BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c12794_g1_i1 len=959 path=[975:0-472 20:473-958]

Length=959
                                                                      Score     E

ref|XP_009770367.1|  PREDICTED: glutamic acid-rich protein-like       68.2    1e-10   
dbj|BAA95789.1|  KED                                                  59.3    2e-06   Nicotiana tabacum [American tobacco]
ref|XP_009615895.1|  PREDICTED: DNA ligase 1-like                     59.3    2e-06   
ref|XP_004249379.1|  PREDICTED: ABC transporter F family member 4...  56.6    1e-05   
ref|XP_006339332.1|  PREDICTED: DNA ligase 1-like                     54.7    6e-05   



>ref|XP_009770367.1| PREDICTED: glutamic acid-rich protein-like, partial [Nicotiana 
sylvestris]
Length=135

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +2

Query  413  GLDKLKSKLEKINAKMESLEQKRADILRQIKEAEDQNTALAE-IKEAEGKASVGT  574
            GLDKLKSK EKINAK+E+L+Q++ADIL+ IKEAED+N A+ E  KEAE KA  G 
Sbjct  77   GLDKLKSKFEKINAKLEALQQRKADILKTIKEAEDKNLAVVESPKEAEPKAQDGV  131



>dbj|BAA95789.1| KED [Nicotiana tabacum]
Length=513

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = +2

Query  422  KLKSKLEKINAKMESLEQKRADILRQIKEAEDQNTALAE-IKEAEGKASVG  571
            KLKSKLEKINAK+E+L+QK+ADI++ IKEAED+N A+ E  KEA+ KA  G
Sbjct  458  KLKSKLEKINAKLEALQQKKADIMKTIKEAEDKNLAVVESPKEADLKAHDG  508



>ref|XP_009615895.1| PREDICTED: DNA ligase 1-like [Nicotiana tomentosiformis]
Length=513

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = +2

Query  422  KLKSKLEKINAKMESLEQKRADILRQIKEAEDQNTALAE-IKEAEGKASVG  571
            KLKSKLEKINAK+E+L+QK+ADI++ IKEAED+N A+ E  KEA+ KA  G
Sbjct  458  KLKSKLEKINAKLEALQQKKADIMKTIKEAEDKNLAVVESPKEADLKAHDG  508



>ref|XP_004249379.1| PREDICTED: ABC transporter F family member 4-like [Solanum lycopersicum]
Length=427

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = +2

Query  416  LDKLKSKLEKINAKMESLEQKRADILRQIKEAEDQNTALAE-IKEAEGKA  562
            L KLKSKL+KINAK+E+L+ K+ADIL+ IKE ED+N A+ E  K+AE KA
Sbjct  376  LSKLKSKLDKINAKLEALQLKKADILKTIKETEDKNLAVVESPKDAESKA  425



>ref|XP_006339332.1| PREDICTED: DNA ligase 1-like [Solanum tuberosum]
Length=487

 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = +2

Query  416  LDKLKSKLEKINAKMESLEQKRADILRQIKEAEDQNTALAE-IKEAEGKA  562
            L KLKSKL+KINAK+E+L+ ++ADIL+ IKE ED+N A+ E  K+AE KA
Sbjct  435  LSKLKSKLDKINAKLEALQLEKADILKTIKETEDKNLAVVESSKDAESKA  484



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2060434175780