BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c128085_g1_i1 len=124 path=[102:0-123]

Length=124
                                                                      Score     E

ref|WP_003447417.1|  O-succinylbenzoate-CoA synthase                  77.4    2e-15   
ref|WP_010233897.1|  O-succinylbenzoate synthase                      76.3    4e-15   
ref|WP_015615200.1|  o-succinylbenzoic acid synthetase                74.7    2e-14   
ref|WP_008426883.1|  o-succinylbenzoic acid synthetase                73.9    3e-14   
ref|WP_009171700.1|  O-succinylbenzoate synthase                      70.9    4e-13   
gb|AHF10314.1|  O-succinylbenzoate synthase                           67.0    9e-12   
ref|WP_020491018.1|  O-succinylbenzoate synthase                      67.0    1e-11   
ref|WP_015045140.1|  O-succinylbenzoate synthase                      66.6    1e-11   
ref|WP_015043098.1|  MULTISPECIES: O-succinylbenzoate synthase        66.6    1e-11   
gb|AHF07908.1|  O-succinylbenzoate synthase                           66.6    1e-11   
ref|WP_015942784.1|  O-succinylbenzoate synthase                      66.6    1e-11   
ref|WP_018307147.1|  O-succinylbenzoate synthase                      66.2    2e-11   
ref|WP_018214374.1|  O-succinylbenzoate synthase                      66.2    2e-11   
ref|WP_021315673.1|  O-succinylbenzoate synthase                      65.9    2e-11   
ref|WP_005810058.1|  O-succinylbenzoate synthase                      64.3    1e-10   
ref|WP_014793839.1|  O-succinylbenzoate synthase                      63.2    2e-10   
ref|WP_019850360.1|  O-succinylbenzoate synthase                      63.2    3e-10   
ref|WP_005387887.1|  hypothetical protein                             54.3    4e-07   
ref|WP_016475971.1|  O-succinylbenzoate synthase                      54.3    4e-07   
ref|WP_026588390.1|  O-succinylbenzoate synthase                      53.9    5e-07   
emb|CEG35055.1|  Mandelate racemase/muconate lactonizing protein      53.5    8e-07   
ref|WP_028392648.1|  O-succinylbenzoate synthase                      53.5    8e-07   
ref|WP_010195213.1|  O-succinylbenzoate synthase                      53.1    9e-07   
ref|WP_009661647.1|  o-succinylbenzoate synthase                      53.1    9e-07   
ref|WP_008587379.1|  O-succinylbenzoate synthase                      53.1    9e-07   
ref|WP_035548887.1|  N-acylamino acid racemase                        52.8    1e-06   
ref|WP_009352117.1|  o-succinylbenzoate synthase                      52.4    2e-06   
ref|WP_038191138.1|  O-succinylbenzoate synthase                      52.4    2e-06   
gb|ETT80984.1|  o-succinylbenzoic acid (OSB) synthetase               52.4    2e-06   
gb|ETJ17792.1|  O-succinylbenzoate synthase                           52.4    2e-06   
ref|WP_035409871.1|  hypothetical protein                             52.0    2e-06   
gb|ETJ23355.1|  O-succinylbenzoate synthase                           52.4    2e-06   
gb|KEZ56095.1|  hypothetical protein AS29_14495                       52.0    2e-06   
ref|WP_026578291.1|  N-acylamino acid racemase                        52.0    2e-06   
ref|WP_038153147.1|  hypothetical protein                             52.0    2e-06   
ref|WP_028257809.1|  hypothetical protein                             52.0    2e-06   
ref|WP_008715474.1|  O-succinylbenzoic acid (OSB) synthetase          52.0    2e-06   
ref|WP_035330425.1|  O-succinylbenzoate synthase                      52.0    2e-06   
ref|WP_018665347.1|  O-succinylbenzoate synthase                      52.0    2e-06   
ref|WP_008637596.1|  O-succinylbenzoate-CoA synthase                  52.0    3e-06   
ref|WP_021147781.1|  O-succinylbenzoate-CoA synthase                  52.0    3e-06   
ref|WP_008405428.1|  O-succinylbenzoate synthase                      51.6    3e-06   
ref|WP_036146276.1|  O-succinylbenzoate synthase                      51.6    3e-06   
gb|ETI98244.1|  Mandelate racemase/muconate lactonizing protein       51.6    3e-06   
ref|WP_035809937.1|  O-succinylbenzoate synthase                      51.6    3e-06   
ref|WP_004693705.1|  o-succinylbenzoic acid synthetase                51.6    3e-06   
ref|WP_027322132.1|  hypothetical protein                             51.6    3e-06   
ref|WP_036117496.1|  O-succinylbenzoate synthase                      51.6    3e-06   
ref|WP_004225539.1|  O-succinylbenzoate synthase                      51.2    4e-06   
ref|WP_006636058.1|  O-succinylbenzoate synthase MenC                 51.2    5e-06   
dbj|GAM16428.1|  O-succinylbenzoate synthase                          50.8    6e-06   
ref|WP_036157696.1|  O-succinylbenzoate synthase                      50.8    7e-06   
ref|WP_035183985.1|  O-succinylbenzoate synthase                      50.8    7e-06   
ref|WP_014097640.1|  O-succinylbenzoate synthase                      50.8    7e-06   
ref|WP_026683693.1|  O-succinylbenzoate synthase                      50.4    7e-06   
ref|WP_035188987.1|  O-succinylbenzoate synthase                      50.4    8e-06   
ref|WP_004697998.1|  o-succinylbenzoate synthase                      50.4    8e-06   
ref|WP_010095356.1|  O-succinylbenzoate synthase                      50.4    9e-06   
ref|WP_012863940.1|  mandelate racemase/muconate lactonizing protein  50.4    9e-06   
ref|WP_035511366.1|  MULTISPECIES: N-acylamino acid racemase          50.1    1e-05   
ref|WP_005377701.1|  O-succinylbenzoate synthase                      49.7    1e-05   
ref|WP_009711810.1|  O-succinylbenzoate synthase                      49.7    1e-05   
ref|WP_008602799.1|  O-succinylbenzoic acid (OSB) synthetase          49.7    2e-05   
ref|WP_023626867.1|  MULTISPECIES: hypothetical protein               49.7    2e-05   
ref|WP_038124463.1|  O-succinylbenzoate synthase                      49.7    2e-05   
ref|WP_026581401.1|  O-succinylbenzoate synthase                      49.7    2e-05   
ref|WP_015595355.1|  O-succinylbenzoate synthase                      49.7    2e-05   
ref|WP_028254490.1|  hypothetical protein                             49.7    2e-05   
ref|WP_012095943.1|  N-acylamino acid racemase                        49.7    2e-05   
ref|WP_028395270.1|  hypothetical protein                             49.3    2e-05   
ref|WP_009333407.1|  O-succinylbenzoate synthase                      49.3    2e-05   
ref|WP_019382995.1|  O-succinylbenzoate synthase                      49.3    2e-05   
ref|WP_007502984.1|  O-succinylbenzoate synthase                      49.3    2e-05   
ref|WP_009329428.1|  MULTISPECIES: O-succinylbenzoate synthase        49.3    2e-05   
ref|WP_035317810.1|  O-succinylbenzoate synthase                      48.1    2e-05   
ref|WP_003184633.1|  O-succinylbenzoate synthase                      49.3    2e-05   
ref|WP_025808457.1|  O-succinylbenzoate synthase                      49.3    2e-05   
ref|WP_019375932.1|  hypothetical protein                             49.3    2e-05   
gb|EKY21644.1|  o-succinylbenzoate synthase                           49.3    2e-05   
ref|WP_035321466.1|  O-succinylbenzoate synthase                      49.3    2e-05   
ref|WP_038148441.1|  O-succinylbenzoate synthase                      49.3    2e-05   
ref|WP_005380242.1|  O-succinylbenzoate synthase                      49.3    2e-05   
ref|WP_019121610.1|  hypothetical protein                             48.9    2e-05   
ref|WP_020452691.1|  O-succinylbenzoate synthase MenC                 48.9    2e-05   
ref|WP_010631221.1|  O-succinylbenzoate synthase                      48.9    3e-05   
ref|WP_038118074.1|  O-succinylbenzoate synthase                      49.3    3e-05   
ref|WP_017797890.1|  O-succinylbenzoate synthase                      48.9    3e-05   
ref|WP_027956477.1|  N-acylamino acid racemase                        48.9    3e-05   
ref|WP_026909225.1|  O-succinylbenzoate synthase                      48.9    3e-05   
ref|WP_004436581.1|  O-succinylbenzoate synthase                      48.9    3e-05   
ref|WP_034642795.1|  N-acylamino acid racemase                        48.9    3e-05   
ref|WP_013860037.1|  O-succinylbenzoate synthase                      48.5    3e-05   
gb|EWH23085.1|  N-acylamino acid racemase                             48.5    4e-05   
ref|WP_023855815.1|  MULTISPECIES: O-succinylbenzoate synthase        48.5    4e-05   
ref|WP_017755155.1|  O-succinylbenzoate synthase                      48.1    5e-05   
ref|WP_034673523.1|  O-succinylbenzoate synthase                      48.1    5e-05   
ref|WP_026021906.1|  O-succinylbenzoate synthase                      48.1    5e-05   
ref|WP_002089229.1|  N-acylamino acid racemase                        48.1    5e-05   
gb|EEL91434.1|  N-acylamino acid racemase                             46.6    6e-05   Bacillus cereus AH1273
emb|CEI81051.1|  o-succinylbenzoate synthase                          48.1    6e-05   
ref|WP_021619715.1|  o-succinylbenzoate synthase                      48.1    6e-05   
ref|WP_012010999.1|  O-succinylbenzoate synthase                      47.8    7e-05   
ref|WP_016837608.1|  hypothetical protein                             47.8    7e-05   
ref|WP_013353285.1|  O-succinylbenzoate synthase                      47.8    7e-05   
ref|WP_036172974.1|  O-succinylbenzoate synthase                      47.8    7e-05   
ref|WP_025785790.1|  O-succinylbenzoate synthase                      47.8    8e-05   
emb|CEG21516.1|  o-succinylbenzoate synthase                          47.8    8e-05   
ref|WP_016079911.1|  O-succinylbenzoic acid (OSB) synthetase          47.8    8e-05   
ref|WP_038464220.1|  O-succinylbenzoate synthase                      47.8    8e-05   
ref|WP_025601451.1|  O-succinylbenzoate synthase                      46.6    8e-05   
ref|WP_035391035.1|  O-succinylbenzoate synthase                      47.8    8e-05   
ref|WP_038459593.1|  O-succinylbenzoate synthase                      47.8    8e-05   
ref|WP_015240438.1|  MenC                                             47.8    8e-05   
ref|WP_003152223.1|  MULTISPECIES: O-succinylbenzoate synthase        47.8    8e-05   
ref|WP_014305634.1|  O-succinylbenzoate synthase                      47.8    8e-05   
gb|AIF44511.1|  O-succinylbenzoate synthase                           47.8    8e-05   
gb|AIU78540.1|  O-succinylbenzoate synthase                           47.8    8e-05   
ref|WP_014418709.1|  MULTISPECIES: O-succinylbenzoate synthase        47.8    8e-05   
ref|WP_012118265.1|  O-succinylbenzoate synthase                      47.8    8e-05   
ref|WP_032857356.1|  O-succinylbenzoate synthase                      47.4    9e-05   
ref|WP_032873547.1|  O-succinylbenzoate synthase                      47.4    9e-05   
ref|WP_025649760.1|  O-succinylbenzoate synthase                      47.4    9e-05   
ref|WP_007408844.1|  MULTISPECIES: O-succinylbenzoate synthase        47.4    9e-05   
ref|WP_007086133.1|  o-succinylbenzoic acid (OSB) synthetase          47.4    9e-05   
ref|WP_027724804.1|  O-succinylbenzoate synthase                      47.4    9e-05   
ref|WP_007123211.1|  O-succinylbenzoate synthase                      47.4    9e-05   
ref|WP_035702147.1|  O-succinylbenzoate synthase                      47.4    9e-05   
ref|WP_007501943.1|  o-succinylbenzoate- synthase                     47.4    9e-05   
ref|WP_008360686.1|  O-succinylbenzoate synthase                      47.4    9e-05   
ref|WP_000574801.1|  hypothetical protein                             46.2    9e-05   
emb|CDQ31351.1|  o-succinylbenzoate synthase                          47.4    9e-05   
dbj|GAK09403.1|  LOW QUALITY PROTEIN: O-succinylbenzoate synthase     47.4    9e-05   
ref|WP_017358377.1|  N-acylamino acid racemase                        47.4    9e-05   
ref|WP_011067107.1|  O-succinylbenzoate synthase                      47.4    9e-05   
ref|WP_008342917.1|  MULTISPECIES: O-succinylbenzoate synthase        47.4    1e-04   
ref|WP_036834195.1|  hypothetical protein                             47.4    1e-04   
ref|WP_003329502.1|  o-succinylbenzoic acid (OSB) synthetase          47.4    1e-04   
dbj|GAK01183.1|  LOW QUALITY PROTEIN: O-succinylbenzoate synthase     47.4    1e-04   
ref|WP_016938467.1|  O-succinylbenzoate synthase                      47.4    1e-04   
ref|WP_039042512.1|  O-succinylbenzoate synthase                      47.4    1e-04   
ref|WP_036198079.1|  O-succinylbenzoate synthase                      47.4    1e-04   
ref|WP_014644091.1|  O-succinylbenzoate synthase                      47.4    1e-04   
ref|WP_003252196.1|  O-succinylbenzoate synthase                      47.4    1e-04   
dbj|GAJ44352.1|  putative O-succinylbenzoate synthase                 47.4    1e-04   
gb|AHL72569.1|  O-succinylbenzoate synthase                           47.4    1e-04   
ref|WP_020007916.1|  O-succinylbenzoate synthase                      47.4    1e-04   
ref|WP_026563224.1|  O-succinylbenzoate synthase                      47.4    1e-04   
ref|WP_034325140.1|  O-succinylbenzoate synthase                      47.4    1e-04   
ref|WP_003217663.1|  O-succinylbenzoate synthase                      47.4    1e-04   
ref|WP_034665282.1|  O-succinylbenzoate synthase                      47.4    1e-04   
ref|WP_010750939.1|  O-succinylbenzoate synthase                      47.4    1e-04   
ref|WP_035196533.1|  O-succinylbenzoate synthase                      47.4    1e-04   
ref|WP_007086217.1|  o-succinylbenzoic acid (OSB) synthetase          47.4    1e-04   
ref|WP_035329732.1|  O-succinylbenzoate synthase                      47.4    1e-04   
ref|WP_021623643.1|  o-succinylbenzoate synthase                      47.0    1e-04   
ref|WP_007086496.1|  o-succinylbenzoic acid (OSB) synthetase          47.0    1e-04   
ref|WP_035353894.1|  O-succinylbenzoate synthase                      47.0    1e-04   
ref|WP_026679577.1|  O-succinylbenzoate synthase                      47.0    1e-04   
ref|WP_021289302.1|  MULTISPECIES: hypothetical protein               47.0    1e-04   
ref|WP_028410457.1|  O-succinylbenzoate synthase                      47.0    1e-04   
ref|WP_025729913.1|  O-succinylbenzoate synthase                      47.0    1e-04   
ref|WP_029143114.1|  MULTISPECIES: O-succinylbenzoate synthase        47.0    2e-04   
ref|WP_025750727.1|  O-succinylbenzoate synthase                      47.0    2e-04   
ref|WP_014457945.1|  O-succinylbenzoate synthase                      47.0    2e-04   
ref|WP_002191034.1|  N-acylamino acid racemase                        47.0    2e-04   
ref|WP_024027854.1|  o-succinylbenzoic acid (OSB) synthetase          47.0    2e-04   
ref|WP_009334178.1|  MULTISPECIES: O-succinylbenzoate synthase        47.0    2e-04   
ref|WP_013059562.1|  O-succinylbenzoate synthase                      47.0    2e-04   
ref|WP_016765779.1|  O-succinylbenzoate synthase                      47.0    2e-04   
ref|WP_013401389.1|  O-succinylbenzoate synthase                      47.0    2e-04   
ref|WP_023509933.1|  O-succinylbenzoate synthase                      46.6    2e-04   
ref|WP_029319911.1|  O-succinylbenzoate synthase                      46.6    2e-04   
ref|WP_012580749.1|  O-succinylbenzoate synthase                      46.6    2e-04   
ref|WP_028411865.1|  MULTISPECIES: O-succinylbenzoate synthase        46.6    2e-04   
ref|WP_034648570.1|  O-succinylbenzoate synthase                      46.6    2e-04   
ref|WP_012986427.1|  O-succinylbenzoate synthase                      46.6    2e-04   
ref|WP_026565281.1|  O-succinylbenzoate synthase                      46.6    2e-04   
ref|WP_036090501.1|  O-succinylbenzoate synthase                      46.6    2e-04   
ref|WP_020956245.1|  MULTISPECIES: O-succinylbenzoate-CoA synthase    46.6    2e-04   
ref|WP_036821066.1|  hypothetical protein                             46.6    2e-04   
gb|EFS02112.1|  O-succinylbenzoic acid (OSB) synthetase               46.6    2e-04   
ref|WP_003749525.1|  O-succinylbenzoate synthase                      46.6    2e-04   
ref|WP_026575843.1|  O-succinylbenzoate synthase                      46.6    2e-04   
ref|WP_026584961.1|  O-succinylbenzoate synthase                      46.6    2e-04   
ref|WP_026865911.1|  O-succinylbenzoate synthase                      46.6    2e-04   
ref|WP_003726232.1|  mandelate racemase/muconate lactonizing enzy...  44.7    2e-04   
ref|WP_016095902.1|  O-succinylbenzoic acid (OSB) synthetase          46.6    2e-04   
ref|WP_033731549.1|  N-acylamino acid racemase                        46.6    2e-04   
ref|WP_039168318.1|  O-succinylbenzoate synthase                      46.6    2e-04   
ref|WP_038536884.1|  O-succinylbenzoate synthase                      46.2    2e-04   
ref|WP_002138834.1|  N-acylamino acid racemase                        46.2    2e-04   
ref|WP_028399700.1|  N-acylamino acid racemase                        46.2    2e-04   
ref|WP_029566205.1|  O-succinylbenzoate synthase                      46.2    2e-04   
ref|WP_002015818.1|  N-acylamino acid racemase                        46.2    2e-04   
ref|WP_029440280.1|  N-acylamino acid racemase                        46.2    2e-04   
ref|WP_002167477.1|  N-acylamino acid racemase                        46.2    2e-04   
ref|WP_000403295.1|  N-acylamino acid racemase                        46.2    3e-04   
ref|WP_029278766.1|  O-succinylbenzoate synthase                      46.2    3e-04   
ref|WP_016092529.1|  O-succinylbenzoic acid (OSB) synthetase          46.2    3e-04   
ref|WP_002067823.1|  N-acylamino acid racemase                        46.2    3e-04   
ref|WP_007474007.1|  putative N-acylamino acid racemase               45.1    3e-04   
ref|WP_034653900.1|  O-succinylbenzoate synthase                      46.2    3e-04   
ref|WP_019119652.1|  hypothetical protein                             46.2    3e-04   
ref|WP_010990009.1|  O-succinylbenzoate synthase                      46.2    3e-04   
ref|WP_019243989.1|  hypothetical protein                             46.2    3e-04   
ref|WP_016766446.1|  O-succinylbenzoate synthase                      46.2    3e-04   
gb|EFR83468.1|  N-acylamino acid racemase                             43.5    3e-04   
ref|WP_024424935.1|  O-succinylbenzoate synthase                      46.2    3e-04   
gb|EUJ45855.1|  N-acylamino acid racemase                             45.8    3e-04   
ref|WP_009497870.1|  O-succinylbenzoate synthase                      45.8    3e-04   
ref|WP_031295637.1|  O-succinylbenzoate synthase                      45.8    3e-04   
ref|WP_012952027.1|  O-succinylbenzoate synthase                      45.8    3e-04   
ref|WP_031645151.1|  O-succinylbenzoate synthase                      45.8    3e-04   
ref|WP_002199002.1|  N-acylamino acid racemase                        45.8    3e-04   
ref|WP_000635662.1|  O-succinylbenzoate synthase                      45.8    3e-04   
ref|WP_039176787.1|  O-succinylbenzoate synthase                      45.8    3e-04   
ref|WP_034621239.1|  O-succinylbenzoate synthase                      45.8    3e-04   
ref|WP_024425781.1|  O-succinylbenzoate synthase                      45.8    3e-04   
ref|WP_014324525.1|  O-succinylbenzoate synthase                      45.8    3e-04   
ref|WP_031941115.1|  O-succinylbenzoate synthase                      44.3    3e-04   
ref|WP_036099659.1|  O-succinylbenzoate synthase                      45.8    3e-04   
gb|AHF18894.1|  L-alanine-DL-glutamate epimerase related enzyme o...  45.8    3e-04   
ref|WP_039180908.1|  O-succinylbenzoate synthase                      45.8    3e-04   
ref|WP_009795310.1|  MULTISPECIES: O-succinylbenzoate synthase        45.8    3e-04   
ref|WP_013055777.1|  O-succinylbenzoate synthase                      45.8    3e-04   
ref|WP_034279379.1|  O-succinylbenzoate synthase                      45.8    3e-04   
gb|KIG00233.1|  O-succinylbenzoate synthase                           45.8    4e-04   
ref|WP_013082069.1|  O-succinylbenzoate synthase                      45.8    4e-04   
gb|KFN02200.1|  o-succinylbenzoate synthase                           45.8    4e-04   
ref|WP_002112537.1|  N-acylamino acid racemase                        45.8    4e-04   
ref|WP_039237693.1|  O-succinylbenzoate synthase                      45.8    4e-04   
ref|WP_033578245.1|  O-succinylbenzoate synthase                      45.8    4e-04   
ref|WP_028407734.1|  O-succinylbenzoate synthase                      45.8    4e-04   
ref|WP_025749606.1|  O-succinylbenzoate synthase                      45.8    4e-04   
ref|WP_008410448.1|  o-succinylbenzoate synthase                      45.8    4e-04   
ref|WP_027408410.1|  O-succinylbenzoate synthase                      45.8    4e-04   
ref|WP_014461249.1|  O-succinylbenzoate synthase                      45.8    4e-04   
ref|WP_011679541.1|  O-succinylbenzoate synthase                      45.8    4e-04   
ref|WP_004164232.1|  O-succinylbenzoate synthase                      45.8    4e-04   
ref|WP_000403294.1|  N-acylamino acid racemase                        45.8    4e-04   
ref|WP_008175179.1|  O-succinylbenzoate synthase                      45.4    4e-04   
ref|WP_010860379.1|  O-succinylbenzoate synthase                      45.4    4e-04   
gb|EZP78877.1|  o-succinylbenzoic acid (OSB) synthetase               45.4    5e-04   
ref|WP_029324964.1|  O-succinylbenzoate synthase                      45.4    5e-04   
ref|WP_026041591.1|  O-succinylbenzoate synthase                      45.4    5e-04   
ref|WP_034286372.1|  O-succinylbenzoate synthase                      45.4    5e-04   
ref|WP_016120967.1|  O-succinylbenzoic acid (OSB) synthetase          45.4    5e-04   
ref|WP_034269950.1|  O-succinylbenzoate synthase                      45.4    5e-04   
ref|WP_025117538.1|  O-succinylbenzoate synthase                      45.4    5e-04   
ref|WP_002129645.1|  N-acylamino acid racemase                        45.4    5e-04   
ref|WP_002164872.1|  N-acylamino acid racemase                        45.4    5e-04   
gb|ABZ81711.1|  N-acylamino acid racemase                             45.4    5e-04   Geobacillus kaustophilus
ref|WP_003191956.1|  MULTISPECIES: N-acylamino acid racemase          45.4    5e-04   
ref|WP_035432583.1|  N-acylamino acid racemase                        45.4    5e-04   
ref|WP_016130419.1|  O-succinylbenzoic acid (OSB) synthetase          45.4    5e-04   
ref|WP_033543996.1|  hypothetical protein                             42.7    5e-04   
ref|WP_012261897.1|  N-acylamino acid racemase                        45.4    5e-04   
ref|WP_016102880.1|  O-succinylbenzoic acid (OSB) synthetase          45.4    5e-04   
ref|WP_036177407.1|  O-succinylbenzoate synthase                      45.4    5e-04   
emb|CEI80417.1|  o-succinylbenzoate synthase                          45.4    5e-04   
ref|WP_002184762.1|  N-acylamino acid racemase                        45.4    5e-04   
ref|WP_023557523.1|  O-succinylbenzoate synthase                      45.4    5e-04   
ref|WP_025910139.1|  O-succinylbenzoate synthase                      45.4    5e-04   
ref|WP_002143563.1|  N-acylamino acid racemase                        45.1    6e-04   
ref|WP_002034510.1|  MULTISPECIES: N-acylamino acid racemase          45.1    6e-04   
ref|WP_036121152.1|  MULTISPECIES: O-succinylbenzoate synthase        45.1    6e-04   
ref|WP_000403279.1|  N-acylamino acid racemase                        45.1    6e-04   
ref|WP_000403289.1|  N-acylamino acid racemase                        45.1    6e-04   
ref|WP_000403320.1|  N-acylamino acid racemase                        45.1    6e-04   
ref|WP_034658950.1|  O-succinylbenzoate synthase                      45.1    6e-04   
ref|WP_036223437.1|  O-succinylbenzoate synthase                      45.1    6e-04   
ref|WP_014822510.1|  O-succinylbenzoate synthase                      45.1    6e-04   
ref|WP_000403311.1|  N-acylamino acid racemase                        45.1    6e-04   
ref|WP_008405844.1|  O-succinylbenzoate synthase                      45.1    6e-04   
ref|WP_000403288.1|  N-acylamino acid racemase                        45.1    6e-04   
gb|EAL13678.1|  O-succinylbenzoic acid (OSB) synthetase               45.1    6e-04   Bacillus cereus G9241
ref|WP_033676261.1|  N-acylamino acid racemase                        45.1    7e-04   
ref|WP_000403321.1|  N-acylamino acid racemase                        45.1    7e-04   
ref|WP_000403287.1|  N-acylamino acid racemase                        45.1    7e-04   
ref|WP_033691523.1|  N-acylamino acid racemase                        45.1    7e-04   
ref|WP_016110861.1|  O-succinylbenzoic acid (OSB) synthetase          45.1    7e-04   
ref|WP_008878864.1|  O-succinylbenzoate synthase                      45.1    7e-04   
ref|WP_016718777.1|  N-acylamino acid racemase                        45.1    7e-04   
ref|WP_000403272.1|  N-acylamino acid racemase                        44.7    8e-04   
ref|WP_035855618.1|  O-succinylbenzoate synthase                      44.7    8e-04   
ref|WP_035810775.1|  O-succinylbenzoate synthase                      44.7    8e-04   
ref|WP_033668361.1|  hypothetical protein                             44.3    8e-04   
ref|WP_007544079.1|  O-succinylbenzoate synthase                      44.7    8e-04   
ref|WP_029760351.1|  O-succinylbenzoate synthase                      44.7    8e-04   
ref|WP_011887017.1|  O-succinylbenzoate synthase                      44.7    8e-04   
ref|WP_000403322.1|  N-acylamino acid racemase                        44.7    8e-04   
ref|WP_016106486.1|  O-succinylbenzoic acid (OSB) synthetase          44.7    8e-04   
gb|EEL53713.1|  o-succinylbenzoate synthase                           44.3    8e-04   
ref|WP_036096919.1|  O-succinylbenzoate synthase                      44.7    8e-04   
ref|WP_000403273.1|  N-acylamino acid racemase                        44.7    9e-04   
ref|WP_002160062.1|  N-acylamino acid racemase                        44.7    9e-04   
ref|WP_004913065.1|  O-succinylbenzoate synthase                      44.7    9e-04   
ref|WP_010278395.1|  O-succinylbenzoate synthase                      44.7    9e-04   
gb|AIE36123.1|  enolase                                               44.7    9e-04   
ref|WP_016118795.1|  O-succinylbenzoic acid (OSB) synthetase          44.7    9e-04   
ref|WP_000403296.1|  N-acylamino acid racemase                        44.7    9e-04   
ref|WP_036076648.1|  O-succinylbenzoate synthase                      44.7    0.001   
ref|WP_000403290.1|  N-acylamino acid racemase                        44.7    0.001   
ref|WP_018394217.1|  hypothetical protein                             44.7    0.001   
ref|WP_000403451.1|  MULTISPECIES: N-acylamino acid racemase          44.7    0.001   
ref|WP_000403449.1|  N-acylamino acid racemase                        44.7    0.001   
ref|WP_000403450.1|  N-acylamino acid racemase                        44.7    0.001   
ref|WP_000403453.1|  N-acylamino acid racemase                        44.7    0.001   
ref|WP_000403278.1|  N-acylamino acid racemase                        44.7    0.001   
ref|WP_000403265.1|  MULTISPECIES: N-acylamino acid racemase          44.7    0.001   
ref|WP_000403448.1|  N-acylamino acid racemase                        44.7    0.001   



>ref|WP_003447417.1| O-succinylbenzoate-CoA synthase [Clostridium pasteurianum]
 gb|ELP57910.1| O-succinylbenzoate-CoA synthase [Clostridium pasteurianum DSM 
525 = ATCC 6013]
 gb|KER13669.1| o-succinylbenzoic acid (OSB) synthetase [Clostridium pasteurianum 
DSM 525 = ATCC 6013]
 gb|AJA48612.1| o-succinylbenzoate synthase [Clostridium pasteurianum DSM 525 
= ATCC 6013]
 gb|AJA52600.1| o-succinylbenzoate synthase [Clostridium pasteurianum DSM 525 
= ATCC 6013]
Length=368

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/39 (95%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SLKDTYIPGDLSSSNRYFK+DIIKPEIIVKNGIIKVP+G
Sbjct  306  SLKDTYIPGDLSSSNRYFKRDIIKPEIIVKNGIIKVPEG  344



>ref|WP_010233897.1| O-succinylbenzoate synthase [Clostridium arbusti]
Length=369

 Score = 76.3 bits (186),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SLKDTYIPGDLSSSNRYFK+DIIKPEII KNGIIK+PKG
Sbjct  306  SLKDTYIPGDLSSSNRYFKRDIIKPEIIAKNGIIKIPKG  344



>ref|WP_015615200.1| o-succinylbenzoic acid synthetase [Clostridium pasteurianum]
 ref|YP_007940569.1| o-succinylbenzoic acid synthetase [Clostridium pasteurianum BC1]
 gb|AGK96892.1| o-succinylbenzoic acid synthetase [Clostridium pasteurianum BC1]
Length=369

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SLKDTYIPGDLSSSNRYFKKDIIKPEII K+GII+VPKG
Sbjct  306  SLKDTYIPGDLSSSNRYFKKDIIKPEIIAKSGIIRVPKG  344



>ref|WP_008426883.1| o-succinylbenzoic acid synthetase [Clostridium sp. Maddingley 
MBC34-26]
 gb|EKQ52294.1| o-succinylbenzoic acid synthetase [Clostridium sp. Maddingley 
MBC34-26]
Length=369

 Score = 73.9 bits (180),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SLKDTYIPGDLSSSNRYFKKDIIKPEII +NG IKVPKG
Sbjct  306  SLKDTYIPGDLSSSNRYFKKDIIKPEIIAENGRIKVPKG  344



>ref|WP_009171700.1| O-succinylbenzoate synthase [Clostridium sp. DL-VIII]
 gb|EHJ01051.1| o-succinylbenzoic acid (OSB) synthetase [Clostridium sp. DL-VIII]
Length=368

 Score = 70.9 bits (172),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL+DTYIPGDLSSS RYF++D+IKPEII +NGIIKVPKG
Sbjct  306  SLQDTYIPGDLSSSKRYFERDVIKPEIIAENGIIKVPKG  344



>gb|AHF10314.1| O-succinylbenzoate synthase [Dehalobacter restrictus DSM 9455]
Length=367

 Score = 67.0 bits (162),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SLKDTYIPGDLS S RYF +DII+PE+ V+NG I+VP+G
Sbjct  306  SLKDTYIPGDLSPSQRYFSQDIIRPEVTVQNGRIEVPRG  344



>ref|WP_020491018.1| O-succinylbenzoate synthase [Dehalobacter sp. FTH1]
Length=367

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SLKDTYIPGDLS S RYF +DII+PEI V+NG I+VP+G
Sbjct  306  SLKDTYIPGDLSPSRRYFPQDIIRPEITVQNGRIEVPQG  344



>ref|WP_015045140.1| O-succinylbenzoate synthase [Dehalobacter sp. CF]
 ref|YP_006913079.1| O-succinylbenzoate-CoA synthase [Dehalobacter sp. CF]
 gb|AFV05094.1| O-succinylbenzoate-CoA synthase [Dehalobacter sp. CF]
Length=367

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SLKDTYIPGDLS S RYF +DII+PE+ V+NG I+VP+G
Sbjct  306  SLKDTYIPGDLSPSQRYFPQDIIRPEVTVQNGRIEVPRG  344



>ref|WP_015043098.1| MULTISPECIES: O-succinylbenzoate synthase [Dehalobacter]
 ref|YP_006910045.1| O-succinylbenzoate-CoA synthase [Dehalobacter sp. DCA]
 gb|AFV02060.1| O-succinylbenzoate-CoA synthase [Dehalobacter sp. DCA]
Length=367

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SLKDTYIPGDLS S RYF +DII+PE+ V+NG I+VP+G
Sbjct  306  SLKDTYIPGDLSPSQRYFPQDIIRPEVTVQNGRIEVPRG  344



>gb|AHF07908.1| O-succinylbenzoate synthase [Desulfitobacterium metallireducens 
DSM 15288]
Length=372

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SLKD YIPGDLSSS RYF +D+I+PEII   G+I+VPKG
Sbjct  307  SLKDNYIPGDLSSSRRYFSEDVIQPEIIASQGLIQVPKG  345



>ref|WP_015942784.1| O-succinylbenzoate synthase [Desulfitobacterium hafniense]
 ref|YP_002456977.1| mandelate racemase [Desulfitobacterium hafniense DCB-2]
 gb|ACL18541.1| Mandelate racemase/muconate lactonizing protein [Desulfitobacterium 
hafniense DCB-2]
Length=378

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SLKD YIPGDLSSS RYF +D+I+PEI V+ G+I+VP+G
Sbjct  306  SLKDNYIPGDLSSSRRYFARDVIRPEITVQRGLIQVPRG  344



>ref|WP_018307147.1| O-succinylbenzoate synthase [Desulfitobacterium hafniense]
Length=378

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SLKD YIPGDLSSS RYF +D+I+PEI V+ G+I+VP+G
Sbjct  306  SLKDNYIPGDLSSSRRYFARDVIRPEITVQRGLIQVPRG  344



>ref|WP_018214374.1| O-succinylbenzoate synthase [Desulfitobacterium hafniense]
Length=378

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SLKD YIPGDLSSS RYF +D+I+PEI V+ G+I+VP+G
Sbjct  306  SLKDNYIPGDLSSSRRYFARDVIQPEITVQRGLIQVPRG  344



>ref|WP_021315673.1| O-succinylbenzoate synthase [Dehalobacter sp. UNSWDHB]
 gb|EQB20823.1| O-succinylbenzoate synthase [Dehalobacter sp. UNSWDHB]
Length=367

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SLKDTYIPGDLS S RYF +DII+PE+ V+NG I+VP+G
Sbjct  306  SLKDTYIPGDLSPSQRYFPQDIIRPEVTVQNGRIEVPRG  344



>ref|WP_005810058.1| O-succinylbenzoate synthase [Desulfitobacterium hafniense]
 ref|YP_516755.1| o-succinylbenzoate synthase [Desulfitobacterium hafniense Y51]
 dbj|BAE82311.1| o-succinylbenzoate synthase [Desulfitobacterium hafniense Y51]
 gb|EHL07836.1| o-succinylbenzoate synthase [Desulfitobacterium hafniense DP7]
 emb|CDX00516.1| o-succinylbenzoate synthase [Desulfitobacterium hafniense]
Length=378

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SLKD YIPGDLSSS RYF +D+I+PEI V+ G I+VP+G
Sbjct  306  SLKDNYIPGDLSSSRRYFARDVIQPEITVQRGRIQVPRG  344



>ref|WP_014793839.1| O-succinylbenzoate synthase [Desulfitobacterium dehalogenans]
 ref|YP_006430145.1| o-succinylbenzoic acid synthetase [Desulfitobacterium dehalogenans 
ATCC 51507]
 gb|AFM00352.1| o-succinylbenzoic acid synthetase [Desulfitobacterium dehalogenans 
ATCC 51507]
Length=374

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL D YIPGDLSS+ RYF KD+I+PEI V+ G+I+VP+G
Sbjct  306  SLMDNYIPGDLSSTRRYFSKDVIQPEIAVRKGLIQVPQG  344



>ref|WP_019850360.1| O-succinylbenzoate synthase [Desulfitobacterium sp. PCE1]
Length=374

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL D YIPGDLSS+ RYF KD+I+PEI V+ G+I+VP+G
Sbjct  306  SLMDNYIPGDLSSTRRYFSKDVIQPEIAVRKGLIQVPQG  344



>ref|WP_005387887.1| hypothetical protein [Veillonella dispar]
 gb|EEP64862.1| o-succinylbenzoate synthase [Veillonella dispar ATCC 17748]
Length=383

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +L D+Y+ GDLS SNRYF++D+I P++  KNG++ VP G
Sbjct  323  ALGDSYMAGDLSDSNRYFERDLIYPDLTFKNGVMHVPDG  361



>ref|WP_016475971.1| O-succinylbenzoate synthase [Veillonella sp. HPA0037]
 gb|EPD79283.1| O-succinylbenzoate synthase [Veillonella sp. HPA0037]
Length=380

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/39 (56%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +L DTY+ GDLS SNRYF+ D+I PEI+  +G ++VP G
Sbjct  320  ALGDTYMAGDLSDSNRYFEHDLIDPEILFTDGAMQVPNG  358



>ref|WP_026588390.1| O-succinylbenzoate synthase [Bacillus sp. NSP9.1]
Length=369

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL    IPGD+SSS+RY+++DI+KPEI ++NG IKVPK
Sbjct  307  SLPQFLIPGDISSSSRYWEEDIVKPEIEIENGWIKVPK  344



>emb|CEG35055.1| Mandelate racemase/muconate lactonizing protein [Bacillus simplex]
Length=369

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SLK   IPGD+SSS+RY+  DII PE+IV+NG+I+VP
Sbjct  308  SLKGFTIPGDISSSSRYWDGDIIDPEVIVENGMIQVP  344



>ref|WP_028392648.1| O-succinylbenzoate synthase [Bacillus sp. FJAT-14515]
Length=368

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL    IPGDLSSS+RY+++DI+ PEI+VK+G I VP G
Sbjct  306  SLHGFTIPGDLSSSSRYWEQDIVNPEIVVKDGNITVPDG  344



>ref|WP_010195213.1| O-succinylbenzoate synthase [Bacillus sp. m3-13]
Length=374

 Score = 53.1 bits (126),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 22/39 (56%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL +  IPGDLS+S+RY++KD+I PE++V++G +KVP+G
Sbjct  307  SLPNFTIPGDLSASSRYWEKDVIIPEVVVEDGKVKVPEG  345



>ref|WP_009661647.1| o-succinylbenzoate synthase [Veillonella sp. ACP1]
 gb|EJO49245.1| o-succinylbenzoate synthase [Veillonella sp. ACP1]
Length=380

 Score = 53.1 bits (126),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +L D Y+ GDLS+SNRYF+ D+I PEI+  +G+++VP G
Sbjct  320  ALGDAYMAGDLSNSNRYFEHDLIDPEILFTDGVMQVPNG  358



>ref|WP_008587379.1| O-succinylbenzoate synthase [Salimicrobium sp. MJ3]
 gb|EKE33095.1| O-succinylbenzoate-CoA synthase [Salimicrobium sp. MJ3]
Length=356

 Score = 53.1 bits (126),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL +  +PGDLS S+RYFKKDIIK  I ++NG I+VP G
Sbjct  294  SLPNFTLPGDLSGSDRYFKKDIIKDPIYLENGFIRVPTG  332



>ref|WP_035548887.1| N-acylamino acid racemase [Halobacillus sp. BBL2006]
 gb|KHE68249.1| N-acylamino acid racemase [Halobacillus sp. BBL2006]
Length=366

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SL +  IPGDLSSS RYF KDIIKP I V+NG I+VP
Sbjct  304  SLPNFSIPGDLSSSTRYFAKDIIKPGIEVENGEIEVP  340



>ref|WP_009352117.1| o-succinylbenzoate synthase [Veillonella sp. oral taxon 158]
 gb|EFR60040.1| o-succinylbenzoate synthase [Veillonella sp. oral taxon 158 str. 
F0412]
Length=383

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +L D+Y+ GDLS SNRYF++D+I P++  K+G++ VP G
Sbjct  323  ALGDSYMAGDLSDSNRYFERDLIYPDLTFKDGVMHVPDG  361



>ref|WP_038191138.1| O-succinylbenzoate synthase [Viridibacillus arenosi]
Length=377

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SL    +PGD +SS+RY++KDII+PE+IV+NGII +P
Sbjct  307  SLSQFVLPGDTASSDRYWEKDIIEPEVIVENGIITIP  343



>gb|ETT80984.1| o-succinylbenzoic acid (OSB) synthetase [Viridibacillus arenosi 
FSL R5-213]
Length=382

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SL    +PGD +SS+RY++KDII+PE+IV+NGII +P
Sbjct  312  SLSQFVLPGDTASSDRYWEKDIIEPEVIVENGIITIP  348



>gb|ETJ17792.1| O-succinylbenzoate synthase [Veillonella sp. DORA_A_3_16_22]
Length=383

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +L D+Y+ GDLS SNRYF++D+I P++  K+G++ VP G
Sbjct  323  ALGDSYMAGDLSDSNRYFERDLIYPDLTFKDGVMHVPDG  361



>ref|WP_035409871.1| hypothetical protein [Bacillus sp. SJS]
Length=369

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL +  IPGD+SSS+RY+ +DII PE+IV+NG I VP+G
Sbjct  307  SLSNFSIPGDISSSSRYWHEDIIVPEVIVENGEIIVPEG  345



>gb|ETJ23355.1| O-succinylbenzoate synthase [Veillonella sp. DORA_A_3_16_22]
Length=383

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +L D+Y+ GDLS SNRYF++D+I P++  K+G++ VP G
Sbjct  323  ALGDSYMAGDLSDSNRYFERDLIYPDLTFKDGVMHVPDG  361



>gb|KEZ56095.1| hypothetical protein AS29_14495 [Bacillus sp. SJS]
Length=368

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL +  IPGD+SSS+RY+ +DII PE+IV+NG I VP+G
Sbjct  306  SLSNFSIPGDISSSSRYWHEDIIVPEVIVENGEIIVPEG  344



>ref|WP_026578291.1| N-acylamino acid racemase [Bacillus sp. SB49]
Length=368

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +L +  IPGDLSSS RYF++DI++P II+  G I+VP+G
Sbjct  305  TLPNFTIPGDLSSSTRYFERDIVQPPIIMDRGEIRVPEG  343



>ref|WP_038153147.1| hypothetical protein [Veillonella montpellierensis]
 gb|KGF46519.1| hypothetical protein HMPREF0872_08090 [Veillonella montpellierensis 
DNF00314]
Length=378

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +L D+Y+PGDLS S+RYF  D+  P ++  +GI+KVP G
Sbjct  316  ALGDSYMPGDLSDSSRYFYDDLTTPALVFNDGIMKVPNG  354



>ref|WP_028257809.1| hypothetical protein [Veillonella montpellierensis]
Length=378

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +L D+Y+PGDLS S+RYF  D+  P ++  +GI+KVP G
Sbjct  316  ALGDSYMPGDLSDSSRYFYDDLTTPALVFNDGIMKVPNG  354



>ref|WP_008715474.1| O-succinylbenzoic acid (OSB) synthetase [Veillonella sp. 3_1_44]
 gb|EFG22716.1| o-succinylbenzoate synthase [Veillonella sp. 3_1_44]
Length=383

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +L D+Y+ GDLS S+RYF++D+I P++  KNG+++VP G
Sbjct  323  ALGDSYMAGDLSDSSRYFEQDLIFPDLTFKNGVMQVPDG  361



>ref|WP_035330425.1| O-succinylbenzoate synthase [Bacillus firmus]
 gb|EWG10639.1| mandelate racemase/muconate lactonizing protein [Bacillus firmus 
DS1]
Length=368

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SL+   IPGD+S+S RY+++DII PE+ VKNGII+VP
Sbjct  306  SLEGFAIPGDISASERYWEEDIILPEVTVKNGIIRVP  342



>ref|WP_018665347.1| O-succinylbenzoate synthase [Bacillus acidiproducens]
Length=369

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/31 (68%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +3

Query  21   IPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            IPGDLS+SNR+++KDII+PE+ V+NG I+VP
Sbjct  313  IPGDLSASNRFWEKDIIEPEVAVENGRIRVP  343



>ref|WP_008637596.1| O-succinylbenzoate-CoA synthase [Halobacillus sp. BAB-2008]
 gb|ELK45967.1| O-succinylbenzoate-CoA synthase [Halobacillus sp. BAB-2008]
Length=367

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +L +  IPGDLSSS RYF++DI++P II+  G I+VP+G
Sbjct  304  TLPNFTIPGDLSSSTRYFERDIVQPPIIMDRGEIRVPEG  342



>ref|WP_021147781.1| O-succinylbenzoate-CoA synthase [Veillonella parvula]
 gb|EQC67611.1| O-succinylbenzoate-CoA synthase [Veillonella parvula HSIVP1]
Length=383

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +L D+Y+ GDLS SNRYF++D+I P++  K GI++VP G
Sbjct  323  ALGDSYMAGDLSDSNRYFEQDLIFPDLTFKAGIMQVPDG  361



>ref|WP_008405428.1| O-succinylbenzoate synthase [Bacillus isronensis]
 gb|EKB45651.1| o-succinylbenzoate synthase [Bacillus isronensis B3W22]
Length=368

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            +L +  +PGD +SSNRY++KDII+PE++ +NG I+VP+
Sbjct  307  TLSNFILPGDTASSNRYWEKDIIEPEVVAENGYIQVPQ  344



>ref|WP_036146276.1| O-succinylbenzoate synthase [Lysinibacillus sp. BF-4]
 gb|KFL42601.1| O-succinylbenzoate synthase [Lysinibacillus sp. BF-4]
Length=368

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            +L +  +PGD +SSNRY+KKDII+PE++ ++G I+VP+
Sbjct  307  TLSNFILPGDTASSNRYWKKDIIEPEVVAQDGYIEVPQ  344



>gb|ETI98244.1| Mandelate racemase/muconate lactonizing protein [Veillonella 
dispar DORA_11]
Length=383

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +L D+Y+ GDLS SNRYF++D+I P++  K GI++VP G
Sbjct  323  ALGDSYMAGDLSDSNRYFEQDLIFPDLTFKAGIMQVPDG  361



>ref|WP_035809937.1| O-succinylbenzoate synthase [Jeotgalicoccus sp. 13MG44_air]
 emb|CEA01850.1| o-succinylbenzoate synthase [Jeotgalicoccus sp. 13MG44_air]
Length=368

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            +L++  +PGD +SS+RYF+KDII+PE+I +NG I+VP+
Sbjct  307  TLENFTLPGDTASSSRYFEKDIIEPEVIAENGSIEVPE  344



>ref|WP_004693705.1| o-succinylbenzoic acid synthetase [Veillonella parvula]
 gb|EFB86259.1| o-succinylbenzoate synthase [Veillonella parvula ATCC 17745]
Length=383

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +L D+Y+ GDLS SNRYF++D+I P++  K G+++VP G
Sbjct  323  ALGDSYMAGDLSDSNRYFEQDLIFPDLTFKKGVMQVPDG  361



>ref|WP_027322132.1| hypothetical protein [Bacillus sp. URHB0009]
Length=368

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL    IPGD+SSS+R++++DII PE+IV+NG IKVPK
Sbjct  306  SLPGFTIPGDISSSSRFWEEDIILPEVIVENGYIKVPK  343



>ref|WP_036117496.1| O-succinylbenzoate synthase [Lysinibacillus sphaericus]
Length=368

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            +L +  +PGD + SNRY++KDII+PEI+VK G I+VP+
Sbjct  307  TLSNFILPGDTAGSNRYWEKDIIEPEIVVKGGYIEVPQ  344



>ref|WP_004225539.1| O-succinylbenzoate synthase [Lysinibacillus fusiformis]
 gb|EFI70094.1| O-succinylbenzoate synthase [Lysinibacillus fusiformis ZC1]
 gb|EKU42572.1| O-succinylbenzoate synthase [Lysinibacillus fusiformis ZB2]
Length=368

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            +L +  +PGD + SNRY++KDII+PE++VK+G I+VP+
Sbjct  307  TLSNFILPGDTAGSNRYWEKDIIEPEVVVKDGYIEVPQ  344



>ref|WP_006636058.1| O-succinylbenzoate synthase MenC [Bacillus sonorensis]
 gb|EME76635.1| O-succinylbenzoate synthase MenC [Bacillus sonorensis L12]
Length=369

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SL    IPGD+SSS+RY+++DI+KPEI + NG IKVP
Sbjct  307  SLPQFLIPGDISSSSRYWEEDIVKPEIRINNGFIKVP  343



>dbj|GAM16428.1| O-succinylbenzoate synthase [Bacillus selenatarsenatis SF-1]
Length=367

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL    IPGD+S S+RY++KDII+PEI V +G+IK+P+G
Sbjct  305  SLPGFTIPGDISGSDRYWEKDIIQPEITVYDGMIKMPEG  343



>ref|WP_036157696.1| O-succinylbenzoate synthase [Lysinibacillus odysseyi]
 gb|KGR82778.1| O-succinylbenzoate synthase [Lysinibacillus odysseyi 34hs-1 = 
NBRC 100172]
Length=368

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            +L +  +PGD +SSNRY++KDII+PE++ +NG I VP+
Sbjct  307  TLSNFILPGDTASSNRYWEKDIIEPEVVAENGYIHVPQ  344



>ref|WP_035183985.1| O-succinylbenzoate synthase [Bacillus coagulans]
 gb|KGB29228.1| O-succinylbenzoate synthase [Bacillus coagulans]
Length=367

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SL    IPGD+SSS+R+++KDII+PEI V+NG I++P
Sbjct  307  SLPGFTIPGDISSSSRFWEKDIIEPEITVENGQIRLP  343



>ref|WP_014097640.1| O-succinylbenzoate synthase [Bacillus coagulans]
 ref|YP_004860360.1| o-succinylbenzoic acid (OSB) synthetase [Bacillus coagulans 36D1]
 gb|AEP01580.1| o-succinylbenzoic acid (OSB) synthetase [Bacillus coagulans 36D1]
Length=367

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SL    IPGD+SSS+R+++KDII+PEI V+NG I++P
Sbjct  307  SLPGFTIPGDISSSSRFWEKDIIEPEITVENGQIRLP  343



>ref|WP_026683693.1| O-succinylbenzoate synthase [Bacillus coagulans]
Length=367

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SL    IPGD+SSS+R+++KDII+PEI V+NG I++P
Sbjct  307  SLPGFTIPGDISSSSRFWEKDIIEPEITVENGQIRLP  343



>ref|WP_035188987.1| O-succinylbenzoate synthase [Bacillus coagulans]
 gb|KGT39170.1| O-succinylbenzoate synthase [Bacillus coagulans P38]
Length=367

 Score = 50.4 bits (119),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SL    IPGD+SSS+R+++KDII+PEI V+NG I++P
Sbjct  307  SLPGFTIPGDISSSSRFWEKDIIEPEITVENGQIRLP  343



>ref|WP_004697998.1| o-succinylbenzoate synthase [Veillonella parvula]
 gb|EGL77276.1| o-succinylbenzoate synthase [Veillonella parvula ACS-068-V-Sch12]
Length=383

 Score = 50.4 bits (119),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +L D+Y+ GDLS SNRYF +D+I P++  K+G++ VP G
Sbjct  323  ALGDSYMAGDLSDSNRYFGQDLIFPDLTFKDGVMHVPDG  361



>ref|WP_010095356.1| O-succinylbenzoate synthase [Ornithinibacillus scapharcae]
Length=371

 Score = 50.4 bits (119),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL +  +PGD + S+RY++KDIIKPE+ V+NG+I VP  
Sbjct  309  SLSNFVLPGDTAGSSRYWEKDIIKPEVTVENGVIHVPSA  347



>ref|WP_012863940.1| mandelate racemase/muconate lactonizing protein [Veillonella 
parvula]
 ref|YP_003311342.1| mandelate racemase/muconate lactonizing protein [Veillonella 
parvula DSM 2008]
 gb|ACZ24062.1| Mandelate racemase/muconate lactonizing protein [Veillonella 
parvula DSM 2008]
 gb|ETI93543.1| Mandelate racemase/muconate lactonizing protein [Veillonella 
sp. DORA_B_18_19_23]
Length=383

 Score = 50.4 bits (119),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +L D+Y+ GDLS SNRYF +D+I P++  K+G++ VP G
Sbjct  323  ALGDSYMAGDLSDSNRYFGQDLIFPDLTFKDGVMHVPDG  361



>ref|WP_035511366.1| MULTISPECIES: N-acylamino acid racemase [Halobacillus]
 emb|CDQ25816.1| o-succinylbenzoate synthase [Halobacillus trueperi]
 emb|CDQ21383.1| o-succinylbenzoate synthase [Halobacillus dabanensis]
 emb|CDQ25545.1| o-succinylbenzoate synthase [Halobacillus karajensis]
Length=366

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL +  IPGDLS S RYF KDII PEI++  G I VP+
Sbjct  304  SLPNFSIPGDLSGSGRYFHKDIIHPEIVMNRGEIAVPQ  341



>ref|WP_005377701.1| O-succinylbenzoate synthase [Veillonella atypica]
 gb|EFL55809.1| o-succinylbenzoate synthase [Veillonella atypica ACS-049-V-Sch6]
Length=380

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +L DTY+ GDLS S+RYF+ D+I P I+  +G ++VP G
Sbjct  320  ALGDTYMAGDLSDSSRYFEHDLINPAILFTDGAMQVPNG  358



>ref|WP_009711810.1| O-succinylbenzoate synthase [Desmospora sp. 8437]
 gb|EGK07374.1| O-succinylbenzoate synthase [Desmospora sp. 8437]
Length=368

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL+   +PGD+S+SNRY+++D+I PE+ V+ G I VP+G
Sbjct  306  SLEGFNLPGDISASNRYWERDLIHPEVTVEEGRIAVPEG  344



>ref|WP_008602799.1| O-succinylbenzoic acid (OSB) synthetase [Veillonella sp. 6_1_27]
 gb|EFG24286.1| o-succinylbenzoate synthase [Veillonella sp. 6_1_27]
Length=383

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 19/39 (49%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +L D+Y+ GDLS SNRYF++D+I P++    G+++VP G
Sbjct  323  ALGDSYMAGDLSDSNRYFEQDLIFPDLTFNEGVMQVPDG  361



>ref|WP_023626867.1| MULTISPECIES: hypothetical protein [Bacillus]
 gb|ESU31012.1| hypothetical protein G3A_19030 [Bacillus sp. 17376]
 dbj|GAE46118.1| O-succinylbenzoate synthase [Bacillus boroniphilus JCM 21738]
Length=368

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SL    IPGD+S S+RY+++DIIKPEI+V+N +I VP
Sbjct  306  SLPGFTIPGDISGSDRYWEQDIIKPEIVVENRMINVP  342



>ref|WP_038124463.1| O-succinylbenzoate synthase [Veillonella sp. ICM51a]
 gb|EUB24580.1| o-succinylbenzoate synthase [Veillonella sp. ICM51a]
Length=380

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +L DTY+ GDLS S+RYF+ D+I P I+  +G ++VP G
Sbjct  320  ALGDTYMAGDLSDSSRYFEHDLINPAILFTDGAMQVPNG  358



>ref|WP_026581401.1| O-succinylbenzoate synthase [Bacillus sp. J33]
Length=368

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            +L +  +PGD ++S+RY++KD+I+PE+ V NGII+VP+
Sbjct  307  TLSNFVMPGDTAASSRYWEKDLIEPEVTVDNGIIRVPE  344



>ref|WP_015595355.1| O-succinylbenzoate synthase [Bacillus sp. 1NLA3E]
 ref|YP_007911809.1| O-succinylbenzoate-CoA synthase [Bacillus sp. 1NLA3E]
 gb|AGK55310.1| O-succinylbenzoate-CoA synthase [Bacillus sp. 1NLA3E]
Length=369

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL    IPGD+S+S+RY+ +DI  PE++V+NG I+VP+G
Sbjct  307  SLPGFTIPGDISASSRYWAEDITTPEVMVENGYIQVPEG  345



>ref|WP_028254490.1| hypothetical protein [Veillonella magna]
Length=374

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +L DTY+ GDLS S RYF+KD+I P+I    G ++VP G
Sbjct  312  ALPDTYMAGDLSDSARYFEKDVICPDIAFSEGSMQVPTG  350



>ref|WP_012095943.1| N-acylamino acid racemase [Bacillus cytotoxicus]
 ref|YP_001376690.1| mandelate racemase/muconate lactonizing protein [Bacillus cytotoxicus 
NVH 391-98]
 gb|ABS23695.1| Mandelate racemase/muconate lactonizing protein [Bacillus cytotoxicus 
NVH 391-98]
Length=368

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL +  IPGD+S+SNR+++KDII PE+ ++NG + VPK 
Sbjct  306  SLPNFTIPGDISASNRHWEKDIILPEVTLQNGKVIVPKA  344



>ref|WP_028395270.1| hypothetical protein [Bacillus sp. FJAT-14578]
Length=372

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKGC  122
            SL    IPGD+S+S RY+++D+I PE++VK+G I VP  C
Sbjct  306  SLPGFTIPGDISASARYWERDVIIPEVMVKDGYINVPSEC  345



>ref|WP_009333407.1| O-succinylbenzoate synthase [Bacillus sp. 2_A_57_CT2]
 gb|EFV77075.1| enolase superfamily protein [Bacillus sp. 2_A_57_CT2]
Length=368

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            S++   IPGD+S+S RY+++DII PE+ V+NG+IKVP
Sbjct  306  SMEGFSIPGDISASGRYWEEDIILPEVTVENGMIKVP  342



>ref|WP_019382995.1| O-succinylbenzoate synthase [Bacillus oceanisediminis]
Length=368

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            S++   IPGD+S+S RY+++DII PE+ V+NG+IKVP
Sbjct  306  SMEGFSIPGDISASGRYWEEDIILPEVTVENGMIKVP  342



>ref|WP_007502984.1| O-succinylbenzoate synthase [Caldalkalibacillus thermarum]
 gb|EGL83837.1| o-succinylbenzoic acid (OSB) synthetase [Caldalkalibacillus thermarum 
TA2.A1]
Length=375

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            +L    +PGD ++S+RY++KDII+PE+ V NG IKVP
Sbjct  311  TLSQFVLPGDTAASSRYWQKDIIEPEVTVHNGTIKVP  347



>ref|WP_009329428.1| MULTISPECIES: O-succinylbenzoate synthase [Bacillus]
 ref|YP_080355.1| O-succinylbenzoate-CoA synthase [Bacillus licheniformis DSM 13 
= ATCC 14580]
 ref|YP_006714551.1| O-succinylbenzoate synthase MenC [Bacillus licheniformis DSM 
13 = ATCC 14580]
 gb|AAU24717.1| O-succinylbenzoate-CoA synthase [Bacillus licheniformis DSM 13 
= ATCC 14580]
 gb|AAU42078.1| O-succinylbenzoate synthase MenC [Bacillus licheniformis DSM 
13 = ATCC 14580]
 gb|EFV71326.1| MenC protein [Bacillus sp. BT1B_CT2]
 gb|EQM26616.1| O-succinylbenzoate synthase [Bacillus licheniformis CG-B52]
Length=369

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SL    IPGDLSSS+RY+++DI+KPEI ++ G I+VP
Sbjct  307  SLPQFLIPGDLSSSSRYWEEDIVKPEIRIEGGYIQVP  343



>ref|WP_035317810.1| O-succinylbenzoate synthase, partial [Bacillus coagulans]
Length=220

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SL    IPGD+SSS+R+++KDII+PEI  +NG I++P
Sbjct  160  SLPGFTIPGDISSSSRFWEKDIIEPEITAENGQIRLP  196



>ref|WP_003184633.1| O-succinylbenzoate synthase [Bacillus licheniformis]
 gb|EID48100.1| O-succinylbenzoate-CoA synthetase [Bacillus licheniformis WX-02]
Length=369

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SL    IPGDLSSS+RY+++DI+KPEI ++ G I+VP
Sbjct  307  SLPQFLIPGDLSSSSRYWEEDIVKPEIRIEGGYIQVP  343



>ref|WP_025808457.1| O-succinylbenzoate synthase [Bacillus licheniformis]
Length=369

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SL    IPGDLSSS+RY+++DI+KPEI ++ G I+VP
Sbjct  307  SLPQFLIPGDLSSSSRYWEEDIVKPEIRIEGGYIQVP  343



>ref|WP_019375932.1| hypothetical protein [Virgibacillus halodenitrificans]
Length=368

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL +  +PGD +SS+RY+ KDII+PE+ V+NG+++VP+
Sbjct  307  SLTNFTLPGDTASSSRYWDKDIIQPEVRVENGLLQVPE  344



>gb|EKY21644.1| o-succinylbenzoate synthase [Veillonella atypica KON]
Length=384

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +L DTY+ GDLS S+RYF+ D+I P I+  +G ++VP G
Sbjct  324  ALGDTYMAGDLSDSSRYFEHDLINPAILFTDGSMQVPNG  362



>ref|WP_035321466.1| O-succinylbenzoate synthase [Bacillus flexus]
Length=368

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL++  IPGD+S+S+RY+ KD+I PE+ V +G+I VPK
Sbjct  307  SLENFTIPGDISASSRYWNKDVILPEVEVDDGLIHVPK  344



>ref|WP_038148441.1| O-succinylbenzoate synthase [Veillonella atypica]
Length=380

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +L DTY+ GDLS S+RYF+ D+I P I+  +G ++VP G
Sbjct  320  ALGDTYMAGDLSDSSRYFEHDLINPAILFTDGSMQVPNG  358



>ref|WP_005380242.1| O-succinylbenzoate synthase [Veillonella atypica]
 gb|EFL58135.1| o-succinylbenzoate synthase [Veillonella atypica ACS-134-V-Col7a]
Length=380

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +L DTY+ GDLS S+RYF+ D+I P I+  +G ++VP G
Sbjct  320  ALGDTYMAGDLSDSSRYFEHDLINPAILFTDGSMQVPNG  358



>ref|WP_019121610.1| hypothetical protein [Brevibacillus massiliensis]
Length=369

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            +L +  +PGD ++S+RY+ +DII PE+ V+NG+I+VP+
Sbjct  307  TLSNFTMPGDTAASSRYWDRDIIDPEVTVENGVIRVPE  344



>ref|WP_020452691.1| O-succinylbenzoate synthase MenC [Bacillus licheniformis]
 ref|YP_008079373.1| O-succinylbenzoate synthase MenC [Bacillus licheniformis 9945A]
 gb|AGN37636.1| O-succinylbenzoate synthase MenC [Bacillus licheniformis 9945A]
 gb|KFM92222.1| o-succinylbenzoate synthase [Bacillus licheniformis]
Length=369

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SL    IPGDLSSS+RY+++DI+KPEI ++ G I+VP
Sbjct  307  SLPQFLIPGDLSSSSRYWEEDIVKPEIRIEGGYIQVP  343



>ref|WP_010631221.1| O-succinylbenzoate synthase [Sporolactobacillus vineae]
Length=371

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +L +  +PGDLS S+RY+ +DII+P I+V +G IKVP+G
Sbjct  306  ALSNFTLPGDLSPSSRYWSEDIIEPGIMVNHGSIKVPEG  344



>ref|WP_038118074.1| O-succinylbenzoate synthase [Veillonella sp. AS16]
 gb|ETS91554.1| o-succinylbenzoate synthase [Veillonella sp. AS16]
Length=383

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 18/39 (46%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +L D+Y+ GDLS S+RYF++D+I P++  ++G++ VP G
Sbjct  323  ALGDSYMAGDLSDSSRYFERDLIYPDLSFRDGVMSVPDG  361



>ref|WP_017797890.1| O-succinylbenzoate synthase [Oceanobacillus kimchii]
Length=370

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SL +  +PGD +SS+RY+ +DII+PE++V NGI++VP
Sbjct  307  SLANFTLPGDTASSSRYWHEDIIEPEVLVHNGILQVP  343



>ref|WP_027956477.1| N-acylamino acid racemase [Halobacillus kuroshimensis]
Length=367

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL +  IPGDLS S RYF+ DI+KP + V+ G + VP+G
Sbjct  304  SLPNFTIPGDLSGSTRYFEADIVKPPLKVQKGALPVPQG  342



>ref|WP_026909225.1| O-succinylbenzoate synthase [Paucisalibacillus globulus]
Length=371

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            +L +  +PGD + S+RY+++DIIKPE+IV+NG I VP
Sbjct  309  TLSNFVLPGDTAGSSRYWERDIIKPEVIVENGAINVP  345



>ref|WP_004436581.1| O-succinylbenzoate synthase [Bacillus methanolicus]
 gb|EIJ78264.1| o-succinylbenzoic acid (OSB) synthetase [Bacillus methanolicus 
PB1]
Length=368

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            +L +  +PGD + S+RY+++DII+PE++V+NG IKVP
Sbjct  307  TLDNFILPGDTAGSSRYWERDIIEPEVVVENGWIKVP  343



>ref|WP_034642795.1| N-acylamino acid racemase [Bacillus manliponensis]
 gb|KEK17663.1| N-acylamino acid racemase [Bacillus manliponensis]
Length=368

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SL++  IPGD+S+SNR++++DII PE++++NG + VP
Sbjct  306  SLQNFTIPGDISASNRHWQQDIIVPEVMLQNGKVIVP  342



>ref|WP_013860037.1| O-succinylbenzoate synthase [Bacillus coagulans]
 ref|YP_004569531.1| mandelate racemase/muconate lactonizing protein [Bacillus coagulans 
2-6]
 gb|AEH54145.1| Mandelate racemase/muconate lactonizing protein [Bacillus coagulans 
2-6]
Length=367

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SL    IPGD+SSS+R+++KDII+PEI  +NG I++P
Sbjct  307  SLPGFTIPGDISSSSRFWEKDIIEPEITAENGQIRLP  343



>gb|EWH23085.1| N-acylamino acid racemase [Bacillus licheniformis S 16]
Length=368

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SL    IPGD+SSS+RY+++DI+KPEI ++ G I+VP
Sbjct  306  SLPQFLIPGDISSSSRYWEEDIVKPEIRIEGGFIQVP  342



>ref|WP_023855815.1| MULTISPECIES: O-succinylbenzoate synthase [Bacillus]
 gb|ETB72131.1| O-succinylbenzoate synthase [Bacillus sp. CPSM8]
Length=369

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SL    IPGDLSSS+RY++ DI+KPEI ++ G I+VP
Sbjct  307  SLPQFLIPGDLSSSSRYWEDDIVKPEIRIEGGYIQVP  343



>ref|WP_017755155.1| O-succinylbenzoate synthase [Bacillus sp. ZYK]
Length=368

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            +L +  +PGD ++S+RY+ KDIIKPE+ V+NG+I VP
Sbjct  307  TLTNFTMPGDTAASSRYWVKDIIKPEVTVENGLITVP  343



>ref|WP_034673523.1| O-succinylbenzoate synthase [Bacillus niacini]
 gb|KGM46080.1| O-succinylbenzoate synthase [Bacillus niacini]
Length=368

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SL    IPGD+S+SNR++++DII PE+ VKNG + VP
Sbjct  306  SLPGFTIPGDISASNRFWEEDIIAPEVSVKNGCVSVP  342



>ref|WP_026021906.1| O-succinylbenzoate synthase [Bacillus timonensis]
Length=367

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL +  IPGD+S+S+RY+ +D+I P++ V+NG I VP G
Sbjct  306  SLPNFTIPGDISASSRYWSRDVINPKVFVENGRIAVPDG  344



>ref|WP_002089229.1| N-acylamino acid racemase [Bacillus cereus]
 gb|EJP87435.1| O-succinylbenzoate synthase [Bacillus cereus VD142]
Length=368

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL +  IPGD+S+SNR+++KDII PE++++ G ++VP+
Sbjct  306  SLPNFTIPGDISASNRHWEKDIISPEVMLEGGKVRVPQ  343



>gb|EEL91434.1| N-acylamino acid racemase [Bacillus cereus AH1273]
Length=183

 Score = 46.6 bits (109),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL +  IPGD+S+S+R++K+DII PE+++++G + VP+
Sbjct  121  SLPNFTIPGDISASSRHWKRDIISPEVMLESGKVIVPQ  158



>emb|CEI81051.1| o-succinylbenzoate synthase [Oceanobacillus oncorhynchi]
Length=368

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SL    +PGD ++S+RY+++DII PE++VK+GI++VP
Sbjct  307  SLSAFTLPGDTAASSRYWEEDIIDPEVVVKDGIVQVP  343



>ref|WP_021619715.1| o-succinylbenzoate synthase [Aneurinibacillus aneurinilyticus]
 gb|ERI10350.1| o-succinylbenzoate synthase [Aneurinibacillus aneurinilyticus 
ATCC 12856]
Length=368

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            +L +  +PGD + S+RY+++DII+PE++VKNG+I +P
Sbjct  307  TLANFVMPGDTAGSSRYWEQDIIEPEVVVKNGMITIP  343



>ref|WP_012010999.1| O-succinylbenzoate synthase [Bacillus pumilus]
 ref|YP_001487932.1| o-succinylbenzoate-CoA synthase [Bacillus pumilus SAFR-032]
 gb|ABV63372.1| o-succinylbenzoate-CoA synthase [Bacillus pumilus SAFR-032]
Length=374

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL    IPGD+S+S++Y+++DII PEI V+NG I+VP+
Sbjct  307  SLPQFTIPGDISASSKYWEQDIIYPEIKVENGFIEVPR  344



>ref|WP_016837608.1| hypothetical protein [Ureibacillus thermosphaericus]
Length=368

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL +  +PGD + S+ YF++DII PE++VK+G I+VP+
Sbjct  307  SLSNFVLPGDTAGSSHYFEEDIINPEVVVKDGTIQVPQ  344



>ref|WP_013353285.1| O-succinylbenzoate synthase [Bacillus amyloliquefaciens]
 ref|YP_003921454.1| O-succinylbenzoate-CoA synthase [Bacillus amyloliquefaciens DSM 
7]
 ref|YP_005542665.1| O-succinylbenzoate-CoA synthase [Bacillus amyloliquefaciens TA208]
 ref|YP_005546913.1| O-succinylbenzoate-CoA synthase [Bacillus amyloliquefaciens LL3]
 ref|YP_005551057.1| O-succinylbenzoate-CoA synthase [Bacillus amyloliquefaciens XH7]
 emb|CBI43984.1| O-succinylbenzoate-CoA synthase [Bacillus amyloliquefaciens DSM 
7]
 gb|AEB25172.1| O-succinylbenzoate-CoA synthase [Bacillus amyloliquefaciens TA208]
 gb|AEB64685.1| O-succinylbenzoate-CoA synthase [Bacillus amyloliquefaciens LL3]
 gb|AEK90209.1| O-succinylbenzoate-CoA synthase [Bacillus amyloliquefaciens XH7]
 gb|AIW34853.1| O-succinylbenzoate synthase [Bacillus subtilis]
Length=371

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL    IPGD+SSS+RY+++DII P+I ++ G I VP G
Sbjct  307  SLPQFTIPGDISSSDRYWEEDIITPDIRIEEGFISVPDG  345



>ref|WP_036172974.1| O-succinylbenzoate synthase [Lysinibacillus massiliensis]
 gb|KGR91590.1| O-succinylbenzoate synthase [Lysinibacillus massiliensis 4400831 
= CIP 108448 = CCUG 49529]
Length=368

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            +L +  +PGD +SS+RY++KDII+PE++ ++G I+VP+
Sbjct  307  TLSNFILPGDTASSSRYWEKDIIEPEVVAEDGYIQVPQ  344



>ref|WP_025785790.1| O-succinylbenzoate synthase [Sporosarcina sp. D27]
Length=379

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +LK+  IPGD + S  Y+K+DI+ PEI++ +GII+VP G
Sbjct  307  TLKNFTIPGDTAPSAHYWKEDIVTPEIVMDHGIIQVPSG  345



>emb|CEG21516.1| o-succinylbenzoate synthase [Planomicrobium sp. ES2]
Length=368

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 19/39 (49%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +L +  +PGD +SS+RY++KDIIKPE++   G ++VP G
Sbjct  307  ALANFTLPGDTASSSRYWEKDIIKPEVVAAGGQVQVPDG  345



>ref|WP_016079911.1| O-succinylbenzoic acid (OSB) synthetase [Bacillus cereus]
 gb|EOO31004.1| O-succinylbenzoic acid (OSB) synthetase [Bacillus cereus BAG1X1-1]
 gb|EOO45777.1| O-succinylbenzoic acid (OSB) synthetase [Bacillus cereus BAG1X2-1]
 gb|EOO55396.1| O-succinylbenzoic acid (OSB) synthetase [Bacillus cereus BAG1X2-2]
 gb|EOO57386.1| O-succinylbenzoic acid (OSB) synthetase [Bacillus cereus BAG1X2-3]
 gb|EOP02917.1| O-succinylbenzoic acid (OSB) synthetase [Bacillus cereus BAG2O-1]
Length=368

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL +  IPGD+S+SNR++K+DII PE++++ G + VP+
Sbjct  306  SLPNFTIPGDISASNRHWKRDIISPEVMLEGGKVMVPQ  343



>ref|WP_038464220.1| O-succinylbenzoate synthase [Bacillus subtilis]
 gb|AIW38549.1| O-succinylbenzoate synthase [Bacillus subtilis]
Length=371

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL    IPGD+SSS+RY+++DI+ P+I ++ G I VP G
Sbjct  307  SLPQFTIPGDISSSDRYWEEDIVTPDIRIEEGFISVPDG  345



>ref|WP_025601451.1| O-succinylbenzoate synthase, partial [Bacillus sp. JGI 0001002-E22]
Length=214

 Score = 46.6 bits (109),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  21   IPGDLSSSNRYFKKDIIKPEIIVKNGIIKV  110
            IPGD+S+S+RY++KDIIKPE+ V+ G+IKV
Sbjct  159  IPGDISASSRYWEKDIIKPEVEVEAGVIKV  188



>ref|WP_035391035.1| O-succinylbenzoate synthase [Bacillus sp. UNC125MFCrub1.1]
Length=374

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL    IPGD+S+S++Y+++DII PEI V+NG I+VP+
Sbjct  307  SLPQFTIPGDISASSKYWEQDIIFPEIKVENGFIEVPR  344



>ref|WP_038459593.1| O-succinylbenzoate synthase [Bacillus amyloliquefaciens]
 gb|AHZ17082.1| MenC [Bacillus amyloliquefaciens SQR9]
Length=371

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL    IPGD+SSS+RY+++DI+ P+I ++ G I VP G
Sbjct  307  SLPQFTIPGDISSSDRYWEEDIVTPDIRIEEGFISVPDG  345



>ref|WP_015240438.1| MenC [Bacillus amyloliquefaciens]
 ref|YP_007187544.1| MenC [Bacillus amyloliquefaciens subsp. plantarum AS43.3]
 gb|AFZ91874.1| MenC [Bacillus amyloliquefaciens subsp. plantarum AS43.3]
Length=371

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL    IPGD+SSS+RY+++DI+ P+I ++ G I VP G
Sbjct  307  SLPQFTIPGDISSSDRYWEEDIVTPDIRIEEGFISVPDG  345



>ref|WP_003152223.1| MULTISPECIES: O-succinylbenzoate synthase [Bacillus]
 gb|EIF14400.1| MenC [Bacillus sp. 5B6]
 gb|EKE47669.1| MenC [Bacillus amyloliquefaciens subsp. plantarum M27]
 gb|ERH56073.1| O-succinylbenzoate synthase [Bacillus amyloliquefaciens EGD-AQ14]
 gb|AHK50293.1| O-succinylbenzoate synthase [Bacillus amyloliquefaciens subsp. 
plantarum TrigoCor1448]
Length=371

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL    IPGD+SSS+RY+++DI+ P+I ++ G I VP G
Sbjct  307  SLPQFTIPGDISSSDRYWEEDIVTPDIRIEEGFISVPDG  345



>ref|WP_014305634.1| O-succinylbenzoate synthase [Bacillus amyloliquefaciens]
 ref|YP_005131517.1| O-succinylbenzoate synthase [Bacillus amyloliquefaciens subsp. 
plantarum CAU B946]
 ref|YP_007444416.1| O-succinylbenzoate synthase [Bacillus amyloliquefaciens IT-45]
 ref|YP_008951296.1| O-succinylbenzoate synthase [Bacillus amyloliquefaciens LFB112]
 emb|CCF06322.1| O-succinylbenzoate synthase [Bacillus amyloliquefaciens subsp. 
plantarum CAU B946]
 gb|AGF26535.1| O-succinylbenzoate synthase [Bacillus amyloliquefaciens IT-45]
 gb|ERK83392.1| O-succinylbenzoate synthase [Bacillus amyloliquefaciens UASWS 
BA1]
 gb|AHC43367.1| O-succinylbenzoate synthase [Bacillus amyloliquefaciens LFB112]
Length=371

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL    IPGD+SSS+RY+++DI+ P+I ++ G I VP G
Sbjct  307  SLPQFTIPGDISSSDRYWEEDIVTPDIRIEEGFISVPDG  345



>gb|AIF44511.1| O-succinylbenzoate synthase [Virgibacillus sp. SK37]
Length=369

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  21   IPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            +PGD + S+RY++KDIIKPE+ V+NG+I VP+
Sbjct  313  LPGDTAGSSRYWEKDIIKPEVTVENGLIYVPE  344



>gb|AIU78540.1| O-succinylbenzoate synthase [Bacillus subtilis]
Length=371

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL    IPGD+SSS+RY+++DI+ P+I ++ G I VP G
Sbjct  307  SLPQFTIPGDISSSDRYWEEDIVTPDIRIEEGFISVPDG  345



>ref|WP_014418709.1| MULTISPECIES: O-succinylbenzoate synthase [Bacillales]
 ref|YP_005422327.1| O-succinylbenzoate synthase [Bacillus amyloliquefaciens subsp. 
plantarum YAU B9601-Y2]
 ref|YP_006329973.1| O-succinylbenzoate-CoA synthase [Bacillus amyloliquefaciens Y2]
 ref|YP_008627584.1| O-succinylbenzoate synthase [Bacillus amyloliquefaciens subsp. 
plantarum NAU-B3]
 emb|CCG51011.1| O-succinylbenzoate synthase [Bacillus amyloliquefaciens subsp. 
plantarum YAU B9601-Y2]
 gb|AFJ63248.1| O-succinylbenzoate-CoA synthase [Bacillus amyloliquefaciens Y2]
 emb|CDH96723.1| O-succinylbenzoate synthase [Bacillus amyloliquefaciens subsp. 
plantarum NAU-B3]
 gb|KFI16816.1| O-succinylbenzoate synthase [Bacillus subtilis]
 gb|AIU82963.1| o-succinylbenzoate synthase [Bacillus methylotrophicus]
Length=371

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL    IPGD+SSS+RY+++DI+ P+I ++ G I VP G
Sbjct  307  SLPQFTIPGDISSSDRYWEEDIVTPDIHIEEGFISVPDG  345



>ref|WP_012118265.1| O-succinylbenzoate synthase [Bacillus amyloliquefaciens]
 ref|YP_001422365.1| MenC [Bacillus amyloliquefaciens subsp. plantarum str. FZB42]
 ref|YP_008728174.1| menC [Bacillus amyloliquefaciens CC178]
 gb|ABS75134.1| MenC [Bacillus amyloliquefaciens subsp. plantarum str. FZB42]
 gb|AGZ57596.1| menC [Bacillus amyloliquefaciens CC178]
Length=371

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL    IPGD+SSS+RY+++DI+ P+I ++ G I VP G
Sbjct  307  SLPQFTIPGDISSSDRYWEEDIVTPDIRIEEGFISVPDG  345



>ref|WP_032857356.1| O-succinylbenzoate synthase [Bacillus amyloliquefaciens]
 gb|KDN93459.1| O-succinylbenzoate synthase [Bacillus amyloliquefaciens]
Length=371

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL    IPGD+SSS+RY+++DI+ P+I ++ G I VP G
Sbjct  307  SLPQFTIPGDISSSDRYWEEDIVTPDIRIEGGFISVPDG  345



>ref|WP_032873547.1| O-succinylbenzoate synthase [Bacillus amyloliquefaciens]
 gb|KFX38971.1| O-succinylbenzoate synthase [Bacillus amyloliquefaciens]
Length=371

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL    IPGD+SSS+RY+++DI+ P+I ++ G I VP G
Sbjct  307  SLPQFTIPGDISSSDRYWEEDIVTPDIRIEEGFISVPDG  345



>ref|WP_025649760.1| O-succinylbenzoate synthase [Bacillus methylotrophicus]
Length=371

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL    IPGD+SSS+RY+++DI+ P+I ++ G I VP G
Sbjct  307  SLPQFTIPGDISSSDRYWEEDIVTPDIHIEEGFISVPDG  345



>ref|WP_007408844.1| MULTISPECIES: O-succinylbenzoate synthase [Bacillus]
 ref|YP_007498389.1| O-succinylbenzoate-CoA synthase [Bacillus amyloliquefaciens subsp. 
plantarum UCMB5036]
 ref|YP_008413888.1| O-succinylbenzoate-CoA synthase [Bacillus amyloliquefaciens subsp. 
plantarum UCMB5033]
 gb|EJD67715.1| MenC [Bacillus sp. 916]
 emb|CCP22733.1| O-succinylbenzoate-CoA synthase [Bacillus amyloliquefaciens subsp. 
plantarum UCMB5036]
 emb|CDG30878.1| O-succinylbenzoate-CoA synthase [Bacillus amyloliquefaciens subsp. 
plantarum UCMB5033]
 gb|EYB34707.1| O-succinylbenzoate synthase [Bacillus amyloliquefaciens EBL11]
 gb|AIW30943.1| O-succinylbenzoate synthase [Bacillus subtilis]
 gb|AJC26356.1| O-succinylbenzoate synthase [Bacillus sp. Pc3]
Length=371

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL    IPGD+SSS+RY+++DI+ P+I ++ G I VP G
Sbjct  307  SLPQFTIPGDISSSDRYWEEDIVTPDIRIEEGFISVPDG  345



>ref|WP_007086133.1| o-succinylbenzoic acid (OSB) synthetase [Bacillus bataviensis]
 gb|EKN66565.1| o-succinylbenzoic acid (OSB) synthetase [Bacillus bataviensis 
LMG 21833]
Length=368

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            +L +  +PGD + SNRY++KDII PE++  NG I+VP+
Sbjct  307  TLSNFILPGDTAGSNRYWEKDIILPEVVAANGYIEVPQ  344



>ref|WP_027724804.1| O-succinylbenzoate synthase [Tuberibacillus calidus]
Length=372

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            +L    +PGD S+S RY+ KDII PE+ V +G+I+VPK
Sbjct  310  TLPQFTLPGDTSASARYWDKDIITPEVTVHDGLIQVPK  347



>ref|WP_007123211.1| O-succinylbenzoate synthase [Lactobacillus antri]
 gb|EEW53160.1| o-succinylbenzoate synthase [Lactobacillus antri DSM 16041]
Length=372

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SL    +P D+SSS RYF+KDII PEI  +NG I VP
Sbjct  312  SLPGFTLPNDISSSQRYFEKDIITPEITQENGKIMVP  348



>ref|WP_035702147.1| O-succinylbenzoate synthase [Bacillus altitudinis]
 gb|KDE31814.1| o-succinylbenzoate-CoA synthase [Bacillus altitudinis 41KF2b]
Length=374

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL    IPGD+S+S++Y+++DII PEI V+NG I+VP+
Sbjct  307  SLPQFTIPGDISASSKYWEQDIIFPEIKVENGFIEVPR  344



>ref|WP_007501943.1| o-succinylbenzoate- synthase [Bacillus stratosphericus]
 gb|EMI12716.1| o-succinylbenzoate- synthase [Bacillus stratosphericus LAMA 585]
Length=374

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL    IPGD+S+S++Y+++DII PEI V+NG I+VP+
Sbjct  307  SLPQFTIPGDISASSKYWEQDIIFPEIKVENGFIEVPR  344



>ref|WP_008360686.1| O-succinylbenzoate synthase [Bacillus xiamenensis]
 gb|EKF34401.1| o-succinylbenzoate-CoA synthase [Bacillus xiamenensis]
Length=374

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL    IPGD+S+S++Y+++DII PEI V+NG I+VP+
Sbjct  307  SLPQFTIPGDISASSKYWEQDIIFPEIKVENGFIEVPR  344



>ref|WP_000574801.1| hypothetical protein, partial [Bacillus cereus]
Length=191

 Score = 46.2 bits (108),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL +  IPGD+S+S+R++K+DII PE+++++G + VP+
Sbjct  129  SLPNFTIPGDISASSRHWKRDIISPEVMLESGKVIVPQ  166



>emb|CDQ31351.1| o-succinylbenzoate synthase [Virgibacillus halodenitrificans]
Length=370

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  21   IPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            +PGD + S+RY++KDIIKPE+ V+NG+I VP+
Sbjct  314  LPGDTAGSSRYWEKDIIKPEVTVENGLIYVPE  345



>dbj|GAK09403.1| LOW QUALITY PROTEIN: O-succinylbenzoate synthase [Geomicrobium 
sp. JCM 19038]
Length=369

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 19/39 (49%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +L    +PGD +SS  Y+ KDII PE++ +NG+I+VP G
Sbjct  306  TLPQFILPGDTASSANYWHKDIISPEVVAENGVIQVPTG  344



>ref|WP_017358377.1| N-acylamino acid racemase [Bacillus pumilus]
Length=374

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL    IPGD+S+S++Y+++DII PEI V+NG I+VP+
Sbjct  307  SLPQFTIPGDISASSKYWEQDIIFPEIKVENGFIEVPR  344



>ref|WP_011067107.1| O-succinylbenzoate synthase [Oceanobacillus iheyensis]
 ref|NP_693635.1| N-acylamino acid racemase [Oceanobacillus iheyensis HTE831]
 dbj|BAC14669.1| N-acylamino acid racemase [Oceanobacillus iheyensis HTE831]
Length=369

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SL +  +PGD ++S+RY+ +DII+PE+ V NGI++VP
Sbjct  307  SLANFTLPGDTAASSRYWHEDIIEPEVFVHNGILQVP  343



>ref|WP_008342917.1| MULTISPECIES: O-succinylbenzoate synthase [Bacillus]
 gb|EIL85901.1| O-succinylbenzoic acid (OSB) synthetase [Bacillus sp. M 2-6]
Length=374

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL    IPGD+S+S++Y+++DII PEI V+NG I+VP+
Sbjct  307  SLPQFTIPGDISASSKYWEQDIIFPEIKVENGFIEVPR  344



>ref|WP_036834195.1| hypothetical protein [Pontibacillus litoralis]
 gb|KGX86751.1| O-succinylbenzoate synthase [Pontibacillus litoralis JSM 072002]
Length=367

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SL +  IPGD+S+SNRY+ KD+I PE+ +  G+I VP
Sbjct  304  SLSNFTIPGDISASNRYWHKDVIVPEVQLIKGMIHVP  340



>ref|WP_003329502.1| o-succinylbenzoic acid (OSB) synthetase [Bacillus azotoformans]
 gb|EKN68965.1| o-succinylbenzoic acid (OSB) synthetase [Bacillus azotoformans 
LMG 9581]
Length=368

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            +L +  +PGD ++S+RY++KDII PE+ V NG+I VP
Sbjct  307  TLSNFSLPGDTAASSRYWEKDIISPEVTVHNGMITVP  343



>dbj|GAK01183.1| LOW QUALITY PROTEIN: O-succinylbenzoate synthase [Geomicrobium 
sp. JCM 19055]
Length=370

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/39 (49%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +L    +PGD +SS  Y+ KDII PE++ +NG+I+VP G
Sbjct  307  TLPQFILPGDTASSANYWHKDIISPEVVAENGVIQVPTG  345



>ref|WP_016938467.1| O-succinylbenzoate synthase [Bacillus siamensis]
Length=371

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL    IPGD+SSS+RY+++DI+ P+I ++ G I VP G
Sbjct  307  SLPQFTIPGDISSSDRYWEEDIVTPDIRIEEGFISVPDG  345



>ref|WP_039042512.1| O-succinylbenzoate synthase [Sporosarcina sp. ZBG7A]
Length=379

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +LK+  IPGD + S  Y+K+DI+ PEI++ +GII+VP G
Sbjct  307  TLKNFTIPGDTAPSAHYWKEDIVTPEIVMNHGIIQVPSG  345



>ref|WP_036198079.1| O-succinylbenzoate synthase [Lysinibacillus sinduriensis]
 gb|KGR77322.1| O-succinylbenzoate synthase [Lysinibacillus sinduriensis BLB-1 
= JCM 15800]
Length=368

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            +L +  +PGD + SN YF++DII PE++VK+G I VP+
Sbjct  307  ALSNFVMPGDTAGSNHYFEQDIITPEVVVKDGYITVPQ  344



>ref|WP_014644091.1| O-succinylbenzoate synthase [Halobacillus halophilus]
 ref|YP_006181476.1| O-succinylbenzoate-CoA synthase [Halobacillus halophilus DSM 
2266]
 emb|CCG46202.1| O-succinylbenzoate-CoA synthase [Halobacillus halophilus DSM 
2266]
Length=367

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SL +  IPGDLS S+RYF+KD++ P I ++NG I+VP
Sbjct  304  SLPNFSIPGDLSGSDRYFQKDLVTPGIQMENGEIEVP  340



>ref|WP_003252196.1| O-succinylbenzoate synthase [Geobacillus thermoglucosidasius]
 ref|YP_004588927.1| o-succinylbenzoic acid (OSB) synthetase [Geobacillus thermoglucosidasius 
C56-YS93]
 gb|AEH48846.1| o-succinylbenzoic acid (OSB) synthetase [Geobacillus thermoglucosidasius 
C56-YS93]
 gb|EID43475.1| o-succinylbenzoic acid (OSB) synthetase [Geobacillus thermoglucosidans 
TNO-09.020]
Length=371

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            +L++  +PGD ++S+ Y++KDII PE++V+NG+I VP+
Sbjct  309  TLENFTLPGDTAASSHYWEKDIIVPEVVVRNGMITVPE  346



>dbj|GAJ44352.1| putative O-succinylbenzoate synthase [Geobacillus thermoglucosidasius 
NBRC 107763]
Length=371

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            +L++  +PGD ++S+ Y++KDII PE++V+NG+I VP+
Sbjct  309  TLENFTLPGDTAASSHYWEKDIIVPEVVVRNGMITVPE  346



>gb|AHL72569.1| O-succinylbenzoate synthase [Bacillus pumilus]
Length=374

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL    IPGD+S+S++Y+++DII PEI V+NG I+VP+
Sbjct  307  SLPQFTIPGDISASSKYWEQDIIFPEIKVENGFIEVPR  344



>ref|WP_020007916.1| O-succinylbenzoate synthase [Salinicoccus albus]
Length=368

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL +  +PGD +SS+RY++KDII+PE+I  +G I VP+
Sbjct  307  SLPNFTLPGDTASSSRYWEKDIIEPEVIADDGCINVPE  344



>ref|WP_026563224.1| O-succinylbenzoate synthase [Bacillus sp. UNC41MFS5]
Length=369

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SL    IPGD+SSSNR++++DII PE+ V+NG + VP
Sbjct  307  SLPGFSIPGDISSSNRFWEEDIITPEVNVQNGSVAVP  343



>ref|WP_034325140.1| O-succinylbenzoate synthase [Bacillus sp. DW5-4]
 gb|KEP24847.1| O-succinylbenzoate synthase [Bacillus sp. DW5-4]
Length=374

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL    IPGD+S+S++Y+++DII PEI V+NG I+VP+
Sbjct  307  SLPQFTIPGDISASSKYWEQDIIFPEIKVENGFIEVPR  344



>ref|WP_003217663.1| O-succinylbenzoate synthase [Bacillus pumilus]
 gb|EDW20068.1| O-succinylbenzoic acid (OSB) synthetase [Bacillus pumilus ATCC 
7061]
Length=374

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL    IPGD+S+S++Y+++DII PEI V+NG I+VP+
Sbjct  307  SLPQFTIPGDISASSKYWEQDIIFPEIKVENGFIEVPR  344



>ref|WP_034665282.1| O-succinylbenzoate synthase [Bacillus pumilus]
 gb|KDE51072.1| O-succinylbenzoate synthase [Bacillus pumilus]
 gb|KEO47879.1| O-succinylbenzoate synthase [Bacillus pumilus]
Length=374

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL    IPGD+S+S++Y+++DII PEI V+NG I+VP+
Sbjct  307  SLPQFTIPGDISASSKYWEQDIIFPEIKVENGFIEVPR  344



>ref|WP_010750939.1| O-succinylbenzoate synthase [Enterococcus villorum]
 gb|EOH89750.1| O-succinylbenzoate synthase [Enterococcus villorum ATCC 700913]
 gb|EOW77982.1| O-succinylbenzoate synthase [Enterococcus villorum ATCC 700913]
Length=370

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  24   PGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            PGD+S+SNRY+  DI++ + I+KNG IKVP G
Sbjct  314  PGDISASNRYYYDDIVEEKAILKNGKIKVPSG  345



>ref|WP_035196533.1| O-succinylbenzoate synthase [Bacillus azotoformans]
 gb|KEF37761.1| O-succinylbenzoate synthase [Bacillus azotoformans MEV2011]
Length=368

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            +L +  +PGD ++S+RY++KDII PE+ V NG+I VP
Sbjct  307  TLSNFSLPGDTAASSRYWEKDIISPEVTVHNGMITVP  343



>ref|WP_007086217.1| o-succinylbenzoic acid (OSB) synthetase [Bacillus bataviensis]
 gb|EKN66404.1| o-succinylbenzoic acid (OSB) synthetase [Bacillus bataviensis 
LMG 21833]
Length=369

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SL +  +PGD ++S+RY+K+DII PE+ V++G+I VP
Sbjct  307  SLSNFTLPGDTAASSRYWKEDIIDPEVTVEDGMITVP  343



>ref|WP_035329732.1| O-succinylbenzoate synthase [Bacillus firmus]
 gb|EWG10970.1| o-succinylbenzoic acid (OSB) synthetase [Bacillus firmus DS1]
Length=376

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            +L +  +PGD ++S+RY++KD+I PE+ V +G+IKVP+
Sbjct  307  TLSNFIMPGDTAASSRYWEKDLIAPEVTVADGMIKVPE  344



>ref|WP_021623643.1| o-succinylbenzoate synthase [Aneurinibacillus aneurinilyticus]
 gb|ERI10978.1| o-succinylbenzoate synthase [Aneurinibacillus aneurinilyticus 
ATCC 12856]
Length=370

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +L +  +PGD ++S RY++KDII PE+ VK+G I VP+G
Sbjct  308  TLSNFIMPGDTAASARYWEKDIIIPEVTVKDGWITVPEG  346



>ref|WP_007086496.1| o-succinylbenzoic acid (OSB) synthetase [Bacillus bataviensis]
 gb|EKN65964.1| o-succinylbenzoic acid (OSB) synthetase [Bacillus bataviensis 
LMG 21833]
Length=370

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL    IPGD+S+S+R++++DII PE+ V+NG I VP+
Sbjct  306  SLPGFSIPGDISASSRFWEEDIITPEVTVENGFITVPE  343



>ref|WP_035353894.1| O-succinylbenzoate synthase [Bacillus ginsengihumi]
 gb|KHD85964.1| O-succinylbenzoate synthase [Bacillus ginsengihumi]
Length=373

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            +L+   IPGD+SSSNR+++KDII PE+ V+ G I+ P
Sbjct  307  TLEGFTIPGDISSSNRFWEKDIITPEVHVRKGKIQAP  343



>ref|WP_026679577.1| O-succinylbenzoate synthase [Bacillus megaterium]
Length=368

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKV  110
            +L +  +PGD +SS+RY++KDII+PE++ KNG++ V
Sbjct  307  ALANFTLPGDTASSSRYWEKDIIQPEVVAKNGVLTV  342



>ref|WP_021289302.1| MULTISPECIES: hypothetical protein [Virgibacillus]
 gb|EQB37674.1| hypothetical protein M948_03725 [Virgibacillus sp. CM-4]
 emb|CDQ38799.1| o-succinylbenzoate synthase [Virgibacillus sp. Vm-5]
Length=368

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKV  110
            SL +  +PGD +SS+RY+ KDII+PE+I +NGI+ V
Sbjct  307  SLANFTLPGDTASSSRYWNKDIIQPEVIAENGILTV  342



>ref|WP_028410457.1| O-succinylbenzoate synthase [Bacillus sp. 171095_106]
Length=367

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  21   IPGDLSSSNRYFKKDIIKPEIIVKNGIIKV  110
            IPGD+S+S+RY++KDIIKPE+ V+ G+IKV
Sbjct  312  IPGDISASSRYWEKDIIKPEVEVEAGVIKV  341



>ref|WP_025729913.1| O-succinylbenzoate synthase [Bacillus ginsengihumi]
Length=373

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            +L+   IPGD+SSSNR+++KDII PE+ V+ G I+ P
Sbjct  307  TLEGFTIPGDISSSNRFWEKDIITPEVHVRKGKIQAP  343



>ref|WP_029143114.1| MULTISPECIES: O-succinylbenzoate synthase [Bacillus]
 emb|CEE00154.1| o-succinylbenzoate synthase [Bacillus thermoamylovorans]
Length=374

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            +L +  +PGD + SNRY++KDII+PE++  +G I VP+
Sbjct  307  TLSNFILPGDTAGSNRYWEKDIIRPEVVATDGYIDVPQ  344



>ref|WP_025750727.1| O-succinylbenzoate synthase [Bacillus flexus]
Length=367

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  21   IPGDLSSSNRYFKKDIIKPEIIVKNGIIKV  110
            IPGD+S+S+RY++KDIIKPE+ V+ G+IKV
Sbjct  312  IPGDISASSRYWEKDIIKPEVEVEAGVIKV  341



>ref|WP_014457945.1| O-succinylbenzoate synthase [Bacillus megaterium]
 ref|YP_005492552.1| enolase superfamily protein [Bacillus megaterium WSH-002]
 gb|AEN87243.1| Enolase superfamily protein; possible N-acylamino acid racemase 
[Bacillus megaterium WSH-002]
Length=367

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  21   IPGDLSSSNRYFKKDIIKPEIIVKNGIIKV  110
            IPGD+S+S+RY++KDIIKPE+ V+ G+IKV
Sbjct  312  IPGDISASSRYWEKDIIKPEVEVEAGVIKV  341



>ref|WP_002191034.1| N-acylamino acid racemase [Bacillus cereus]
 gb|EJS02148.1| O-succinylbenzoic acid (OSB) synthetase [Bacillus cereus VDM034]
 gb|EJS16031.1| O-succinylbenzoic acid (OSB) synthetase [Bacillus cereus VDM062]
Length=368

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL +  IPGD+S+S+R++K+DII PE++++ G ++VP+
Sbjct  306  SLPNFTIPGDISASSRHWKRDIISPEVMLEGGKVRVPQ  343



>ref|WP_024027854.1| o-succinylbenzoic acid (OSB) synthetase [Bacillus vireti]
 gb|ETI69290.1| o-succinylbenzoic acid (OSB) synthetase [Bacillus vireti LMG 
21834]
Length=368

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  21   IPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            IPGD+S+S+R++++DII PE+ ++NG I VPK 
Sbjct  312  IPGDISASSRFWEEDIISPEVTIENGYITVPKA  344



>ref|WP_009334178.1| MULTISPECIES: O-succinylbenzoate synthase [Bacillus]
 gb|EFV76451.1| N-acylamino acid racemase [Bacillus sp. 2_A_57_CT2]
Length=368

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            +L +  +PGD ++S+RY++KD+I PE+ V++G+IKVP
Sbjct  307  TLSNFIMPGDTAASSRYWEKDLIDPEVTVEDGMIKVP  343



>ref|WP_013059562.1| O-succinylbenzoate synthase [Bacillus megaterium]
 ref|YP_003565323.1| O-succinylbenzoic acid (OSB) synthetase [Bacillus megaterium 
QM B1551]
 gb|ADE71889.1| O-succinylbenzoic acid (OSB) synthetase [Bacillus megaterium 
QM B1551]
Length=367

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  21   IPGDLSSSNRYFKKDIIKPEIIVKNGIIKV  110
            IPGD+S+S+RY++KDIIKPE+ V+ G+IKV
Sbjct  312  IPGDISASSRYWEKDIIKPEVEVEAGVIKV  341



>ref|WP_016765779.1| O-succinylbenzoate synthase [Bacillus megaterium]
Length=367

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  21   IPGDLSSSNRYFKKDIIKPEIIVKNGIIKV  110
            IPGD+S+S+RY++KDIIKPE+ V+ G+IKV
Sbjct  312  IPGDISASSRYWEKDIIKPEVEVEAGVIKV  341



>ref|WP_013401389.1| O-succinylbenzoate synthase [Geobacillus sp. Y4.1MC1]
 ref|YP_003990241.1| o-succinylbenzoic acid (OSB) synthetase [Geobacillus sp. Y4.1MC1]
 gb|ADP75630.1| o-succinylbenzoic acid (OSB) synthetase [Geobacillus sp. Y4.1MC1]
Length=371

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            +L++  +PGD ++S+ Y++KDII PE++V+NG I VP+
Sbjct  309  TLENFTLPGDTAASSHYWEKDIIVPEVVVRNGTITVPE  346



>ref|WP_023509933.1| O-succinylbenzoate synthase [Sporolactobacillus laevolacticus]
 gb|EST12092.1| O-succinylbenzoate synthase [Sporolactobacillus laevolacticus 
DSM 442]
Length=369

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL+   +PGDL +S+ Y+  D+I+PEI V+ G+I VPKG
Sbjct  306  SLEGFTLPGDLFASSHYWTNDLIEPEITVRQGLIIVPKG  344



>ref|WP_029319911.1| O-succinylbenzoate synthase [Bacillus sp. RP1137]
Length=367

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  21   IPGDLSSSNRYFKKDIIKPEIIVKNGIIKV  110
            IPGD+S+S+RY++KDIIKPE+ V+ G+IKV
Sbjct  312  IPGDISASSRYWEKDIIKPEVEVEAGVIKV  341



>ref|WP_012580749.1| O-succinylbenzoate synthase [Listeria monocytogenes]
 ref|YP_002349056.1| O-succinylbenzoic acid synthetase [Listeria monocytogenes HCC23]
 ref|YP_005927515.1| N-acylamino acid racemase [Listeria monocytogenes L99]
 ref|YP_005948625.1| putative O-succinylbenzoate-CoA synthase [Listeria monocytogenes 
M7]
 gb|ACK38442.1| O-succinylbenzoic acid (OSB) synthetase [Listeria monocytogenes 
HCC23]
 emb|CAR85226.1| N-acylamino acid racemase [Listeria monocytogenes L99]
 gb|AEH93567.1| putative O-succinylbenzoate-CoA synthase [Listeria monocytogenes 
M7]
Length=374

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = +3

Query  24   PGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            PGD+S+SNRYF +DII P  I+  G I VP G
Sbjct  314  PGDISASNRYFNEDIISPAFILNQGKITVPTG  345



>ref|WP_028411865.1| MULTISPECIES: O-succinylbenzoate synthase [Bacillus]
Length=367

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  21   IPGDLSSSNRYFKKDIIKPEIIVKNGIIKV  110
            IPGD+S+S+RY++KDIIKPE+ V+ G+IKV
Sbjct  312  IPGDISASSRYWEKDIIKPEVEVEAGVIKV  341



>ref|WP_034648570.1| O-succinylbenzoate synthase [Bacillus megaterium]
 gb|KFN00353.1| o-succinylbenzoate synthase [Bacillus megaterium]
 gb|KGJ86148.1| O-succinylbenzoate synthase [Bacillus megaterium NBRC 15308 = 
ATCC 14581]
Length=367

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  21   IPGDLSSSNRYFKKDIIKPEIIVKNGIIKV  110
            IPGD+S+S+RY++KDIIKPE+ V+ G+IKV
Sbjct  312  IPGDISASSRYWEKDIIKPEVEVEAGVIKV  341



>ref|WP_012986427.1| O-succinylbenzoate synthase [Listeria seeligeri]
 ref|YP_003465653.1| N-acylamino acid racemase [Listeria seeligeri serovar 1/2b str. 
SLCC3954]
 emb|CBH28571.1| N-acylamino acid racemase [Listeria seeligeri serovar 1/2b str. 
SLCC3954]
Length=374

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  24   PGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            PGD+S+SNRYF +D+I P  +++ G +KVP+G
Sbjct  314  PGDISASNRYFHEDVISPAFVLERGRLKVPEG  345



>ref|WP_026565281.1| O-succinylbenzoate synthase [Bacillus sp. UNC41MFS5]
Length=375

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL +  +PGD ++S  Y+K+DII PE+IV++G+I +PK
Sbjct  307  SLSNFKLPGDTAASAHYWKEDIIDPEVIVEDGMITIPK  344



>ref|WP_036090501.1| O-succinylbenzoate synthase [Leuconostoc mesenteroides]
 gb|KGB50595.1| O-succinylbenzoate synthase [Leuconostoc mesenteroides P45]
Length=366

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL     PGD+S S RYF++DII+  + V NGII VPK
Sbjct  303  SLPKIAFPGDISDSRRYFERDIIEERLRVNNGIISVPK  340



>ref|WP_020956245.1| MULTISPECIES: O-succinylbenzoate-CoA synthase [Bacillus]
 ref|YP_008422131.1| O-succinylbenzoate-CoA synthase [Bacillus amyloliquefaciens subsp. 
plantarum UCMB5113]
 emb|CDG27004.1| O-succinylbenzoate-CoA synthase [Bacillus amyloliquefaciens subsp. 
plantarum UCMB5113]
Length=371

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/39 (49%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL    IPGD+SSS+RY+++DI+ P++ ++ G I VP G
Sbjct  307  SLPQFTIPGDISSSDRYWEEDIVTPDMRIEEGFISVPDG  345



>ref|WP_036821066.1| hypothetical protein [Pontibacillus yanchengensis]
 gb|KGP72034.1| O-succinylbenzoate synthase [Pontibacillus yanchengensis Y32]
Length=366

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/39 (49%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL +  IPGD+S+S RY++KD+I PE+ + NG + +P G
Sbjct  304  SLPNFTIPGDISASKRYWEKDVIIPEVELPNGYVVIPDG  342



>gb|EFS02112.1| O-succinylbenzoic acid (OSB) synthetase [Listeria seeligeri FSL 
S4-171]
Length=374

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  24   PGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            PGD+S+SNRYF +DI+ P  +++ G +KVP+G
Sbjct  314  PGDISASNRYFHEDIVSPAFVLERGRLKVPEG  345



>ref|WP_003749525.1| O-succinylbenzoate synthase [Listeria seeligeri]
 gb|EFR99080.1| O-succinylbenzoic acid (OSB) synthetase [Listeria seeligeri FSL 
N1-067]
Length=374

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  24   PGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            PGD+S+SNRYF +DI+ P  +++ G +KVP+G
Sbjct  314  PGDISASNRYFHEDIVSPAFVLERGRLKVPEG  345



>ref|WP_026575843.1| O-succinylbenzoate synthase [Bacillus sp. UNC438CL73TsuS30]
Length=367

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            +L +  +PGD ++S+RY+++DII PE+ V NG+I VP
Sbjct  307  TLANFTMPGDTAASSRYWERDIIDPEVTVHNGLITVP  343



>ref|WP_026584961.1| O-succinylbenzoate synthase [Bacillus sp. J33]
Length=371

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SL+   IPGD+S+S RY+++DII PE+ VK+G I+VP
Sbjct  306  SLEGFSIPGDISASGRYWEEDIILPEVTVKDGKIEVP  342



>ref|WP_026865911.1| O-succinylbenzoate synthase [Jeotgalicoccus marinus]
Length=368

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            +L +  +PGD +SS+RY+ KDII+PE++ ++G+I VP
Sbjct  307  TLSNFTLPGDTASSSRYWDKDIIEPEVVSEDGVIVVP  343



>ref|WP_003726232.1| mandelate racemase/muconate lactonizing enzyme family protein 
[Listeria monocytogenes]
 gb|EAL08697.1| mandelate racemase/muconate lactonizing enzyme family protein 
[Listeria monocytogenes str. 4b H7858]
Length=147

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 16/32 (50%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = +3

Query  24   PGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            PGD+S+SNRYF +DI+ P  ++  G + VP G
Sbjct  87   PGDISASNRYFNEDIVSPAFVLNQGKLTVPTG  118



>ref|WP_016095902.1| O-succinylbenzoic acid (OSB) synthetase [Bacillus cereus]
 gb|EOO17841.1| O-succinylbenzoic acid (OSB) synthetase [Bacillus cereus HuA3-9]
Length=368

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL +  IPGD+S+S+R+++KDII PE++++ G ++VP+
Sbjct  306  SLPNFTIPGDISASSRHWEKDIISPEVMLEGGKVRVPQ  343



>ref|WP_033731549.1| N-acylamino acid racemase [Bacillus weihenstephanensis]
 gb|ETT70196.1| mandelate racemase/muconate lactonizing protein [Bacillus weihenstephanensis 
FSL H7-687]
Length=368

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL +  IPGD+S+S+R+++KDII PE++++ G ++VP+
Sbjct  306  SLPNFTIPGDISASSRHWEKDIISPEVMLEGGKVRVPQ  343



>ref|WP_039168318.1| O-succinylbenzoate synthase [Bacillus altitudinis]
 gb|KHG36700.1| O-succinylbenzoate synthase [Bacillus altitudinis]
Length=374

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            +L    IPGD+S+S++Y+++DII PEI V+NG I+VP+
Sbjct  307  TLPQFTIPGDISASSKYWEQDIIFPEIKVENGFIEVPR  344



>ref|WP_038536884.1| O-succinylbenzoate synthase [Bacillus sp. X1(2014)]
 gb|AIM15992.1| O-succinylbenzoate synthase [Bacillus sp. X1(2014)]
Length=368

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            S+    IPGD+S SNR++++DII PE+IV NG I VP
Sbjct  306  SMPGFTIPGDISGSNRFWEEDIISPEVIVVNGKISVP  342



>ref|WP_002138834.1| N-acylamino acid racemase [Bacillus cereus]
 gb|EJV79117.1| O-succinylbenzoic acid (OSB) synthetase [Bacillus cereus HuA2-1]
Length=368

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL +  IPGD+S+S+R+++KDII PE++++ G ++VP+
Sbjct  306  SLPNFTIPGDISASSRHWEKDIISPEVMLEGGKVRVPQ  343



>ref|WP_028399700.1| N-acylamino acid racemase [Bacillus panaciterrae]
Length=367

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/39 (46%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL +  IPGD+S+S+R++++D+I PE+ ++NG +KV  G
Sbjct  306  SLPNFTIPGDISASSRHWERDLITPEVTLQNGKVKVQNG  344



>ref|WP_029566205.1| O-succinylbenzoate synthase [Bacillus cibi]
 gb|KEZ49765.1| O-succinylbenzoate synthase [Bacillus cibi]
Length=369

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SL    IPGD+S+S+RY+++DII PE+ V  G+I VP
Sbjct  307  SLSGFSIPGDISASSRYWEEDIITPEVKVDKGLIDVP  343



>ref|WP_002015818.1| N-acylamino acid racemase [Bacillus cereus]
 gb|EEK70994.1| o-succinylbenzoate synthase [Bacillus cereus AH621]
Length=368

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL +  IPGD+S+S+R+++KDII PE++++ G ++VP+
Sbjct  306  SLPNFTIPGDISASSRHWEKDIISPEVMLEGGKVRVPQ  343



>ref|WP_029440280.1| N-acylamino acid racemase [Bacillus thuringiensis]
Length=368

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL +  IPGD+S+SNR+++KDII PE+ ++ G + VP+
Sbjct  306  SLPNFTIPGDISASNRHWEKDIISPEVTLEGGKVMVPQ  343



>ref|WP_002167477.1| N-acylamino acid racemase [Bacillus cereus]
 gb|EJR44485.1| O-succinylbenzoic acid (OSB) synthetase [Bacillus cereus VD078]
Length=368

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL +  IPGD+S+S+R+++KDII PE++++ G ++VP+
Sbjct  306  SLPNFTIPGDISASSRHWEKDIISPEVMLEGGKVRVPQ  343



>ref|WP_000403295.1| N-acylamino acid racemase [Bacillus cereus]
 gb|EJS60609.1| O-succinylbenzoic acid (OSB) synthetase [Bacillus cereus BAG1X1-3]
 gb|EOO71344.1| O-succinylbenzoic acid (OSB) synthetase [Bacillus cereus BAG1O-1]
Length=368

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL +  IPGD+S+SNR++++DII PE++++ G + VP+
Sbjct  306  SLPNFMIPGDISASNRHWERDIISPEVMLEGGKVIVPQ  343



>ref|WP_029278766.1| O-succinylbenzoate synthase [Bacillus indicus]
 gb|KEZ51464.1| O-succinylbenzoate synthase [Bacillus indicus LMG 22858]
Length=369

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            SL    IPGD+S+S+RY+++DII PE+ V  G+I VP
Sbjct  307  SLSGFSIPGDISASSRYWEEDIITPEVKVDKGLIDVP  343



>ref|WP_016092529.1| O-succinylbenzoic acid (OSB) synthetase [Bacillus cereus]
 gb|EOO17667.1| O-succinylbenzoic acid (OSB) synthetase [Bacillus cereus HuA2-9]
Length=368

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL +  IPGD+S+S+R+++KDII PE++++ G ++VP+
Sbjct  306  SLPNFTIPGDISASSRHWEKDIISPEVMLEGGKVRVPQ  343



>ref|WP_002067823.1| N-acylamino acid racemase [Bacillus cereus]
 gb|EEL68445.1| o-succinylbenzoate synthase [Bacillus cereus AH603]
Length=368

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL +  IPGD+S+S+R+++KDII PE++++ G ++VP+
Sbjct  306  SLPNFTIPGDISASSRHWEKDIISPEVMLEGGKVRVPQ  343



>ref|WP_007474007.1| putative N-acylamino acid racemase [Listeria fleischmannii]
 gb|EMG28306.1| putative N-acylamino acid racemase [Listeria fleischmannii LU2006-1]
Length=217

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  18   YIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            + PGD+S++ RYFK DIIK +  + NG I+VP+G
Sbjct  159  HFPGDISATKRYFKHDIIKKDFELNNGEIEVPQG  192



>ref|WP_034653900.1| O-succinylbenzoate synthase [Bacillus megaterium]
 gb|KFM97871.1| o-succinylbenzoate synthase [Bacillus megaterium]
 gb|KGJ76028.1| O-succinylbenzoate synthase [Bacillus megaterium NBRC 15308 = 
ATCC 14581]
Length=369

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            +L +  +PGD ++S++Y+ +DII PEI V NGII VP
Sbjct  307  TLANFTLPGDTAASSKYWPRDIIHPEITVDNGIISVP  343



>ref|WP_019119652.1| hypothetical protein [Brevibacillus massiliensis]
Length=368

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/31 (55%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  21   IPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            +PGD ++S+RY+++DII PE+ V+NG+I VP
Sbjct  313  LPGDTAASSRYWREDIIDPEVTVENGVITVP  343



>ref|WP_010990009.1| O-succinylbenzoate synthase [Listeria monocytogenes]
 ref|NP_466043.1| O-succinylbenzoate-CoA synthase [Listeria monocytogenes EGD-e]
 ref|YP_006685910.1| N-acylamino acid racemase [Listeria monocytogenes SLCC2372]
 ref|YP_006688846.1| N-acylamino acid racemase [Listeria monocytogenes SLCC2479]
 emb|CAD00598.1| lmo2520 [Listeria monocytogenes EGD-e]
 emb|CBY55918.1| N-acylamino acid racemase [Listeria monocytogenes SLCC2372]
 emb|CBY58854.1| N-acylamino acid racemase [Listeria monocytogenes SLCC2479]
 gb|KEU33748.1| O-succinylbenzoate synthase [Listeria monocytogenes]
 gb|KEV43088.1| O-succinylbenzoate synthase [Listeria monocytogenes]
 gb|KHK16999.1| N-acylamino acid racemase [Listeria monocytogenes SHL006]
Length=374

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = +3

Query  24   PGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            PGD+S+SNRYF KDI+ P  ++  G + VP G
Sbjct  314  PGDISASNRYFNKDIVSPAFVLNQGKLTVPTG  345



>ref|WP_019243989.1| hypothetical protein [Bacillus massilioanorexius]
Length=368

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL+   +P D+SSS+R++ +DII PEI+V+NG +KV K
Sbjct  306  SLEGFTLPSDISSSSRFWDEDIIDPEIVVENGTVKVSK  343



>ref|WP_016766446.1| O-succinylbenzoate synthase [Bacillus megaterium]
Length=369

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            +L +  +PGD ++S++Y+ +DII PEI V NGII VP
Sbjct  307  TLANFTLPGDTAASSKYWPRDIIHPEITVDNGIISVP  343



>gb|EFR83468.1| N-acylamino acid racemase [Listeria monocytogenes FSL F2-208]
Length=69

 Score = 43.5 bits (101),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +3

Query  21   IPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
             PGD+S+SNRYF +DII P   +  G I VP G
Sbjct  8    FPGDISASNRYFNEDIISPAFTLNQGKITVPTG  40



>ref|WP_024424935.1| O-succinylbenzoate synthase [Bacillus safensis]
Length=374

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL    IPGD+S+S++++++DII PEI V+NG I+VP+
Sbjct  307  SLPQFTIPGDISASSKFWEQDIIFPEIKVENGFIEVPR  344



>gb|EUJ45855.1| N-acylamino acid racemase [Listeria riparia FSL S10-1204]
Length=358

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  24   PGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            PGD+S+SNRYF +DII+ EII+ NG I  P
Sbjct  302  PGDISASNRYFHQDIIQNEIIIDNGKIATP  331



>ref|WP_009497870.1| O-succinylbenzoate synthase [Sporosarcina newyorkensis]
 gb|EGQ21827.1| O-succinylbenzoate synthase [Sporosarcina newyorkensis 2681]
Length=376

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            +L +  +PGD + S+RY+ +DIIKPE++ +NG I VP
Sbjct  313  TLPNFTLPGDTAGSSRYWDQDIIKPEVVAENGYITVP  349



>ref|WP_031295637.1| O-succinylbenzoate synthase, partial [Leuconostoc mesenteroides]
Length=346

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL     PGD+S S RYF++DII+  + V NGII VP+
Sbjct  297  SLPKIAFPGDISDSRRYFERDIIEERLRVNNGIISVPR  334



>ref|WP_012952027.1| O-succinylbenzoate synthase [Listeria monocytogenes]
 ref|YP_003414823.1| hypothetical protein LM5578_2715 [Listeria monocytogenes 08-5578]
 ref|YP_003417867.1| hypothetical protein LM5923_2664 [Listeria monocytogenes 08-5923]
 gb|ADB69461.1| hypothetical protein LM5578_2715 [Listeria monocytogenes 08-5578]
 gb|ADB72505.1| hypothetical protein LM5923_2664 [Listeria monocytogenes 08-5923]
 gb|EXL17375.1| o-succinylbenzoate synthase [Listeria monocytogenes Lm_1823]
 gb|EXL26928.1| o-succinylbenzoate synthase [Listeria monocytogenes Lm_1889]
 emb|CDK43610.1| o-succinylbenzoate synthase [Listeria monocytogenes QOC1]
 emb|CDM17861.1| o-succinylbenzoate synthase [Listeria monocytogenes R479a]
 gb|KEK05202.1| O-succinylbenzoate synthase [Listeria monocytogenes]
 gb|KEK06077.1| O-succinylbenzoate synthase [Listeria monocytogenes]
 gb|AIL68519.1| O-succinylbenzoate synthase [Listeria monocytogenes]
 gb|KHK05527.1| hypothetical protein I612_13055 [Listeria monocytogenes SHL004]
 gb|KHK27635.1| hypothetical protein I620_11616 [Listeria monocytogenes SHL011]
 gb|KHS60368.1| O-succinylbenzoate synthase [Listeria monocytogenes]
 gb|KHS62509.1| O-succinylbenzoate synthase [Listeria monocytogenes]
Length=374

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = +3

Query  24   PGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            PGD+S+SNRYF KDI+ P  ++  G + VP G
Sbjct  314  PGDISASNRYFNKDIVSPAFVLNQGKLTVPTG  345



>ref|WP_031645151.1| O-succinylbenzoate synthase [Listeria monocytogenes]
 emb|CDK33701.1| o-succinylbenzoate synthase [Listeria monocytogenes QOC2]
 gb|KES27889.1| O-succinylbenzoate synthase [Listeria monocytogenes]
 gb|KES35017.1| O-succinylbenzoate synthase [Listeria monocytogenes]
 gb|KEU51297.1| O-succinylbenzoate synthase [Listeria monocytogenes]
 gb|KEX11708.1| O-succinylbenzoate synthase [Listeria monocytogenes]
 gb|KEX37225.1| O-succinylbenzoate synthase [Listeria monocytogenes]
 gb|KEX45119.1| O-succinylbenzoate synthase [Listeria monocytogenes]
 gb|KEX45290.1| O-succinylbenzoate synthase [Listeria monocytogenes]
Length=374

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = +3

Query  24   PGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            PGD+S+SNRYF KDI+ P  ++  G + VP G
Sbjct  314  PGDISASNRYFNKDIVSPTFVLNQGKLTVPTG  345



>ref|WP_002199002.1| N-acylamino acid racemase [Bacillus cereus]
 gb|EJQ50177.1| O-succinylbenzoic acid (OSB) synthetase [Bacillus cereus BAG5X1-1]
Length=368

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL +  IPGD+S+SNR++++DII PE++++ G + VP+
Sbjct  306  SLPNFTIPGDISASNRHWERDIISPEVMLEGGKVVVPQ  343



>ref|WP_000635662.1| O-succinylbenzoate synthase [Bacillus cereus]
 gb|EEK44730.1| N-acylamino acid racemase [Bacillus cereus m1293]
Length=368

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/38 (45%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            +L +  +PGD + S+RY+++DII+PE++V+NG+I +P+
Sbjct  307  TLSNFIMPGDTAGSSRYWEQDIIEPEVVVENGMIIIPE  344



>ref|WP_039176787.1| O-succinylbenzoate synthase [Listeria monocytogenes]
 gb|KID16964.1| O-succinylbenzoate synthase [Listeria monocytogenes]
Length=374

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = +3

Query  24   PGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            PGD+S+SNRYF KDI+ P  ++  G + VP G
Sbjct  314  PGDISASNRYFNKDIVSPAFVLNQGKLTVPTG  345



>ref|WP_034621239.1| O-succinylbenzoate synthase [Bacillus safensis]
 gb|KEP31915.1| O-succinylbenzoate synthase [Bacillus safensis]
Length=374

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL    IPGD+S+S++++++DII PEI V+NG I+VP+
Sbjct  307  SLPQFTIPGDISASSKFWEQDIIFPEIKVENGFIEVPR  344



>ref|WP_024425781.1| O-succinylbenzoate synthase [Bacillus pumilus]
Length=374

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL    IPGD+S+S++++++DII PEI V+NG I+VP+
Sbjct  307  SLPQFTIPGDISASSKFWEQDIIFPEIKVENGFIEVPR  344



>ref|WP_014324525.1| O-succinylbenzoate synthase [Leuconostoc mesenteroides]
 ref|YP_005174117.1| O-succinylbenzoate synthase [Leuconostoc mesenteroides subsp. 
mesenteroides J18]
 gb|AET30151.1| O-succinylbenzoate synthase [Leuconostoc mesenteroides subsp. 
mesenteroides J18]
Length=366

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL     PGD+S S RYF++DII+  + V NGII VP+
Sbjct  303  SLPKIAFPGDISDSRRYFERDIIEERLRVNNGIISVPR  340



>ref|WP_031941115.1| O-succinylbenzoate synthase, partial [Leuconostoc pseudomesenteroides]
Length=163

 Score = 44.3 bits (103),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL     PGD+S S RYF++DII+  + V NGII VP+
Sbjct  118  SLPKIAFPGDISDSRRYFERDIIEERLRVNNGIISVPR  155



>ref|WP_036099659.1| O-succinylbenzoate synthase [Listeria riparia]
Length=370

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  24   PGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            PGD+S+SNRYF +DII+ EII+ NG I  P
Sbjct  314  PGDISASNRYFHQDIIQNEIIIDNGKIATP  343



>gb|AHF18894.1| L-alanine-DL-glutamate epimerase related enzyme of enolase superfamily 
[Leuconostoc mesenteroides KFRI-MG]
Length=366

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL     PGD+S S RYF++DII+  + V NGII VP+
Sbjct  303  SLPKIAFPGDISDSRRYFERDIIEERLRVNNGIISVPR  340



>ref|WP_039180908.1| O-succinylbenzoate synthase [Bacillus sp. WP8]
 gb|AIZ61276.1| O-succinylbenzoate synthase [Bacillus sp. WP8]
Length=374

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL    IPGD+S+S++++++DII PEI V+NG I+VP+
Sbjct  307  SLPQFTIPGDISASSKFWEQDIIFPEIKVENGFIEVPR  344



>ref|WP_009795310.1| MULTISPECIES: O-succinylbenzoate synthase [Bacillus]
 ref|YP_008610744.1| O-succinylbenzoate synthase [Bacillus infantis NRRL B-14911]
 gb|EAR64774.1| enolase superfamily protein; possible N-acylamino acid racemase, 
mandelate racemase/muconate lactonizing enzyme [Bacillus 
sp. NRRL B-14911]
 gb|AGX05951.1| O-succinylbenzoate synthase [Bacillus infantis NRRL B-14911]
Length=369

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            SL    IPGD+S S RY+++DII P + V++G I VP+G
Sbjct  306  SLPGFEIPGDISGSERYWEQDIITPGVTVEDGFINVPEG  344



>ref|WP_013055777.1| O-succinylbenzoate synthase [Bacillus megaterium]
 ref|YP_003561536.1| o-succinylbenzoic acid (OSB) synthetase [Bacillus megaterium 
QM B1551]
 gb|ADE68102.1| o-succinylbenzoic acid (OSB) synthetase [Bacillus megaterium 
QM B1551]
Length=369

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            +L +  +PGD ++S++Y+ +DI+ PEI V NGII VP
Sbjct  307  TLANFTLPGDTAASSKYWPRDIVHPEITVDNGIISVP  343



>ref|WP_034279379.1| O-succinylbenzoate synthase [Bacillus safensis]
 gb|KDE28835.1| o-succinylbenzoate-CoA synthase [Bacillus safensis FO-36b]
Length=374

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL    IPGD+S+S++++++DII PEI V+NG I+VP+
Sbjct  307  SLPQFTIPGDISASSKFWEQDIIFPEIKVENGFIEVPR  344



>gb|KIG00233.1| O-succinylbenzoate synthase [Bacillaceae bacterium MTCC 8252]
 gb|KIG00338.1| O-succinylbenzoate synthase [Bacillaceae bacterium MTCC 10057]
Length=369

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            +L    +PGD ++S+RY+ KDIIKPE+ V++G+I VP+
Sbjct  307  TLSQFTLPGDNAASSRYWVKDIIKPEVTVESGMIDVPE  344



>ref|WP_013082069.1| O-succinylbenzoate synthase [Bacillus megaterium]
 ref|YP_003596283.1| o-succinylbenzoic acid (OSB) synthetase [Bacillus megaterium 
DSM 319]
 gb|ADF37933.1| o-succinylbenzoic acid (OSB) synthetase [Bacillus megaterium 
DSM 319]
Length=369

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            +L +  +PGD ++S++Y+ +DI+ PEI V NGII VP
Sbjct  307  TLANFTLPGDTAASSKYWPRDIVHPEITVDNGIISVP  343



>gb|KFN02200.1| o-succinylbenzoate synthase [Bacillus mycoides]
Length=368

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL +  IPGD+S+S+R+++KDII PE+ +K+G + VP+
Sbjct  306  SLPNFTIPGDISASSRHWEKDIISPEVTLKDGKVIVPQ  343



>ref|WP_002112537.1| N-acylamino acid racemase [Bacillus cereus]
 gb|EJV65571.1| O-succinylbenzoic acid (OSB) synthetase [Bacillus cereus BAG6O-2]
Length=368

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL +  IPGD+S+SNR++++DII PE++++ G + VP+
Sbjct  306  SLPNFTIPGDISASNRHWERDIISPEVMLEGGKVVVPQ  343



>ref|WP_039237693.1| O-succinylbenzoate synthase [Bacillus thermotolerans]
 gb|KIA67634.1| O-succinylbenzoate synthase [Bacillus thermotolerans]
Length=369

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            +L    +PGD ++S+RY+ KDIIKPE+ V++G+I VP+
Sbjct  307  TLSQFTLPGDNAASSRYWVKDIIKPEVTVESGMIDVPE  344



>ref|WP_033578245.1| O-succinylbenzoate synthase [Bacillus aryabhattai]
Length=369

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            +L +  +PGD ++S++Y+ +DI+ PEI V NGII VP
Sbjct  307  TLANFTLPGDTAASSKYWPRDIVHPEITVDNGIISVP  343



>ref|WP_028407734.1| O-succinylbenzoate synthase [Bacillus sp. 171095_106]
Length=369

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            +L +  +PGD ++S++Y+ +DI+ PEI V NGII VP
Sbjct  307  TLANFTLPGDTAASSKYWPRDIVHPEITVDNGIISVP  343



>ref|WP_025749606.1| O-succinylbenzoate synthase [Bacillus flexus]
Length=369

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            +L +  +PGD ++S++Y+ +DI+ PEI V NGII VP
Sbjct  307  TLANFTLPGDTAASSKYWPRDIVHPEITVDNGIISVP  343



>ref|WP_008410448.1| o-succinylbenzoate synthase [Desulfotomaculum hydrothermale]
 emb|CCO07537.1| o-succinylbenzoate synthase [Desulfotomaculum hydrothermale Lam5 
= DSM 18033]
Length=369

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 16/31 (52%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +3

Query  21   IPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            +PGD ++S+RY+++DII+PE+ V+ G+I+VP
Sbjct  313  LPGDTAASSRYWEQDIIQPEVTVEKGLIQVP  343



>ref|WP_027408410.1| O-succinylbenzoate synthase [Anoxybacillus tepidamans]
Length=369

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 17/38 (45%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            +L++  +PGD ++S+ Y+++DII PE+ V+NG+I VP+
Sbjct  307  TLENFVLPGDTAASSYYWERDIIDPEVTVENGMITVPE  344



>ref|WP_014461249.1| O-succinylbenzoate synthase [Bacillus megaterium]
 ref|YP_005496360.1| N-acylamino acid racemase [Bacillus megaterium WSH-002]
 gb|AEN91051.1| putative N-acylamino acid racemase; possible O-succinylbenzoate 
synthase [Bacillus megaterium WSH-002]
Length=369

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            +L +  +PGD ++S++Y+ +DI+ PEI V NGII VP
Sbjct  307  TLANFTLPGDTAASSKYWPRDIVHPEITVDNGIISVP  343



>ref|WP_011679541.1| O-succinylbenzoate synthase [Leuconostoc mesenteroides]
 ref|YP_818236.1| O-succinylbenzoate synthase [Leuconostoc mesenteroides subsp. 
mesenteroides ATCC 8293]
 gb|ABJ61863.1| O-succinylbenzoate synthase [Leuconostoc mesenteroides subsp. 
mesenteroides ATCC 8293]
Length=366

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL     PGD+S S RYF++DII+  + V NGII VP+
Sbjct  303  SLPKIAFPGDISDSRRYFERDIIEERLRVNNGIISVPR  340



>ref|WP_004164232.1| O-succinylbenzoate synthase [Leuconostoc mesenteroides]
 gb|EEJ42255.1| o-succinylbenzoate synthase [Leuconostoc mesenteroides subsp. 
cremoris ATCC 19254]
 gb|KDA51971.1| O-succinylbenzoate synthase [Leuconostoc mesenteroides subsp. 
cremoris T26]
Length=366

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL     PGD+S S RYF++DII+  + V NGII VP+
Sbjct  303  SLPKIAFPGDISDSRRYFERDIIEERLRVNNGIISVPR  340



>ref|WP_000403294.1| N-acylamino acid racemase [Bacillus cereus]
 gb|EEL85688.1| o-succinylbenzoate synthase [Bacillus cereus AH1272]
Length=368

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL +  IPGD+S+S+R++K+DII PE+++++G + VP+
Sbjct  306  SLPNFTIPGDISASSRHWKRDIISPEVMLESGKVIVPQ  343



>ref|WP_008175179.1| O-succinylbenzoate synthase [Bacillus sp. B14905]
 gb|EAZ86616.1| N-acylamino acid racemase [Bacillus sp. B14905]
Length=363

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL    +PGD + S+ Y+ +DII PE+IVKNG I VP+
Sbjct  302  SLSHFMLPGDTAGSSHYWYEDIINPEVIVKNGYIDVPQ  339



>ref|WP_010860379.1| O-succinylbenzoate synthase [Lysinibacillus sphaericus]
 gb|EON71161.1| O-succinylbenzoate synthase [Lysinibacillus sphaericus OT4b.31]
Length=368

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL +  +PGD + S+ Y+ +DII PE++V+NG I+VP+
Sbjct  307  SLANFVLPGDTAGSSHYWDEDIITPEVVVENGYIRVPQ  344



>gb|EZP78877.1| o-succinylbenzoic acid (OSB) synthetase [Geobacillus stearothermophilus 
NUB3621]
Length=371

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 17/38 (45%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            +L++  +PGD ++S+ Y++KDII PE++V++G+I VP+
Sbjct  309  TLENFTMPGDTAASSHYWEKDIIVPEVVVQDGMITVPE  346



>ref|WP_029324964.1| O-succinylbenzoate synthase [Bacillus sp. RP1137]
Length=369

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            +L +  +PGD ++S++Y+ +DI+ PEI V NGII VP
Sbjct  307  TLANFTLPGDTAASSKYWPRDIVHPEIAVDNGIISVP  343



>ref|WP_026041591.1| O-succinylbenzoate synthase [Bacillus oceanisediminis]
Length=378

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPKG  119
            +L +  +PGD + S+ Y++ DI+KPEI ++NG I+VP+G
Sbjct  307  ALSNFTMPGDTAPSSHYWEDDIVKPEITMENGYIQVPEG  345



>ref|WP_034286372.1| O-succinylbenzoate synthase [Bacillus sp. 72]
Length=368

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKV  110
            SL    IPGD+ SSN Y+++DII+PEI+V+NG I++
Sbjct  308  SLPGFTIPGDIVSSNHYWEEDIIEPEILVENGRIQL  343



>ref|WP_016120967.1| O-succinylbenzoic acid (OSB) synthetase [Bacillus cereus]
 gb|EOP34124.1| O-succinylbenzoic acid (OSB) synthetase [Bacillus cereus VD146]
Length=368

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 17/38 (45%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL +  IPGD+S+S+R++++DII PE++++ G ++VP+
Sbjct  306  SLPNFTIPGDISASSRHWERDIISPEVMLEGGKVRVPQ  343



>ref|WP_034269950.1| O-succinylbenzoate synthase, partial [Bacillus sp. Aph1]
Length=352

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVP  113
            +L +  +PGD ++S++Y+ +DI+ PEI V NGII VP
Sbjct  307  TLANFTLPGDTAASSKYWPRDIVHPEITVDNGIISVP  343



>ref|WP_025117538.1| O-succinylbenzoate synthase [Lysinibacillus fusiformis]
Length=368

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL    +PGD + S+ Y+ +DII PE+IVKNG I VP+
Sbjct  307  SLSHFILPGDTAGSSHYWYEDIINPEVIVKNGYIDVPQ  344



>ref|WP_002129645.1| N-acylamino acid racemase [Bacillus cereus]
 gb|EJQ57549.1| O-succinylbenzoic acid (OSB) synthetase [Bacillus cereus CER057]
 gb|EJQ69738.1| O-succinylbenzoic acid (OSB) synthetase [Bacillus cereus CER074]
 gb|EJV62428.1| O-succinylbenzoic acid (OSB) synthetase [Bacillus cereus BtB2-4]
Length=368

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 17/38 (45%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    SLKDTYIPGDLSSSNRYFKKDIIKPEIIVKNGIIKVPK  116
            SL +  IPGD+S+S+R++++DII PE++++ G ++VP+
Sbjct  306  SLPNFTIPGDISASSRHWERDIISPEVMLEGGKVRVPQ  343



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 516678285084