED: uncharacterized protein LOC100793543 [Glycine max]
 gb|KHN10360.1| hypothetical protein glysoja_048323 [Glycine soja]
Length=69

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  329  GDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            GDW P  +S VLF+LL PGL+VQIPG  R IEF   +TS  +I +H +
Sbjct  2    GDWGPVFVSVVLFILLSPGLLVQIPGRGRFIEFGNFQTSGLSILIHAI  49



>ref|XP_004502278.1| PREDICTED: uncharacterized protein LOC101503082 [Cicer arietinum]
Length=69

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ Q+PG  R++EF  M+TS  +I VHT+
Sbjct  3    DWGPVVIAVVLFVLLSPGLLFQLPGRSRVVEFGNMQTSGVSILVHTI  49



>ref|XP_002304675.2| hypothetical protein POPTR_0003s16890g, partial [Populus trichocarpa]
 gb|EEE79654.2| hypothetical protein POPTR_0003s16890g, partial [Populus trichocarpa]
Length=105

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ Q+PG  R++EF  M+TS  +I VHT+
Sbjct  39   DWGPVVIAVVLFVLLSPGLLFQLPGRNRVVEFGNMQTSALSILVHTI  85



>gb|ACG27155.1| hypothetical protein [Zea mays]
 tpg|DAA53892.1| TPA: hypothetical protein ZEAMMB73_769058 [Zea mays]
Length=70

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLI-EFRTMKTSFKAIFVHTL  472
            DW P LI+ + FVLL PGL+ QIPG  R I EF +M+TS  AIFVHTL
Sbjct  3    DWGPVLIAVLFFVLLTPGLLCQIPGSGRGIPEFHSMRTSGVAIFVHTL  50



>ref|XP_002514896.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47450.1| conserved hypothetical protein [Ricinus communis]
Length=69

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ Q+PG+ R++EF  M+TS  +I VHT+
Sbjct  3    DWGPVVIAVVLFVLLSPGLLFQLPGKGRVVEFGNMQTSGLSILVHTI  49



>ref|XP_008361851.1| PREDICTED: uncharacterized protein LOC103425537 [Malus domestica]
Length=69

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ Q+PG+ R++EF  M+TS  +I VHT+
Sbjct  3    DWGPVVIAVVLFVLLSPGLLFQLPGKGRVVEFGNMQTSGISILVHTI  49



>ref|XP_010044830.1| PREDICTED: uncharacterized protein LOC104433689 [Eucalyptus grandis]
 gb|KCW86939.1| hypothetical protein EUGRSUZ_B03510 [Eucalyptus grandis]
Length=69

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ Q+PG +R IEF  M+TS  +I VHT+
Sbjct  3    DWGPVVIAVVLFVLLSPGLLFQLPGRQRFIEFGNMQTSGLSILVHTI  49



>gb|ABK23540.1| unknown [Picea sitchensis]
Length=64

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  329  GDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
             DW P L+  +LFVLL PGL++Q PG  R I+F  ++TS ++I +HT+
Sbjct  2    ADWGPVLVGVILFVLLSPGLLIQFPGNCRTIDFGNLETSGRSILMHTI  49



>ref|XP_011071240.1| PREDICTED: uncharacterized protein LOC105156717 [Sesamum indicum]
Length=70

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ Q+PG  R++EF  M+TS  +I VHT+
Sbjct  4    DWGPVVIAVVLFVLLSPGLLFQLPGRGRVVEFGNMQTSGLSILVHTI  50



>ref|XP_009629695.1| PREDICTED: uncharacterized protein LOC104119810 [Nicotiana tomentosiformis]
Length=69

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI+ VLFVLL PGL+ Q+PG  R++EF  M TS  +I VHT+
Sbjct  3    DWGPVLIAVVLFVLLSPGLLFQLPGRHRVVEFGNMHTSGLSILVHTI  49



>ref|XP_010086969.1| hypothetical protein L484_010115 [Morus notabilis]
 gb|EXB25248.1| hypothetical protein L484_010115 [Morus notabilis]
Length=69

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ QIP + R++EF  M+TS  +IFVH++
Sbjct  3    DWGPVIIATVLFVLLSPGLLFQIPAKGRVVEFGNMQTSGGSIFVHSI  49



>ref|XP_003553183.1| PREDICTED: uncharacterized protein LOC100527578 [Glycine max]
 gb|KHN24053.1| hypothetical protein glysoja_025226 [Glycine soja]
Length=69

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ Q+PG  R++EF  M+TS  +I VHT+
Sbjct  3    DWGPVVIAVVLFVLLSPGLLFQLPGRSRVVEFGNMQTSAISILVHTI  49



>ref|XP_009802034.1| PREDICTED: uncharacterized protein LOC104247662 [Nicotiana sylvestris]
Length=69

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI+ VLFVLL PGL+ Q+PG  R++EF  M TS  +I VHT+
Sbjct  3    DWGPVLIAVVLFVLLSPGLLFQLPGRHRVVEFGNMHTSGLSILVHTI  49



>gb|KFK34166.1| hypothetical protein AALP_AA5G109200 [Arabis alpina]
Length=69

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +++ +LFVLL PGL+VQIP   R+IEF  M TS  +I VHT+
Sbjct  3    DWGPVVVAVILFVLLTPGLLVQIPARGRIIEFGNMHTSGASILVHTI  49



>ref|XP_003549178.1| PREDICTED: uncharacterized protein LOC100527861 [Glycine max]
 gb|ACU17054.1| unknown [Glycine max]
 gb|KHN28291.1| hypothetical protein glysoja_040171 [Glycine soja]
Length=69

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  329  GDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            GDW P  +S VLF+LL PGL+VQIPG  R IEF   +TS  +I +H +
Sbjct  2    GDWGPVFVSVVLFILLTPGLLVQIPGRGRFIEFGNFQTSGLSILIHAI  49



>gb|KDP22604.1| hypothetical protein JCGZ_26435 [Jatropha curcas]
Length=69

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +++ VLFVLL PGL+ QIPG+ R++EF  M+TS  +I VH +
Sbjct  3    DWGPVIVAVVLFVLLTPGLLFQIPGKGRVVEFGNMQTSGASIIVHAI  49



>ref|XP_009359419.1| PREDICTED: uncharacterized protein LOC103949996 [Pyrus x bretschneideri]
Length=71

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ +LFVLL PGL+ QIPG +RL+EF  M+TS  +I VH +
Sbjct  3    DWGPVVIAVLLFVLLTPGLLFQIPGHRRLVEFGNMETSGASILVHAV  49



>ref|XP_008441320.1| PREDICTED: uncharacterized protein LOC103485470 [Cucumis melo]
Length=69

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  326  RGDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
             GDW P LI+ +LFV+L PG++ Q+PG  R+++F  M+TS  ++FVH++
Sbjct  1    MGDWGPVLIAVILFVVLSPGVLFQLPGNDRVVQFVNMQTSAISVFVHSI  49



>ref|XP_006447042.1| hypothetical protein CICLE_v10017402mg [Citrus clementina]
 ref|XP_006470083.1| PREDICTED: uncharacterized protein LOC102614017 [Citrus sinensis]
 gb|ESR60282.1| hypothetical protein CICLE_v10017402mg [Citrus clementina]
Length=69

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I  +LFVLLQPGL+ Q+PG  R +EF +MKT+ KAI VH++
Sbjct  3    DWGPVVIGVLLFVLLQPGLLFQLPGHNRQLEFGSMKTNGKAIAVHSV  49



>gb|KEH21021.1| transmembrane protein, putative [Medicago truncatula]
Length=69

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ QIPG  ++IEF  M+TS  +I VH +
Sbjct  3    DWGPVIIAVVLFVLLSPGLLFQIPGRGKVIEFGNMQTSGASILVHAI  49



>gb|AFK47378.1| unknown [Lotus japonicus]
Length=69

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  +S VLF+LL PGL++QIPG+ R++EF   +TS  +I VH++
Sbjct  3    DWGPVFVSVVLFILLTPGLLIQIPGKSRMVEFGNFQTSGASILVHSI  49



>ref|XP_002455353.1| hypothetical protein SORBIDRAFT_03g009090 [Sorghum bicolor]
 gb|EES00473.1| hypothetical protein SORBIDRAFT_03g009090 [Sorghum bicolor]
Length=70

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLI-EFRTMKTSFKAIFVHTL  472
            DW P LI+ + FVLL PGL+ QIPG  R + EF +M+TS  AIFVHTL
Sbjct  3    DWGPVLIAVLFFVLLTPGLLCQIPGSGRGVPEFHSMRTSGVAIFVHTL  50



>ref|XP_007038005.1| Uncharacterized protein TCM_014660 [Theobroma cacao]
 gb|EOY22506.1| Uncharacterized protein TCM_014660 [Theobroma cacao]
Length=173

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  329  GDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
             DW P L++ VLFVLL PGL+ QIPG  +++EF  M+TS  +I VH +
Sbjct  105  ADWGPVLVATVLFVLLSPGLLFQIPGRNKVVEFGNMQTSGASILVHAI  152



>ref|XP_002321710.2| hypothetical protein POPTR_0015s11020g [Populus trichocarpa]
 gb|EEF05837.2| hypothetical protein POPTR_0015s11020g [Populus trichocarpa]
Length=70

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +++ VLFVLL PGL+ QIPG+ R++EF  M+TS  +I VH +
Sbjct  3    DWGPVIVAVVLFVLLTPGLLFQIPGKSRVVEFGNMQTSGASIAVHAI  49



>dbj|BAB62632.1| P0402A09.15 [Oryza sativa Japonica Group]
 dbj|BAB92134.1| P0455C04.9 [Oryza sativa Japonica Group]
Length=593

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = +2

Query  329  GDWLPFLISAVLFVLLQPGLIVQIPGEK-RLIEFRTMKTSFKAIFVHTL  472
            GDW P LI+ VLFVLL PGL+ QIPG   R+ EF +M+TS  +IFVH L
Sbjct  525  GDWGPVLIALVLFVLLTPGLLCQIPGSNGRVAEFHSMRTSVASIFVHAL  573



>ref|XP_008360750.1| PREDICTED: uncharacterized protein LOC103424445 [Malus domestica]
Length=71

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ +LFVLL PGL+ QIPG  RL+EF  M+TS  +I VH++
Sbjct  3    DWGPVVIAVMLFVLLTPGLLFQIPGHGRLVEFGNMETSGASILVHSV  49



>ref|XP_008441322.1| PREDICTED: uncharacterized protein LOC103485472 [Cucumis melo]
 gb|KGN63160.1| hypothetical protein Csa_2G406095 [Cucumis sativus]
Length=69

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I  VLFVLL PGL+ Q PG  R  EF +MKT+ KA+ +HTL
Sbjct  3    DWAPVVIGVVLFVLLSPGLLFQFPGNNRQFEFGSMKTNGKAVAIHTL  49



>ref|XP_006493216.1| PREDICTED: uncharacterized protein LOC102619374 [Citrus sinensis]
 gb|KDO64399.1| hypothetical protein CISIN_1g040390mg [Citrus sinensis]
Length=69

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ QIPG  R++EF  M+TS  +I VH++
Sbjct  3    DWGPVVIATVLFVLLTPGLLFQIPGRNRVVEFGNMQTSGASILVHSV  49



>ref|XP_003631356.1| PREDICTED: uncharacterized protein LOC100852958 [Vitis vinifera]
Length=71

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +++ VLFVLL PGL+ QIPG  R++EF  M TS  +I VH +
Sbjct  3    DWGPVVVATVLFVLLTPGLLCQIPGRGRVVEFGNMSTSGLSILVHAV  49



>ref|XP_004306303.1| PREDICTED: uncharacterized protein LOC101306079 [Fragaria vesca 
subsp. vesca]
Length=161

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  RRGDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
               DW P LI  VLF+LLQPGL+  +PG  + +EF +MKT+ KAI VHTL
Sbjct  92   EMADWGPVLIGVVLFILLQPGLLFSLPGNGKQVEFGSMKTNGKAIAVHTL  141


 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  I+ VLF+LL PGL++QIPG+ R +EF   +TS  +I VH++
Sbjct  3    DWGPVFIAVVLFILLTPGLLIQIPGKSRFVEFGNFQTSGVSILVHSI  49



>ref|XP_006352171.1| PREDICTED: uncharacterized protein LOC102585729 [Solanum tuberosum]
Length=69

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI+ VLFVLL PGL+ Q+PG  +++EF  M+TS  +I VHT+
Sbjct  3    DWGPVLIAVVLFVLLSPGLLFQLPGRHKIVEFGNMQTSGLSILVHTV  49



>ref|XP_003575014.1| PREDICTED: uncharacterized protein LOC100827399 [Brachypodium 
distachyon]
Length=69

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +++ +LFVLL PGL+ Q+PG+ R +EF +M TS  AI VH +
Sbjct  3    DWGPVVVAVILFVLLSPGLMFQVPGKTRFVEFGSMGTSGVAILVHAV  49



>ref|XP_011044119.1| PREDICTED: uncharacterized protein LOC105139404 [Populus euphratica]
Length=69

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ QIPG  R++EF  M+TS  +I VH +
Sbjct  3    DWGPVIIAVVLFVLLVPGLLFQIPGRNRVVEFGNMQTSGASIVVHAI  49



>ref|XP_010660745.1| PREDICTED: uncharacterized protein LOC100246292 [Vitis vinifera]
 emb|CBI21333.3| unnamed protein product [Vitis vinifera]
Length=69

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ Q+PG  R++EF  M+TS  +I VHT+
Sbjct  3    DWGPVVIAVVLFVLLTPGLLFQLPGNNRVVEFGNMQTSRISILVHTI  49



>ref|XP_010682737.1| PREDICTED: uncharacterized protein LOC104897542 [Beta vulgaris 
subsp. vulgaris]
Length=69

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLF+LL PGL+ QIPG  R++EF  M+TS  +I VH +
Sbjct  3    DWGPVVIALVLFILLSPGLLCQIPGRGRVVEFANMQTSGVSILVHAI  49



>emb|CDY34185.1| BnaA02g28550D [Brassica napus]
Length=69

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P L+  VLFV+L PGL+  IPG  R ++F  +KT+ KAI VHTL
Sbjct  3    DWAPVLVGVVLFVILSPGLLFSIPGNNRGVDFGNLKTNGKAIAVHTL  49



>ref|XP_008379099.1| PREDICTED: uncharacterized protein LOC103442121 [Malus domestica]
Length=69

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ Q+PG  R+ EF  M+TS  +I VHT+
Sbjct  3    DWGPVVIAVVLFVLLTPGLLFQLPGNSRVAEFNNMQTSGVSILVHTI  49



>ref|XP_009597111.1| PREDICTED: uncharacterized protein LOC104093102 [Nicotiana tomentosiformis]
Length=69

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  326  RGDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
              DW P LI+ +LFVLL PGL+ Q+PG  R IEF   +TS  +IF+HTL
Sbjct  1    MADWGPVLIAVMLFVLLTPGLLFQLPGSSRSIEFVNFQTSAISIFIHTL  49



>gb|EYU42082.1| hypothetical protein MIMGU_mgv1a017524mg [Erythranthe guttata]
Length=69

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ Q+PG  R++EF  M+TS  +I VHT+
Sbjct  3    DWGPVVIAVVLFVLLSPGLLFQLPGRGRVVEFGNMQTSGLSILVHTV  49



>ref|XP_007225875.1| hypothetical protein PRUPE_ppa014446mg [Prunus persica]
 gb|EMJ27074.1| hypothetical protein PRUPE_ppa014446mg [Prunus persica]
Length=69

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ Q+PG  R++EF +M TS  +I VHT+
Sbjct  3    DWGPVVIAVVLFVLLSPGLLFQLPGRGRVVEFGSMHTSGISILVHTI  49



>ref|XP_010090641.1| hypothetical protein L484_017443 [Morus notabilis]
 gb|EXB40305.1| hypothetical protein L484_017443 [Morus notabilis]
Length=158

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL++Q PG  R++EF  M TS  +I VHT+
Sbjct  3    DWGPVVIAVVLFVLLSPGLLIQFPGRNRVVEFGNMHTSGLSILVHTV  49



>ref|XP_009129454.1| PREDICTED: uncharacterized protein LOC103854272 [Brassica rapa]
Length=69

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P L+  VLFV+L PGL+  IPG  R ++F  +KT+ KAI VHTL
Sbjct  3    DWAPVLVGVVLFVILSPGLLFSIPGNNRGVDFGNLKTNGKAIAVHTL  49



>ref|XP_009606515.1| PREDICTED: uncharacterized protein LOC104100868 [Nicotiana tomentosiformis]
 ref|XP_009788056.1| PREDICTED: uncharacterized protein LOC104235922 [Nicotiana sylvestris]
Length=69

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ Q+PG  R +EF   +TS  +IF+HTL
Sbjct  3    DWGPVVIAVVLFVLLSPGLLFQLPGNSRAVEFANFQTSGLSIFIHTL  49



>ref|XP_009129453.1| PREDICTED: uncharacterized protein LOC103854271 [Brassica rapa]
 emb|CDY34184.1| BnaA02g28560D [Brassica napus]
 emb|CDY28498.1| BnaC02g36620D [Brassica napus]
Length=69

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  ++  LFVLL PGL++QIPG  R++EF T +TS  ++ VHTL
Sbjct  3    DWGPVFVAVTLFVLLTPGLLIQIPGRNRVVEFGTFQTSGVSVIVHTL  49



>emb|CDP13356.1| unnamed protein product [Coffea canephora]
Length=69

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  ++ VLFVLL PGL+ QIPG  R +EF  ++TS  AI VH+L
Sbjct  3    DWGPIFVAVVLFVLLSPGLLFQIPGHHRCVEFGNLQTSGAAIMVHSL  49



>ref|XP_009372260.1| PREDICTED: uncharacterized protein LOC103961442 [Pyrus x bretschneideri]
Length=69

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ Q+PG+ R++EF  M TS  +I VHT+
Sbjct  3    DWGPVVIAVVLFVLLSPGLLFQLPGKGRVVEFGNMHTSGISILVHTI  49



>gb|KCW60623.1| hypothetical protein EUGRSUZ_H03348 [Eucalyptus grandis]
Length=69

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  + A LFV+L PGL+ Q+PG+ R+IEF  M+TS  +I VHT+
Sbjct  3    DWAPVFVGAFLFVILSPGLLFQLPGKGRVIEFNNMQTSGVSILVHTI  49



>ref|XP_003575013.1| PREDICTED: uncharacterized protein LOC100827089 [Brachypodium 
distachyon]
Length=69

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I  VLF+LL PGL+ +IPG  R ++F + +T+ KAIF+HTL
Sbjct  3    DWGPVVIGVVLFILLSPGLLFEIPGSHRHVDFGSFRTNGKAIFIHTL  49



>ref|XP_007031907.1| Uncharacterized protein TCM_017236 [Theobroma cacao]
 gb|EOY02833.1| Uncharacterized protein TCM_017236 [Theobroma cacao]
Length=134

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  RRGDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            R  DW   LI+A LF  L PGL++QIPG+ + I+F  MKTS  AIFVH +
Sbjct  66   RMNDWAAPLIAAALFAFLSPGLVLQIPGKNQPIDFMNMKTSVAAIFVHAV  115



>ref|XP_004239230.1| PREDICTED: uncharacterized protein LOC101249266 [Solanum lycopersicum]
Length=69

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI+ VLFVLL PGL+ Q+PG  +++EF  M+TS  ++ VHT+
Sbjct  3    DWGPVLIAVVLFVLLSPGLLFQLPGRHKIVEFGNMQTSGLSVLVHTV  49



>ref|XP_006438001.1| hypothetical protein CICLE_v10033268mg [Citrus clementina]
 ref|XP_006484137.1| PREDICTED: uncharacterized protein LOC102617509 [Citrus sinensis]
 gb|ESR51241.1| hypothetical protein CICLE_v10033268mg [Citrus clementina]
 gb|KDO36879.1| hypothetical protein CISIN_1g035259mg [Citrus sinensis]
Length=69

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ Q+PG  R++EF  M TS  +I VHT+
Sbjct  3    DWGPVVIAVVLFVLLSPGLLFQLPGRNRVVEFGNMHTSGLSILVHTI  49



>ref|XP_010425441.1| PREDICTED: uncharacterized protein LOC104710521 [Camelina sativa]
Length=69

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  ++  LFVLL PGL++QIPG  R++EF T +TS  ++ VHTL
Sbjct  3    DWGPVFVAVTLFVLLTPGLLIQIPGRGRVVEFGTFQTSGVSVIVHTL  49



>ref|XP_002298634.2| hypothetical protein POPTR_0001s33660g [Populus trichocarpa]
 gb|EEE83439.2| hypothetical protein POPTR_0001s33660g [Populus trichocarpa]
Length=76

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  ++ VLF+LL PGL++QIPG +RL+EF   +TS  +I VH++
Sbjct  3    DWGPVFVAVVLFILLTPGLLIQIPGRQRLVEFGNFQTSGVSILVHSI  49



>ref|XP_003601753.1| hypothetical protein MTR_3g085020 [Medicago truncatula]
 gb|AES72004.1| transmembrane protein, putative [Medicago truncatula]
Length=69

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ Q+PG  +++EF  M+TS  +I VHT+
Sbjct  3    DWGPVVIAVVLFVLLSPGLLFQMPGRNKVVEFGNMQTSGVSILVHTI  49



>ref|XP_007043959.1| Uncharacterized protein TCM_008722 [Theobroma cacao]
 gb|EOX99790.1| Uncharacterized protein TCM_008722 [Theobroma cacao]
Length=135

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ Q+PG  +++EF  M+TS  +I VHT+
Sbjct  69   DWGPVVIAVVLFVLLSPGLLFQLPGRSKVVEFGNMQTSGISILVHTI  115



>ref|XP_010028987.1| PREDICTED: uncharacterized protein LOC104419131 [Eucalyptus grandis]
 gb|KCW55820.1| hypothetical protein EUGRSUZ_I01637 [Eucalyptus grandis]
Length=70

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  RRGDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
               DW P +++ VLF+LL PGL++QIPG+ R+ EF  M TS  +I VH +
Sbjct  1    MSADWGPVIVAVVLFILLSPGLLIQIPGKMRVAEFGNMATSGISILVHAV  50



>ref|XP_010249051.1| PREDICTED: uncharacterized protein LOC104591752 [Nelumbo nucifera]
Length=69

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ Q+PG  R++EF  M+TS  +I VH +
Sbjct  3    DWGPVVIAVVLFVLLTPGLVFQLPGRNRIVEFGNMQTSGVSILVHAV  49



>emb|CDY52400.1| BnaC07g48990D [Brassica napus]
Length=77

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  ++  LFVLL PG+++QIPG+ R++EF T +TS  ++ VHTL
Sbjct  3    DWGPVFVAVALFVLLTPGVLIQIPGKNRVVEFGTFQTSGLSVIVHTL  49



>gb|AFW75090.1| hypothetical protein ZEAMMB73_968611, partial [Zea mays]
Length=118

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  RRGDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            +  DW P +I  VLFVLL PGL+VQ+PG   L+EF  +KTS  +I VH++
Sbjct  48   KMSDWGPVVIGLVLFVLLSPGLLVQLPGRHHLVEFGNLKTSAVSIVVHSI  97



>ref|XP_006405409.1| hypothetical protein EUTSA_v10028016mg [Eutrema salsugineum]
 gb|ESQ46862.1| hypothetical protein EUTSA_v10028016mg [Eutrema salsugineum]
Length=69

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P L+  VLFV+L PGL+  +PG  R +EF  MKT+ KAI VH+L
Sbjct  3    DWAPVLVGVVLFVMLSPGLLFSLPGHHRTLEFGGMKTNGKAIAVHSL  49



>ref|XP_006436859.1| hypothetical protein CICLE_v10033156mg [Citrus clementina]
 gb|ESR50099.1| hypothetical protein CICLE_v10033156mg [Citrus clementina]
Length=101

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +2

Query  326  RGDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
              DW P +I+ VLFVLL PGL+ QIPG  R++EF  M+TS  +I VH++
Sbjct  1    MADWGPVVIATVLFVLLTPGLLFQIPGRNRVVEFGNMQTSGASILVHSV  49



>ref|XP_006292430.1| hypothetical protein CARUB_v10018645mg [Capsella rubella]
 ref|XP_010502664.1| PREDICTED: uncharacterized protein LOC104779929 [Camelina sativa]
 ref|XP_010514387.1| PREDICTED: uncharacterized protein LOC104790353 [Camelina sativa]
 gb|EOA25328.1| hypothetical protein CARUB_v10018645mg [Capsella rubella]
Length=69

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  ++  LFVLL PGL++QIPG  R++EF T +TS  ++ VHTL
Sbjct  3    DWGPVFVAVTLFVLLTPGLLIQIPGRGRVVEFGTFQTSGLSVIVHTL  49



>ref|XP_008222189.1| PREDICTED: uncharacterized protein LOC103322090 [Prunus mume]
Length=69

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ Q+PG  R++EF  M TS  +I VHT+
Sbjct  3    DWGPVVIAVVLFVLLSPGLLFQLPGRGRVVEFGGMHTSGISILVHTI  49



>ref|XP_010556293.1| PREDICTED: uncharacterized protein LOC104825630 [Tarenaya hassleriana]
Length=69

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  ++  LFVLL PGL++QIPG  R++EF T +TS  ++ VH+L
Sbjct  3    DWGPVFVAVALFVLLTPGLLIQIPGRSRVVEFGTFQTSGVSVLVHSL  49



>gb|ACG41546.1| hypothetical protein [Zea mays]
Length=70

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I  VLFVLL PGL+VQ+PG   L+EF  +KTS  +I VH++
Sbjct  3    DWGPVVIGLVLFVLLSPGLLVQLPGRHHLVEFGNLKTSAVSILVHSI  49



>ref|XP_004138041.1| PREDICTED: uncharacterized protein LOC101212373 [Cucumis sativus]
 ref|XP_004167276.1| PREDICTED: uncharacterized LOC101212373 [Cucumis sativus]
 ref|XP_008464420.1| PREDICTED: uncharacterized protein LOC103502312 [Cucumis melo]
 gb|KGN63475.1| hypothetical protein Csa_1G001470 [Cucumis sativus]
Length=69

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ QIP + R++EF  M+TS  +I VH +
Sbjct  3    DWGPVIIAVVLFVLLSPGLLFQIPAKGRVVEFGNMQTSGASILVHAI  49



>gb|AFK45116.1| unknown [Lotus japonicus]
Length=70

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +IS VLFVLL PGL+ Q+PG  +++ F +M+TS  +I VHT+
Sbjct  4    DWGPVVISVVLFVLLSPGLLFQLPGRGKVVAFGSMQTSGLSILVHTI  50



>ref|XP_006373211.1| hypothetical protein POPTR_0017s09690g [Populus trichocarpa]
 ref|XP_011009187.1| PREDICTED: uncharacterized protein LOC105114366 [Populus euphratica]
 gb|ERP51008.1| hypothetical protein POPTR_0017s09690g [Populus trichocarpa]
Length=69

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI  VLFVLL PGL+ Q+PG  + +EF ++KT+  A+ VHTL
Sbjct  3    DWGPVLIGVVLFVLLTPGLLFQLPGNSKQVEFGSLKTNGMAVAVHTL  49



>ref|XP_003528798.1| PREDICTED: uncharacterized protein LOC100305821 [Glycine max]
 ref|XP_003548470.1| PREDICTED: uncharacterized protein LOC100781253 [Glycine max]
 gb|KHN06296.1| hypothetical protein glysoja_021134 [Glycine soja]
 gb|KHN15948.1| hypothetical protein glysoja_013164 [Glycine soja]
Length=70

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  +S VLF+LL PGL++QIPG+ +++EF   +TS  +I VH++
Sbjct  3    DWGPVFVSVVLFILLTPGLLIQIPGKGKMVEFGNFQTSGVSILVHSI  49



>ref|XP_006373210.1| hypothetical protein POPTR_0017s09680g [Populus trichocarpa]
 gb|ABK93721.1| unknown [Populus trichocarpa]
 gb|ERP51007.1| hypothetical protein POPTR_0017s09680g [Populus trichocarpa]
Length=68

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW   LI+A LF  L PGL+ Q+PG++R ++F  MKTS  AIFVH +
Sbjct  3    DWAASLIAAALFAFLSPGLVFQMPGKERPLDFMNMKTSLAAIFVHLV  49



>ref|XP_011020769.1| PREDICTED: uncharacterized protein LOC105123025 [Populus euphratica]
Length=155

 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ Q+PG  R++EF  ++TS  +I VHT+
Sbjct  89   DWGPVVIAVVLFVLLSPGLLCQLPGRSRVVEFGNLQTSGLSILVHTI  135


 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  ++ VLF+LL PGL+ Q+PG  R IEF   +TS  +I VHTL
Sbjct  3    DWGPVFMAVVLFILLTPGLLFQVPGRHRSIEFGNFQTSGASIMVHTL  49



>ref|XP_010550223.1| PREDICTED: uncharacterized protein LOC104821134 [Tarenaya hassleriana]
Length=70

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P ++S VLF++L PG++ Q+PG+ R++EF   +TS  AIF+HTL
Sbjct  4    DWGPVVMSVVLFIVLTPGVLFQLPGKTRVVEFGGFQTSGAAIFIHTL  50



>ref|XP_004231769.1| PREDICTED: uncharacterized protein LOC101265494 [Solanum lycopersicum]
Length=69

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ Q+PG  R +EF   +TS  +IF+HT+
Sbjct  3    DWGPVVIAVVLFVLLSPGLLFQLPGNNRAVEFANFQTSGLSIFIHTI  49



>ref|XP_006292149.1| hypothetical protein CARUB_v10018353mg [Capsella rubella]
 ref|XP_010515183.1| PREDICTED: uncharacterized protein LOC104791080 [Camelina sativa]
 ref|XP_010426359.1| PREDICTED: uncharacterized protein LOC104711357 [Camelina sativa]
 gb|EOA25047.1| hypothetical protein CARUB_v10018353mg [Capsella rubella]
Length=69

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ +LFVLL PGL+ QIP   R++EF  M+TS  +I VHT+
Sbjct  3    DWGPVVIAVILFVLLTPGLLFQIPARGRVVEFGNMQTSGASILVHTI  49



>ref|XP_011000976.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105108380 
[Populus euphratica]
Length=142

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I  VLFVLLQPGL+ Q+PG  + ++F ++KT+ KAI VHTL
Sbjct  76   DWGPVVIGVVLFVLLQPGLLFQLPGNNKHVDFGSLKTNGKAIAVHTL  122


 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  ++ VLF+LL PGL++QIPG +RL+EF   +TS  +I VH++
Sbjct  3    DWGPVFVAVVLFILLTPGLLIQIPGRQRLVEFGNFQTSGVSILVHSI  49



>emb|CDX84422.1| BnaC03g50780D [Brassica napus]
 emb|CDX84423.1| BnaC03g50770D [Brassica napus]
Length=69

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI+ +LFV+L PGL+ QIP   R++EF  MKTS  +I VH +
Sbjct  3    DWGPVLIAVILFVVLTPGLLFQIPAGGRVVEFGNMKTSGASILVHAI  49



>ref|XP_008341294.1| PREDICTED: uncharacterized protein LOC103404184 [Malus domestica]
Length=69

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI  VLF+LLQPGL+   PG  + +EF  MKT+ KAI VHTL
Sbjct  3    DWGPVLIGVVLFILLQPGLLFTFPGNGKQLEFGRMKTNGKAIAVHTL  49



>emb|CDP16705.1| unnamed protein product [Coffea canephora]
Length=70

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  ++ VLF+LL PGL++QIPG  R +EF   +TS  +I VH+L
Sbjct  3    DWGPVFVAVVLFILLTPGLLIQIPGHGRFVEFSNFQTSGASILVHSL  49



>ref|XP_006404231.1| hypothetical protein EUTSA_v10010885mg [Eutrema salsugineum]
 gb|ESQ45684.1| hypothetical protein EUTSA_v10010885mg [Eutrema salsugineum]
Length=69

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +++ +LFVLL PGL+ QIP   R++EF  M+TS  +I VHT+
Sbjct  3    DWGPVVVAVILFVLLTPGLLFQIPARGRIVEFGNMQTSGASILVHTI  49



>ref|XP_002511164.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51766.1| conserved hypothetical protein [Ricinus communis]
Length=69

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ +LFVLL PGL+ QIPG  R++EF  M TS  +I VH +
Sbjct  3    DWGPVIIAVILFVLLTPGLLFQIPGRNRVVEFGNMHTSGASIVVHAI  49



>ref|XP_006605561.1| PREDICTED: uncharacterized protein LOC102669109 [Glycine max]
 gb|KHN32729.1| hypothetical protein glysoja_038683 [Glycine soja]
Length=69

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHT  469
            DW P L   VLF+LLQPGL+   PG  + +EF +MKT+ KAIF+HT
Sbjct  3    DWAPVLNGVVLFMLLQPGLLFSFPGNGKQLEFGSMKTNDKAIFIHT  48



>gb|ACG27375.1| hypothetical protein [Zea mays]
Length=70

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I  VLFVLL PGL+VQ+PG   L+EF  +KTS  +I VH++
Sbjct  3    DWGPVVIGLVLFVLLSPGLLVQLPGRHHLVEFGNLKTSAVSIVVHSI  49



>ref|XP_006447040.1| hypothetical protein CICLE_v10017398mg [Citrus clementina]
 ref|XP_006470085.1| PREDICTED: uncharacterized protein LOC102614599 [Citrus sinensis]
 gb|ESR60280.1| hypothetical protein CICLE_v10017398mg [Citrus clementina]
Length=69

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ Q+P + R++EF  M+TS  +IFVH++
Sbjct  3    DWGPVIIATVLFVLLTPGLLFQLPAKGRVVEFGNMQTSPASIFVHSI  49



>emb|CDY13678.1| BnaA06g32450D [Brassica napus]
Length=69

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  ++  LFVLL PG+++QIPG+ R++EF T +TS  ++ VHTL
Sbjct  3    DWGPVFVAVALFVLLTPGVLIQIPGKNRVVEFGTFQTSGLSVIVHTL  49



>ref|XP_010680015.1| PREDICTED: uncharacterized protein LOC104895255 [Beta vulgaris 
subsp. vulgaris]
Length=69

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  326  RGDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
             GDW P  ++ V+F++L PGL+VQIPG  + +EF +  TS  AI VH L
Sbjct  1    MGDWGPVFVAVVMFIILTPGLLVQIPGRDKAVEFSSFHTSGPAILVHAL  49



>ref|XP_006848292.1| hypothetical protein AMTR_s00013p00100030 [Amborella trichopoda]
 gb|ERN09873.1| hypothetical protein AMTR_s00013p00100030 [Amborella trichopoda]
Length=69

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ Q+PG+ R++EF   +TS  +I VHT+
Sbjct  3    DWGPVVIAVVLFVLLSPGLLFQLPGKSRVVEFGNFQTSGISILVHTI  49



>ref|XP_006580125.1| PREDICTED: uncharacterized protein LOC102662714 [Glycine max]
 gb|KHN34828.1| hypothetical protein glysoja_036821 [Glycine soja]
Length=69

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  +S VLFVLL PGL+ Q+PG  R++EF   +TS  AI +H+L
Sbjct  3    DWGPVFVSLVLFVLLTPGLLFQVPGRSRVVEFGNFQTSGAAILIHSL  49



>dbj|BAD42942.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD42993.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD44663.1| hypothetical protein [Arabidopsis thaliana]
Length=69

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  ++  LFVLL PGL++Q+PG  R++EF T +TS  ++ VHTL
Sbjct  3    DWGPVFVAVTLFVLLTPGLLIQVPGRGRVVEFGTFQTSGLSVIVHTL  49



>gb|KFK28060.1| hypothetical protein AALP_AA8G466600 [Arabis alpina]
Length=69

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI+ +LFV+L PGL+ QIP   R++EF +M+TS  +I VH +
Sbjct  3    DWGPVLIAVILFVVLTPGLLFQIPAGGRIVEFGSMQTSGASILVHAI  49



>ref|XP_006338707.1| PREDICTED: uncharacterized protein LOC102580109 [Solanum tuberosum]
Length=69

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ Q+PG  R+++F   +TS  +IF+HT+
Sbjct  3    DWGPVVIAVVLFVLLSPGLLFQLPGNNRVVQFANFQTSGLSIFIHTI  49



>ref|XP_011009186.1| PREDICTED: uncharacterized protein LOC105114364 [Populus euphratica]
Length=70

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  ++ VLF+LL PGL++Q+PG  R IEF   KTS  +I VH++
Sbjct  3    DWGPVFVAVVLFILLSPGLLIQMPGHNRFIEFGNFKTSGVSILVHSI  49



>ref|XP_002298636.2| hypothetical protein POPTR_0001s33630g, partial [Populus trichocarpa]
 gb|EEE83441.2| hypothetical protein POPTR_0001s33630g, partial [Populus trichocarpa]
Length=66

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +2

Query  335  WLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            W P +I  VLFVLLQPGL+ Q+PG  + ++F ++KT+ KAI VHTL
Sbjct  1    WGPVVIGVVLFVLLQPGLLFQLPGNNKHVDFGSLKTNGKAIAVHTL  46



>ref|XP_007161717.1| hypothetical protein PHAVU_001G092500g [Phaseolus vulgaris]
 gb|ESW33711.1| hypothetical protein PHAVU_001G092500g [Phaseolus vulgaris]
Length=69

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  326  RGDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
             GDW P  +S VLF+LL PGL+VQIPG    IEF   +TS  +I +H +
Sbjct  1    MGDWGPVFVSVVLFILLTPGLLVQIPGRGSFIEFGNFQTSGLSILIHAI  49



>gb|EMS67281.1| hypothetical protein TRIUR3_17967 [Triticum urartu]
Length=69

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P ++  VLF+LL PGL++++PG  R ++F  + T+ KAIFVHT+
Sbjct  3    DWAPVVVGVVLFILLSPGLLLEMPGSHRHVDFGGLHTNGKAIFVHTI  49



>ref|XP_004138621.1| PREDICTED: uncharacterized protein LOC101211888 [Cucumis sativus]
 ref|XP_004172664.1| PREDICTED: uncharacterized LOC101211888 [Cucumis sativus]
Length=142

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I  VLFVLL PGL+ Q PG  R  EF +MKT+ KA+ +HTL
Sbjct  76   DWAPVVIGVVLFVLLSPGLLFQFPGNNRQFEFGSMKTNGKAVAIHTL  122


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  329  GDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
             DW P  ++ +LFVLL PGL+VQ+PG+ R +EF   +TS  +I VH++
Sbjct  2    ADWGPVFVAVMLFVLLTPGLLVQMPGKSRFVEFGNFQTSGVSILVHSI  49



>ref|XP_010112378.1| hypothetical protein L484_010783 [Morus notabilis]
 gb|EXC33373.1| hypothetical protein L484_010783 [Morus notabilis]
Length=70

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  ++ VLF+LL PGL++QIPG+ R+IE+   +TS  +I VH++
Sbjct  3    DWGPVFVAVVLFILLTPGLLIQIPGKSRMIEYGNFQTSGVSILVHSV  49



>ref|XP_010530564.1| PREDICTED: uncharacterized protein LOC104807141 [Tarenaya hassleriana]
 ref|XP_010552445.1| PREDICTED: uncharacterized protein LOC104822794 [Tarenaya hassleriana]
Length=69

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P L++ +LFVLL PGL+ Q+PG  R +EF   +TS  A+ VH+L
Sbjct  3    DWGPVLVAVILFVLLTPGLLFQLPGRNRCVEFGNFQTSAPAVIVHSL  49



>gb|KFK33626.1| hypothetical protein AALP_AA5G038000 [Arabis alpina]
Length=69

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  ++  LFVLL PGL++Q+PG  R+IEF T +TS  ++ +HTL
Sbjct  3    DWGPVFVAVSLFVLLTPGLLIQVPGRNRVIEFGTFQTSGVSVIIHTL  49



>ref|XP_011098907.1| PREDICTED: uncharacterized protein LOC105177440 [Sesamum indicum]
Length=69

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVH  466
            D  P LI+ +LFV+L PGL+ Q+PG++R IEF  M+TS  +IFVH
Sbjct  3    DLAPVLIAVILFVVLSPGLLFQLPGKRRAIEFTNMQTSGLSIFVH  47



>gb|KCW55823.1| hypothetical protein EUGRSUZ_I01640 [Eucalyptus grandis]
Length=70

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  ++ VLFVLL PGL++QIPG+ R IEF   +TS  ++ VH++
Sbjct  3    DWGPVFVAMVLFVLLTPGLLIQIPGKHRFIEFGNFQTSGASVLVHSI  49



>gb|AFK46474.1| unknown [Medicago truncatula]
Length=69

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  +S VLF+LL PGL+VQIPG+ +++EF   +TS  +I +H++
Sbjct  3    DWGPVFVSVVLFILLTPGLLVQIPGKGKMVEFGNFQTSGLSILIHSI  49



>ref|XP_006594529.1| PREDICTED: uncharacterized protein LOC102664775 [Glycine max]
Length=69

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ Q+PG+ +++EF  M+T   +I VHT+
Sbjct  3    DWGPMVIAVVLFVLLSPGLLFQLPGKSKVVEFGNMQTRAVSILVHTI  49



>ref|XP_004234309.1| PREDICTED: uncharacterized protein LOC101248948 [Solanum lycopersicum]
Length=69

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI+ VLFVLL PGL+ Q+P   +++EF  M+TS  AI VH +
Sbjct  3    DWGPVLIAVVLFVLLSPGLLFQLPSRGKVVEFGGMQTSGAAILVHAV  49



>ref|XP_004515982.1| PREDICTED: uncharacterized protein LOC101493732 [Cicer arietinum]
Length=69

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            +W P LI+A LF LL PG+I Q+PG+   +EF  MKT+  +IFVHT+
Sbjct  3    NWAPPLIAAALFWLLSPGMIFQLPGKNSPLEFMNMKTTVASIFVHTV  49



>gb|KHN41505.1| hypothetical protein glysoja_039206 [Glycine soja]
Length=84

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI  VLFVLLQP L+   PG    +EF +MKT+ KAIF+H L
Sbjct  3    DWAPVLIGVVLFVLLQPVLLFSFPGNGEQLEFGSMKTNDKAIFIHML  49



>gb|KEH18682.1| transmembrane protein, putative [Medicago truncatula]
Length=110

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  +S VLF+LL PGL+VQIPG+ +++EF   +TS  +I +H++
Sbjct  3    DWGPVFVSVVLFILLTPGLLVQIPGKGKMVEFGNFQTSGLSILIHSI  49



>ref|XP_006351515.1| PREDICTED: uncharacterized protein LOC102599395 [Solanum tuberosum]
Length=69

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI+ VLFVLL PGL+ Q+P   +++EF  M+TS  AI VH +
Sbjct  3    DWGPVLIAVVLFVLLSPGLLFQLPSRGKVVEFGGMQTSGAAILVHAV  49



>emb|CDY13677.1| BnaA06g32460D [Brassica napus]
Length=69

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P ++  +LFV+L PGL+  +PG  R ++F  +KT+ KAI VHTL
Sbjct  3    DWAPVIVGVILFVILSPGLLFSLPGNNRAVDFGNLKTNGKAIAVHTL  49



>ref|XP_007031906.1| Uncharacterized protein TCM_017235 [Theobroma cacao]
 gb|EOY02832.1| Uncharacterized protein TCM_017235 [Theobroma cacao]
Length=70

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  ++ VLF+LL PGL++Q+PG+ R IEF   +TS  +I VH++
Sbjct  3    DWGPVFVAVVLFILLTPGLLIQVPGKSRFIEFGNFQTSGLSILVHSI  49



>ref|XP_010656087.1| PREDICTED: uncharacterized protein LOC100262494 [Vitis vinifera]
Length=71

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  +S VLFVLL PGL+ Q+PG  R +EF  ++TS  +I +H L
Sbjct  4    DWGPIFVSVVLFVLLSPGLLFQLPGSNRCVEFGNLRTSGASIMLHAL  50



>gb|AEW08927.1| hypothetical protein CL2309Contig1_03, partial [Pinus radiata]
 gb|AFG46384.1| hypothetical protein CL2309Contig1_03, partial [Pinus taeda]
 gb|AFG46385.1| hypothetical protein CL2309Contig1_03, partial [Pinus taeda]
 gb|AFG46386.1| hypothetical protein CL2309Contig1_03, partial [Pinus taeda]
 gb|AFG46387.1| hypothetical protein CL2309Contig1_03, partial [Pinus taeda]
 gb|AFG46388.1| hypothetical protein CL2309Contig1_03, partial [Pinus taeda]
 gb|AFG46389.1| hypothetical protein CL2309Contig1_03, partial [Pinus taeda]
 gb|AFG46390.1| hypothetical protein CL2309Contig1_03, partial [Pinus taeda]
 gb|AFG46391.1| hypothetical protein CL2309Contig1_03, partial [Pinus taeda]
 gb|AFG46392.1| hypothetical protein CL2309Contig1_03, partial [Pinus taeda]
 gb|AFG46393.1| hypothetical protein CL2309Contig1_03, partial [Pinus taeda]
 gb|AFG46394.1| hypothetical protein CL2309Contig1_03, partial [Pinus taeda]
 gb|AFG46395.1| hypothetical protein CL2309Contig1_03, partial [Pinus taeda]
 gb|AFG46396.1| hypothetical protein CL2309Contig1_03, partial [Pinus taeda]
 gb|AFG46397.1| hypothetical protein CL2309Contig1_03, partial [Pinus taeda]
 gb|AFG46398.1| hypothetical protein CL2309Contig1_03, partial [Pinus taeda]
Length=71

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  329  GDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
             DW P L+  +LFVLL PGL +QIPG  R +EF  ++TS ++I +HTL
Sbjct  16   ADWGPVLVGVILFVLLSPGLFLQIPGNCRAVEFCNVETSGRSIAMHTL  63



>gb|ACG35954.1| hypothetical protein [Zea mays]
 gb|ACG40527.1| hypothetical protein [Zea mays]
Length=69

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI  VLF+LL PGL+ QIPG+ R+IEF   +TS  +I VH +
Sbjct  3    DWGPVLIGLVLFILLSPGLLFQIPGKGRIIEFGNFQTSGLSILVHAV  49



>ref|XP_006582287.1| PREDICTED: uncharacterized protein LOC102670423 [Glycine max]
Length=69

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ Q+PG+ +++EF  M+T   +I VHT+
Sbjct  3    DWGPMVIAVVLFVLLSPGLLFQLPGKSKVVEFGNMQTRAVSILVHTI  49



>ref|XP_008360131.1| PREDICTED: uncharacterized protein LOC103423825 [Malus domestica]
 ref|XP_009343144.1| PREDICTED: uncharacterized protein LOC103935115 [Pyrus x bretschneideri]
Length=69

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ Q+PG  +++EF  M TS  +I VHT+
Sbjct  3    DWGPVVIAVVLFVLLSPGLLFQLPGRGKVVEFGNMHTSGISILVHTI  49



>ref|XP_009149804.1| PREDICTED: uncharacterized protein LOC103873125 [Brassica rapa]
 emb|CDY44657.1| BnaA08g06830D [Brassica napus]
 emb|CDY08087.1| BnaA06g16390D [Brassica napus]
 emb|CDY05860.1| BnaC08g20370D [Brassica napus]
Length=69

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ +LFVLL PGL+ QIP   R++EF  M+TS  +I VH++
Sbjct  3    DWGPVVIAVILFVLLTPGLLFQIPARGRIVEFGNMQTSGASILVHSI  49



>ref|XP_009151994.1| PREDICTED: uncharacterized protein LOC103875252 [Brassica rapa]
Length=145

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  ++  LFVLL PG+++QIPG+ R++EF T +TS  ++ VHTL
Sbjct  3    DWGPVFVAVALFVLLTPGVLIQIPGKNRVVEFGTFQTSGLSVIVHTL  49


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P ++  +LFV+L PGL+  +PG  R ++F  +KT+ KAI VHTL
Sbjct  79   DWAPVIVGVILFVILSPGLLFSLPGNNRAVDFGNLKTNGKAIAVHTL  125



>ref|XP_003544184.1| PREDICTED: uncharacterized protein LOC100776055 [Glycine max]
Length=69

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI  VLFVLLQP L+   PG    +EF +MKT+ KAIF+H L
Sbjct  3    DWAPVLIGVVLFVLLQPVLLFSFPGNGEQLEFGSMKTNDKAIFIHML  49



>ref|XP_004516406.1| PREDICTED: uncharacterized protein LOC101504054 [Cicer arietinum]
Length=69

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  +S VLF+LL PGL+VQIPG+ +++EF   +TS  +I +H++
Sbjct  3    DWGPVFVSVVLFILLTPGLLVQIPGKAKMVEFGNFQTSGLSILIHSV  49



>gb|KEH21985.1| transmembrane protein, putative [Medicago truncatula]
Length=117

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  329  GDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
             DW P +I  +LFVL  PGL+ Q+PG+ R++EF   +TS  +IFVH+L
Sbjct  2    ADWAPIVIGLILFVLFSPGLLFQLPGKGRVVEFVNFQTSAISIFVHSL  49



>ref|XP_003631357.1| PREDICTED: uncharacterized protein LOC100852987 [Vitis vinifera]
Length=71

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +++ VLFVLL PGL+ QIP + RL+EF  M TS  +I VH +
Sbjct  3    DWGPVIVATVLFVLLTPGLLFQIPAKGRLVEFGNMSTSGLSILVHAV  49



>ref|NP_201155.1| uncharacterized protein [Arabidopsis thaliana]
 ref|XP_002864849.1| hypothetical protein ARALYDRAFT_919638 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006279720.1| hypothetical protein CARUB_v10027490mg [Capsella rubella]
 ref|XP_006394270.1| hypothetical protein EUTSA_v10005243mg [Eutrema salsugineum]
 dbj|BAB08815.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAC42648.1| GPI-anchored protein [Arabidopsis thaliana]
 gb|AAO42898.1| At5g63500 [Arabidopsis thaliana]
 gb|EFH41108.1| hypothetical protein ARALYDRAFT_919638 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED97759.1| uncharacterized protein AT5G63500 [Arabidopsis thaliana]
 gb|EOA12618.1| hypothetical protein CARUB_v10027490mg [Capsella rubella]
 gb|ESQ31556.1| hypothetical protein EUTSA_v10005243mg [Eutrema salsugineum]
Length=69

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI+ +LFV+L PGL+ QIP   R++EF  M+TS  +I VH +
Sbjct  3    DWGPVLIAVILFVVLSPGLLFQIPAGGRVVEFGNMQTSGASILVHAI  49



>gb|KEH20614.1| transmembrane protein, putative [Medicago truncatula]
Length=69

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  +S VLFVLL PGL+ QIPG  R +EF   +TS  +I +H+L
Sbjct  3    DWGPVFVSIVLFVLLTPGLLFQIPGRSRCVEFGNFQTSGASILIHSL  49



>ref|XP_002321709.2| hypothetical protein POPTR_0015s11010g [Populus trichocarpa]
 gb|EEF05836.2| hypothetical protein POPTR_0015s11010g [Populus trichocarpa]
Length=112

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  329  GDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
             DW P L+  VLF+LL PGL+ Q+PG  R +EF +  T+ KAI VHTL
Sbjct  45   ADWAPILLGFVLFILLSPGLLFQVPGTTRNLEFSSFTTNGKAIVVHTL  92



>gb|AFK45356.1| unknown [Medicago truncatula]
 gb|KEH22001.1| transmembrane protein, putative [Medicago truncatula]
Length=69

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            +W P LI+A LF LL PG+I Q+PG+   +EF  MKT+  +IFVHT+
Sbjct  3    NWAPPLIAAALFWLLSPGMIFQLPGKNSPLEFMNMKTTIASIFVHTV  49



>ref|XP_006373209.1| hypothetical protein POPTR_0017s09670g [Populus trichocarpa]
 gb|ERP51006.1| hypothetical protein POPTR_0017s09670g [Populus trichocarpa]
Length=70

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  ++ VLF+LL PGL++Q+PG  R IEF   KTS  +I VH++
Sbjct  3    DWGPVFVAVVLFILLTPGLLIQMPGHHRFIEFGNFKTSGVSILVHSI  49



>ref|XP_002877012.1| hypothetical protein ARALYDRAFT_322830 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53271.1| hypothetical protein ARALYDRAFT_322830 [Arabidopsis lyrata subsp. 
lyrata]
Length=142

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  ++  LFVLL PGL++Q+PG  R++EF T +TS  ++ VHTL
Sbjct  3    DWGPVFVAVTLFVLLTPGLLIQVPGRGRVVEFGTFQTSGLSVIVHTL  49


 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P L+  VLFV+L PGL+  +PG  R ++F  +KT+ KAI VHTL
Sbjct  76   DWAPVLVGVVLFVILSPGLLFSLPGNNRTVDFGGLKTNGKAIAVHTL  122



>ref|XP_006438002.1| hypothetical protein CICLE_v10033318mg [Citrus clementina]
 ref|XP_006484136.1| PREDICTED: uncharacterized protein LOC102617214 [Citrus sinensis]
 gb|ESR51242.1| hypothetical protein CICLE_v10033318mg [Citrus clementina]
 gb|KDO81858.1| hypothetical protein CISIN_1g040541mg [Citrus sinensis]
Length=69

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  ++ +LFVLL PGL+ Q+PG  R +EF   +TS  AI VH+L
Sbjct  3    DWGPVFVAVILFVLLSPGLLFQVPGRHRCVEFGNFQTSGAAIMVHSL  49



>ref|XP_002455352.1| hypothetical protein SORBIDRAFT_03g009080 [Sorghum bicolor]
 gb|EES00472.1| hypothetical protein SORBIDRAFT_03g009080 [Sorghum bicolor]
Length=70

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  IS VLF+LL PGL+ Q+PG+ R+IEF   +TS  +I VH +
Sbjct  3    DWAPVFISLVLFILLSPGLLFQMPGKCRIIEFGNFQTSAISILVHAI  49



>ref|XP_004967908.1| PREDICTED: uncharacterized protein LOC101762723 [Setaria italica]
Length=70

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  IS VLF+LL PGL+ QIPG+ R+IEF    TS  +I VH +
Sbjct  3    DWAPVFISLVLFILLSPGLLFQIPGKCRIIEFGNFHTSALSILVHAI  49



>ref|NP_189339.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE77258.1| uncharacterized protein AT3G27030 [Arabidopsis thaliana]
Length=142

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  ++  LFVLL PGL++Q+PG  R++EF T +TS  ++ VHTL
Sbjct  3    DWGPVFVAVTLFVLLTPGLLIQVPGRGRVVEFGTFQTSGLSVIVHTL  49


 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P L+  VLFV+L PGL+  +PG  R ++F  +KT+ KAI VHTL
Sbjct  76   DWAPVLVGVVLFVILSPGLLFSLPGNNRTVDFGGLKTNGKAIAVHTL  122



>ref|NP_190435.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB62355.1| putative protein [Arabidopsis thaliana]
 gb|AEE78441.1| uncharacterized protein AT3G48660 [Arabidopsis thaliana]
Length=89

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +++ +LFVLL PGL+ QIP   R++EF  M+TS  +I VHT+
Sbjct  3    DWGPVVVAVILFVLLTPGLLFQIPARGRVVEFGNMQTSGASILVHTI  49



>ref|XP_006395489.1| hypothetical protein EUTSA_v10005506mg [Eutrema salsugineum]
 gb|ESQ32775.1| hypothetical protein EUTSA_v10005506mg [Eutrema salsugineum]
Length=175

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  326  RGDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
              DW P L+  +LFV+L PGL+  +PG  R ++F T+KT+ KAI VHTL
Sbjct  107  MADWAPVLVGVILFVILSPGLLFSLPGNNRAVDFGTLKTNGKAIAVHTL  155


 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  ++  LFVLL PG+++QIPG+ R++EF T +TS  ++ VHTL
Sbjct  3    DWGPVFVAVTLFVLLTPGVLIQIPGKNRVVEFGTFQTSGVSVIVHTL  49



>emb|CDY11729.1| BnaC06g13370D [Brassica napus]
 emb|CDX67480.1| BnaA07g15200D [Brassica napus]
Length=69

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P L+  VLFV+L PGL+  +PG  R ++   MKT+ KAI VHTL
Sbjct  3    DWAPVLVGVVLFVMLSPGLLFSLPGHHRTLDLGGMKTNGKAIAVHTL  49



>gb|KCW61925.1| hypothetical protein EUGRSUZ_H04621 [Eucalyptus grandis]
Length=69

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLF+LL PGL+ Q+PG+ + +EF  M+T+  +I VHT+
Sbjct  3    DWGPVVIAVVLFILLSPGLLFQLPGKMKAVEFGNMQTTGASILVHTI  49



>emb|CAN77119.1| hypothetical protein VITISV_037262 [Vitis vinifera]
Length=71

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +++ VLFVLL PGL+ QIP + RL+EF  M TS  +I VH +
Sbjct  3    DWGPVIVATVLFVLLTPGLLFQIPAKGRLVEFGNMSTSGLSILVHAV  49



>emb|CDX83043.1| BnaA01g20430D [Brassica napus]
Length=69

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +++ +LFVLL PGL+ QIP   R++EF  M TS  +I VHT+
Sbjct  3    DWGPVVVAVILFVLLTPGLLFQIPARGRVVEFGNMHTSGASILVHTI  49



>ref|XP_009150403.1| PREDICTED: uncharacterized protein LOC103873762 [Brassica rapa]
 emb|CDY68989.1| BnaA06g39150D [Brassica napus]
Length=69

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI+ +LFV+L PGL+ QIP   R++EF  M+TS  +I VH +
Sbjct  3    DWGPVLIAVILFVVLTPGLLFQIPAGGRVVEFGNMQTSGASILVHAI  49



>ref|XP_007038004.1| Uncharacterized protein TCM_014659 [Theobroma cacao]
 gb|EOY22505.1| Uncharacterized protein TCM_014659 [Theobroma cacao]
Length=69

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I  +LF+LL PGL+ Q+PG  R +EF   KT+ KAI +HT+
Sbjct  3    DWAPIVIGLLLFILLSPGLLFQLPGNTRTVEFGNFKTNGKAIVIHTI  49



>ref|XP_008351734.1| PREDICTED: uncharacterized protein LOC103415161 [Malus domestica]
 ref|XP_009359420.1| PREDICTED: uncharacterized protein LOC103949997 [Pyrus x bretschneideri]
Length=69

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P L+  +LF+LL PGL+ QIPG  R +EF +  T+ KAI VHTL
Sbjct  3    DWAPILMGWLLFILLSPGLLFQIPGNSRHVEFGSFTTNGKAILVHTL  49



>gb|KDP26825.1| hypothetical protein JCGZ_17983 [Jatropha curcas]
Length=69

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  ++ +LFVLL PGL+ Q+PG +R +EF   +TS  +I VH+L
Sbjct  3    DWGPVFVAVILFVLLTPGLLFQVPGNRRCVEFGNFQTSGASIMVHSL  49



>ref|XP_009372258.1| PREDICTED: uncharacterized protein LOC103961441 [Pyrus x bretschneideri]
Length=69

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  ++ VLFVLL PGL+ Q+PG  R +EF +  TS  AI VH+L
Sbjct  3    DWGPVCVAVVLFVLLSPGLLFQLPGRHRCVEFGSFHTSGAAIMVHSL  49



>ref|XP_002875914.1| hypothetical protein ARALYDRAFT_323459 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52173.1| hypothetical protein ARALYDRAFT_323459 [Arabidopsis lyrata subsp. 
lyrata]
Length=84

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +++ +LFVLL PGL+ QIP   R++EF  M+TS  +I VHT+
Sbjct  3    DWGPVVVAVILFVLLTPGLLFQIPARGRVVEFGNMQTSGASILVHTI  49



>ref|XP_002449524.1| hypothetical protein SORBIDRAFT_05g017500 [Sorghum bicolor]
 gb|ACG39831.1| hypothetical protein [Zea mays]
 gb|ACG48790.1| hypothetical protein [Zea mays]
 gb|EES08512.1| hypothetical protein SORBIDRAFT_05g017500 [Sorghum bicolor]
 gb|AFW60737.1| hypothetical protein ZEAMMB73_570920 [Zea mays]
Length=69

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI  VLF+LL PGL+ QIPG+ R+IEF   +TS  +I +H +
Sbjct  3    DWGPVLIGLVLFILLSPGLLFQIPGKGRIIEFGNFQTSGLSILIHAV  49



>ref|XP_008341292.1| PREDICTED: uncharacterized protein LOC103404182 [Malus domestica]
Length=70

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  I+ VLF+LL PGL++Q+PG+ R +EF   +TS  +I VH++
Sbjct  3    DWGPVFIAVVLFILLTPGLLIQMPGKSRFVEFGNFQTSGVSILVHSI  49



>ref|XP_010660746.1| PREDICTED: uncharacterized protein LOC100256574 [Vitis vinifera]
 emb|CBI21335.3| unnamed protein product [Vitis vinifera]
Length=68

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW   LI++ LF  L PGLI QIPG +R  +F  MKT+  A+FVH +
Sbjct  3    DWAALLIASALFAFLSPGLIFQIPGRERPADFMGMKTNIAAVFVHAV  49



>ref|XP_009150183.1| PREDICTED: uncharacterized protein LOC103873522 [Brassica rapa]
 emb|CDY37918.1| BnaA06g18990D [Brassica napus]
 emb|CDX77917.1| BnaC03g53020D [Brassica napus]
Length=69

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  329  GDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
             DW P +++ +LFVLL PGL+ QIP   R++EF  M TS  +I VHT+
Sbjct  2    ADWGPVVVAVILFVLLTPGLLFQIPARGRIVEFGNMHTSGASILVHTI  49



>ref|XP_010680010.1| PREDICTED: uncharacterized protein LOC104895250 [Beta vulgaris 
subsp. vulgaris]
Length=69

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  326  RGDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
              DW P +++ VLF+LL PGL+ Q+PG+ R++EF  ++TS  +I VHT+
Sbjct  1    MADWGPVVMALVLFILLTPGLLFQLPGKNRVVEFGNLQTSGMSILVHTV  49



>ref|XP_008807446.1| PREDICTED: uncharacterized protein LOC103719813 isoform X2 [Phoenix 
dactylifera]
Length=142

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  I+AVLF+LL PGL+ QIPG+ R++EF   +TS  +I VH +
Sbjct  3    DWGPVFIAAVLFILLSPGLLFQIPGKNRIVEFGNFQTSGISILVHAI  49



>gb|KDP46268.1| hypothetical protein JCGZ_10108 [Jatropha curcas]
Length=69

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  ++ VLF+LL PGL++QIPG  R IEF   +TS  +I VH++
Sbjct  3    DWGPVFVAVVLFILLTPGLLIQIPGRHRFIEFGNFQTSGVSILVHSI  49



>ref|XP_010682738.1| PREDICTED: uncharacterized protein LOC104897543 [Beta vulgaris 
subsp. vulgaris]
Length=74

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  I+ +LFVLL PGL+ Q+PG +R IEF   +T   +I +H L
Sbjct  8    DWGPVFIATILFVLLSPGLLFQVPGHQRCIEFGNFRTGGASILIHAL  54



>ref|XP_008678124.1| PREDICTED: uncharacterized protein LOC100277266 [Zea mays]
Length=156

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  329  GDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
             DW P LI  VLF+LL PGL+ QIPG+ R+IEF   +TS  +I +H +
Sbjct  89   ADWGPVLIGLVLFILLSPGLLFQIPGKGRIIEFGNFQTSGLSILIHAV  136



>ref|XP_010556291.1| PREDICTED: uncharacterized protein LOC104825629 [Tarenaya hassleriana]
 ref|XP_010556292.1| PREDICTED: uncharacterized protein LOC104825629 [Tarenaya hassleriana]
Length=69

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P L+  +LF +L PGL+  +PG  R +EF ++KT+ KA+ VHTL
Sbjct  3    DWAPVLVGVILFAILSPGLLFSLPGSHRTLEFGSLKTNGKAVAVHTL  49



>ref|XP_010456447.1| PREDICTED: uncharacterized protein LOC104737892 [Camelina sativa]
Length=86

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  RRGDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            ++ DW P L++ +LFV+L PGL+ Q+PG +R +EF   +TS  ++ VH+L
Sbjct  17   KKSDWGPVLVTVILFVMLTPGLLFQLPGRQRYVEFGNFQTSAVSVIVHSL  66



>ref|XP_002300114.1| hypothetical protein POPTR_0001s33640g [Populus trichocarpa]
 gb|EEE84919.1| hypothetical protein POPTR_0001s33640g [Populus trichocarpa]
Length=68

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW   LI+A LF  L PGL+ Q+PG++R ++F  MKTS  A+FVH +
Sbjct  3    DWAAPLIAAALFAFLSPGLVFQMPGKERPLDFMNMKTSLAAMFVHLV  49



>ref|XP_010322518.1| PREDICTED: uncharacterized protein LOC101251388 [Solanum lycopersicum]
Length=69

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI+ VLFVLL PGL+ Q+PG  + +EF  M+TS  +I VH +
Sbjct  3    DWGPVLIAVVLFVLLTPGLLFQLPGRGKTVEFGNMQTSGVSILVHAV  49



>gb|ACG32653.1| hypothetical protein [Zea mays]
 tpg|DAA53890.1| TPA: hypothetical protein ZEAMMB73_765265 [Zea mays]
Length=70

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  +S VLF+LL PGL+ Q+PG+ R+IEF   +TS  +I VH +
Sbjct  3    DWAPVFVSLVLFILLSPGLLFQMPGKCRIIEFGNFQTSAISILVHAI  49



>gb|ADE76945.1| unknown [Picea sitchensis]
Length=69

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  329  GDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
             DW P ++  +LF+LL PGL+ Q+PG  R +EF   +TS K+I VHTL
Sbjct  2    ADWAPVVVGFILFILLSPGLLFQLPGHGRTVEFANFRTSGKSIVVHTL  49



>ref|XP_006347392.1| PREDICTED: uncharacterized protein LOC102602710 [Solanum tuberosum]
Length=69

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P LI+ VLFVLL PGL+ Q+PG  + +EF  M+TS  +I VH +
Sbjct  3    DWGPVLIAVVLFVLLTPGLLFQLPGRGKTVEFGNMQTSGVSILVHAV  49



>ref|XP_010027269.1| PREDICTED: uncharacterized protein LOC104417744 [Eucalyptus grandis]
Length=216

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  329  GDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
             DW P +I+ VLF+LL PGL+ Q+PG+ + +EF  M+T+  +I VHT+
Sbjct  149  ADWGPVVIAVVLFILLSPGLLFQLPGKMKAVEFGNMQTTGASILVHTI  196



>ref|XP_003568948.1| PREDICTED: uncharacterized protein LOC100830110 [Brachypodium 
distachyon]
Length=71

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = +2

Query  329  GDWLPFLISAVLFVLLQPGLIVQIPG-EKRLIEFRTMKTSFKAIFVHTL  472
            GDW P +++ + FV + PGL+ QIPG + R+ EF +M+TS  +IFVHT+
Sbjct  3    GDWGPVVLAVIFFVAMTPGLLCQIPGNDGRIAEFHSMRTSGLSIFVHTV  51



>ref|XP_003531203.1| PREDICTED: uncharacterized protein LOC100777861 [Glycine max]
 gb|KHN12379.1| hypothetical protein glysoja_018509 [Glycine soja]
 gb|KHN34829.1| hypothetical protein glysoja_036822 [Glycine soja]
Length=70

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +IS VLFVLL PGL+ Q+P + +++ F +M+TS  +I VHT+
Sbjct  4    DWGPVVISVVLFVLLSPGLLFQLPAKGKVVAFGSMQTSGLSILVHTI  50



>ref|XP_009344919.1| PREDICTED: uncharacterized protein LOC103936777 [Pyrus x bretschneideri]
Length=143

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  329  GDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
             DW P LI  VLF+LLQPGL+   PG  + +EF  MKT+ KAI VHTL
Sbjct  76   ADWGPVLIGVVLFILLQPGLLFSFPGNSKQLEFGRMKTNGKAIAVHTL  123


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  I+ VLF+LL PGL++Q+PG+ R +EF   +TS  +I VH++
Sbjct  3    DWGPVFIAVVLFILLTPGLLIQMPGKSRFVEFGNFQTSGVSILVHSI  49



>ref|XP_002456863.1| hypothetical protein SORBIDRAFT_03g044200 [Sorghum bicolor]
 gb|EES01983.1| hypothetical protein SORBIDRAFT_03g044200 [Sorghum bicolor]
Length=98

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +++ +LFV+L PGL+ Q+P   R++EF  M TS  AI VH +
Sbjct  32   DWGPIIVAVILFVVLSPGLLFQLPSRTRVVEFGNMATSAIAILVHAV  78



>ref|XP_008810234.1| PREDICTED: uncharacterized protein LOC103721704 [Phoenix dactylifera]
Length=69

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ Q+PG  R++EF   +TS  +I +HT+
Sbjct  3    DWGPVVIATVLFVLLSPGLLFQLPGRGRVVEFGNFQTSGISILIHTV  49



>ref|NP_198913.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB09699.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM13087.1| unknown protein [Arabidopsis thaliana]
 gb|AAM67349.1| unknown [Arabidopsis thaliana]
 gb|AAN15414.1| unknown protein [Arabidopsis thaliana]
 gb|AED94620.1| uncharacterized protein AT5G40970 [Arabidopsis thaliana]
Length=69

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P L+  VLFV+L PGL+  +PG    ++F  MKT+ KAI VHTL
Sbjct  3    DWAPVLVGVVLFVILSPGLLFSLPGHHHTLQFGGMKTNGKAIAVHTL  49



>ref|XP_002270989.1| PREDICTED: uncharacterized protein LOC100251434 [Vitis vinifera]
Length=70

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P ++S VLF+LL PGL+ Q+P   R++EF  M TS  AI VH +
Sbjct  4    DWGPVVVSVVLFILLSPGLLFQLPARTRVVEFGNMCTSGIAILVHAI  50



>ref|XP_009771784.1| PREDICTED: uncharacterized protein LOC104222268 [Nicotiana sylvestris]
Length=70

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +++ V+F+LL PGL+ Q+P   R+IEF  M TS  AI VH +
Sbjct  4    DWGPVVVAVVMFILLSPGLLCQLPARTRVIEFGNMYTSGIAILVHAI  50



>ref|XP_009421065.1| PREDICTED: uncharacterized protein LOC104000686 [Musa acuminata 
subsp. malaccensis]
Length=70

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  326  RGDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
              DW P  ++ +LFVLL PGL+ Q PG+ RLIEF  ++TS  +I VH++
Sbjct  1    MADWGPVFMAVILFVLLTPGLVFQAPGKSRLIEFGNLQTSGISIVVHSI  49



>ref|NP_001044809.1| Os01g0849500 [Oryza sativa Japonica Group]
 dbj|BAF06723.1| Os01g0849500 [Oryza sativa Japonica Group]
 gb|EAZ14153.1| hypothetical protein OsJ_04083 [Oryza sativa Japonica Group]
 dbj|BAG99123.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC71806.1| hypothetical protein OsI_04440 [Oryza sativa Indica Group]
Length=68

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I++ LF LL PG I+Q+PG  R ++F  MKTS  +I VH +
Sbjct  3    DWAPAIIASALFALLCPGGILQMPGRNRPVDFMNMKTSLASIVVHAV  49



>ref|XP_010232759.1| PREDICTED: uncharacterized protein LOC100824068 [Brachypodium 
distachyon]
Length=167

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P ++S VLFVLL PGL+ Q+P   R++E   M TS  AI VH +
Sbjct  101  DWGPIIVSVVLFVLLSPGLLFQLPARTRVVELGNMATSAIAILVHAI  147



>ref|XP_008347999.1| PREDICTED: uncharacterized protein LOC103411121 [Malus domestica]
Length=139

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  326  RGDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
              DW P  I  VLF+LLQPGL+  +PG  + +EF  MKT+ KAI VHTL
Sbjct  71   MADWGPIFIGVVLFILLQPGLLFALPGNSKQMEFGHMKTNGKAIAVHTL  119


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  I+ +LFVLL PGL++Q+PG+ R +EF   +TS  +I VH++
Sbjct  3    DWGPVFIAVLLFVLLTPGLLIQMPGKSRFVEFGNFQTSGVSILVHSI  49



>ref|XP_004979312.1| PREDICTED: uncharacterized protein LOC101758057 [Setaria italica]
Length=69

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  I  VLF+LL PGL+ QIPG+ R+IEF   +TS  +I +H +
Sbjct  3    DWAPVFIGLVLFILLSPGLLFQIPGKGRIIEFGNFQTSGLSILIHAI  49



>ref|XP_007031908.1| Uncharacterized protein TCM_017237 [Theobroma cacao]
 gb|EOY02834.1| Uncharacterized protein TCM_017237 [Theobroma cacao]
Length=113

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  329  GDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
             DW P +++ VLF+LL PGL+ Q+P   R+IEF  M TS  AI VH +
Sbjct  46   ADWGPVIVAVVLFILLSPGLLFQLPSRTRVIEFGNMCTSGIAILVHAV  93



>gb|KDP46266.1| hypothetical protein JCGZ_10106 [Jatropha curcas]
Length=111

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +2

Query  329  GDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHT  469
             DW P +I+  LF+LL PGL+ Q+P   R+IEF  M TS  AI +H 
Sbjct  3    ADWGPVIIAVALFILLSPGLLFQLPARTRVIEFGNMNTSGIAILIHA  49



>ref|XP_007160023.1| hypothetical protein PHAVU_002G286200g [Phaseolus vulgaris]
 gb|AAQ09000.1| hypothetical protein [Phaseolus vulgaris]
 gb|ESW32017.1| hypothetical protein PHAVU_002G286200g [Phaseolus vulgaris]
Length=69

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +I+ VLFVLL PGL+ QIP   R+ EF  M+TS  +I VH +
Sbjct  3    DWGPVIIAVVLFVLLSPGLLFQIPSRGRIAEFGNMQTSGASILVHAV  49



>ref|XP_007161716.1| hypothetical protein PHAVU_001G092400g [Phaseolus vulgaris]
 gb|ESW33710.1| hypothetical protein PHAVU_001G092400g [Phaseolus vulgaris]
Length=68

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            +W P LI+A LF LL PG+I Q+PG+    EF  MKT+  +IFVHT+
Sbjct  3    NWAPPLIAAALFWLLSPGMIFQLPGKNAPFEFMNMKTTVASIFVHTV  49



>ref|XP_006284885.1| hypothetical protein CARUB_v10006177mg [Capsella rubella]
 ref|XP_006284886.1| hypothetical protein CARUB_v10006177mg [Capsella rubella]
 gb|EOA17783.1| hypothetical protein CARUB_v10006177mg [Capsella rubella]
 gb|EOA17784.1| hypothetical protein CARUB_v10006177mg [Capsella rubella]
Length=68

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW   LI++ LF  LQPGLI+Q PG++  + F  MKT+  +IFVHT+
Sbjct  3    DWAAPLIASALFAFLQPGLILQFPGKESPVGFMNMKTTIASIFVHTV  49



>ref|XP_009597110.1| PREDICTED: uncharacterized protein LOC104093101 [Nicotiana tomentosiformis]
Length=70

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +++ V+F+LL PGL+ Q+P   R+IEF  M TS  AI VH +
Sbjct  4    DWGPVVVAVVMFILLSPGLLCQLPARTRVIEFGNMYTSGIAILVHAI  50



>ref|NP_001067936.1| Os11g0496500 [Oryza sativa Japonica Group]
 dbj|BAF28299.1| Os11g0496500 [Oryza sativa Japonica Group]
 gb|EAY81001.1| hypothetical protein OsI_36184 [Oryza sativa Indica Group]
 dbj|BAG88505.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC68208.1| hypothetical protein OsI_36188 [Oryza sativa Indica Group]
 gb|EEE52133.1| hypothetical protein OsJ_33960 [Oryza sativa Japonica Group]
Length=69

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  I  VLF+LL PGL+ QIPG+ R++EF   +TS  +I VH++
Sbjct  3    DWGPVFIGLVLFILLSPGLLFQIPGKGRIVEFGNFQTSGLSILVHSI  49



>ref|XP_010528162.1| PREDICTED: uncharacterized protein LOC104805325 [Tarenaya hassleriana]
Length=142

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  323  RRGDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
               DW P L+  +LFV+L PGL+  +PG  R +EF  +KT+ KAI VHTL
Sbjct  73   SMADWAPVLVGVILFVILSPGLLFSLPGNHRTLEFGNLKTNGKAIAVHTL  122


 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  ++  LF+LL PGL+VQIPG  + +EF T +TS  ++ VH+L
Sbjct  3    DWGPVFVAVALFILLTPGLLVQIPGRNKAVEFGTFQTSGVSVLVHSL  49



>ref|XP_004515066.1| PREDICTED: uncharacterized protein LOC101492296 [Cicer arietinum]
Length=69

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  +S VLF+LL PGL+ QIPG  +++EF   +TS  +I +H L
Sbjct  3    DWGPIFVSVVLFILLTPGLLFQIPGRNKIVEFGNFQTSGLSILIHAL  49



>ref|XP_008441325.1| PREDICTED: uncharacterized protein LOC103485474 [Cucumis melo]
Length=70

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  329  GDWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
             DW P  ++ +LFVLL PGL+VQ+PG+ R +EF   +TS  +I VH++
Sbjct  2    ADWGPVFVAVMLFVLLTPGLLVQMPGKSRFVEFGNFQTSGVSILVHSI  49



>ref|XP_008231104.1| PREDICTED: uncharacterized protein LOC103330325 [Prunus mume]
Length=70

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  ++ VLF+LL PGL++Q+PG+ R +EF   +TS  +I VH++
Sbjct  3    DWGPVFVAVVLFILLTPGLLIQMPGKGRFVEFGNFQTSGISILVHSI  49



>ref|XP_004236928.1| PREDICTED: uncharacterized protein LOC101264206 [Solanum lycopersicum]
 ref|XP_006355057.1| PREDICTED: uncharacterized protein LOC102605996 [Solanum tuberosum]
Length=69

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P L+S +LF+LL PGL+ Q+PG +  +EF    TS  +I +HTL
Sbjct  3    DWGPVLVSVILFILLSPGLLFQLPGHRHCVEFGNFHTSGASIMIHTL  49



>ref|XP_010551939.1| PREDICTED: uncharacterized protein LOC104822418 [Tarenaya hassleriana]
Length=70

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P ++S VLF+LL PG++ Q+PG+ R++EF   +TS  AI +HT+
Sbjct  4    DWGPVVMSVVLFILLTPGVLFQLPGKTRVVEFGGFQTSGAAIVIHTV  50



>ref|XP_009415891.1| PREDICTED: uncharacterized protein LOC103996657 [Musa acuminata 
subsp. malaccensis]
Length=69

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +++ +LFVLL PGL++Q+P   R++EF  M+TS  +I VH +
Sbjct  3    DWGPVVVAVMLFVLLSPGLLIQLPARGRVVEFGNMQTSGLSILVHAI  49



>ref|XP_004504402.1| PREDICTED: uncharacterized protein LOC101504831 [Cicer arietinum]
Length=143

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P +IS VLFVLL PGL+ Q+P + R++ F +M+TS  +I VHT+
Sbjct  77   DWGPVVISVVLFVLLSPGLLFQLPAKGRVVAFGSMQTSGISILVHTI  123


 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  +S VLFVLL PGL+ Q+PG  R +EF   +TS  +I +H+L
Sbjct  3    DWGPVFVSIVLFVLLTPGLLFQLPGRSRCVEFGNFQTSGASILIHSL  49



>ref|XP_007158672.1| hypothetical protein PHAVU_002G172700g [Phaseolus vulgaris]
 gb|ESW30666.1| hypothetical protein PHAVU_002G172700g [Phaseolus vulgaris]
Length=69

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  332  DWLPFLISAVLFVLLQPGLIVQIPGEKRLIEFRTMKTSFKAIFVHTL  472
            DW P  +S VLFVLL PGL+ Q+PG  R +EF   +TS  ++ +H+L
Sbjct  3    DWGPVFVSLVLFVLLTPGLLFQVPGRGRCVEFGNFQTSGASVLIHSL  49



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669965605652