BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1270_g2_i1 len=534 path=[1466:0-533]

Length=534
                                                                      Score     E

ref|XP_004233691.2|  PREDICTED: thaumatin-like protein                  189   3e-56   
ref|XP_006338784.1|  PREDICTED: thaumatin-like protein-like             188   1e-55   
gb|EYU34121.1|  hypothetical protein MIMGU_mgv1a022628mg                183   4e-54   
ref|XP_009620637.1|  PREDICTED: thaumatin-like protein                  183   5e-54   
gb|ABK95807.1|  unknown                                                 181   5e-53   Populus trichocarpa [western balsam poplar]
ref|XP_002323818.2|  hypothetical protein POPTR_0017s11190g             181   5e-53   Populus trichocarpa [western balsam poplar]
ref|XP_011098559.1|  PREDICTED: pathogenesis-related protein 5          180   1e-52   
ref|XP_011008365.1|  PREDICTED: thaumatin-like protein                  180   1e-52   
ref|XP_009775802.1|  PREDICTED: thaumatin-like protein                  180   1e-52   
ref|XP_010660983.1|  PREDICTED: thaumatin-like protein                  179   1e-52   
ref|XP_007032343.1|  Pathogenesis-related thaumatin superfamily p...    179   2e-52   
gb|KDP45445.1|  hypothetical protein JCGZ_09694                         176   5e-51   
ref|XP_010029259.1|  PREDICTED: thaumatin-like protein                  175   1e-50   
ref|XP_004302370.1|  PREDICTED: thaumatin-like protein-like             174   2e-50   
ref|XP_007215905.1|  hypothetical protein PRUPE_ppa010781mg             172   4e-50   
ref|XP_002517440.1|  Protein P21, putative                              172   7e-50   Ricinus communis
ref|XP_008230703.1|  PREDICTED: thaumatin-like protein                  172   8e-50   
gb|KHG15061.1|  hypothetical protein F383_19667                         172   1e-49   
ref|XP_008803423.1|  PREDICTED: thaumatin-like protein                  171   4e-49   
ref|XP_008365396.1|  PREDICTED: thaumatin-like protein                  170   9e-49   
ref|XP_010909541.1|  PREDICTED: thaumatin-like protein                  168   3e-48   
gb|AFK33451.1|  unknown                                                 167   6e-48   
gb|KHN34189.1|  Thaumatin-like protein                                  167   7e-48   
emb|CDY30288.1|  BnaC04g31990D                                          167   1e-47   
ref|XP_006431048.1|  hypothetical protein CICLE_v10012489mg             167   1e-47   
ref|XP_009139951.1|  PREDICTED: thaumatin-like protein                  167   1e-47   
emb|CDY30841.1|  BnaC04g26960D                                          167   1e-47   
ref|XP_010272178.1|  PREDICTED: thaumatin-like protein                  167   1e-47   
ref|XP_003554871.2|  PREDICTED: thaumatin-like protein-like             167   1e-47   
ref|XP_006482515.1|  PREDICTED: thaumatin-like protein-like             166   2e-47   
ref|XP_008443444.1|  PREDICTED: thaumatin-like protein                  166   3e-47   
ref|XP_004147456.1|  PREDICTED: thaumatin-like protein-like             166   3e-47   
ref|XP_008341518.1|  PREDICTED: thaumatin-like protein isoform X2       165   3e-47   
ref|XP_002868677.1|  hypothetical protein ARALYDRAFT_493983             165   4e-47   
ref|XP_010450736.1|  PREDICTED: thaumatin-like protein                  165   4e-47   
gb|KGN59605.1|  Protein P21                                             166   5e-47   
gb|AFK39390.1|  unknown                                                 165   6e-47   
ref|XP_008341517.1|  PREDICTED: thaumatin-like protein isoform X1       165   7e-47   
ref|XP_009335804.1|  PREDICTED: thaumatin-like protein                  165   8e-47   
ref|XP_010554023.1|  PREDICTED: thaumatin-like protein                  164   1e-46   
ref|XP_003618434.1|  Thaumatin-like protein                             164   1e-46   
ref|XP_010435956.1|  PREDICTED: thaumatin-like protein                  164   2e-46   
ref|NP_198818.1|  pathogenesis-related thaumatin-like protein           164   2e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006284382.1|  hypothetical protein CARUB_v10005550mg             164   2e-46   
ref|XP_010441116.1|  PREDICTED: thaumatin-like protein                  164   2e-46   
ref|XP_009418409.1|  PREDICTED: thaumatin-like protein                  162   5e-46   
ref|XP_006405559.1|  hypothetical protein EUTSA_v10027894mg             162   9e-46   
ref|XP_010065046.1|  PREDICTED: thaumatin-like protein                  162   1e-45   
gb|KCW70776.1|  hypothetical protein EUGRSUZ_F03936                     162   1e-45   
ref|XP_007151179.1|  hypothetical protein PHAVU_004G024600g             160   2e-45   
ref|XP_010670350.1|  PREDICTED: thaumatin-like protein                  161   4e-45   
emb|CDP20596.1|  unnamed protein product                                159   9e-45   
ref|XP_010065049.1|  PREDICTED: pathogenesis-related protein 5-like     160   2e-44   
gb|KCW70779.1|  hypothetical protein EUGRSUZ_F03940                     160   3e-44   
gb|AIR93916.1|  thaumatin                                               155   5e-44   
ref|XP_010065048.1|  PREDICTED: pathogenesis-related protein 5-like     157   6e-44   
gb|KCW70777.1|  hypothetical protein EUGRSUZ_F03937                     159   7e-44   
ref|XP_004489362.1|  PREDICTED: thaumatin-like protein-like             154   9e-43   
ref|XP_006838650.1|  hypothetical protein AMTR_s00002p00239680          150   1e-41   
ref|XP_003545288.2|  PREDICTED: pathogenesis-related protein 5-like     140   1e-37   
ref|XP_003545287.2|  PREDICTED: pathogenesis-related protein 5-like     135   1e-35   
dbj|BAJ87574.1|  predicted protein                                      133   1e-34   
gb|KHN04547.1|  Thaumatin-like protein                                  129   2e-34   
gb|ABK25809.1|  unknown                                                 132   3e-34   Picea sitchensis
ref|XP_003525190.1|  PREDICTED: thaumatin-like protein-like             131   5e-34   
dbj|BAD90814.1|  thaumatin-like protein                                 130   6e-34   Cryptomeria japonica
ref|XP_007160531.1|  hypothetical protein PHAVU_002G329400g             130   1e-33   
ref|XP_003530957.2|  PREDICTED: thaumatin-like protein-like             130   2e-33   
ref|XP_010097569.1|  hypothetical protein L484_017379                   129   2e-33   
ref|XP_010033700.1|  PREDICTED: thaumatin-like protein                  129   3e-33   
gb|AAV64186.1|  hypothetical protein C9002                              130   3e-33   Zea mays [maize]
ref|XP_010668000.1|  PREDICTED: thaumatin-like protein                  130   4e-33   
gb|KDP32764.1|  hypothetical protein JCGZ_12056                         129   4e-33   
ref|XP_011001430.1|  PREDICTED: thaumatin-like protein                  129   5e-33   
ref|XP_011008805.1|  PREDICTED: thaumatin-like protein                  128   6e-33   
ref|NP_001131249.1|  uncharacterized protein LOC100192561 precursor     129   6e-33   Zea mays [maize]
ref|XP_006856120.1|  hypothetical protein AMTR_s00059p00148770          128   7e-33   
ref|XP_010929479.1|  PREDICTED: pathogenesis-related protein 5-like     129   7e-33   
ref|XP_004501042.1|  PREDICTED: pathogenesis-related protein 5-like     128   8e-33   
gb|KEH26933.1|  pathogenesis-related thaumatin family protein           127   9e-33   
ref|XP_004172611.1|  PREDICTED: thaumatin-like protein-like             128   1e-32   
gb|AHC69780.1|  thuamatin-like protein                                  127   1e-32   
ref|XP_004140385.1|  PREDICTED: thaumatin-like protein-like             128   1e-32   
ref|XP_007160788.1|  hypothetical protein PHAVU_001G016700g             127   1e-32   
dbj|BAJ93087.1|  predicted protein                                      128   2e-32   
gb|KGN50964.1|  hypothetical protein Csa_5G374740                       128   2e-32   
gb|AAA32875.1|  thaumatin-like protein                                  127   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010529666.1|  PREDICTED: pathogenesis-related protein 5-like     127   2e-32   
gb|KEH36134.1|  pathogenesis-related thaumatin family protein           127   3e-32   
ref|XP_010519216.1|  PREDICTED: thaumatin-like protein                  126   3e-32   
ref|XP_007018987.1|  Pathogenesis-related thaumatin superfamily p...    127   3e-32   
gb|ABL86687.1|  TLP1                                                    126   3e-32   Gossypium barbadense [Egyptian cotton]
ref|XP_006451631.1|  hypothetical protein CICLE_v10009291mg             126   3e-32   
ref|XP_008465794.1|  PREDICTED: thaumatin-like protein                  127   4e-32   
ref|XP_006416627.1|  hypothetical protein EUTSA_v10008614mg             126   4e-32   
ref|XP_006386379.1|  hypothetical protein POPTR_0002s08760g             126   4e-32   
ref|XP_004959962.1|  PREDICTED: pathogenesis-related protein 5-like     127   4e-32   
ref|XP_008463807.1|  PREDICTED: thaumatin-like protein                  126   5e-32   
ref|XP_002307423.1|  hypothetical protein POPTR_0005s16030g             127   5e-32   Populus trichocarpa [western balsam poplar]
ref|XP_003634206.1|  PREDICTED: thaumatin-like protein                  126   5e-32   
ref|XP_004137499.1|  PREDICTED: thaumatin-like protein-like             126   5e-32   
ref|XP_011027593.1|  PREDICTED: thaumatin-like protein                  127   5e-32   
ref|XP_011012813.1|  PREDICTED: thaumatin-like protein                  127   5e-32   
emb|CAN59843.1|  hypothetical protein VITISV_030359                     125   6e-32   Vitis vinifera
gb|ABL86688.1|  TLP2                                                    124   6e-32   Gossypium barbadense [Egyptian cotton]
ref|NP_001031064.1|  Thaumatin-like protein                             125   7e-32   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173261.1|  Thaumatin-like protein                                125   7e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009360173.1|  PREDICTED: thaumatin-like protein                  125   7e-32   
ref|XP_009356044.1|  PREDICTED: thaumatin-like protein                  125   7e-32   
ref|XP_010459436.1|  PREDICTED: thaumatin-like protein                  125   8e-32   
ref|XP_004250343.2|  PREDICTED: pathogenesis-related protein 5          126   8e-32   
emb|CBI34998.3|  unnamed protein product                                124   9e-32   
gb|KEH40091.1|  pathogenesis-related thaumatin family protein           125   9e-32   
emb|CAB53479.1|  CAA30376.1 protein                                     131   9e-32   Oryza sativa [red rice]
ref|XP_004235810.1|  PREDICTED: thaumatin-like protein                  125   9e-32   
gb|ACH60847.1|  thaumatin-like protein                                  121   9e-32   Pseudotsuga menziesii
gb|ACH60838.1|  thaumatin-like protein                                  121   9e-32   Pseudotsuga menziesii
gb|ABR17407.1|  unknown                                                 125   1e-31   Picea sitchensis
gb|KHG18980.1|  hypothetical protein F383_08602                         125   1e-31   
ref|XP_004301252.1|  PREDICTED: thaumatin-like protein-like             125   1e-31   
ref|XP_006434928.1|  hypothetical protein CICLE_v10002288mg             125   1e-31   
ref|XP_010274714.1|  PREDICTED: thaumatin-like protein                  125   1e-31   
ref|XP_006473452.1|  PREDICTED: pathogenesis-related protein 5-like     125   1e-31   
ref|XP_006303313.1|  hypothetical protein CARUB_v10010135mg             125   1e-31   
gb|KHG08802.1|  hypothetical protein F383_35963                         124   1e-31   
ref|XP_002887494.1|  hypothetical protein ARALYDRAFT_476498             125   1e-31   
ref|XP_009387350.1|  PREDICTED: thaumatin-like protein 1                124   1e-31   
ref|XP_010672697.1|  PREDICTED: thaumatin-like protein                  125   1e-31   
ref|XP_006341532.1|  PREDICTED: thaumatin-like protein-like             125   1e-31   
ref|XP_009799009.1|  PREDICTED: pathogenesis-related protein 5-like     125   1e-31   
ref|XP_007209509.1|  hypothetical protein PRUPE_ppa010418mg             125   1e-31   
gb|ADV19265.1|  unknown                                                 122   2e-31   
ref|NP_001147654.1|  LOC100281263 precursor                             125   2e-31   Zea mays [maize]
ref|XP_008393422.1|  PREDICTED: thaumatin-like protein                  125   2e-31   
ref|XP_011075024.1|  PREDICTED: thaumatin-like protein                  125   2e-31   
ref|XP_010498212.1|  PREDICTED: thaumatin-like protein                  124   2e-31   
ref|XP_009104608.1|  PREDICTED: thaumatin-like protein                  125   2e-31   
emb|CDX68047.1|  BnaA07g20870D                                          125   2e-31   
ref|XP_008240157.1|  PREDICTED: thaumatin-like protein                  124   2e-31   
emb|CDX79230.1|  BnaC06g20730D                                          125   2e-31   
ref|NP_177893.1|  Pathogenesis-related thaumatin superfamily protein    126   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009598313.1|  PREDICTED: pathogenesis-related protein 5-like     125   2e-31   
ref|XP_002892990.1|  hypothetical protein ARALYDRAFT_889237             124   2e-31   
ref|XP_002273271.2|  PREDICTED: thaumatin-like protein                  125   2e-31   Vitis vinifera
ref|XP_008801393.1|  PREDICTED: pathogenesis-related protein 5-li...    125   3e-31   
ref|XP_006302686.1|  hypothetical protein CARUB_v10020795mg             124   3e-31   
ref|XP_010416173.1|  PREDICTED: thaumatin-like protein                  124   3e-31   
ref|XP_011083734.1|  PREDICTED: pathogenesis-related protein 5-like     124   3e-31   
emb|CDP12448.1|  unnamed protein product                                125   3e-31   
ref|XP_010091351.1|  hypothetical protein L484_020153                   125   3e-31   
ref|XP_007017454.1|  Thaumatin-like protein 3                           124   3e-31   
ref|XP_008801392.1|  PREDICTED: pathogenesis-related protein 5-li...    125   3e-31   
ref|NP_001058421.1|  Os06g0691200                                       124   3e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009417646.1|  PREDICTED: thaumatin-like protein                  124   4e-31   
ref|XP_003549422.2|  PREDICTED: pathogenesis-related protein 5-like     124   4e-31   
gb|AAM62907.1|  thaumatin-like protein                                  124   4e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008790236.1|  PREDICTED: pathogenesis-related protein 5          123   4e-31   
ref|XP_007027490.1|  Thaumatin-like protein 1a                          124   4e-31   
ref|XP_002322099.1|  hypothetical protein POPTR_0015s04510g             124   4e-31   Populus trichocarpa [western balsam poplar]
ref|XP_006390065.1|  hypothetical protein EUTSA_v10019646mg             124   4e-31   
ref|XP_003545289.2|  PREDICTED: pathogenesis-related protein 5-like     124   4e-31   
ref|XP_011074598.1|  PREDICTED: pathogenesis-related protein 5-like     124   4e-31   
gb|AIU34434.1|  thaumatin-like protein 5                                123   4e-31   
ref|XP_009785059.1|  PREDICTED: thaumatin-like protein isoform X2       123   5e-31   
ref|XP_009785058.1|  PREDICTED: thaumatin-like protein isoform X1       123   5e-31   
gb|KDP23919.1|  hypothetical protein JCGZ_27079                         123   5e-31   
ref|XP_004503284.1|  PREDICTED: thaumatin-like protein-like             123   5e-31   
ref|XP_009414066.1|  PREDICTED: thaumatin-like protein                  123   5e-31   
emb|CAJ86348.1|  H0814G11.15                                            123   5e-31   Oryza sativa [red rice]
gb|EYU24132.1|  hypothetical protein MIMGU_mgv1a012513mg                123   5e-31   
ref|XP_003631101.1|  Thaumatin-like protein                             123   6e-31   
emb|CDX96487.1|  BnaA07g30980D                                          123   6e-31   
ref|XP_007160787.1|  hypothetical protein PHAVU_001G016600g             123   6e-31   
ref|NP_001288837.1|  thaumatin-like protein precursor                   123   6e-31   
gb|AFK48181.1|  unknown                                                 123   6e-31   
ref|XP_004238367.1|  PREDICTED: pathogenesis-related protein 5          125   6e-31   
ref|NP_177503.1|  pathogenesis-related thaumatin-like protein           123   6e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011083577.1|  PREDICTED: thaumatin-like protein 1b               124   6e-31   
ref|XP_009128246.1|  PREDICTED: pathogenesis-related protein 5-like     124   7e-31   
ref|XP_002887695.1|  predicted protein                                  123   7e-31   
ref|XP_009596997.1|  PREDICTED: thaumatin-like protein                  123   7e-31   
emb|CDY44520.1|  BnaCnng11310D                                          124   8e-31   
ref|XP_003543788.1|  PREDICTED: pathogenesis-related protein 5-like     124   8e-31   
ref|XP_007160648.1|  hypothetical protein PHAVU_001G005000g             124   8e-31   
ref|XP_009630387.1|  PREDICTED: thaumatin-like protein 1b               124   8e-31   
emb|CDO98353.1|  unnamed protein product                                123   8e-31   
ref|XP_006390535.1|  hypothetical protein EUTSA_v10019050mg             122   8e-31   
ref|XP_011005199.1|  PREDICTED: pathogenesis-related protein 5-like     124   8e-31   
ref|XP_009106020.1|  PREDICTED: thaumatin-like protein isoform X2       123   8e-31   
ref|XP_008377347.1|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...    122   9e-31   
emb|CDX72995.1|  BnaC06g34430D                                          123   9e-31   
ref|XP_007160647.1|  hypothetical protein PHAVU_001G005000g             123   9e-31   
ref|XP_006342237.1|  PREDICTED: pathogenesis-related protein 5-like     124   9e-31   
ref|XP_010262463.1|  PREDICTED: thaumatin-like protein isoform X1       122   9e-31   
ref|XP_010262514.1|  PREDICTED: thaumatin-like protein isoform X2       122   1e-30   
ref|XP_008364687.1|  PREDICTED: LOW QUALITY PROTEIN: thaumatin-li...    122   1e-30   
ref|XP_002532822.1|  Protein P21, putative                              122   1e-30   Ricinus communis
ref|XP_008357219.1|  PREDICTED: pathogenesis-related protein 5-like     122   1e-30   
ref|XP_002467254.1|  hypothetical protein SORBIDRAFT_01g022110          123   1e-30   Sorghum bicolor [broomcorn]
gb|KDO80739.1|  hypothetical protein CISIN_1g023852mg                   123   1e-30   
ref|XP_006302655.1|  hypothetical protein CARUB_v10020759mg             123   1e-30   
emb|CAN70296.1|  hypothetical protein VITISV_007440                     122   1e-30   Vitis vinifera
ref|XP_003574984.1|  PREDICTED: pathogenesis-related protein 5-like     123   1e-30   
ref|XP_010471966.1|  PREDICTED: pathogenesis-related protein 5-like     123   1e-30   
ref|XP_006472729.1|  PREDICTED: thaumatin-like protein-like             123   1e-30   
ref|XP_006434136.1|  hypothetical protein CICLE_v10002069mg             123   1e-30   
ref|XP_010246990.1|  PREDICTED: pathogenesis-related protein 5          122   1e-30   
gb|ACU65941.1|  pathogenesis-related 5 protein                          122   1e-30   
ref|XP_011035010.1|  PREDICTED: thaumatin-like protein 1                124   1e-30   
ref|XP_011096945.1|  PREDICTED: thaumatin-like protein 1                124   1e-30   
ref|XP_010106041.1|  hypothetical protein L484_021218                   122   2e-30   
ref|XP_003614785.1|  Pathogenesis-related protein                       123   2e-30   
ref|XP_008444682.1|  PREDICTED: pathogenesis-related protein 5-like     122   2e-30   
ref|XP_002301969.2|  hypothetical protein POPTR_0002s02200g             123   2e-30   Populus trichocarpa [western balsam poplar]
ref|XP_002301968.2|  hypothetical protein POPTR_0002s02200g             123   2e-30   Populus trichocarpa [western balsam poplar]
ref|XP_008374844.1|  PREDICTED: thaumatin-like protein                  122   2e-30   
ref|XP_007222068.1|  hypothetical protein PRUPE_ppa009575mg             122   2e-30   
ref|XP_009391386.1|  PREDICTED: thaumatin-like protein                  122   2e-30   
ref|XP_002990777.1|  hypothetical protein SELMODRAFT_236128             122   2e-30   
ref|XP_010428854.1|  PREDICTED: thaumatin-like protein                  122   2e-30   
dbj|BAA95017.1|  thaumatin-like protein                                 120   2e-30   Cestrum elegans
gb|KGN62571.1|  hypothetical protein Csa_2G361370                       122   2e-30   
ref|XP_008233902.1|  PREDICTED: pathogenesis-related protein 5          122   2e-30   
ref|XP_004499121.1|  PREDICTED: pathogenesis-related protein 5-like     122   2e-30   
ref|XP_010416727.1|  PREDICTED: pathogenesis-related protein 5-like     122   2e-30   
gb|KHG17165.1|  hypothetical protein F383_22419                         121   2e-30   
ref|NP_001268088.1|  SCUTL2 precursor                                   121   2e-30   
gb|EYU23904.1|  hypothetical protein MIMGU_mgv1a011450mg                122   2e-30   
ref|XP_008466475.1|  PREDICTED: thaumatin-like protein 1                123   2e-30   
ref|XP_010678327.1|  PREDICTED: pathogenesis-related protein 5-like     121   2e-30   
ref|XP_007036794.1|  Pathogenesis-related thaumatin superfamily p...    122   2e-30   
ref|NP_001288814.1|  thaumatin-like protein precursor                   121   2e-30   
ref|XP_007141088.1|  hypothetical protein PHAVU_008G166500g             122   3e-30   
gb|KFK41805.1|  hypothetical protein AALP_AA2G174200                    121   3e-30   
ref|XP_002447372.1|  hypothetical protein SORBIDRAFT_06g033910          122   3e-30   Sorghum bicolor [broomcorn]
ref|XP_006653913.1|  PREDICTED: pathogenesis-related protein 5-like     122   3e-30   
gb|KHG03900.1|  hypothetical protein F383_27474                         121   3e-30   
ref|XP_011031355.1|  PREDICTED: pathogenesis-related protein 5          121   3e-30   
ref|XP_010428288.1|  PREDICTED: thaumatin-like protein                  121   3e-30   
ref|XP_009412932.1|  PREDICTED: thaumatin-like protein 1b               122   3e-30   
ref|XP_009365665.1|  PREDICTED: pathogenesis-related protein 5-like     121   3e-30   
ref|XP_009778054.1|  PREDICTED: pathogenesis-related protein 5-like     121   3e-30   
ref|XP_004513301.1|  PREDICTED: pathogenesis-related protein 5-like     122   3e-30   
emb|CDY19198.1|  BnaC05g13990D                                          121   3e-30   
gb|EEC78305.1|  hypothetical protein OsI_18027                          122   3e-30   Oryza sativa Indica Group [Indian rice]
ref|NP_001054348.1|  Os04g0689900                                       122   3e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008364957.1|  PREDICTED: pathogenesis-related protein 5-like     121   3e-30   
ref|XP_010471424.1|  PREDICTED: thaumatin-like protein                  121   3e-30   
ref|XP_010063355.1|  PREDICTED: pathogenesis-related protein 5          122   3e-30   
ref|XP_009767579.1|  PREDICTED: pathogenesis-related protein 5-like     122   3e-30   
ref|XP_006347468.1|  PREDICTED: pathogenesis-related protein 5-like     122   4e-30   
ref|XP_010531575.1|  PREDICTED: pathogenesis-related protein 5          120   4e-30   
ref|XP_004152784.1|  PREDICTED: pathogenesis-related protein 5-like     121   4e-30   
ref|XP_009393838.1|  PREDICTED: thaumatin-like protein 1b               122   4e-30   
emb|CDY26178.1|  BnaA06g12390D                                          120   4e-30   
gb|KCW56621.1|  hypothetical protein EUGRSUZ_I02339                     122   4e-30   
ref|XP_010029672.1|  PREDICTED: thaumatin-like protein 1                122   4e-30   
ref|XP_011084258.1|  PREDICTED: thaumatin-like protein                  121   4e-30   
ref|XP_009760388.1|  PREDICTED: pathogenesis-related protein 5-like     120   5e-30   
gb|EAY78456.1|  hypothetical protein OsI_33545                          121   5e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_002991832.1|  hypothetical protein SELMODRAFT_430120             122   5e-30   
ref|XP_006375059.1|  hypothetical protein POPTR_0014s04020g             120   5e-30   
ref|XP_004241432.1|  PREDICTED: pathogenesis-related protein 5          122   5e-30   
ref|XP_009591540.1|  PREDICTED: pathogenesis-related protein 5          122   6e-30   
ref|XP_002510340.1|  Zeamatin precursor, putative                       120   6e-30   Ricinus communis
ref|XP_006596544.1|  PREDICTED: thaumatin-like protein 1-like           122   6e-30   
ref|XP_011039126.1|  PREDICTED: thaumatin-like protein                  121   6e-30   
ref|XP_011045068.1|  PREDICTED: thaumatin-like protein 1b               122   6e-30   
gb|ACH60860.1|  thaumatin-like protein                                  117   7e-30   Pseudotsuga macrocarpa
ref|XP_010539926.1|  PREDICTED: pathogenesis-related protein 5-like     120   7e-30   
ref|XP_010274354.1|  PREDICTED: pathogenesis-related protein 5-like     121   8e-30   
ref|XP_002317878.2|  hypothetical protein POPTR_0012s04520g             121   8e-30   Populus trichocarpa [western balsam poplar]
ref|XP_010254957.1|  PREDICTED: pathogenesis-related protein 5          120   8e-30   
ref|XP_006826851.1|  hypothetical protein AMTR_s00010p00113630          120   8e-30   
ref|XP_009595245.1|  PREDICTED: pathogenesis-related protein 5          120   8e-30   
ref|XP_006369356.1|  hypothetical protein POPTR_0001s21790g             121   9e-30   
ref|XP_003549464.1|  PREDICTED: thaumatin-like protein 1-like           121   9e-30   
ref|XP_004292680.1|  PREDICTED: thaumatin-like protein-like             120   1e-29   
gb|KFK33653.1|  hypothetical protein AALP_AA5G041900                    120   1e-29   
ref|XP_010109991.1|  hypothetical protein L484_021879                   122   1e-29   
ref|XP_010026231.1|  PREDICTED: pathogenesis-related protein 5          120   1e-29   
gb|EAZ03619.1|  hypothetical protein OsI_25757                          120   1e-29   
ref|XP_009364361.1|  PREDICTED: pathogenesis-related protein 5-like     119   1e-29   
ref|XP_010090318.1|  hypothetical protein L484_024983                   121   1e-29   
ref|XP_010936134.1|  PREDICTED: pathogenesis-related protein 5          120   2e-29   
gb|KFK42166.1|  hypothetical protein AALP_AA2G219700                    120   2e-29   
gb|KDP38462.1|  hypothetical protein JCGZ_04387                         119   2e-29   
ref|XP_010912035.1|  PREDICTED: pathogenesis-related protein 5          120   2e-29   
emb|CDO97536.1|  unnamed protein product                                119   2e-29   
ref|XP_009411358.1|  PREDICTED: thaumatin-like protein 1                119   2e-29   
emb|CAN80000.1|  hypothetical protein VITISV_043971                     123   2e-29   
emb|CDP04967.1|  unnamed protein product                                120   2e-29   
ref|XP_006851913.1|  hypothetical protein AMTR_s00041p00163280          120   3e-29   
ref|NP_001175160.1|  Os07g0417600                                       119   3e-29   
ref|XP_002306940.2|  hypothetical protein POPTR_0005s26250g             120   3e-29   
ref|XP_009629786.1|  PREDICTED: thaumatin-like protein 1b               120   3e-29   
ref|XP_010933320.1|  PREDICTED: thaumatin-like protein 1b               120   3e-29   
ref|XP_010521235.1|  PREDICTED: thaumatin-like protein                  120   3e-29   
ref|XP_006359673.1|  PREDICTED: thaumatin-like protein 1-like           120   3e-29   
ref|XP_007224286.1|  hypothetical protein PRUPE_ppa019465mg             120   4e-29   
gb|EYU38797.1|  hypothetical protein MIMGU_mgv1a010302mg                120   4e-29   
ref|XP_009772169.1|  PREDICTED: thaumatin-like protein 1                120   4e-29   
ref|XP_010679923.1|  PREDICTED: thaumatin-like protein 1b               120   4e-29   
ref|XP_004973784.1|  PREDICTED: thaumatin-like protein-like             119   4e-29   
emb|CDP07386.1|  unnamed protein product                                119   4e-29   
ref|XP_002306938.2|  pathogenesis-related thaumatin family protein      119   4e-29   
ref|XP_006349009.1|  PREDICTED: osmotin-like protein-like               118   5e-29   
gb|KFK41944.1|  hypothetical protein AALP_AA2G192400                    118   5e-29   
ref|XP_010272861.1|  PREDICTED: pathogenesis-related protein 5          119   5e-29   
ref|XP_004136377.1|  PREDICTED: thaumatin-like protein 1-like           119   5e-29   
gb|EPS57386.1|  zeamatin                                                118   6e-29   
gb|EPS57841.1|  hypothetical protein M569_16976                         119   6e-29   
gb|AAV64224.1|  hypothetical protein C9002                              119   6e-29   
ref|XP_008352662.1|  PREDICTED: pathogenesis-related protein 5-like     118   6e-29   
ref|XP_010477000.1|  PREDICTED: thaumatin-like protein                  117   6e-29   
ref|XP_006390358.1|  hypothetical protein EUTSA_v10019046mg             118   6e-29   
ref|XP_007163959.1|  hypothetical protein PHAVU_L002100g                118   7e-29   
ref|XP_008221246.1|  PREDICTED: thaumatin-like protein 1b               117   7e-29   
ref|XP_006466956.1|  PREDICTED: thaumatin-like protein 1-like           119   8e-29   
ref|XP_006850900.1|  hypothetical protein AMTR_s00025p00166890          118   8e-29   
ref|XP_002533803.1|  Protein P21, putative                              118   8e-29   
ref|XP_008361553.1|  PREDICTED: pathogenesis-related protein 5-like     119   8e-29   
ref|XP_008377134.1|  PREDICTED: thaumatin-like protein 1b               119   8e-29   
ref|XP_006425450.1|  hypothetical protein CICLE_v10026181mg             118   8e-29   
dbj|BAK02018.1|  predicted protein                                      117   9e-29   
gb|KEH34729.1|  pathogenesis-related thaumatin family protein           117   9e-29   
ref|XP_008785871.1|  PREDICTED: pathogenesis-related protein 5          118   9e-29   
ref|XP_008778758.1|  PREDICTED: thaumatin-like protein 1b               117   1e-28   
ref|XP_004287804.1|  PREDICTED: thaumatin-like protein 1-like           119   1e-28   
emb|CDY30840.1|  BnaC04g26950D                                          113   1e-28   
ref|XP_004231024.1|  PREDICTED: thaumatin-like protein 1                119   1e-28   
ref|XP_009341686.1|  PREDICTED: thaumatin-like protein                  117   1e-28   
ref|XP_009414593.1|  PREDICTED: pathogenesis-related protein 5-like     118   1e-28   
gb|KDP46765.1|  hypothetical protein JCGZ_06553                         118   1e-28   
ref|XP_010933190.1|  PREDICTED: thaumatin-like protein 1b               117   1e-28   
ref|XP_003544148.2|  PREDICTED: pathogenesis-related protein 5-like     118   1e-28   
ref|XP_010556520.1|  PREDICTED: thaumatin-like protein 1                117   1e-28   
gb|KHN34468.1|  Pathogenesis-related protein 5                          118   1e-28   
ref|XP_010928530.1|  PREDICTED: pathogenesis-related protein 5-like     116   1e-28   
ref|XP_010539098.1|  PREDICTED: thaumatin-like protein 1b               118   1e-28   
gb|AEV57470.1|  thaumatin-like protein 1                                117   1e-28   
ref|XP_011045069.1|  PREDICTED: thaumatin-like protein 1b               118   1e-28   
ref|XP_006383094.1|  hypothetical protein POPTR_0005s11490g             118   1e-28   
ref|XP_004293225.1|  PREDICTED: pathogenesis-related protein 5-like     117   1e-28   
ref|XP_004238220.1|  PREDICTED: pathogenesis-related protein 5          117   1e-28   
ref|XP_010690395.1|  PREDICTED: thaumatin-like protein 1                119   2e-28   
ref|XP_003563464.1|  PREDICTED: thaumatin-like protein                  117   2e-28   
ref|XP_004966180.1|  PREDICTED: thaumatin-like protein-like             117   2e-28   
gb|ACT52847.1|  thaumatin family protein                                114   2e-28   
ref|XP_004505780.1|  PREDICTED: thaumatin-like protein 1-like           118   2e-28   
ref|XP_007027491.1|  Thaumatin-like protein 1a                          116   2e-28   
ref|XP_002962330.1|  hypothetical protein SELMODRAFT_404034             116   2e-28   
emb|CDO96933.1|  unnamed protein product                                118   2e-28   
ref|XP_002962947.1|  hypothetical protein SELMODRAFT_404385             116   2e-28   
gb|KDP36910.1|  hypothetical protein JCGZ_08201                         118   2e-28   
ref|XP_011083579.1|  PREDICTED: thaumatin-like protein 1                117   2e-28   
ref|XP_008221247.1|  PREDICTED: thaumatin-like protein 1                118   2e-28   
ref|XP_006366466.1|  PREDICTED: pathogenesis-related protein 5-like     116   2e-28   
ref|XP_008457671.1|  PREDICTED: thaumatin-like protein 1b isoform X2    117   2e-28   
ref|XP_008457670.1|  PREDICTED: thaumatin-like protein 1b isoform X1    117   2e-28   
ref|XP_007131695.1|  hypothetical protein PHAVU_011G0342001g            116   2e-28   
ref|XP_011043181.1|  PREDICTED: thaumatin-like protein 1b               117   2e-28   
ref|XP_009622122.1|  PREDICTED: thaumatin-like protein 1                118   2e-28   
ref|XP_004171339.1|  PREDICTED: thaumatin-like protein 1-like           116   2e-28   
ref|XP_002510548.1|  Zeamatin precursor, putative                       117   3e-28   
ref|XP_002301966.2|  hypothetical protein POPTR_0002s02190g             117   3e-28   
ref|XP_008788616.1|  PREDICTED: thaumatin-like protein 1b               117   3e-28   
ref|XP_004517306.1|  PREDICTED: thaumatin-like protein 1a-like          116   3e-28   
gb|EYU45112.1|  hypothetical protein MIMGU_mgv1a012469mg                116   3e-28   
gb|KEH42145.1|  allergen Pru protein, putative                          116   3e-28   
ref|XP_008224153.1|  PREDICTED: thaumatin-like protein 1                116   3e-28   
ref|XP_010069813.1|  PREDICTED: thaumatin-like protein 1b               117   3e-28   
gb|EYU26189.1|  hypothetical protein MIMGU_mgv1a023542mg                117   3e-28   
gb|EPS67898.1|  hypothetical protein M569_06877                         115   3e-28   
gb|EYU30411.1|  hypothetical protein MIMGU_mgv1a010348mg                117   3e-28   
ref|XP_002510549.1|  Zeamatin precursor, putative                       117   3e-28   
ref|XP_010471602.1|  PREDICTED: pathogenesis-related protein 5-like     116   3e-28   
ref|XP_010416362.1|  PREDICTED: pathogenesis-related protein 5-like     116   3e-28   
gb|KEH30510.1|  pathogenesis-related thaumatin family protein           117   3e-28   
ref|XP_002513184.1|  Zeamatin precursor, putative                       115   3e-28   
gb|KEH40232.1|  pathogenesis-related thaumatin family protein           116   4e-28   
ref|XP_008241910.1|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...    114   4e-28   
ref|XP_004147030.1|  PREDICTED: thaumatin-like protein 1-like           116   4e-28   
ref|XP_002633650.1|  C. briggsae CBR-THN-1 protein                      115   4e-28   
ref|XP_004170901.1|  PREDICTED: thaumatin-like protein 1-like           116   4e-28   
ref|XP_002887570.1|  hypothetical protein ARALYDRAFT_476641             115   4e-28   
ref|XP_009625711.1|  PREDICTED: thaumatin-like protein 1b               117   4e-28   
ref|XP_004512140.1|  PREDICTED: thaumatin-like protein 1-like           116   5e-28   
gb|EYU37936.1|  hypothetical protein MIMGU_mgv1a009447mg                117   5e-28   
ref|XP_004499280.1|  PREDICTED: thaumatin-like protein 1-like           117   5e-28   
ref|XP_003589504.1|  Thaumatin-like protein                             117   5e-28   
ref|XP_009785286.1|  PREDICTED: thaumatin-like protein 1b               117   5e-28   
ref|XP_011075843.1|  PREDICTED: thaumatin-like protein 1                116   5e-28   
ref|XP_006590850.1|  PREDICTED: thaumatin-like protein 1-like iso...    117   5e-28   
ref|XP_006390357.1|  hypothetical protein EUTSA_v10019680mg             115   5e-28   
ref|XP_010555234.1|  PREDICTED: thaumatin-like protein 1b               117   5e-28   
ref|XP_010416364.1|  PREDICTED: pathogenesis-related protein 5-like     115   5e-28   
ref|XP_010920168.1|  PREDICTED: thaumatin-like protein 1b isoform X2    116   5e-28   
ref|XP_009391981.1|  PREDICTED: thaumatin-like protein 1b               116   6e-28   
ref|XP_004146145.1|  PREDICTED: thaumatin-like protein 1-like           115   6e-28   
ref|XP_009379396.1|  PREDICTED: thaumatin-like protein 1                116   6e-28   
ref|XP_002528602.1|  Protein P21, putative                              116   6e-28   
ref|XP_004488837.1|  PREDICTED: thaumatin-like protein 1-like           115   6e-28   
ref|XP_003100784.1|  hypothetical protein CRE_15516                     115   6e-28   
ref|XP_008457672.1|  PREDICTED: thaumatin-like protein 1b               117   6e-28   
ref|XP_010471604.1|  PREDICTED: pathogenesis-related protein 5-like     115   6e-28   
ref|XP_006851914.1|  hypothetical protein AMTR_s00041p00164900          115   6e-28   
gb|KDO84883.1|  hypothetical protein CISIN_1g026056mg                   115   6e-28   
ref|XP_011088584.1|  PREDICTED: thaumatin-like protein 1b               117   6e-28   
ref|XP_009358005.1|  PREDICTED: thaumatin-like protein 1b               115   6e-28   
ref|XP_004169877.1|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...    117   6e-28   
ref|XP_003100717.1|  hypothetical protein CRE_15517                     115   6e-28   
gb|AIU34433.1|  thaumatin-like protein 2                                115   6e-28   
ref|XP_004231023.1|  PREDICTED: thaumatin-like protein 1b               115   7e-28   
ref|NP_502362.1|  Protein THN-2                                         115   7e-28   
ref|XP_008218810.1|  PREDICTED: thaumatin-like protein                  115   7e-28   
ref|XP_003089190.1|  hypothetical protein CRE_18333                     115   7e-28   
ref|XP_004957480.1|  PREDICTED: thaumatin-like protein 1-like           116   7e-28   
ref|XP_010531542.1|  PREDICTED: thaumatin-like protein 1b               116   7e-28   
gb|KEH19055.1|  pathogenesis-related thaumatin family protein           115   7e-28   
ref|XP_003628396.1|  Thaumatin-like protein                             115   7e-28   
gb|EEE50571.1|  hypothetical protein OsJ_30720                          116   7e-28   
ref|XP_004147029.1|  PREDICTED: pathogenesis-related protein 5-like     117   7e-28   
ref|XP_007159594.1|  hypothetical protein PHAVU_002G250400g             115   7e-28   
gb|KDP46766.1|  hypothetical protein JCGZ_06554                         116   7e-28   
ref|NP_001234714.1|  osmotin-like protein precursor                     115   7e-28   
ref|XP_002303159.2|  hypothetical protein POPTR_0003s01430g             116   8e-28   
gb|AIR93918.1|  thaumatin                                               116   8e-28   
ref|XP_003540838.1|  PREDICTED: thaumatin-like protein 1-like           116   8e-28   
gb|ACE80962.1|  putative allergen Pru du 2.04                           116   9e-28   
ref|XP_007222615.1|  hypothetical protein PRUPE_ppa008483mg             116   9e-28   
ref|XP_003615487.1|  Thaumatin-like protein                             117   9e-28   
emb|CDP07730.1|  unnamed protein product                                114   9e-28   
ref|XP_006359672.1|  PREDICTED: thaumatin-like protein 1-like           115   9e-28   
ref|XP_007202291.1|  hypothetical protein PRUPE_ppa009119mg             116   9e-28   
gb|EYU38795.1|  hypothetical protein MIMGU_mgv1a010603mg                116   9e-28   
ref|XP_008378490.1|  PREDICTED: pathogenesis-related protein 5-like     115   9e-28   
gb|ACE80963.1|  putative allergen Pru p 2.04                            116   9e-28   
ref|XP_006304859.1|  hypothetical protein CARUB_v10012596mg             114   9e-28   
ref|XP_011092890.1|  PREDICTED: thaumatin-like protein 1b               116   9e-28   
ref|XP_009367296.1|  PREDICTED: pathogenesis-related protein 5-like     115   9e-28   
ref|XP_008347349.1|  PREDICTED: thaumatin-like protein 1b               115   1e-27   
ref|XP_009400987.1|  PREDICTED: thaumatin-like protein 1b               114   1e-27   
ref|XP_004490542.1|  PREDICTED: pathogenesis-related protein 5-li...    116   1e-27   
emb|CDY24827.1|  BnaA08g14830D                                          115   1e-27   
ref|XP_004292943.1|  PREDICTED: pathogenesis-related protein 5-like     116   1e-27   
ref|XP_008440825.1|  PREDICTED: thaumatin-like protein 1b               115   1e-27   
emb|CDY68760.1|  BnaAnng28270D                                          114   1e-27   
ref|XP_009363485.1|  PREDICTED: thaumatin-like protein 1                116   1e-27   
ref|XP_009334939.1|  PREDICTED: thaumatin-like protein 1b               116   1e-27   
ref|XP_009109259.1|  PREDICTED: thaumatin-like protein 1b               115   1e-27   
emb|CDY62047.1|  BnaC03g76850D                                          115   1e-27   
ref|XP_002321939.2|  hypothetical protein POPTR_0015s00310g             115   1e-27   
gb|EGT40057.1|  hypothetical protein CAEBREN_14297                      114   1e-27   
ref|XP_009419984.1|  PREDICTED: pathogenesis-related protein 5-like     115   1e-27   
ref|XP_010920167.1|  PREDICTED: thaumatin-like protein 1b isoform X1    115   1e-27   
ref|XP_008387927.1|  PREDICTED: thaumatin-like protein 1b               116   1e-27   
gb|KHG02948.1|  Thaumatin-like protein 1                                115   1e-27   
ref|XP_007226798.1|  hypothetical protein PRUPE_ppa018160mg             115   1e-27   
ref|NP_502360.1|  Protein THN-1                                         114   1e-27   
ref|XP_007223736.1|  hypothetical protein PRUPE_ppa010458mg             114   1e-27   
gb|EGT46642.1|  hypothetical protein CAEBREN_16826                      114   1e-27   
ref|XP_002264550.2|  PREDICTED: pathogenesis-related protein 5-like     114   1e-27   
ref|XP_008444818.1|  PREDICTED: thaumatin-like protein 1b               114   1e-27   
ref|XP_007027494.1|  Thaumatin-like protein 1a                          114   1e-27   
gb|KHG07208.1|  hypothetical protein F383_34305                         115   1e-27   
ref|XP_009148123.1|  PREDICTED: thaumatin-like protein 1b isoform X1    115   1e-27   
ref|XP_004512141.1|  PREDICTED: thaumatin-like protein 1-like           115   1e-27   
ref|XP_010056278.1|  PREDICTED: thaumatin-like protein 1                114   1e-27   
ref|XP_006435194.1|  hypothetical protein CICLE_v10001948mg             115   1e-27   
ref|XP_006473672.1|  PREDICTED: thaumatin-like protein 1-like           115   1e-27   
ref|XP_010428504.1|  PREDICTED: pathogenesis-related protein 5          114   1e-27   
ref|XP_004152646.1|  PREDICTED: thaumatin-like protein 1-like           115   1e-27   
ref|NP_177640.1|  thaumatin-like protein 3                              114   2e-27   
ref|XP_011035009.1|  PREDICTED: thaumatin-like protein                  115   2e-27   
gb|KHG27805.1|  Thaumatin-like protein 1a                               115   2e-27   
ref|XP_011007951.1|  PREDICTED: pathogenesis-related protein 5-like     115   2e-27   
gb|AAK63884.1|AC074105_13  Putative thaumatin-like protein              115   2e-27   
gb|KEH20376.1|  pathogenesis-related thaumatin family protein           114   2e-27   
ref|XP_008233674.1|  PREDICTED: thaumatin-like protein                  114   2e-27   
gb|KEH27589.1|  pathogenesis-related thaumatin family protein           114   2e-27   
ref|XP_010236582.1|  PREDICTED: LOW QUALITY PROTEIN: thaumatin-li...    115   2e-27   
gb|KEH42122.1|  allergen Pru protein, putative                          114   2e-27   
dbj|BAK00264.1|  predicted protein                                      114   2e-27   
ref|XP_006598662.1|  PREDICTED: thaumatin-like protein 1-like           114   2e-27   
ref|XP_008444817.1|  PREDICTED: thaumatin-like protein 1b               115   2e-27   
gb|KFK30232.1|  hypothetical protein AALP_AA7G234800                    114   2e-27   
ref|XP_006284201.1|  hypothetical protein CARUB_v10005355mg             115   2e-27   
ref|XP_004509366.1|  PREDICTED: pathogenesis-related protein 5-li...    114   2e-27   
ref|XP_010428509.1|  PREDICTED: pathogenesis-related protein 5          114   2e-27   
ref|XP_010056281.1|  PREDICTED: thaumatin-like protein 1 isoform X1     114   2e-27   
ref|XP_008788393.1|  PREDICTED: thaumatin-like protein 1b               115   2e-27   
gb|EYU45345.1|  hypothetical protein MIMGU_mgv1a011005mg                115   2e-27   
gb|AEX11058.1|  hypothetical protein 0_1213_01                          110   2e-27   
gb|KDP38887.1|  hypothetical protein JCGZ_05044                         114   2e-27   
ref|XP_010248229.1|  PREDICTED: pathogenesis-related protein 5-like     114   2e-27   
ref|XP_009104727.1|  PREDICTED: pathogenesis-related protein 5-like     114   2e-27   
ref|XP_010907999.1|  PREDICTED: thaumatin-like protein 1                113   2e-27   
ref|XP_002460577.1|  hypothetical protein SORBIDRAFT_02g031130          115   2e-27   
ref|XP_008372899.1|  PREDICTED: thaumatin-like protein 1b               115   2e-27   



>ref|XP_004233691.2| PREDICTED: thaumatin-like protein [Solanum lycopersicum]
Length=270

 Score =   189 bits (481),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLPVSV + PSS+KC I GC K++++ CP ELQVVN  G VVACKSACLAF
Sbjct  139  YDVSLVDGYNLPVSVTNKPSSTKCLIRGCTKNLKDTCPPELQVVNDGGQVVACKSACLAF  198

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N DSFCCRN+YGSP+KCKPS+YS +FKNACPSYVSYAFD PSP++SCSSD++  TFCP+ 
Sbjct  199  NLDSFCCRNKYGSPEKCKPSVYSSLFKNACPSYVSYAFDTPSPVLSCSSDQFIITFCPDK  258

Query  173  F  171
            +
Sbjct  259  W  259



>ref|XP_006338784.1| PREDICTED: thaumatin-like protein-like [Solanum tuberosum]
Length=266

 Score =   188 bits (477),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLPVSV + PSSSKC I GC ++M++ CP ELQVVN  G VVACKSACLAF
Sbjct  139  YDVSLVDGYNLPVSVTNKPSSSKCLIRGCTQNMKDTCPTELQVVNDEGQVVACKSACLAF  198

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N DSFCCRN+YGSP+KCKPS+YS +FK ACPSYVSYAFD PSP+VSCSSD+   TFCP+ 
Sbjct  199  NLDSFCCRNKYGSPEKCKPSVYSSLFKKACPSYVSYAFDTPSPVVSCSSDQSVITFCPDK  258

Query  173  F  171
            +
Sbjct  259  W  259



>gb|EYU34121.1| hypothetical protein MIMGU_mgv1a022628mg, partial [Erythranthe 
guttata]
Length=243

 Score =   183 bits (465),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 106/123 (86%), Gaps = 2/123 (2%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVA--SIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACL  360
            YDVSLVDGYNLPV V+  S  + SKC+IGGC  +++ ACPAELQVVNG G++VACKSACL
Sbjct  112  YDVSLVDGYNLPVHVSPRSPAAESKCHIGGCSGNLKAACPAELQVVNGRGEIVACKSACL  171

Query  359  AFNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            AFN DSFCCRN+YG+P+KC+PS+YSKMFK+ACPSY SYAFD P P+V+C++D+Y  TFCP
Sbjct  172  AFNLDSFCCRNEYGTPEKCRPSVYSKMFKDACPSYFSYAFDAPPPLVNCAADEYVITFCP  231

Query  179  ENF  171
            E +
Sbjct  232  EKW  234



>ref|XP_009620637.1| PREDICTED: thaumatin-like protein [Nicotiana tomentosiformis]
Length=263

 Score =   183 bits (465),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLPVSV S PS+SKC IG C +++   CP+ELQV+N  G VVACKSACLAF
Sbjct  135  YDVSLVDGYNLPVSVTSKPSASKCVIGSCSRNLNAMCPSELQVINDEGQVVACKSACLAF  194

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N DSFCCRN+YGSPDKCKPS+YS +FK +CPSYV+YAFD PSP+V CSSD++  TFCP+ 
Sbjct  195  NLDSFCCRNKYGSPDKCKPSVYSSLFKKSCPSYVTYAFDTPSPVVGCSSDQFVITFCPDK  254

Query  173  F  171
            +
Sbjct  255  W  255



>gb|ABK95807.1| unknown [Populus trichocarpa]
Length=260

 Score =   181 bits (458),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLPVSV +   SSKC IGGC K+++N+CP ELQV+N NG++VACKSACLAF
Sbjct  133  YDVSLVDGYNLPVSVTTKQISSKCTIGGCSKNLKNSCPMELQVLNKNGEIVACKSACLAF  192

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N DSFCC N+YGSP+KCKPS+YSKMFK+ACP Y SYAFD P+P+V+C+S +Y  TFCP +
Sbjct  193  NLDSFCCSNEYGSPEKCKPSVYSKMFKDACPYYYSYAFDSPAPLVNCASKEYIVTFCPSS  252

Query  173  F  171
            +
Sbjct  253  W  253



>ref|XP_002323818.2| hypothetical protein POPTR_0017s11190g [Populus trichocarpa]
 gb|EEF03951.2| hypothetical protein POPTR_0017s11190g [Populus trichocarpa]
Length=260

 Score =   181 bits (458),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLPVSV +   SSKC IGGC K+++N+CP ELQV+N NG++VACKSACLAF
Sbjct  133  YDVSLVDGYNLPVSVTTKQISSKCTIGGCSKNLKNSCPMELQVLNKNGEIVACKSACLAF  192

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N DSFCC N+YGSP+KCKPS+YSKMFK+ACP Y SYAFD P+P+V+C+S +Y  TFCP +
Sbjct  193  NLDSFCCSNEYGSPEKCKPSVYSKMFKDACPYYYSYAFDSPAPLVNCASKEYIVTFCPSS  252

Query  173  F  171
            +
Sbjct  253  W  253



>ref|XP_011098559.1| PREDICTED: pathogenesis-related protein 5 [Sesamum indicum]
Length=260

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLPV V +  S +KC IGGC K ++  CP ELQV+NG G++VACKSACLAF
Sbjct  133  YDVSLVDGYNLPVHVWTKASDTKCQIGGCSKDLKATCPTELQVLNGQGEIVACKSACLAF  192

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N DSFCCRN YGSP+KCKPS+YS++FK+ACPSY SYAF  P P+ SC+SD+Y  TFCPE 
Sbjct  193  NLDSFCCRNAYGSPEKCKPSVYSQLFKDACPSYFSYAFQTPPPLASCASDEYVITFCPER  252

Query  173  F  171
            +
Sbjct  253  W  253



>ref|XP_011008365.1| PREDICTED: thaumatin-like protein [Populus euphratica]
Length=260

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLPVSV +   SSKC IGGC K+++N+CP ELQV N NG++VACKSACLAF
Sbjct  133  YDVSLVDGYNLPVSVTTKQISSKCTIGGCSKNLKNSCPMELQVHNKNGEIVACKSACLAF  192

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N DSFCC N+YGSP+KCKPS+YSKMFK+ACP Y SYAFD P+P+V+C+S +Y  TFCP +
Sbjct  193  NLDSFCCSNEYGSPEKCKPSVYSKMFKDACPYYYSYAFDSPAPLVNCASKEYIVTFCPSS  252

Query  173  F  171
            +
Sbjct  253  W  253



>ref|XP_009775802.1| PREDICTED: thaumatin-like protein [Nicotiana sylvestris]
Length=262

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLPVS+ S PS+SKC I  C +++   CP ELQV+N  G VVACKSACLAF
Sbjct  135  YDVSLVDGYNLPVSITSKPSASKCVITSCSRNLNAMCPPELQVINDEGQVVACKSACLAF  194

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N DSFCCRN+YGSPDKCKPS+YS +FK +CPSYV+YAFD PSP+V CSSD++  TFCP+ 
Sbjct  195  NLDSFCCRNKYGSPDKCKPSVYSSLFKKSCPSYVTYAFDTPSPVVGCSSDQFVITFCPDQ  254

Query  173  F  171
            +
Sbjct  255  W  255



>ref|XP_010660983.1| PREDICTED: thaumatin-like protein [Vitis vinifera]
Length=259

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLPVSV + P +SKC IGGC+ +M + CP ELQV++ N +VVACKSACLAF
Sbjct  132  YDVSLVDGYNLPVSVTTKPRASKCSIGGCLTNMNSLCPQELQVLSNNMEVVACKSACLAF  191

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N D FCCRN+YG+P+KCKPS+YSKMFK ACPSY SYAFD P+P+V+C S +Y  TFCP N
Sbjct  192  NLDMFCCRNEYGTPEKCKPSVYSKMFKGACPSYYSYAFDTPAPLVNCPSKEYIITFCPSN  251

Query  173  F  171
            +
Sbjct  252  W  252



>ref|XP_007032343.1| Pathogenesis-related thaumatin superfamily protein [Theobroma 
cacao]
 gb|EOY03269.1| Pathogenesis-related thaumatin superfamily protein [Theobroma 
cacao]
Length=254

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLPVSVA+ PS  KC IG C K++ N CP EL+ +N NG+VVACKSACLAF
Sbjct  127  YDVSLVDGYNLPVSVATRPSLPKCTIGSCPKNLNNLCPPELEALNRNGEVVACKSACLAF  186

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            N DSFCCRN+YG+P+KCKPS+YSKMFK+ACPSY SYAFD P P+V+C+S +Y  TFCP
Sbjct  187  NLDSFCCRNEYGTPEKCKPSVYSKMFKDACPSYYSYAFDMPPPLVNCASKEYVITFCP  244



>gb|KDP45445.1| hypothetical protein JCGZ_09694 [Jatropha curcas]
Length=261

 Score =   176 bits (445),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYN+P+S+ S P SSKC IGGC K++ + CP ELQV+N NG+++ACKSACLAF
Sbjct  133  YDVSLVDGYNIPISITSRPLSSKCTIGGCSKNLNSLCPHELQVINNNGEIIACKSACLAF  192

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N DSFCCRN++GSP+KCKP++YS +FK ACP+Y SYAFD P P+V+C+S +Y  TFCP +
Sbjct  193  NLDSFCCRNEFGSPEKCKPNVYSNVFKKACPNYYSYAFDSPPPLVNCASKEYVITFCPSS  252

Query  173  F  171
            +
Sbjct  253  W  253



>ref|XP_010029259.1| PREDICTED: thaumatin-like protein [Eucalyptus grandis]
 gb|KCW56146.1| hypothetical protein EUGRSUZ_I01898 [Eucalyptus grandis]
Length=268

 Score =   175 bits (443),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YD+SLVDGYN+P+SV S P+  KC I GC K++ + CPAELQVVNG G VVACKSACLAF
Sbjct  133  YDISLVDGYNIPISVESKPAWPKCGIPGCSKNLNDVCPAELQVVNGEGKVVACKSACLAF  192

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            NAD FCCRNQYG+P+KCKPS+YS +FK+ACP Y SYA+D P+P+VSC+S  Y  TFCP  
Sbjct  193  NADKFCCRNQYGTPEKCKPSVYSWIFKDACPCYYSYAYDSPAPLVSCASKDYVITFCPST  252

Query  173  F  171
            +
Sbjct  253  W  253



>ref|XP_004302370.1| PREDICTED: thaumatin-like protein-like [Fragaria vesca subsp. 
vesca]
Length=259

 Score =   174 bits (441),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLP+SV   P +S C I GC++ ++  CP ELQV+N  G+VVACKSACLAF
Sbjct  132  YDVSLVDGYNLPISVMLRPVASNCSISGCLRDLKTRCPEELQVLNSKGEVVACKSACLAF  191

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N DSFCCRNQYG+P+KCKPS+YSK+FK+ACPSY SYA+D P P+V+C +++Y  TFCP  
Sbjct  192  NKDSFCCRNQYGTPEKCKPSVYSKIFKDACPSYYSYAYDSPPPLVNCKANEYVITFCPSG  251

Query  173  F  171
            +
Sbjct  252  W  252



>ref|XP_007215905.1| hypothetical protein PRUPE_ppa010781mg [Prunus persica]
 gb|EMJ17104.1| hypothetical protein PRUPE_ppa010781mg [Prunus persica]
Length=236

 Score =   172 bits (437),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLPV+V S P +S C IGGC+K++++ CP EL+V+N  G+VVACKSACLAF
Sbjct  108  YDVSLVDGYNLPVAVLSKPVASNCGIGGCLKNLKSWCPEELKVLNSKGEVVACKSACLAF  167

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N D FCCRN+YG+P KCKPS+YSK+FK+ACPSY SYA+D P P+V+C S +Y  TFCP  
Sbjct  168  NTDPFCCRNEYGTPAKCKPSVYSKIFKDACPSYYSYAYDSPPPLVTCKSSEYVITFCPSG  227

Query  173  F  171
            +
Sbjct  228  W  228



>ref|XP_002517440.1| Protein P21, putative [Ricinus communis]
 gb|EEF44982.1| Protein P21, putative [Ricinus communis]
Length=261

 Score =   172 bits (437),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLPV V +   S KC IGGC KS+  +CP ELQVVN NG+VVACKSACLAF
Sbjct  132  YDVSLVDGYNLPVLVTNKQLSPKCTIGGCSKSLIRSCPHELQVVNNNGEVVACKSACLAF  191

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N D+FCCRN +GSPDKCKP++YS +FK+ACP+Y SYAFD P P+V+C+S +Y  TFCP +
Sbjct  192  NLDTFCCRNDHGSPDKCKPNVYSNIFKDACPNYYSYAFDSPPPLVNCASKEYVITFCPSS  251

Query  173  F  171
            +
Sbjct  252  W  252



>ref|XP_008230703.1| PREDICTED: thaumatin-like protein [Prunus mume]
Length=260

 Score =   172 bits (437),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLPV+V S P +S C IGGC+K++++ CP EL+V+N  G+VVACKSACLAF
Sbjct  132  YDVSLVDGYNLPVAVLSKPVASNCGIGGCLKNLKSWCPEELKVLNSKGEVVACKSACLAF  191

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N D FCCRN+YG+P KCKPS+YSK+FK+ACPSY SYA+D P P+V+C S +Y  TFCP  
Sbjct  192  NTDPFCCRNEYGTPAKCKPSVYSKIFKDACPSYYSYAYDSPPPLVTCKSSEYVITFCPSG  251

Query  173  F  171
            +
Sbjct  252  W  252



>gb|KHG15061.1| hypothetical protein F383_19667 [Gossypium arboreum]
Length=253

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLPVSV + P S KC IG C K+  N CP E+QVVN NG+VVACKSACLAF
Sbjct  126  YDVSLVDGYNLPVSVTTRPFSPKCTIGSCSKNPNNFCPQEVQVVNKNGEVVACKSACLAF  185

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            + DSFCCRN++G+P+KCKPS+YSKMFK+ACPSY SYAFD P P+V+C+S  Y   FCP
Sbjct  186  DIDSFCCRNEFGTPEKCKPSVYSKMFKDACPSYYSYAFDMPPPLVNCASKDYVIIFCP  243



>ref|XP_008803423.1| PREDICTED: thaumatin-like protein [Phoenix dactylifera]
Length=257

 Score =   171 bits (432),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVS+VDGYNLP+SV++ P+  KC+IGGC KS+ + CP ELQV++ +G ++ACKSACLAF
Sbjct  131  YDVSVVDGYNLPISVSTKPADRKCWIGGCTKSINSVCPPELQVLDQSGGIIACKSACLAF  190

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N D FCCRN YG P+KCK S+YSKMFK+ACPSY SYA+D PSP+V+C S  Y  TFCP  
Sbjct  191  NLDVFCCRNSYGKPEKCKASMYSKMFKDACPSYFSYAYDTPSPLVNCYSKDYVITFCPSK  250

Query  173  F  171
            +
Sbjct  251  W  251



>ref|XP_008365396.1| PREDICTED: thaumatin-like protein [Malus domestica]
Length=262

 Score =   170 bits (430),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVS+VDGYNLPV V S P +S C IGGC+K ++  CP EL+V+N  G+VVACKSACLAF
Sbjct  132  YDVSVVDGYNLPVVVLSNPVASNCTIGGCLKDLKTRCPKELKVLNKKGEVVACKSACLAF  191

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            N D++CCR +YG+P+KCKPS+YSK+FK+ACPSY SYA+D P P+V+C + KY  TFCP
Sbjct  192  NTDAYCCRKEYGTPEKCKPSVYSKLFKDACPSYYSYAYDTPPPLVTCKASKYVITFCP  249



>ref|XP_010909541.1| PREDICTED: thaumatin-like protein [Elaeis guineensis]
Length=261

 Score =   168 bits (426),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVS+VDGYNLP+SV+++P+  KC+IGGC KS+ + CP ELQV++ +G V+ACKSACLAF
Sbjct  135  YDVSVVDGYNLPISVSTMPADRKCWIGGCTKSINSVCPPELQVLDQSGGVIACKSACLAF  194

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            + D FCCRN YG P KCK S+YSKMFK+ACPSY SYA+D P P+V+C S  Y  TFCP  
Sbjct  195  DLDVFCCRNSYGKPQKCKASMYSKMFKDACPSYFSYAYDSPPPLVNCYSKDYVITFCPSK  254

Query  173  F  171
            +
Sbjct  255  W  255



>gb|AFK33451.1| unknown [Lotus japonicus]
Length=260

 Score =   167 bits (424),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVS+VDGYN+PVSV    ++ KC I GC+K ++  C  EL+V+N  G+VVACKSACLAF
Sbjct  131  YDVSIVDGYNIPVSVTPKITNPKCTIQGCLKDLKRCCLHELEVLNAKGEVVACKSACLAF  190

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            + D FCCRN+YGSP+KCKPS+YSK+FK+ACPSY SYAFD PSP+VSC S +Y  TFCP  
Sbjct  191  DNDKFCCRNEYGSPEKCKPSVYSKIFKDACPSYFSYAFDTPSPLVSCGSSEYIITFCPSG  250

Query  173  F  171
            +
Sbjct  251  W  251



>gb|KHN34189.1| Thaumatin-like protein [Glycine soja]
Length=245

 Score =   167 bits (423),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYN+PVSV    ++ KC I GC+K ++  CP EL+V+N  G++VACKSACLAF
Sbjct  115  YDVSLVDGYNIPVSVTPKITNPKCNIPGCLKDLKGLCPPELEVLNSKGEIVACKSACLAF  174

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            + D FCCRNQYGSP KCKPS+YSK+FK+ACP+Y SYAFD P+P+VSC+S ++  TFCP
Sbjct  175  DNDKFCCRNQYGSPGKCKPSVYSKIFKDACPNYFSYAFDTPTPLVSCASSEFIITFCP  232



>emb|CDY30288.1| BnaC04g31990D [Brassica napus]
Length=255

 Score =   167 bits (423),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLPV+V S P SSKC I GC + ++  CP ELQVVN  G VVACKSACLAF
Sbjct  130  YDVSLVDGYNLPVTVTSKPMSSKCTIFGCHRDLKTTCPEELQVVNKEGRVVACKSACLAF  189

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            + D FCCRN YG+PDKCK + YS +FK ACPSY SYA+D P P+VSC++ +Y  TFCP +
Sbjct  190  DNDRFCCRNAYGTPDKCKRTTYSMLFKEACPSYYSYAYDAPPPLVSCAAKEYIITFCPSS  249

Query  173  F  171
            +
Sbjct  250  W  250



>ref|XP_006431048.1| hypothetical protein CICLE_v10012489mg [Citrus clementina]
 gb|ESR44288.1| hypothetical protein CICLE_v10012489mg [Citrus clementina]
Length=264

 Score =   167 bits (423),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNL V V +   S+KC I GC K+M   CP ELQV+N N  VVACKSACLAF
Sbjct  129  YDVSLVDGYNLHVMVTTRQISTKCTINGCRKNMNIFCPPELQVLNENRQVVACKSACLAF  188

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N DSFCCRN++G+PDKCKPSLYSK+FK+ACP+Y SYA+D P+P+VSC+S ++  TFCP  
Sbjct  189  NLDSFCCRNEFGTPDKCKPSLYSKIFKDACPAYYSYAYDMPAPLVSCASREFVITFCPSG  248

Query  173  F  171
            +
Sbjct  249  W  249



>ref|XP_009139951.1| PREDICTED: thaumatin-like protein [Brassica rapa]
Length=255

 Score =   167 bits (422),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLPV+V S P SSKC I GC + ++  CP ELQVVN  G VVACKSACLAF
Sbjct  130  YDVSLVDGYNLPVTVTSKPMSSKCTIFGCHRDLKTTCPEELQVVNKEGRVVACKSACLAF  189

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            + D FCCRN YG+PDKCK + YS +FK ACPSY SYA+D P P+VSC++ +Y  TFCP +
Sbjct  190  DNDRFCCRNAYGTPDKCKRTTYSMLFKEACPSYYSYAYDAPPPLVSCAAKEYIITFCPSS  249

Query  173  F  171
            +
Sbjct  250  W  250



>emb|CDY30841.1| BnaC04g26960D [Brassica napus]
Length=256

 Score =   167 bits (422),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLPV+V S P SSKC I GC + ++  CP ELQVVN  G VVACKSACLAF
Sbjct  131  YDVSLVDGYNLPVTVTSKPMSSKCTIFGCHRDLKTTCPEELQVVNKEGRVVACKSACLAF  190

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            + D FCCRN YG+PDKCK + YS +FK ACPSY SYA+D P P+VSC++ +Y  TFCP +
Sbjct  191  DNDRFCCRNAYGTPDKCKRTTYSMLFKEACPSYYSYAYDAPPPLVSCAAKEYIITFCPSS  250

Query  173  F  171
            +
Sbjct  251  W  251



>ref|XP_010272178.1| PREDICTED: thaumatin-like protein [Nelumbo nucifera]
Length=258

 Score =   167 bits (422),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLPVSV++ P +S C I GC+K++ + CP+ELQV+N +G VVACKSACLAF
Sbjct  132  YDVSLVDGYNLPVSVSAKPFASNCSITGCLKNLNSLCPSELQVLNASGQVVACKSACLAF  191

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            + D FCCRN YGSP+KCK ++YS MFK+ACPSY SYAFD P P+V C+S  Y  TFCP  
Sbjct  192  DLDVFCCRNAYGSPEKCKSNMYSDMFKDACPSYFSYAFDTPPPLVRCTSQVYVITFCPSR  251

Query  173  F  171
            +
Sbjct  252  W  252



>ref|XP_003554871.2| PREDICTED: thaumatin-like protein-like [Glycine max]
Length=261

 Score =   167 bits (422),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYN+PVSV    ++ KC I GC+K ++  CP EL+V+N  G++VACKSACLAF
Sbjct  131  YDVSLVDGYNIPVSVTPKITNPKCNIPGCLKDLKGLCPPELEVLNSKGEIVACKSACLAF  190

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            + D FCCRNQYGSP KCKPS+YSK+FK+ACP+Y SYAFD P+P+VSC+S ++  TFCP
Sbjct  191  DNDKFCCRNQYGSPGKCKPSVYSKIFKDACPNYFSYAFDTPTPLVSCASSEFIITFCP  248



>ref|XP_006482515.1| PREDICTED: thaumatin-like protein-like [Citrus sinensis]
Length=264

 Score =   166 bits (421),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNL V V +   S+KC I GC K+M   CP ELQV+N N  VVACKSACLAF
Sbjct  129  YDVSLVDGYNLHVMVTTRQISTKCTINGCRKNMNIFCPPELQVLNENRQVVACKSACLAF  188

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N DSFCCRN++G+PDKCKPSLYSK+FK+ACP+Y SYA+D P+P+VSC S ++  TFCP  
Sbjct  189  NLDSFCCRNEFGTPDKCKPSLYSKIFKDACPAYYSYAYDMPAPLVSCVSGEFVITFCPSG  248

Query  173  F  171
            +
Sbjct  249  W  249



>ref|XP_008443444.1| PREDICTED: thaumatin-like protein [Cucumis melo]
Length=271

 Score =   166 bits (421),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 97/122 (80%), Gaps = 1/122 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVAS-IPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLA  357
            YD+SLVDG+NLP+SV S  P S KC IG C K++   CP EL+V+NGNGDVVAC+SACLA
Sbjct  134  YDISLVDGFNLPISVNSRQPISPKCAIGSCGKNLNEICPDELKVLNGNGDVVACRSACLA  193

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            F  DSFCCRN YG+P+ CKPSLYS+MFK+ACPSY S+AFD P P+ SCS+ ++  TFCP 
Sbjct  194  FGLDSFCCRNAYGTPETCKPSLYSRMFKDACPSYYSFAFDSPPPLASCSAREFVVTFCPA  253

Query  176  NF  171
             +
Sbjct  254  GW  255



>ref|XP_004147456.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus]
 ref|XP_004164898.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus]
Length=256

 Score =   166 bits (419),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 96/122 (79%), Gaps = 1/122 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVAS-IPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLA  357
            YD+SLVDG+N+P+SV S  P S KC IG C K++   CP EL+V+NGNGDVVAC+SACLA
Sbjct  119  YDISLVDGFNIPISVNSKQPISPKCAIGSCEKNLNEICPDELKVLNGNGDVVACRSACLA  178

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            F  DSFCCRN YG+P+ CKPSLYS+MFK ACPSY S+AFD P P+ SCS+ ++  TFCP 
Sbjct  179  FGLDSFCCRNTYGTPETCKPSLYSRMFKEACPSYYSFAFDSPPPLASCSAREFVVTFCPA  238

Query  176  NF  171
             +
Sbjct  239  GW  240



>ref|XP_008341518.1| PREDICTED: thaumatin-like protein isoform X2 [Malus domestica]
 ref|XP_008341519.1| PREDICTED: thaumatin-like protein isoform X2 [Malus domestica]
Length=236

 Score =   165 bits (417),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            Y VS+VDGYNLPV++ S P++S C + GC+K ++  CP EL+V+N  G+VVACKSACLAF
Sbjct  108  YAVSVVDGYNLPVAILSRPAASNCAVRGCLKDLKTCCPDELKVLNDEGEVVACKSACLAF  167

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            + DSFCCRN+YG+P+KCKPS+YSK+FK+ACPSY SYA+D P P+V+C + +Y  TFCP  
Sbjct  168  DTDSFCCRNKYGTPEKCKPSVYSKIFKDACPSYYSYAYDSPPPLVTCKASEYVITFCPAG  227

Query  173  F  171
            +
Sbjct  228  W  228



>ref|XP_002868677.1| hypothetical protein ARALYDRAFT_493983 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44936.1| hypothetical protein ARALYDRAFT_493983 [Arabidopsis lyrata subsp. 
lyrata]
Length=256

 Score =   165 bits (418),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLPV+V S P SSKC I GC K ++  CP ELQV+N  G +VACKSACLAF
Sbjct  131  YDVSLVDGYNLPVAVNSKPVSSKCNILGCHKDLKTTCPEELQVLNEEGQIVACKSACLAF  190

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            + D FCCRN YG+P+KCK + YS +FK ACP+Y SYA+D P P+V+CS+ +Y  TFCP N
Sbjct  191  DNDRFCCRNAYGTPEKCKRNTYSMLFKEACPNYYSYAYDTPPPLVTCSAKEYLITFCPSN  250

Query  173  F  171
            +
Sbjct  251  W  251



>ref|XP_010450736.1| PREDICTED: thaumatin-like protein [Camelina sativa]
Length=256

 Score =   165 bits (418),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLPV+V S P+SS C I GC K ++  CP ELQV+N  G +VACKSACLAF
Sbjct  131  YDVSLVDGYNLPVAVNSKPTSSICTISGCHKDLKTTCPEELQVLNEEGRIVACKSACLAF  190

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            + D FCCRN YG+P+KCK + YS +FK ACPSY SYA+D P P+V+CS+ +Y+ TFCP +
Sbjct  191  DNDRFCCRNAYGTPEKCKRTTYSMLFKEACPSYYSYAYDTPPPLVTCSAKEYFITFCPSS  250

Query  173  F  171
            +
Sbjct  251  W  251



>gb|KGN59605.1| Protein P21 [Cucumis sativus]
Length=271

 Score =   166 bits (419),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 96/122 (79%), Gaps = 1/122 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVAS-IPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLA  357
            YD+SLVDG+N+P+SV S  P S KC IG C K++   CP EL+V+NGNGDVVAC+SACLA
Sbjct  134  YDISLVDGFNIPISVNSKQPISPKCAIGSCEKNLNEICPDELKVLNGNGDVVACRSACLA  193

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            F  DSFCCRN YG+P+ CKPSLYS+MFK ACPSY S+AFD P P+ SCS+ ++  TFCP 
Sbjct  194  FGLDSFCCRNTYGTPETCKPSLYSRMFKEACPSYYSFAFDSPPPLASCSAREFVVTFCPA  253

Query  176  NF  171
             +
Sbjct  254  GW  255



>gb|AFK39390.1| unknown [Medicago truncatula]
Length=272

 Score =   165 bits (418),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 103/124 (83%), Gaps = 4/124 (3%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPS---SSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSAC  363
            YDVSLVDGYN+PVSV  +P+   +SKC I GC K +++ CP EL+V+N NG+VVACKSAC
Sbjct  133  YDVSLVDGYNIPVSVV-VPNKNINSKCNIQGCFKDVKSLCPRELEVLNSNGEVVACKSAC  191

Query  362  LAFNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            LAF+ D+FCCRN YGSP+KC+P++YSK+FK+ACP+Y SYAFD P+P+VSC S +Y  TFC
Sbjct  192  LAFDLDNFCCRNDYGSPEKCRPNVYSKIFKDACPNYFSYAFDTPTPLVSCGSLEYIITFC  251

Query  182  PENF  171
            P+ +
Sbjct  252  PQGW  255



>ref|XP_008341517.1| PREDICTED: thaumatin-like protein isoform X1 [Malus domestica]
Length=260

 Score =   165 bits (417),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            Y VS+VDGYNLPV++ S P++S C + GC+K ++  CP EL+V+N  G+VVACKSACLAF
Sbjct  132  YAVSVVDGYNLPVAILSRPAASNCAVRGCLKDLKTCCPDELKVLNDEGEVVACKSACLAF  191

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            + DSFCCRN+YG+P+KCKPS+YSK+FK+ACPSY SYA+D P P+V+C + +Y  TFCP  
Sbjct  192  DTDSFCCRNKYGTPEKCKPSVYSKIFKDACPSYYSYAYDSPPPLVTCKASEYVITFCPAG  251

Query  173  F  171
            +
Sbjct  252  W  252



>ref|XP_009335804.1| PREDICTED: thaumatin-like protein [Pyrus x bretschneideri]
Length=260

 Score =   165 bits (417),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            Y VS+VDGYNLPV+++S P +S C + GC+K ++  CP EL+V+N  G+VVACKSACLAF
Sbjct  132  YAVSVVDGYNLPVAISSRPVASNCAVRGCLKDLKTWCPDELKVLNDEGEVVACKSACLAF  191

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            + DSFCCRN+YG+P+KCKPS+YSK+FK+ACPSY SYA+D P P+V+C + +Y  TFCP  
Sbjct  192  DTDSFCCRNKYGTPEKCKPSVYSKIFKDACPSYYSYAYDSPPPLVTCKASEYVITFCPAG  251

Query  173  F  171
            +
Sbjct  252  W  252



>ref|XP_010554023.1| PREDICTED: thaumatin-like protein [Tarenaya hassleriana]
Length=258

 Score =   164 bits (415),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYN+PV+V S P SSKC I GC K ++  CP EL+V+N  G VVACKSACLAF
Sbjct  133  YDVSLVDGYNIPVAVNSKPVSSKCTISGCQKDLKGTCPDELEVLNKEGKVVACKSACLAF  192

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            + D FCCRN YG+P+KC+P+ YS MFK ACP+Y SYA+D P P+V+C + +Y  TFCP N
Sbjct  193  DNDRFCCRNSYGTPEKCRPNTYSTMFKEACPNYYSYAYDTPPPLVTCFAKEYVVTFCPSN  252

Query  173  F  171
            +
Sbjct  253  W  253



>ref|XP_003618434.1| Thaumatin-like protein [Medicago truncatula]
 gb|AES74652.1| pathogenesis-related thaumatin family protein [Medicago truncatula]
Length=272

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 102/124 (82%), Gaps = 4/124 (3%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPS---SSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSAC  363
            YDVSLVDGYN+PVSV  +P+   +SKC I GC K +++ CP EL+V+N NG+VVACKSAC
Sbjct  133  YDVSLVDGYNIPVSVV-VPNKNINSKCNIQGCFKDVKSLCPRELEVLNSNGEVVACKSAC  191

Query  362  LAFNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            LAF+ D+FCCRN YGSP KC+P++YSK+FK+ACP+Y SYAFD P+P+VSC S +Y  TFC
Sbjct  192  LAFDLDNFCCRNDYGSPKKCRPNVYSKIFKDACPNYFSYAFDTPTPLVSCGSLEYIITFC  251

Query  182  PENF  171
            P+ +
Sbjct  252  PQGW  255



>ref|XP_010435956.1| PREDICTED: thaumatin-like protein [Camelina sativa]
Length=256

 Score =   164 bits (414),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLPV+V S P SSKC I GC K ++  CP ELQV+N  G +VACKSACLAF
Sbjct  131  YDVSLVDGYNLPVAVNSKPISSKCAISGCHKDLKTTCPEELQVLNEEGRIVACKSACLAF  190

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            + D FCCRN YG+P KCK ++YS +FK ACP+Y SYA+D P P+V+CS+ +Y  TFCP +
Sbjct  191  DNDRFCCRNAYGTPGKCKRNMYSMLFKEACPNYYSYAYDTPPPLVTCSAKEYLITFCPSS  250

Query  173  F  171
            +
Sbjct  251  W  251



>ref|NP_198818.1| pathogenesis-related thaumatin-like protein [Arabidopsis thaliana]
 dbj|BAB10226.1| thaumatin-like protein [Arabidopsis thaliana]
 gb|AAR24653.1| At5g40020 [Arabidopsis thaliana]
 dbj|BAF00030.1| thaumatin-like protein [Arabidopsis thaliana]
 gb|AED94502.1| pathogenesis-related thaumatin-like protein [Arabidopsis thaliana]
Length=256

 Score =   164 bits (414),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLPV V S P SSKC I GC K ++  CP ELQV+N  G VVACKSACLAF
Sbjct  131  YDVSLVDGYNLPVVVNSKPVSSKCTILGCHKDLKTTCPEELQVLNEEGRVVACKSACLAF  190

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            + D FCCRN YG+P+KCK + YS +FK ACP+Y SYA++ P P+V+CS+ +Y  TFCP N
Sbjct  191  DNDRFCCRNAYGTPEKCKRNTYSMLFKEACPNYYSYAYETPPPLVTCSAKEYLITFCPSN  250

Query  173  F  171
            +
Sbjct  251  W  251



>ref|XP_006284382.1| hypothetical protein CARUB_v10005550mg [Capsella rubella]
 gb|EOA17280.1| hypothetical protein CARUB_v10005550mg [Capsella rubella]
Length=256

 Score =   164 bits (414),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLPV+V S P SSKC I GC K ++  CP ELQV+N  G +VACKSACLAF
Sbjct  131  YDVSLVDGYNLPVAVNSKPMSSKCTISGCHKDLKTTCPQELQVLNEEGRIVACKSACLAF  190

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            + D FCCRN YG+P KCK + YS +FK ACP+Y SYA+D P P+V+CS+ +Y  TFCP +
Sbjct  191  DNDRFCCRNAYGTPGKCKRTTYSMLFKEACPNYYSYAYDTPPPLVTCSAKEYLITFCPSS  250

Query  173  F  171
            +
Sbjct  251  W  251



>ref|XP_010441116.1| PREDICTED: thaumatin-like protein [Camelina sativa]
Length=256

 Score =   164 bits (414),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLPV+V S P SSKC I GC K ++  CP ELQV+N  G +VACKSACLAF
Sbjct  131  YDVSLVDGYNLPVAVNSKPISSKCAISGCHKDLKTTCPEELQVLNEEGRIVACKSACLAF  190

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            + D FCCRN YG+P KCK ++YS +FK ACP+Y SYA+D P P+V+CS+ +Y  TFCP +
Sbjct  191  DNDRFCCRNAYGTPGKCKRNMYSMLFKEACPNYYSYAYDTPPPLVTCSAKEYLITFCPSS  250

Query  173  F  171
            +
Sbjct  251  W  251



>ref|XP_009418409.1| PREDICTED: thaumatin-like protein [Musa acuminata subsp. malaccensis]
Length=255

 Score =   162 bits (411),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 97/122 (80%), Gaps = 1/122 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGD-VVACKSACLA  357
            YDVS+VDGYNLP++V++ P+  KC+IGGC KS+ + CP ELQV++ NG  VVACKSACLA
Sbjct  128  YDVSVVDGYNLPIAVSTKPAYRKCWIGGCTKSINSVCPEELQVLDHNGAAVVACKSACLA  187

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            F+ D FCCRN YG P+ CKPS+YS MFK+ACPSY SYA+D P P+V+C S +Y  TFCP 
Sbjct  188  FDLDVFCCRNSYGKPETCKPSVYSAMFKDACPSYFSYAYDTPPPLVNCYSREYAITFCPS  247

Query  176  NF  171
             +
Sbjct  248  RW  249



>ref|XP_006405559.1| hypothetical protein EUTSA_v10027894mg [Eutrema salsugineum]
 dbj|BAJ34394.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ47012.1| hypothetical protein EUTSA_v10027894mg [Eutrema salsugineum]
Length=256

 Score =   162 bits (409),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLPV+V S P SSKC + GC K +   CP ELQV+N  G VVACKSACLAF
Sbjct  131  YDVSLVDGYNLPVAVNSKPVSSKCVVLGCHKDLITTCPEELQVLNKEGRVVACKSACLAF  190

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            + D FCCRN YG+P+KCK + YS +FK ACP+Y SYA++ P P+V+CS+ +Y  TFCP N
Sbjct  191  DNDRFCCRNAYGTPEKCKRTTYSMLFKEACPNYYSYAYETPPPLVTCSAKEYLITFCPSN  250

Query  173  F  171
            +
Sbjct  251  W  251



>ref|XP_010065046.1| PREDICTED: thaumatin-like protein [Eucalyptus grandis]
Length=264

 Score =   162 bits (410),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YD+SLVDG+NLP+SV + P+  +C I GC K + + CP ELQVVNG G VVACKSACLAF
Sbjct  131  YDISLVDGFNLPISVQTRPTQPECEIPGCSKPLNSLCPKELQVVNGKGKVVACKSACLAF  190

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            N D +CCRN+Y +PDKCKP++YS++FK+ACP Y S+ +D P P+VSC+S ++   FCP
Sbjct  191  NTDEYCCRNEYATPDKCKPNVYSRLFKDACPGYYSHPYDSPRPLVSCASKEFEIIFCP  248



>gb|KCW70776.1| hypothetical protein EUGRSUZ_F03936 [Eucalyptus grandis]
Length=265

 Score =   162 bits (409),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YD+SLVDG+NLP+SV + P+  +C I GC K + + CP ELQVVNG G VVACKSACLAF
Sbjct  132  YDISLVDGFNLPISVQTRPTQPECEIPGCSKPLNSLCPKELQVVNGKGKVVACKSACLAF  191

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            N D +CCRN+Y +PDKCKP++YS++FK+ACP Y S+ +D P P+VSC+S ++   FCP
Sbjct  192  NTDEYCCRNEYATPDKCKPNVYSRLFKDACPGYYSHPYDSPRPLVSCASKEFEIIFCP  249



>ref|XP_007151179.1| hypothetical protein PHAVU_004G024600g [Phaseolus vulgaris]
 gb|ESW23173.1| hypothetical protein PHAVU_004G024600g [Phaseolus vulgaris]
Length=253

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYN+PVS+    +  KC IGGC+K + + CP +L+V+N  G+VV CKSACLAF
Sbjct  129  YDVSLVDGYNIPVSITPRTTDPKCLIGGCLKDINSLCPPQLKVLNSKGEVVGCKSACLAF  188

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
              D +CCRN YG+P+KC+PS+YSK+FK+ACPSY SYAFD P+P+V C+S  Y  TFCP
Sbjct  189  GDDRYCCRNAYGTPEKCRPSVYSKIFKDACPSYFSYAFDSPTPLVRCASSLYVVTFCP  246



>ref|XP_010670350.1| PREDICTED: thaumatin-like protein [Beta vulgaris subsp. vulgaris]
Length=272

 Score =   161 bits (407),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 94/121 (78%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLPVSV  +PS+ KC I GC + ++  CP ELQV +G G++VACKSACLAF
Sbjct  142  YDVSLVDGYNLPVSVL-VPSAPKCSIRGCYRDLKAICPLELQVKDGGGNIVACKSACLAF  200

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N D FCCRN+Y + +KC PSLYS +FK ACPSYVSYAFD PSP++SC   + + TFCP  
Sbjct  201  NLDRFCCRNEYRNAEKCTPSLYSDVFKGACPSYVSYAFDSPSPLMSCLVKELYVTFCPAG  260

Query  173  F  171
            +
Sbjct  261  Y  261



>emb|CDP20596.1| unnamed protein product [Coffea canephora]
Length=265

 Score =   159 bits (403),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 89/121 (74%), Gaps = 0/121 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVS+VDGYNLPVSV   P++ KCYIGGC   ++  CP EL V+N  G VVACKSACLAF
Sbjct  134  YDVSIVDGYNLPVSVTPYPTAPKCYIGGCFSDIKKECPGELAVLNELGQVVACKSACLAF  193

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N D FCCR +YGSP  CKP +YS+ FK  CP Y S  FD PSP+V+C +D+Y  TFCP+ 
Sbjct  194  NEDRFCCRKKYGSPATCKPDVYSRFFKAECPYYFSKPFDTPSPLVNCPADQYIITFCPDG  253

Query  173  F  171
            +
Sbjct  254  W  254



>ref|XP_010065049.1| PREDICTED: pathogenesis-related protein 5-like [Eucalyptus grandis]
Length=295

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            Y++SLVDG+NLP+SV + P+  +C I GC K +   CP ELQV+NG G VVACKSACLAF
Sbjct  162  YNISLVDGFNLPISVQTRPTQPECEIPGCSKPLNGLCPEELQVMNGKGKVVACKSACLAF  221

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            N D +CCRN+Y +PDKCKPS+YS++FK+ACP Y S+ +D P P VSC+S ++   FCP
Sbjct  222  NTDEYCCRNEYATPDKCKPSVYSRLFKDACPGYYSHPYDSPRPQVSCASKEFEIIFCP  279



>gb|KCW70779.1| hypothetical protein EUGRSUZ_F03940 [Eucalyptus grandis]
Length=311

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 93/121 (77%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            Y++SLVDG+NLP+SV + P+  +C I GC K +   CP ELQV+NG G VVACKSACLAF
Sbjct  182  YNISLVDGFNLPISVQTRPTQPECEIPGCSKPLNGLCPEELQVMNGKGKVVACKSACLAF  241

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N D +CCRN+Y +PDKCKPS+YS++FK+ACP Y S+ +D P P VSC+S ++   FCP N
Sbjct  242  NTDEYCCRNEYATPDKCKPSVYSRLFKDACPGYYSHPYDSPRPQVSCASKEFEIIFCP-N  300

Query  173  F  171
            F
Sbjct  301  F  301



>gb|AIR93916.1| thaumatin [Cicer arietinum]
Length=183

 Score =   155 bits (392),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 97/119 (82%), Gaps = 1/119 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVA-SIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLA  357
            YDVSLVDGYN+PVS+  S   +SKC I GC+K +++ CP ELQV+N NG+VVACKSACLA
Sbjct  52   YDVSLVDGYNVPVSITPSKNINSKCNIQGCLKDVKSLCPNELQVLNSNGEVVACKSACLA  111

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            F+ D+FC RN YGS  KC+P++YS++FK+ACP+Y S+AFD P+P+VSC + +Y  TFCP
Sbjct  112  FDLDNFCRRNGYGSQQKCRPNVYSRIFKDACPNYFSFAFDTPTPLVSCGALEYVITFCP  170



>ref|XP_010065048.1| PREDICTED: pathogenesis-related protein 5-like [Eucalyptus grandis]
Length=275

 Score =   157 bits (398),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YD+SLVDG+NLP+SV + P+  +C I GC K + + CP ELQV+NG G VVACKSACLAF
Sbjct  142  YDISLVDGFNLPISVQTRPTQPECEIPGCSKPLNSLCPEELQVMNGKGKVVACKSACLAF  201

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            N D +CCRN+Y +PDKCKPS+YS++FK+ACP Y S+ +D   P VSC+S ++   FCP
Sbjct  202  NTDEYCCRNEYATPDKCKPSVYSRLFKDACPGYYSHPYDSARPQVSCASKEFEIIFCP  259



>gb|KCW70777.1| hypothetical protein EUGRSUZ_F03937 [Eucalyptus grandis]
Length=311

 Score =   159 bits (401),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 93/121 (77%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YD+SLVDG+NLP+SV + P+  +C I GC K + + CP ELQV+NG G VVACKSACLAF
Sbjct  182  YDISLVDGFNLPISVQTRPTQPECEIPGCSKPLNSLCPEELQVMNGKGKVVACKSACLAF  241

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N D +CCRN+Y +PDKCKPS+YS++FK+ACP Y S+ +D   P VSC+S ++   FCP N
Sbjct  242  NTDEYCCRNEYATPDKCKPSVYSRLFKDACPGYYSHPYDSARPQVSCASKEFEIIFCP-N  300

Query  173  F  171
            F
Sbjct  301  F  301



>ref|XP_004489362.1| PREDICTED: thaumatin-like protein-like [Cicer arietinum]
Length=264

 Score =   154 bits (390),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 97/119 (82%), Gaps = 1/119 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVA-SIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLA  357
            YDVSLVDGYN+PVS+  S   +SKC I GC+K +++ CP ELQV+N NG+VVACKSACLA
Sbjct  133  YDVSLVDGYNVPVSITPSKNINSKCNIQGCLKDVKSLCPNELQVLNSNGEVVACKSACLA  192

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            F+ D+FC RN YGS  KC+P++YS++FK+ACP+Y S+AFD P+P+VSC + +Y  TFCP
Sbjct  193  FDLDNFCRRNGYGSQQKCRPNVYSRIFKDACPNYFSFAFDTPTPLVSCGALEYVITFCP  251



>ref|XP_006838650.1| hypothetical protein AMTR_s00002p00239680 [Amborella trichopoda]
 gb|ERN01219.1| hypothetical protein AMTR_s00002p00239680 [Amborella trichopoda]
Length=209

 Score =   150 bits (378),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 91/122 (75%), Gaps = 3/122 (2%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCY-IGGCMKSMRNACPAELQVVNGNGDVVACKSACLA  357
            +DVSLVDGYNLP+SV+  P  ++C    GC K +++ CP EL+V +  G VVACKSACLA
Sbjct  82   HDVSLVDGYNLPISVS--PRGARCSPTPGCAKDLKSHCPPELRVTDHRGSVVACKSACLA  139

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN D FCCRN YGSPDKC PS+YS MFK+ACP+Y SYA+D P P+ SC + +Y  TFCP 
Sbjct  140  FNLDVFCCRNDYGSPDKCHPSMYSTMFKDACPAYFSYAYDMPPPLYSCVASEYVVTFCPS  199

Query  176  NF  171
             +
Sbjct  200  KW  201



>ref|XP_003545288.2| PREDICTED: pathogenesis-related protein 5-like [Glycine max]
Length=250

 Score =   140 bits (354),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 81/120 (68%), Gaps = 0/120 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYN+ V V +   +  C   GC + +  ACPAELQV +G G+VVACKSAC AF
Sbjct  131  YDVSLVDGYNVGVGVRATGGTGDCKYAGCSEDLNAACPAELQVKDGGGEVVACKSACAAF  190

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N   FCC   + SP  C P+LYSK+FKNACP+  SYA+D PS I +CS   Y  TFCP +
Sbjct  191  NTAEFCCTGDHSSPQTCSPTLYSKIFKNACPAAYSYAYDDPSSICTCSGSDYVITFCPSH  250



>ref|XP_003545287.2| PREDICTED: pathogenesis-related protein 5-like [Glycine max]
Length=246

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 79/120 (66%), Gaps = 0/120 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYN+ V V +   +  C   GC + +  ACPAELQV +G G VVACKSAC AF
Sbjct  127  YDVSLVDGYNVGVGVRATGGTGDCKYAGCSEDLNPACPAELQVKDGGGAVVACKSACAAF  186

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N   FCC   + SP  C P+ YSK+FKNACP+  SYA+D PS I +CS   Y  TFCP +
Sbjct  187  NTAEFCCTGDHSSPQTCSPTRYSKIFKNACPAAYSYAYDDPSSICTCSGSDYVITFCPSH  246



>dbj|BAJ87574.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92082.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=258

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 86/124 (69%), Gaps = 3/124 (2%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPS--SSKCYIGGCMKSMRNACPAELQVVNGN-GDVVACKSAC  363
            YDVS+VDGYNLPV+V + P+  S  C+I GC K M   CP ELQV +G    VVAC+SAC
Sbjct  128  YDVSVVDGYNLPVAVWTRPANRSGGCFIAGCAKDMNAVCPPELQVTSGKKATVVACRSAC  187

Query  362  LAFNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            LAF  D+FCCR  YG+ + C+ S+YS++F++ACP+Y SYA+D  +    C + +Y  TFC
Sbjct  188  LAFGLDAFCCRGAYGTAETCRGSVYSRIFRDACPAYYSYAYDVAAATPRCYAQEYVLTFC  247

Query  182  PENF  171
            P  +
Sbjct  248  PSRW  251



>gb|KHN04547.1| Thaumatin-like protein, partial [Glycine soja]
Length=131

 Score =   129 bits (323),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 76/118 (64%), Gaps = 0/118 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYN+ + V +   +  C   GC+  +   CP ELQV    G +VACKSAC AF
Sbjct  13   YDVSLVDGYNVAMGVRATGGTGNCQYAGCVTDLNGKCPTELQVTAEGGSIVACKSACAAF  72

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            NA  FCC  +Y +P  CKP+ YS++FK+ACPS  SYA+D  +   +CS+  Y  TFCP
Sbjct  73   NAAEFCCTGEYSTPQTCKPTQYSEIFKSACPSAYSYAYDDATSTCTCSASDYVITFCP  130



>gb|ABK25809.1| unknown [Picea sitchensis]
Length=243

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 80/119 (67%), Gaps = 0/119 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLP+++A    S KC   GC+  +  +CP  LQV N  G V+ACKSAC AF
Sbjct  125  YDVSLVDGYNLPIAIAPRRGSGKCTYAGCISDLNLSCPPSLQVKNEQGCVMACKSACFAF  184

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            +   +CC   YG+P  C+P+ +S++FKNACP   SYA+D P+ +V+CS   Y  TFCP 
Sbjct  185  STPQYCCTGSYGNPQTCRPTSFSRLFKNACPRAYSYAYDDPNSLVTCSGADYLITFCPH  243



>ref|XP_003525190.1| PREDICTED: thaumatin-like protein-like [Glycine max]
Length=245

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 79/121 (65%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVN-GNGDVVACKSACLA  357
            YDVSLVDGYNLP+S+     S KC   GC+  +   CP  LQV +  N  VVACKSAC A
Sbjct  124  YDVSLVDGYNLPISITPFKGSGKCSYAGCVSDLNTMCPVGLQVRSRDNKRVVACKSACSA  183

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   YGSP  CKP++YSK+FK ACP   SYA+D P+ I +C+   Y+ TFCP 
Sbjct  184  FNSPKYCCTGSYGSPQACKPTVYSKIFKTACPKAYSYAYDDPTSIATCTKANYFLTFCPH  243

Query  176  N  174
             
Sbjct  244  R  244



>dbj|BAD90814.1| thaumatin-like protein [Cryptomeria japonica]
Length=240

 Score =   130 bits (328),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 83/120 (69%), Gaps = 1/120 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYN+P+S+A++  +  C   GC+  +R +CPAEL V + NG V+ACKSAC AF
Sbjct  122  YDVSLVDGYNVPLSIAAVGGTGDCRTAGCVSDLRTSCPAELSVTS-NGQVIACKSACAAF  180

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            +   +CC   +GSP  C PS YS++FK+ACP+  SYA+D  +   +CS+  Y  TFCP +
Sbjct  181  STPEYCCTGDHGSPQTCSPSKYSQVFKSACPTAYSYAYDDATSTFTCSNADYTITFCPSS  240



>ref|XP_007160531.1| hypothetical protein PHAVU_002G329400g [Phaseolus vulgaris]
 gb|ESW32525.1| hypothetical protein PHAVU_002G329400g [Phaseolus vulgaris]
Length=248

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 79/121 (65%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVN-GNGDVVACKSACLA  357
            YDVSLVDGYNLP+S+     S KC   GC+  +   CP  LQV +  N  VVACKSAC A
Sbjct  127  YDVSLVDGYNLPISITPFKGSGKCSYAGCVSDLNTMCPVGLQVRSRDNKRVVACKSACSA  186

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   YGSP  CKP++YSK+FK+ACP   SYA+D P+ I +C+   Y  TFCP 
Sbjct  187  FNSPKYCCTGSYGSPQACKPTVYSKIFKSACPKAYSYAYDDPTSIATCTKANYLITFCPH  246

Query  176  N  174
             
Sbjct  247  R  247



>ref|XP_003530957.2| PREDICTED: thaumatin-like protein-like [Glycine max]
Length=253

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVN-GNGDVVACKSACLA  357
            YDVSLVDGYNLP+S+     S KC   GC+  +   CP  LQV +  N  VVACKSAC A
Sbjct  132  YDVSLVDGYNLPISITPFKGSGKCSYAGCVSDLNTMCPVGLQVRSRDNKRVVACKSACSA  191

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   YGSP  CKP++YSK+FK ACP   SYA+D P+ I +C+   Y  TFCP 
Sbjct  192  FNSPRYCCTGSYGSPQACKPTVYSKIFKTACPKAYSYAYDDPTSIATCTKANYLVTFCPH  251

Query  176  N  174
             
Sbjct  252  R  252



>ref|XP_010097569.1| hypothetical protein L484_017379 [Morus notabilis]
 gb|EXB69101.1| hypothetical protein L484_017379 [Morus notabilis]
Length=249

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 80/121 (66%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGD-VVACKSACLA  357
            YDVSLVDGYNL +S+     S KC   GC+  +   CPA LQV +G+G  VVACKSAC A
Sbjct  128  YDVSLVDGYNLAISITPSKGSGKCSYAGCVSDLNVMCPASLQVRSGDGRRVVACKSACSA  187

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +GSP  CKP+ YS++FK ACP   SYA+D P+ I +C+   Y  TFCP 
Sbjct  188  FNSPRYCCTGSFGSPQSCKPTAYSRIFKAACPKAYSYAYDDPTSIATCTKGNYLVTFCPH  247

Query  176  N  174
            +
Sbjct  248  H  248



>ref|XP_010033700.1| PREDICTED: thaumatin-like protein [Eucalyptus grandis]
 gb|KCW84061.1| hypothetical protein EUGRSUZ_B00944 [Eucalyptus grandis]
Length=249

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 76/120 (63%), Gaps = 0/120 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNL +S+     + KC   GC+  +   CP  LQV   +  VVACKSAC AF
Sbjct  128  YDVSLVDGYNLAISITPFKGTGKCSYAGCVSDLNTMCPVGLQVRGHDNSVVACKSACFAF  187

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N+  +CC   +G+P  CKP+ YSK+FK ACP   SYA+D P+ I +C+   Y  TFCP +
Sbjct  188  NSPRYCCTGSFGNPQSCKPTAYSKIFKTACPKAYSYAYDDPTSIATCTRGNYIVTFCPHH  247



>gb|AAV64186.1| hypothetical protein C9002 [Zea mays]
 gb|ACF79579.1| unknown [Zea mays]
 tpg|DAA49989.1| TPA: putative thaumatin domain family protein [Zea mays]
Length=288

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 87/131 (66%), Gaps = 10/131 (8%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSS-----KCYIGGCMKSMRNACPAELQVV----NGNGDVV  381
            YDVSLVDGYNLPV+V++ P++      KC I GC K++   CP ELQV      G   VV
Sbjct  147  YDVSLVDGYNLPVAVSAKPATGGADPNKCAIAGCAKNVNAVCPPELQVTATGSGGGKTVV  206

Query  380  ACKSACLAFNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVS-CSSD  204
            ACKSACLAF  D+FCCR  Y +P  C+ ++YS++FK+ACP+Y SYA+D  +   S C + 
Sbjct  207  ACKSACLAFGLDAFCCRGAYATPATCRGTVYSRLFKDACPAYYSYAYDTAATTASGCYAQ  266

Query  203  KYWFTFCPENF  171
            +Y  TFCP  +
Sbjct  267  EYIITFCPSRW  277



>ref|XP_010668000.1| PREDICTED: thaumatin-like protein [Beta vulgaris subsp. vulgaris]
Length=294

 Score =   130 bits (326),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 78/118 (66%), Gaps = 1/118 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGN-GDVVACKSACLA  357
            YDVSLVDG+N+PV+V  +  +  C I GC K +R  CP EL V   N G  VAC+SAC  
Sbjct  126  YDVSLVDGFNIPVAVKPLKGTGNCTIAGCDKDLRRNCPKELSVKTSNHGKTVACRSACDV  185

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            F+ D +CCR  YG P  C P+ YSK+FK+ACP+  SYA+D PS I +CSS  Y  TFC
Sbjct  186  FDTDEYCCRGLYGGPSVCHPTYYSKLFKSACPTAYSYAYDDPSSIFTCSSADYVITFC  243



>gb|KDP32764.1| hypothetical protein JCGZ_12056 [Jatropha curcas]
Length=285

 Score =   129 bits (325),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 78/118 (66%), Gaps = 1/118 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP+ V  I     C + GC   +R+ CP+EL  V  NG V+AC+SAC  F
Sbjct  123  YDVSLVDGFNLPLLVTPINGVGNCSVAGCYMDLRSTCPSEL-AVKSNGKVIACRSACDVF  181

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            N D +CCR  YG+P  C+P+ YSK FK ACP+  SYA+D P+ I +CS   Y  TFCP
Sbjct  182  NTDEYCCRGVYGNPVVCQPTYYSKKFKEACPTAYSYAYDDPTSIFTCSGTDYVITFCP  239



>ref|XP_011001430.1| PREDICTED: thaumatin-like protein [Populus euphratica]
Length=285

 Score =   129 bits (325),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 77/117 (66%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP++V  I     C + GC   +RN CP+EL  V   G V+AC+SAC  F
Sbjct  127  YDVSLVDGFNLPITVTPINGKGNCSVAGCDADLRNTCPSEL-AVKSKGKVIACRSACDVF  185

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            N D +CCR  YG+P  C+P+ YSK FK ACP+  SYA+D PS I +C+   Y  TFC
Sbjct  186  NTDEYCCRGLYGNPRVCQPTFYSKKFKEACPTAYSYAYDDPSSICTCAGTDYVITFC  242



>ref|XP_011008805.1| PREDICTED: thaumatin-like protein [Populus euphratica]
Length=247

 Score =   128 bits (322),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 76/120 (63%), Gaps = 0/120 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNL +S+     S KC   GC++ +   CP  LQV   N  VVACKSAC AF
Sbjct  127  YDVSLVDGYNLAISITPFKGSGKCSYAGCVRDLNMMCPVGLQVRTKNNRVVACKSACSAF  186

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N+  +CC   +G+P  CKP+ YS++FK ACP   SYA+D P+ I +C+   Y  TFCP  
Sbjct  187  NSPRYCCTGSFGTPQACKPTAYSRIFKAACPKAYSYAYDDPTSIATCTRGNYLVTFCPNQ  246



>ref|NP_001131249.1| uncharacterized protein LOC100192561 precursor [Zea mays]
 gb|ACG42500.1| osmotin-like protein precursor [Zea mays]
Length=288

 Score =   129 bits (325),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 87/131 (66%), Gaps = 10/131 (8%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSS-----KCYIGGCMKSMRNACPAELQVV----NGNGDVV  381
            YDVSLVDGYNLPV+V++ P++      KC I GC K++   CP ELQV      G   VV
Sbjct  147  YDVSLVDGYNLPVAVSAKPATGGADPNKCAIAGCAKNVNAVCPPELQVTATGSGGGKTVV  206

Query  380  ACKSACLAFNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVS-CSSD  204
            ACKSACLAF  D+FCCR  Y +P  C+ ++YS++FK+ACP+Y SYA+D  +   S C + 
Sbjct  207  ACKSACLAFGLDAFCCRGAYATPATCRGTVYSRLFKDACPAYYSYAYDIAATTASGCYAQ  266

Query  203  KYWFTFCPENF  171
            +Y  TFCP  +
Sbjct  267  EYIITFCPSRW  277



>ref|XP_006856120.1| hypothetical protein AMTR_s00059p00148770 [Amborella trichopoda]
 gb|ERN17587.1| hypothetical protein AMTR_s00059p00148770 [Amborella trichopoda]
Length=234

 Score =   128 bits (321),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 74/118 (63%), Gaps = 0/118 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLP+ V ++  +  C   GC   +R  CP EL +   +G  VACKSAC+AF
Sbjct  117  YDVSLVDGYNLPMGVNAVHGTGNCQYAGCTADLRTTCPTELVLKGQSGQTVACKSACMAF  176

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            N   +CC   YGSP  CKP+ YS++FK ACP   SYA+D  S   +C+   Y  TFCP
Sbjct  177  NTPEYCCTGAYGSPTTCKPTKYSQIFKTACPDAYSYAYDDESSTRTCTGSDYVVTFCP  234



>ref|XP_010929479.1| PREDICTED: pathogenesis-related protein 5-like [Elaeis guineensis]
Length=310

 Score =   129 bits (325),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 77/120 (64%), Gaps = 1/120 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLPV+ A      +C   GC   +  ACP ELQV +G+G VVACKSAC AF
Sbjct  126  YDVSLVDGYNLPVAAAPRVPRGRCNATGCAADLNRACPKELQV-DGDGGVVACKSACEAF  184

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
              D +CC  ++GSP  CKPS YS +FKNACP   SYAFD  +   +C +  Y   FCP N
Sbjct  185  GLDEYCCSGEFGSPGTCKPSFYSSIFKNACPRAYSYAFDDGTSTFTCKAYDYTIIFCPVN  244



>ref|XP_004501042.1| PREDICTED: pathogenesis-related protein 5-like [Cicer arietinum]
Length=250

 Score =   128 bits (321),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 74/118 (63%), Gaps = 0/118 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYN+ + + +   +  C   GC+  +   CPAELQV    G VVACKSAC AF
Sbjct  129  YDVSLVDGYNVGMGIRATGGTGDCQYAGCVADLNGNCPAELQVTEEGGSVVACKSACAAF  188

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            N   FCC  ++ SP  C P+ YS+MFK+ACPS  SYA+D  S   +CS   Y  TFCP
Sbjct  189  NTAEFCCTGEHSSPQSCSPTKYSEMFKSACPSAYSYAYDDASSTCTCSGSDYHITFCP  246



>gb|KEH26933.1| pathogenesis-related thaumatin family protein [Medicago truncatula]
Length=240

 Score =   127 bits (320),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 79/119 (66%), Gaps = 1/119 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGN-GDVVACKSACLA  357
            YDVSLVDGYNLP+++  +  + KC   GC++ +   CP  LQV + +   VV CKSAC A
Sbjct  122  YDVSLVDGYNLPLTITPLNGNGKCEFAGCVRDLNVMCPMSLQVRSSDMNQVVGCKSACYA  181

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            FN+  +CC   YGSP  CKP+ YS++FK ACP   SYAFD P+ IV+CS   Y  TFCP
Sbjct  182  FNSPEYCCTGSYGSPQACKPTSYSRIFKLACPKAYSYAFDDPTSIVTCSMANYLVTFCP  240



>ref|XP_004172611.1| PREDICTED: thaumatin-like protein-like, partial [Cucumis sativus]
Length=268

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 80/117 (68%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP++V  I  + KC + GC K +R  CP EL  V   G VVAC+SAC  F
Sbjct  103  YDVSLVDGFNLPMAVRPINGTGKCGVAGCDKDLRPECPKEL-AVKSKGKVVACRSACDVF  161

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            + D +CCR  YG+P  C+P+ YSK FK+ACP+  SYA+D P+ I +CS+  Y  TFC
Sbjct  162  DKDEYCCRGVYGNPMTCRPTFYSKKFKDACPTAYSYAYDDPTSIFTCSAADYVITFC  218



>gb|AHC69780.1| thuamatin-like protein [Quercus suber]
Length=249

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVV-NGNGDVVACKSACLA  357
            YDVSLVDGYNL +S+  I  S KC   GC+  +   CP  LQV  + N  VVACKSAC A
Sbjct  128  YDVSLVDGYNLAISITPIKGSGKCSYAGCVSDLNMMCPVGLQVRSHDNRRVVACKSACFA  187

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +GSP  CKP+ YS++FK ACP   SYA+D P+ I +C+   Y  TFCP 
Sbjct  188  FNSPRYCCTGSFGSPQACKPTAYSRIFKAACPKAYSYAYDDPTSISTCTGGNYLVTFCPH  247

Query  176  N  174
            +
Sbjct  248  H  248



>ref|XP_004140385.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus]
Length=295

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 80/117 (68%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP++V  I  + KC + GC K +R  CP EL  V   G VVAC+SAC  F
Sbjct  130  YDVSLVDGFNLPMAVRPINGTGKCGVAGCDKDLRPECPKEL-AVKSKGKVVACRSACDVF  188

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            + D +CCR  YG+P  C+P+ YSK FK+ACP+  SYA+D P+ I +CS+  Y  TFC
Sbjct  189  DKDEYCCRGVYGNPMTCRPTFYSKKFKDACPTAYSYAYDDPTSIFTCSAADYVITFC  245



>ref|XP_007160788.1| hypothetical protein PHAVU_001G016700g [Phaseolus vulgaris]
 gb|ESW32782.1| hypothetical protein PHAVU_001G016700g [Phaseolus vulgaris]
Length=248

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 76/117 (65%), Gaps = 0/117 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYN+ + V +   +  C   GC+  +  ACP ELQV +G G VVACKSAC AF
Sbjct  126  YDVSLVDGYNVGMGVRATGGTGDCRYAGCVADLNGACPTELQVRDGGGAVVACKSACAAF  185

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            N   FCC   +G+P  C P+ YS++FK+ACP+  SYA+D  S   +CS+  Y  TFC
Sbjct  186  NTAEFCCTGDHGTPQTCSPTHYSEIFKSACPTAYSYAYDDASSTFTCSNSDYVITFC  242



>dbj|BAJ93087.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=287

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 74/117 (63%), Gaps = 0/117 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP++V  +     C + GC   +R+ CPAEL V   +G   AC+SAC  F
Sbjct  125  YDVSLVDGFNLPITVTPVNGRGNCSVAGCDGDLRDTCPAELSVKGPSGKTAACRSACDVF  184

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            N D +CCR ++G P  C P+ YSK FK ACPS  SYA+D PS +  CS   Y  TFC
Sbjct  185  NTDQYCCRGKFGGPSTCPPTPYSKKFKEACPSAYSYAYDDPSSLFQCSGADYIITFC  241



>gb|KGN50964.1| hypothetical protein Csa_5G374740 [Cucumis sativus]
Length=307

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 80/117 (68%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP++V  I  + KC + GC K +R  CP EL  V   G VVAC+SAC  F
Sbjct  142  YDVSLVDGFNLPMAVRPINGTGKCGVAGCDKDLRPECPKEL-AVKSKGKVVACRSACDVF  200

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            + D +CCR  YG+P  C+P+ YSK FK+ACP+  SYA+D P+ I +CS+  Y  TFC
Sbjct  201  DKDEYCCRGVYGNPMTCRPTFYSKKFKDACPTAYSYAYDDPTSIFTCSAADYVITFC  257



>gb|AAA32875.1| thaumatin-like protein [Arabidopsis thaliana]
 prf||2106421A thaumatin-like protein
Length=243

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 79/121 (65%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGD-VVACKSACLA  357
            YDVSLVDGYNL +S+  +  S +C   GC+  +   CP  LQV + NG  VVACKSAC A
Sbjct  121  YDVSLVDGYNLAMSIMPVKGSGQCTYAGCVSDLNQMCPVGLQVRSRNGKRVVACKSACSA  180

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  CKP+ YSK+FK ACP   SYA+D P+ I +CS   Y  TFCP 
Sbjct  181  FNSPQYCCTGLFGNPQSCKPTAYSKIFKVACPKAYSYAYDEPTSIATCSKANYIVTFCPH  240

Query  176  N  174
            +
Sbjct  241  H  241



>ref|XP_010529666.1| PREDICTED: pathogenesis-related protein 5-like [Tarenaya hassleriana]
Length=242

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 79/121 (65%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVN-GNGDVVACKSACLA  357
            YDVSLVDGYN+ + + ++  S  C   GC+  +   CP+EL+VV+ G GDV ACKSACLA
Sbjct  121  YDVSLVDGYNVEMGIRALGGSGDCQYAGCVSDVNAICPSELRVVDPGTGDVAACKSACLA  180

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  FCC   + +P+ C P+ +S MFKNACPS  SYA+D  S   +C+   Y  TFCP 
Sbjct  181  FNSPEFCCTGDHATPETCSPTKFSGMFKNACPSAYSYAYDDASSTCTCTGSDYLITFCPT  240

Query  176  N  174
             
Sbjct  241  G  241



>gb|KEH36134.1| pathogenesis-related thaumatin family protein [Medicago truncatula]
Length=250

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 75/118 (64%), Gaps = 0/118 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYN+ + + +   +  C   GC+  + + CPAELQV    G VVACKSAC AF
Sbjct  129  YDVSLVDGYNVGIGIQATRGTGDCQYAGCVADLNSHCPAELQVTEVGGSVVACKSACAAF  188

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            N + FCC  ++ SP  C  + YS+MFK+ACPS  SYA+D  S   +CS   Y  TFCP
Sbjct  189  NTEEFCCTGEHSSPQSCSSTQYSEMFKSACPSAYSYAYDDASSTCTCSESDYHITFCP  246



>ref|XP_010519216.1| PREDICTED: thaumatin-like protein [Tarenaya hassleriana]
Length=243

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 79/121 (65%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNG-DVVACKSACLA  357
            YDVSLVDGYNL +S+  +  S +C   GC+  +   CP  LQV + NG  VVACKSAC A
Sbjct  121  YDVSLVDGYNLAMSIQPVKGSGQCSYAGCVSDLNRMCPVGLQVRSRNGKQVVACKSACSA  180

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  C+P+ YSK+FK ACP   SYA+D P+ I +CS   Y  TFCP 
Sbjct  181  FNSPRYCCTGSFGNPQSCRPTAYSKIFKAACPKAYSYAYDDPTSIATCSKANYLVTFCPH  240

Query  176  N  174
            +
Sbjct  241  H  241



>ref|XP_007018987.1| Pathogenesis-related thaumatin superfamily protein [Theobroma 
cacao]
 gb|EOY16212.1| Pathogenesis-related thaumatin superfamily protein [Theobroma 
cacao]
Length=283

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 79/117 (68%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP++V  I     C + GC   +R +CP+EL V   NG V+AC+SAC  F
Sbjct  120  YDVSLVDGFNLPLAVTPINGRGNCTVAGCDSDLRKSCPSELSV-KANGKVIACRSACDIF  178

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            N D +CCR  YG+P  C+P+ YSK FK+ACP+  SYA+D P+ I +CS   Y  TFC
Sbjct  179  NTDEYCCRGLYGNPVVCQPTYYSKKFKSACPTAYSYAYDDPTSIFTCSGPDYVITFC  235



>gb|ABL86687.1| TLP1 [Gossypium barbadense]
Length=244

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 80/118 (68%), Gaps = 1/118 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YD+SLVDGYN+ V+V ++  +  C   GC+  +   CPAELQ+ + +G VVACKSAC AF
Sbjct  126  YDISLVDGYNMAVAVKAVGGTGTCQYAGCVNDLNTNCPAELQMTD-SGSVVACKSACAAF  184

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            N   +CC   +G+P  C P++YS++FKNACP+  SYA+D  +  ++C+   Y  TFCP
Sbjct  185  NTPEYCCTGAHGTPQTCSPTMYSQLFKNACPTAYSYAYDDATSTMTCTGADYLITFCP  242



>ref|XP_006451631.1| hypothetical protein CICLE_v10009291mg [Citrus clementina]
 ref|XP_006490768.1| PREDICTED: thaumatin-like protein-like [Citrus sinensis]
 gb|ESR64871.1| hypothetical protein CICLE_v10009291mg [Citrus clementina]
 gb|KDO63812.1| hypothetical protein CISIN_1g025749mg [Citrus sinensis]
Length=248

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 78/120 (65%), Gaps = 1/120 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYN+ +S+  I  S KC   GC+  +   CPA LQV   N  VVACKSAC AF
Sbjct  128  YDVSLVDGYNIAMSILPIRGSGKCSYAGCVSDLNLMCPAGLQV-RSNSRVVACKSACFAF  186

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N+  +CC   +G+P  CKP+ YS++FK ACP   SYA+D P+ I +C+   Y  TFCP +
Sbjct  187  NSPRYCCTGSFGNPQSCKPTAYSRIFKAACPRAYSYAYDDPTSIATCTGSNYLLTFCPRH  246



>ref|XP_008465794.1| PREDICTED: thaumatin-like protein [Cucumis melo]
Length=285

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 80/117 (68%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP++V  I  + KC + GC + +R  CP EL  V   G VVAC+SAC  F
Sbjct  120  YDVSLVDGFNLPMAVRPINGTGKCGVAGCDRDLRPECPKEL-AVKSKGKVVACRSACDVF  178

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            + D +CCR  YG+P  C+P+ YSK FK+ACP+  SYA+D P+ I +CS+  Y  TFC
Sbjct  179  DKDEYCCRGVYGNPVTCRPTFYSKKFKDACPTAYSYAYDDPTSIFTCSAADYVITFC  235



>ref|XP_006416627.1| hypothetical protein EUTSA_v10008614mg [Eutrema salsugineum]
 gb|ESQ34980.1| hypothetical protein EUTSA_v10008614mg [Eutrema salsugineum]
Length=244

 Score =   126 bits (316),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 80/121 (66%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGD-VVACKSACLA  357
            YDVSLVDGYNL +S+  +  S +C   GC++ +   CP  LQV + NG  VVACKSAC A
Sbjct  122  YDVSLVDGYNLAMSIMPVKGSGQCSYAGCVRDLNRMCPVGLQVRSRNGKRVVACKSACSA  181

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  CKP+ YSK+FK ACP   SYA+D P+ I +CS   Y  TFCP 
Sbjct  182  FNSPQYCCTGSFGNPLSCKPTAYSKIFKVACPKAYSYAYDDPTSIATCSKANYILTFCPH  241

Query  176  N  174
            +
Sbjct  242  H  242



>ref|XP_006386379.1| hypothetical protein POPTR_0002s08760g [Populus trichocarpa]
 gb|ERP64176.1| hypothetical protein POPTR_0002s08760g [Populus trichocarpa]
Length=260

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 78/117 (67%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP++V  +     C + GC   +R+ CP+EL  V  NG V+AC+SAC  F
Sbjct  101  YDVSLVDGFNLPIAVTPVNGKGNCSVAGCDADLRDTCPSEL-AVKSNGKVIACRSACDVF  159

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            N D +CCR  YG+P  C+P+ YSK FK ACP+  SYA+D P+ I +CS   Y  +FC
Sbjct  160  NTDEYCCRGVYGNPVVCQPTYYSKKFKEACPTAYSYAYDDPTSIFTCSGTDYIVSFC  216



>ref|XP_004959962.1| PREDICTED: pathogenesis-related protein 5-like [Setaria italica]
Length=281

 Score =   127 bits (318),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 76/117 (65%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP+ +  +     C   GC   +R  CP+EL  V  NG  VAC+SAC  F
Sbjct  122  YDVSLVDGFNLPMVIKPVNGQGNCSAAGCDGDLRQTCPSEL-AVRANGRTVACRSACDVF  180

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            N D +CCR Q+G+P  C+P+ YSK FK ACP+  SYA+D P+ I +CS+  Y  TFC
Sbjct  181  NTDQYCCRGQFGNPATCQPTFYSKKFKEACPTAYSYAYDDPTSIFTCSNADYIITFC  237



>ref|XP_008463807.1| PREDICTED: thaumatin-like protein [Cucumis melo]
Length=250

 Score =   126 bits (316),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVV-NGNGDVVACKSACLA  357
            YDVSLVDGYNL +S+     S KC   GC+  +   CP  LQV  + N  VVACKSAC A
Sbjct  129  YDVSLVDGYNLAISITPSKGSGKCSYAGCVSDLNMMCPVGLQVRSHDNRRVVACKSACFA  188

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC  ++G+P  CKP+ YSK+FK ACP   SYA+D P+ I +C+   Y  TFCP 
Sbjct  189  FNSPRYCCTGRFGNPQSCKPTAYSKIFKTACPKAYSYAYDDPTSIATCTGGNYLVTFCPH  248

Query  176  N  174
            +
Sbjct  249  H  249



>ref|XP_002307423.1| hypothetical protein POPTR_0005s16030g [Populus trichocarpa]
 gb|EEE94419.1| hypothetical protein POPTR_0005s16030g [Populus trichocarpa]
Length=281

 Score =   127 bits (318),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 77/117 (66%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP++V  I     C + GC   +R+ CP+EL  V   G V+AC+SAC  F
Sbjct  123  YDVSLVDGFNLPIAVTPINGKGNCSVAGCDADLRDTCPSEL-AVKSKGKVIACRSACDVF  181

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            N D +CCR  YG+P  C+P+ YSK FK ACP+  SYA+D P+ I +C+   Y  TFC
Sbjct  182  NTDEYCCRGLYGNPRVCQPTFYSKKFKEACPTAYSYAYDDPTSICTCAGTDYVITFC  238



>ref|XP_003634206.1| PREDICTED: thaumatin-like protein [Vitis vinifera]
 emb|CBI15563.3| unnamed protein product [Vitis vinifera]
Length=244

 Score =   126 bits (316),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 77/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVV-NGNGDVVACKSACLA  357
            YDVSLVDGYNL +S+     S KC   GC+  +   CP  LQV  + N  VVACKSAC A
Sbjct  124  YDVSLVDGYNLAISITPFKGSGKCSYAGCVSDLNTMCPVGLQVRSHDNRRVVACKSACSA  183

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +GSP  CKP+ YSK+FK ACP   SYA+D P+ I +C+   Y  TFCP 
Sbjct  184  FNSPRYCCTGSFGSPQSCKPTAYSKIFKAACPRAYSYAYDDPTSIATCTGGNYLVTFCPH  243

Query  176  N  174
            +
Sbjct  244  H  244



>ref|XP_004137499.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus]
 ref|XP_004163817.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus]
 gb|KGN64169.1| Protein P21 [Cucumis sativus]
Length=250

 Score =   126 bits (316),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVV-NGNGDVVACKSACLA  357
            YDVSLVDGYNL +S+     S KC   GC+  +   CP  LQV  + N  VVACKSAC A
Sbjct  129  YDVSLVDGYNLAISITPSKGSGKCSYAGCVSDLNMMCPVGLQVRSHDNRRVVACKSACFA  188

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC  ++G+P  CKP+ YSK+FK ACP   SYA+D P+ I +C+   Y  TFCP 
Sbjct  189  FNSPRYCCTGRFGNPQSCKPTAYSKIFKTACPKAYSYAYDDPTSIATCTGGNYLVTFCPH  248

Query  176  N  174
            +
Sbjct  249  H  249



>ref|XP_011027593.1| PREDICTED: thaumatin-like protein [Populus euphratica]
Length=281

 Score =   127 bits (318),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 78/117 (67%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP++V  +     C + GC   +R+ CP+EL  V  NG V+AC+SAC  F
Sbjct  123  YDVSLVDGFNLPIAVTPVNGKGNCSVAGCDADLRDTCPSEL-AVKSNGKVIACRSACDVF  181

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            N D +CCR  YG+P  C+P+ YSK FK ACP+  SYA+D P+ I +CS   Y  +FC
Sbjct  182  NTDEYCCRGVYGNPVVCQPTYYSKKFKEACPTAYSYAYDDPTSIFTCSGTDYIVSFC  238



>ref|XP_011012813.1| PREDICTED: thaumatin-like protein [Populus euphratica]
Length=281

 Score =   127 bits (318),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 78/117 (67%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP++V  +     C + GC   +R+ CP+EL  V  NG V+AC+SAC  F
Sbjct  123  YDVSLVDGFNLPIAVTPVNGKGNCSVAGCDADLRDTCPSEL-AVKSNGKVIACRSACDVF  181

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            N D +CCR  YG+P  C+P+ YSK FK ACP+  SYA+D P+ I +CS   Y  +FC
Sbjct  182  NTDEYCCRGVYGNPVVCQPTYYSKKFKEACPTAYSYAYDDPTSIFTCSGTDYIVSFC  238



>emb|CAN59843.1| hypothetical protein VITISV_030359 [Vitis vinifera]
Length=243

 Score =   125 bits (315),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 77/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVV-NGNGDVVACKSACLA  357
            YDVSLVDGYNL +S+     S KC   GC+  +   CP  LQV  + N  VVACKSAC A
Sbjct  123  YDVSLVDGYNLAISITPFKGSGKCSYAGCVSDLNTMCPVGLQVRSHDNRRVVACKSACSA  182

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +GSP  CKP+ YSK+FK ACP   SYA+D P+ I +C+   Y  TFCP 
Sbjct  183  FNSPRYCCTGSFGSPQSCKPTAYSKIFKAACPRAYSYAYDDPTSIATCTGGNYLVTFCPH  242

Query  176  N  174
            +
Sbjct  243  H  243



>gb|ABL86688.1| TLP2 [Gossypium barbadense]
Length=187

 Score =   124 bits (311),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 80/118 (68%), Gaps = 1/118 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YD+SLVDGYN+ V+V ++  +  C   GC+  +   CPAELQ+++ +G VVACKSAC AF
Sbjct  69   YDISLVDGYNMAVAVKAVGGTGTCQYAGCVNDLNTNCPAELQMMD-SGSVVACKSACAAF  127

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            N   +CC   +G+P  C P+ YS++FKNACP+  SYA+D  +  ++C+   Y  TFCP
Sbjct  128  NMPEYCCTGAHGTPQTCSPTKYSQLFKNACPTAYSYAYDDATSTMTCTGADYLITFCP  185



>ref|NP_001031064.1| Thaumatin-like protein [Arabidopsis thaliana]
 gb|AEE29691.1| Thaumatin-like protein [Arabidopsis thaliana]
Length=244

 Score =   125 bits (315),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 79/121 (65%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGD-VVACKSACLA  357
            YDVSLVDGYNL +S+  +  S +C   GC+  +   CP  LQV + NG  VVACKSAC A
Sbjct  122  YDVSLVDGYNLAMSIMPVKGSGQCSYAGCVSDLNQMCPVGLQVRSRNGKRVVACKSACSA  181

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  CKP+ YSK+FK ACP   SYA+D P+ I +CS   Y  TFCP 
Sbjct  182  FNSPQYCCTGLFGNPQSCKPTAYSKIFKVACPKAYSYAYDDPTSIATCSKANYIVTFCPH  241

Query  176  N  174
            +
Sbjct  242  H  242



>ref|NP_173261.1| Thaumatin-like protein [Arabidopsis thaliana]
 sp|P50699.2|TLPH_ARATH RecName: Full=Thaumatin-like protein; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE29690.1| Thaumatin-like protein [Arabidopsis thaliana]
Length=243

 Score =   125 bits (315),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 79/121 (65%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGD-VVACKSACLA  357
            YDVSLVDGYNL +S+  +  S +C   GC+  +   CP  LQV + NG  VVACKSAC A
Sbjct  121  YDVSLVDGYNLAMSIMPVKGSGQCSYAGCVSDLNQMCPVGLQVRSRNGKRVVACKSACSA  180

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  CKP+ YSK+FK ACP   SYA+D P+ I +CS   Y  TFCP 
Sbjct  181  FNSPQYCCTGLFGNPQSCKPTAYSKIFKVACPKAYSYAYDDPTSIATCSKANYIVTFCPH  240

Query  176  N  174
            +
Sbjct  241  H  241



>ref|XP_009360173.1| PREDICTED: thaumatin-like protein [Pyrus x bretschneideri]
Length=235

 Score =   125 bits (314),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 77/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVV-NGNGDVVACKSACLA  357
            YDVSLVDGYNL +S+     S KC   GC+  +   CP  LQV  + N  VVACKSAC A
Sbjct  114  YDVSLVDGYNLAISITPFKGSGKCSYAGCVSDLNMMCPVGLQVRSHDNHQVVACKSACSA  173

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +GSP  CKP+ YSK+FK ACP   SYA+D P+ I +C+   +  TFCP 
Sbjct  174  FNSPRYCCTGSFGSPQSCKPTAYSKIFKAACPKAYSYAYDDPTSIATCTRGNFLVTFCPH  233

Query  176  N  174
            +
Sbjct  234  H  234



>ref|XP_009356044.1| PREDICTED: thaumatin-like protein [Pyrus x bretschneideri]
Length=250

 Score =   125 bits (315),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 77/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVV-NGNGDVVACKSACLA  357
            YDVSLVDGYNL +S+     S KC   GC+  +   CP  LQV  + N  VVACKSAC A
Sbjct  129  YDVSLVDGYNLAISITPFKGSGKCSYAGCVSDLNMMCPVGLQVRSHDNRRVVACKSACSA  188

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +GSP  CKP+ YSK+FK ACP   SYA+D P+ I +C+   Y  TFCP 
Sbjct  189  FNSPRYCCTGSFGSPQSCKPTAYSKIFKAACPKAYSYAYDDPTSIATCTRGNYLVTFCPH  248

Query  176  N  174
            +
Sbjct  249  H  249



>ref|XP_010459436.1| PREDICTED: thaumatin-like protein [Camelina sativa]
Length=245

 Score =   125 bits (314),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 79/121 (65%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGD-VVACKSACLA  357
            YDVSLVDGYNL +S+  +  S +C   GC+  +   CP  LQV + NG  VVACKSAC A
Sbjct  121  YDVSLVDGYNLAMSIMPVKGSGQCSYAGCVSDLNQMCPVGLQVRSRNGKRVVACKSACSA  180

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  CKP+ YSK+FK ACP   SYA+D P+ I +CS   Y  TFCP 
Sbjct  181  FNSPQYCCTGLFGNPQSCKPTAYSKIFKVACPKAYSYAYDDPTSIATCSKANYIVTFCPH  240

Query  176  N  174
            +
Sbjct  241  H  241



>ref|XP_004250343.2| PREDICTED: pathogenesis-related protein 5 [Solanum lycopersicum]
Length=287

 Score =   126 bits (317),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 76/117 (65%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+N+P+SV  +     C + GC   +R  CP+EL V N +G V+ C+SAC  F
Sbjct  124  YDVSLVDGFNVPISVTPLNGKGNCSVAGCNGDLRQNCPSELAVKN-DGKVIGCRSACDVF  182

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            N D +CCR  YG+P  C+P+ YSK FK  CP+  SYA+D P+ I +CS   Y  TFC
Sbjct  183  NTDEYCCRGNYGNPSTCQPTFYSKKFKEDCPTAYSYAYDDPTSIFTCSGTDYVVTFC  239



>emb|CBI34998.3| unnamed protein product [Vitis vinifera]
Length=205

 Score =   124 bits (311),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  413  LQVVNGNGDVVACKSACLAFNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDR  234
            LQV++ N +VVACKSACLAFN D FCCRN+YG+P+KCKPS+YSKMFK ACPSY SYAFD 
Sbjct  118  LQVLSNNMEVVACKSACLAFNLDMFCCRNEYGTPEKCKPSVYSKMFKGACPSYYSYAFDT  177

Query  233  PSPIVSCSSDKYWFTFCPENF  171
            P+P+V+C S +Y  TFCP N+
Sbjct  178  PAPLVNCPSKEYIITFCPSNW  198



>gb|KEH40091.1| pathogenesis-related thaumatin family protein [Medicago truncatula]
Length=249

 Score =   125 bits (314),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 75/120 (63%), Gaps = 1/120 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYN  + V +   +  C   GC+  +   CPAEL+V N  G VVACKSACLAF
Sbjct  129  YDVSLVDGYNAGMGVWATGGTGDCQYAGCVADLNGGCPAELRV-NSGGSVVACKSACLAF  187

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N + FCC  Q+ +P  C P+ YS++FK ACP+  SYA+D  S   +CS   Y  TFCP  
Sbjct  188  NMEEFCCTGQHATPQTCSPTHYSEIFKKACPTAYSYAYDDASSTCTCSGSDYHITFCPNG  247



>emb|CAB53479.1| CAA30376.1 protein [Oryza sativa]
Length=749

 Score =   131 bits (329),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 58/117 (50%), Positives = 77/117 (66%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP+ V  +     C + GC   +R++CP+EL     NG  VAC+SAC  F
Sbjct  592  YDVSLVDGFNLPMVVRPLNGEGNCSVAGCDGDLRDSCPSELSK-KVNGRTVACRSACDVF  650

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            + D +CCR  YG+P  C+P+ YSK FK ACP+  SYA+D P+ I +CS+  Y  TFC
Sbjct  651  DTDQYCCRGMYGNPSTCQPTFYSKKFKAACPTAYSYAYDDPTSIFTCSNADYTITFC  707



>ref|XP_004235810.1| PREDICTED: thaumatin-like protein [Solanum lycopersicum]
Length=245

 Score =   125 bits (314),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGN-GDVVACKSACLA  357
            YDVSLVDGYNL +SV  +    KC   GC+  +   CPA LQV + +   VVACKSAC A
Sbjct  125  YDVSLVDGYNLAISVTPVRGKGKCSYAGCVSDLNTMCPAGLQVRSHDKSQVVACKSACSA  184

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  CKP+ YS++FK ACP   SYA+D P+ I +C+   Y  TFCP 
Sbjct  185  FNSPRYCCTGTFGNPQTCKPTAYSRIFKTACPKAYSYAYDDPTSIATCTGSSYVLTFCPH  244

Query  176  N  174
            +
Sbjct  245  H  245



>gb|ACH60847.1| thaumatin-like protein [Pseudotsuga menziesii]
Length=115

 Score =   121 bits (304),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 73/114 (64%), Gaps = 0/114 (0%)
 Frame = -2

Query  515  DGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAFNADSFC  336
            DGYNLP+++A    S KC   GC+  +   CP  LQV N  G V+ACKSAC AF+   +C
Sbjct  1    DGYNLPIAIAPRRGSGKCTYAGCISDLNLNCPPSLQVRNEQGCVMACKSACFAFSTPQYC  60

Query  335  CRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            C   YGSP  C+P+ +S++FKNACP   SYA+D PS +V+CS   Y  TFCP  
Sbjct  61   CTGSYGSPQSCRPTSFSRLFKNACPRAYSYAYDDPSSLVTCSGADYLITFCPHQ  114



>gb|ACH60838.1| thaumatin-like protein [Pseudotsuga menziesii]
 gb|ACH60839.1| thaumatin-like protein [Pseudotsuga menziesii]
 gb|ACH60840.1| thaumatin-like protein [Pseudotsuga menziesii]
 gb|ACH60841.1| thaumatin-like protein [Pseudotsuga menziesii]
 gb|ACH60842.1| thaumatin-like protein [Pseudotsuga menziesii]
 gb|ACH60843.1| thaumatin-like protein [Pseudotsuga menziesii]
 gb|ACH60844.1| thaumatin-like protein [Pseudotsuga menziesii]
 gb|ACH60845.1| thaumatin-like protein [Pseudotsuga menziesii]
 gb|ACH60846.1| thaumatin-like protein [Pseudotsuga menziesii]
 gb|ACH60848.1| thaumatin-like protein [Pseudotsuga menziesii]
 gb|ACH60849.1| thaumatin-like protein [Pseudotsuga menziesii]
 gb|ACH60850.1| thaumatin-like protein [Pseudotsuga menziesii]
 gb|ACH60851.1| thaumatin-like protein [Pseudotsuga menziesii]
 gb|ACH60852.1| thaumatin-like protein [Pseudotsuga menziesii]
 gb|ACH60853.1| thaumatin-like protein [Pseudotsuga menziesii]
 gb|ACH60854.1| thaumatin-like protein [Pseudotsuga menziesii]
 gb|ACH60855.1| thaumatin-like protein [Pseudotsuga menziesii]
 gb|ACH60856.1| thaumatin-like protein [Pseudotsuga menziesii]
 gb|ACH60857.1| thaumatin-like protein [Pseudotsuga menziesii]
 gb|ACH60858.1| thaumatin-like protein [Pseudotsuga menziesii]
 gb|ACH60859.1| thaumatin-like protein [Pseudotsuga menziesii]
Length=115

 Score =   121 bits (304),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 73/114 (64%), Gaps = 0/114 (0%)
 Frame = -2

Query  515  DGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAFNADSFC  336
            DGYNLP+++A    S KC   GC+  +   CP  LQV N  G V+ACKSAC AF+   +C
Sbjct  1    DGYNLPIAIAPRRGSGKCTYAGCISDLNLNCPPSLQVKNEQGCVMACKSACFAFSTPQYC  60

Query  335  CRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            C   YGSP  C+P+ +S++FKNACP   SYA+D PS +V+CS   Y  TFCP  
Sbjct  61   CTGSYGSPQSCRPTSFSRLFKNACPRAYSYAYDDPSSLVTCSGADYLITFCPHQ  114



>gb|ABR17407.1| unknown [Picea sitchensis]
Length=246

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 79/118 (67%), Gaps = 0/118 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYN+P+S+ +   +  C   GC   +R++CPAEL V   +G V+AC+SAC AF
Sbjct  125  YDVSLVDGYNVPLSIRAAGGTGDCRTAGCSSDLRSSCPAELSVKGSDGRVIACRSACNAF  184

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
             +  +CC   +G+P  C P+ YS++FK ACP+  SYA+D  S +V+C+   Y  TFCP
Sbjct  185  GSAEYCCTGDHGNPQTCSPNKYSQIFKAACPTAYSYAYDDASSLVTCTHADYTITFCP  242



>gb|KHG18980.1| hypothetical protein F383_08602 [Gossypium arboreum]
Length=240

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 76/120 (63%), Gaps = 1/120 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYN+ +S+     + KC   GC+  +   CP  LQV + N  VVACKSAC AF
Sbjct  121  YDVSLVDGYNIAMSITPFKGAGKCSYAGCVSDLNLMCPVALQVRD-NKQVVACKSACFAF  179

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N+  +CC   +GSP  CKP+ YSK+FK ACP   SYA+D P+ I +CS   Y  TFCP  
Sbjct  180  NSPRYCCTGSFGSPQSCKPTAYSKIFKTACPKAYSYAYDDPTSIATCSRGNYLVTFCPHR  239



>ref|XP_004301252.1| PREDICTED: thaumatin-like protein-like [Fragaria vesca subsp. 
vesca]
Length=250

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 77/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVV-NGNGDVVACKSACLA  357
            YDVSLVDGYNL +S+     S KC   GC+  +   CP  LQV  + N  VVACKSAC A
Sbjct  127  YDVSLVDGYNLAISITPYQGSGKCSYAGCVSDLNMMCPVGLQVRSHDNRRVVACKSACSA  186

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   YGSP  CKP+ YS++FK ACP   SYA+D P+ I +C+   Y  TFCP 
Sbjct  187  FNSPRYCCTGSYGSPQSCKPTAYSRIFKTACPRAYSYAYDDPTSIATCTRGNYVVTFCPR  246

Query  176  N  174
            +
Sbjct  247  H  247



>ref|XP_006434928.1| hypothetical protein CICLE_v10002288mg [Citrus clementina]
 gb|ESR48168.1| hypothetical protein CICLE_v10002288mg [Citrus clementina]
Length=245

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 76/118 (64%), Gaps = 1/118 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYN+ + V ++     C   GC+  +   CPAELQV + +G VVACKSAC AF
Sbjct  128  YDVSLVDGYNIGLGVKAVGGKGDCQYAGCVADLNGNCPAELQVTD-SGSVVACKSACAAF  186

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            N   FCC   + +PD C P+ YS++FK+ACP+  SYA+D  S   +CS   Y  TFCP
Sbjct  187  NTPEFCCTGDHATPDTCSPTQYSQLFKHACPTAYSYAYDDASSTCTCSGSDYLITFCP  244



>ref|XP_010274714.1| PREDICTED: thaumatin-like protein [Nelumbo nucifera]
Length=246

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 77/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVN-GNGDVVACKSACLA  357
            YDVSLVDGYNLP+S+     + KC   GC+  +   CP  LQV +  N  VVACKSAC A
Sbjct  126  YDVSLVDGYNLPISITPFRGTGKCNYAGCISDLNEMCPVGLQVRSRDNRRVVACKSACFA  185

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            F +  +CC   YG+P  CKP+ YS++FK+ACP   SYA+D P+ I +C    Y  TFCP 
Sbjct  186  FKSPKYCCTGTYGNPQSCKPTAYSRIFKSACPKAYSYAYDDPTSIETCRGGSYLVTFCPH  245

Query  176  N  174
            +
Sbjct  246  H  246



>ref|XP_006473452.1| PREDICTED: pathogenesis-related protein 5-like [Citrus sinensis]
 gb|KDO84436.1| hypothetical protein CISIN_1g026001mg [Citrus sinensis]
Length=245

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 76/118 (64%), Gaps = 1/118 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYN+ + V ++     C   GC+  +   CPAELQV + +G VVACKSAC AF
Sbjct  128  YDVSLVDGYNIGLGVKAVGGKGDCQYAGCVADLNGNCPAELQVTD-SGSVVACKSACAAF  186

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            N   FCC   + +PD C P+ YS++FK+ACP+  SYA+D  S   +CS   Y  TFCP
Sbjct  187  NTPEFCCTGDHATPDTCSPTQYSQLFKHACPTAYSYAYDDASSTCTCSGSDYLITFCP  244



>ref|XP_006303313.1| hypothetical protein CARUB_v10010135mg [Capsella rubella]
 gb|EOA36211.1| hypothetical protein CARUB_v10010135mg [Capsella rubella]
Length=243

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 79/121 (65%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGD-VVACKSACLA  357
            YDVSLVDGYNL +S+  +  S KC   GC+  +   CP  LQV + NG  V+ACKSAC A
Sbjct  121  YDVSLVDGYNLAMSIMPVKGSGKCSYAGCVSDLNRMCPVGLQVRSRNGKRVLACKSACSA  180

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  CKP+ YSK+FK ACP   SYA+D P+ I +CS   Y  TFCP 
Sbjct  181  FNSPQYCCTGLFGNPQSCKPTAYSKIFKVACPKAYSYAYDDPTSIATCSKANYIVTFCPH  240

Query  176  N  174
            +
Sbjct  241  H  241



>gb|KHG08802.1| hypothetical protein F383_35963 [Gossypium arboreum]
Length=236

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 79/118 (67%), Gaps = 1/118 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YD+SLVDGYN+ V+V ++  +  C   GC+  +   CPAELQ+ + +G VVACKSAC AF
Sbjct  118  YDISLVDGYNMAVAVKAVGGTGTCQYAGCVNDLNTNCPAELQMTD-SGSVVACKSACAAF  176

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            N   +CC   +G+P  C P+ YS++FKNACP+  SYA+D  +  ++C+   Y  TFCP
Sbjct  177  NTPEYCCTGAHGTPQTCSPTKYSQLFKNACPTAYSYAYDDATSTMTCTGADYLITFCP  234



>ref|XP_002887494.1| hypothetical protein ARALYDRAFT_476498 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63753.1| hypothetical protein ARALYDRAFT_476498 [Arabidopsis lyrata subsp. 
lyrata]
Length=244

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 79/121 (65%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNG-DVVACKSACLA  357
            YDVSLVDGYNL +S+  +  + KC   GC+  +   CP  LQV++ +G  VVACKSAC A
Sbjct  122  YDVSLVDGYNLAMSIMPVKGTGKCTYAGCVSDLNRMCPVGLQVLSRDGKQVVACKSACSA  181

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  CKP+ YSK+FK ACP   SYA+D P+ I +CS   Y  TFCP 
Sbjct  182  FNSPRYCCTGLFGNPQSCKPTAYSKIFKVACPKAYSYAYDDPTSIATCSKANYIVTFCPH  241

Query  176  N  174
             
Sbjct  242  R  242



>ref|XP_009387350.1| PREDICTED: thaumatin-like protein 1 [Musa acuminata subsp. malaccensis]
Length=235

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 79/119 (66%), Gaps = 3/119 (3%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSS-SKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLA  357
            YDVS VDG+N+PVSV  +PS  S C    C  ++   CP ELQ++  +G VV CKSACLA
Sbjct  119  YDVSCVDGFNVPVSV--VPSGGSNCDSTSCQTNINARCPTELQMLAPDGSVVGCKSACLA  176

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            F+ D +CCR QYG PD CKP+ YSKMFK+ACP   SYA+D  S   +C    Y  T+CP
Sbjct  177  FDTDEYCCRGQYGGPDTCKPTSYSKMFKDACPQAYSYAYDDKSSTFTCVGANYDITYCP  235



>ref|XP_010672697.1| PREDICTED: thaumatin-like protein [Beta vulgaris subsp. vulgaris]
Length=249

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 77/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSS-KCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLA  357
            YDVSLVDGYNL +S+     ++ +C   GC+  +   CP  LQV    G VVACKSAC A
Sbjct  127  YDVSLVDGYNLAISMVPFKGAAGQCAPAGCISDLNTMCPTGLQVRGARGGVVACKSACSA  186

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  CKP+ YSK+FK ACP   SYA+D P+ I +C+   Y  TFCP 
Sbjct  187  FNSPRYCCTGNFGTPQSCKPTAYSKIFKTACPRAYSYAYDDPTSIATCTGANYLVTFCPH  246

Query  176  N  174
            +
Sbjct  247  H  247



>ref|XP_006341532.1| PREDICTED: thaumatin-like protein-like [Solanum tuberosum]
Length=247

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGN-GDVVACKSACLA  357
            YDVSLVDGYNL +SV  +    KC   GC+  +   CPA LQV + +   VVACKSAC A
Sbjct  127  YDVSLVDGYNLAISVTPVRGKGKCSYAGCVSDLNTMCPAGLQVRSHDKSQVVACKSACSA  186

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  CKP+ YS++FK ACP   SYA+D P+ I +C+   Y  TFCP 
Sbjct  187  FNSPRYCCTGTFGNPQTCKPTAYSRIFKTACPKAYSYAYDDPTSISTCTGSSYVLTFCPH  246

Query  176  N  174
            +
Sbjct  247  H  247



>ref|XP_009799009.1| PREDICTED: pathogenesis-related protein 5-like [Nicotiana sylvestris]
Length=285

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 74/117 (63%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+N+P+SV  I     C I GC   +R  CP EL  V  NG VVAC+SAC  F
Sbjct  123  YDVSLVDGFNVPISVTPINGKGNCSIAGCDGDLRQDCPKEL-AVKANGKVVACRSACDVF  181

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            + D +CCR  YG+P  C+P+ YSK FK  CP+  SYA+D P+ I +CS   Y   FC
Sbjct  182  DTDEYCCRGNYGNPTTCQPTYYSKKFKQVCPTAYSYAYDDPTSIYTCSGTDYVIAFC  238



>ref|XP_007209509.1| hypothetical protein PRUPE_ppa010418mg [Prunus persica]
 gb|EMJ10708.1| hypothetical protein PRUPE_ppa010418mg [Prunus persica]
Length=250

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 77/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVV-NGNGDVVACKSACLA  357
            YDVSLVDGYNL +S+     S KC   GC+  +   CP  LQV  + N  VVACKSAC A
Sbjct  129  YDVSLVDGYNLAISIQPFKGSGKCSYAGCISDLNMMCPVGLQVRSHDNRRVVACKSACSA  188

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +GSP  CKP+ YSK+FK ACP   SYA+D P+ I +C+   Y  TFCP 
Sbjct  189  FNSPRYCCTGSFGSPQSCKPTAYSKIFKAACPKAYSYAYDDPTSIATCTRGNYVVTFCPH  248

Query  176  N  174
            +
Sbjct  249  H  249



>gb|ADV19265.1| unknown [Helleborus orientalis]
Length=140

 Score =   122 bits (305),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 76/121 (63%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGD-VVACKSACLA  357
            YDVSLVDGYNL +S+       +C   GC+  +   CP  LQV + +   VVACKSAC A
Sbjct  20   YDVSLVDGYNLAISITPFRGKGRCSSAGCVSDLNAMCPVGLQVKSHDSRRVVACKSACSA  79

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   YG+P  CKP+ YS++FK ACP   SYA+D P+ I +CS   Y  TFCP 
Sbjct  80   FNSPRYCCTGVYGNPQSCKPTAYSRIFKTACPKAYSYAYDDPTSIATCSGGSYLITFCPH  139

Query  176  N  174
            +
Sbjct  140  H  140



>ref|NP_001147654.1| LOC100281263 precursor [Zea mays]
 gb|ACG28263.1| thaumatin-like protein precursor [Zea mays]
 gb|ACL54179.1| unknown [Zea mays]
 gb|AFW69212.1| putative thaumatin domain family protein [Zea mays]
Length=249

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 82/122 (67%), Gaps = 3/122 (2%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASI-PSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLA  357
            YDVSLVDGYN+P+++  +  S ++C   GC+  +   CPA L  V G G VV C+SAC A
Sbjct  128  YDVSLVDGYNIPIAMTPVHGSGARCAAAGCVSDLNRVCPAGL-AVRGEGRVVGCRSACAA  186

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSD-KYWFTFCP  180
            + A  +CC  Q+GSP +CKP+ YS++FK+ACP   SYA+D P+ I++CS+   Y  TFCP
Sbjct  187  YGAPQYCCTGQFGSPQQCKPTAYSRLFKSACPKAYSYAYDDPTSILTCSAGASYVVTFCP  246

Query  179  EN  174
              
Sbjct  247  HR  248



>ref|XP_008393422.1| PREDICTED: thaumatin-like protein [Malus domestica]
Length=250

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 77/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVV-NGNGDVVACKSACLA  357
            YDVSLVDGYNL +S+     S KC   GC+  +   CP  LQV  + N  VVACKSAC A
Sbjct  129  YDVSLVDGYNLAISITPFKGSGKCSYAGCVSDLNMMCPVGLQVRSHDNRQVVACKSACSA  188

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +GSP  CKP+ YSK+FK ACP   SYA+D P+ I +C+   +  TFCP 
Sbjct  189  FNSPRYCCTGSFGSPQSCKPTAYSKIFKAACPKAYSYAYDDPTSIATCTRGNFLVTFCPH  248

Query  176  N  174
            +
Sbjct  249  H  249



>ref|XP_011075024.1| PREDICTED: thaumatin-like protein, partial [Sesamum indicum]
Length=280

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 74/117 (63%), Gaps = 0/117 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP++V  I     C + GC   +R  CP EL V    G  VAC+SAC  F
Sbjct  117  YDVSLVDGFNLPIAVTPINGRGNCSVAGCDTDLRPNCPTELAVKGNGGRNVACRSACDVF  176

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            N D +CCR  YG+P  C+P+ YSK FK ACP+  SYA+D P+ I +CS   Y  +FC
Sbjct  177  NTDEYCCRGVYGNPVTCQPTFYSKRFKQACPAAYSYAYDDPTSIFTCSGTDYVVSFC  233



>ref|XP_010498212.1| PREDICTED: thaumatin-like protein [Camelina sativa]
Length=245

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 79/121 (65%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGD-VVACKSACLA  357
            YDVSLVDGYNL +S+  +  S +C   GC+  +   CP  LQV + NG  V+ACKSAC A
Sbjct  121  YDVSLVDGYNLAMSIMPVKGSGQCSYAGCVSDLNQMCPVGLQVRSRNGKRVLACKSACSA  180

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  CKP+ YSK+FK ACP   SYA+D P+ I +CS   Y  TFCP 
Sbjct  181  FNSPQYCCTGLFGNPQSCKPTAYSKIFKVACPKAYSYAYDDPTSIATCSKANYIVTFCPH  240

Query  176  N  174
            +
Sbjct  241  H  241



>ref|XP_009104608.1| PREDICTED: thaumatin-like protein [Brassica rapa]
Length=284

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 78/117 (67%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP+SV  +     C + GC+  +R  CP EL  V  NG V++C+SAC  F
Sbjct  124  YDVSLVDGFNLPMSVTPLNGKGNCSVAGCVADLRPKCPREL-AVKSNGKVISCRSACDVF  182

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            + D +CCR  YG+P  C+P+ YSK+FK ACP+  SYA+D P+ I +CS   Y  +FC
Sbjct  183  DKDEYCCRGVYGNPSTCRPTYYSKLFKEACPTSYSYAYDDPTSIFTCSGTDYVISFC  239



>emb|CDX68047.1| BnaA07g20870D [Brassica napus]
Length=284

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 78/117 (67%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP+SV  +     C + GC+  +R  CP EL  V  NG V++C+SAC  F
Sbjct  124  YDVSLVDGFNLPMSVTPLNGKGNCSVAGCVADLRPKCPREL-AVKSNGKVISCRSACDVF  182

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            + D +CCR  YG+P  C+P+ YSK+FK ACP+  SYA+D P+ I +CS   Y  +FC
Sbjct  183  DKDEYCCRGVYGNPSTCRPTYYSKLFKEACPTSYSYAYDDPTSIFTCSGTDYVISFC  239



>ref|XP_008240157.1| PREDICTED: thaumatin-like protein [Prunus mume]
Length=250

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 77/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVV-NGNGDVVACKSACLA  357
            YDVSLVDGYNL +S+     S KC   GC+  +   CP  LQV  + N  VVACKSAC A
Sbjct  129  YDVSLVDGYNLAISIQPFKGSGKCSYAGCISDLNMMCPVGLQVRSHDNRRVVACKSACSA  188

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +GSP  CKP+ YSK+FK ACP   SYA+D P+ I +C+   Y  TFCP 
Sbjct  189  FNSPRYCCTGSFGSPQSCKPTAYSKIFKAACPKAYSYAYDDPTSIATCTRGNYVVTFCPH  248

Query  176  N  174
            +
Sbjct  249  H  249



>emb|CDX79230.1| BnaC06g20730D [Brassica napus]
Length=292

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 78/117 (67%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP+SV  +     C + GC+  +R  CP EL  V  NG V++C+SAC  F
Sbjct  124  YDVSLVDGFNLPMSVTPLNGKGNCSVAGCVADLRPKCPREL-AVKSNGKVISCRSACDVF  182

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            + D +CCR  YG+P  C+P+ YSK+FK ACP+  SYA+D P+ I +CS   Y  +FC
Sbjct  183  DKDEYCCRGVYGNPSTCRPTYYSKLFKEACPTSYSYAYDDPTSIFTCSGTDYVISFC  239



>ref|NP_177893.1| Pathogenesis-related thaumatin superfamily protein [Arabidopsis 
thaliana]
 gb|AAG51631.1|AC012193_13 thaumatin-like protein; 12104-13574 [Arabidopsis thaliana]
 gb|AEE36011.1| Pathogenesis-related thaumatin superfamily protein [Arabidopsis 
thaliana]
Length=356

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 81/121 (67%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP+SV  +     C + GC+  +R  CP EL  V  NG V++C+SAC  F
Sbjct  184  YDVSLVDGFNLPMSVTPMNGKGNCSVAGCVADLRPHCPQEL-AVKSNGKVISCRSACDVF  242

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            + D +CCR  YG+P  C+P+ YSK+FK ACP+  SYA+D P+ I++C++  Y  +FC   
Sbjct  243  DRDEYCCRGVYGNPVVCQPTYYSKIFKQACPTAYSYAYDDPTSIMTCTASDYVISFCSSR  302

Query  173  F  171
            F
Sbjct  303  F  303



>ref|XP_009598313.1| PREDICTED: pathogenesis-related protein 5-like [Nicotiana tomentosiformis]
Length=277

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 74/117 (63%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+N+P+SV  I     C I GC   +R  CP EL  V  NG VVAC+SAC  F
Sbjct  123  YDVSLVDGFNVPMSVTPINGKGNCSIAGCDGDLRQDCPKEL-AVKANGKVVACRSACDVF  181

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            + D +CCR  YG+P  C+P+ YSK FK  CP+  SYA+D P+ I +CS   Y   FC
Sbjct  182  DTDEYCCRGNYGNPTTCQPTYYSKKFKQVCPTAYSYAYDDPTSIFTCSGTDYVIAFC  238



>ref|XP_002892990.1| hypothetical protein ARALYDRAFT_889237 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69249.1| hypothetical protein ARALYDRAFT_889237 [Arabidopsis lyrata subsp. 
lyrata]
Length=243

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 79/121 (65%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNG-DVVACKSACLA  357
            YDVSLVDGYNL +S+  +  S +C   GC+  +   CP  LQV + NG  VVACKSAC A
Sbjct  121  YDVSLVDGYNLAMSIMPVKGSGQCSYAGCVSDLNRMCPVGLQVRSRNGKHVVACKSACSA  180

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  CKP+ YSK+FK ACP   SYA+D P+ I +CS   Y  TFCP 
Sbjct  181  FNSPQYCCTGLFGNPLSCKPTAYSKIFKVACPKAYSYAYDDPTSIATCSKANYIVTFCPH  240

Query  176  N  174
            +
Sbjct  241  H  241



>ref|XP_002273271.2| PREDICTED: thaumatin-like protein [Vitis vinifera]
 emb|CBI23858.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 80/118 (68%), Gaps = 1/118 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP+++  +  +  C + GC   +R  CP+EL  +  +G ++ACKSAC AF
Sbjct  125  YDVSLVDGFNLPITITPMKGTVNCSVAGCDADLRQKCPSEL-ALKTDGKIIACKSACEAF  183

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            N D +CCR  YG+P  C  + YS+ FK ACP   SYAFD P+ I++C++ +Y  TFCP
Sbjct  184  NTDQYCCRGAYGNPISCVATNYSRSFKQACPVAYSYAFDDPTSILTCNAPEYIVTFCP  241



>ref|XP_008801393.1| PREDICTED: pathogenesis-related protein 5-like isoform X2 [Phoenix 
dactylifera]
Length=279

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 84/138 (61%), Gaps = 1/138 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLP++ A      +C I GC+  + +ACP ELQV +G+G VVACKSAC AF
Sbjct  126  YDVSLVDGYNLPIAAAPRVPRGRCNITGCVADLNSACPKELQV-DGDGGVVACKSACEAF  184

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
              D +CC  ++G+P  CKPS YS +FK ACP   SYA+D  +   +C +  Y   FCP  
Sbjct  185  GLDKYCCSGEFGNPTTCKPSYYSSIFKTACPRAYSYAYDDGTSTFTCKAYDYTIVFCPNA  244

Query  173  Fgsgsvss*ssVQAVKSE  120
             G       S+ QA+   
Sbjct  245  NGMRRSDGFSTGQAINGH  262



>ref|XP_006302686.1| hypothetical protein CARUB_v10020795mg [Capsella rubella]
 gb|EOA35584.1| hypothetical protein CARUB_v10020795mg [Capsella rubella]
Length=269

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 79/121 (65%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNG-DVVACKSACLA  357
            YDVSLVDGYNL +S+  +  + KC   GC+  +   CP  LQV + +G  VVACKSAC A
Sbjct  147  YDVSLVDGYNLAMSIMPVKGTGKCTYAGCVSDLNRMCPVGLQVRSRDGKQVVACKSACSA  206

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  CKP+ YSK+FK ACP   SYA+D P+ I +CS   Y  TFCP 
Sbjct  207  FNSPRYCCTGLFGNPQSCKPTAYSKIFKVACPKAYSYAYDDPTSIATCSKANYVVTFCPH  266

Query  176  N  174
            +
Sbjct  267  H  267



>ref|XP_010416173.1| PREDICTED: thaumatin-like protein [Camelina sativa]
Length=245

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 79/121 (65%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNG-DVVACKSACLA  357
            YDVSLVDGYNL +S+  +  + KC   GC+  +   CP  LQV + +G  VVACKSAC A
Sbjct  123  YDVSLVDGYNLAMSIMPVKGTGKCTYAGCVSDLNRMCPVGLQVRSRDGKQVVACKSACSA  182

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  CKP+ YSK+FK ACP   SYA+D P+ I +CS   Y  TFCP 
Sbjct  183  FNSPRYCCTGLFGNPQSCKPTAYSKIFKVACPKAYSYAYDDPTSIATCSKANYVVTFCPH  242

Query  176  N  174
            +
Sbjct  243  H  243



>ref|XP_011083734.1| PREDICTED: pathogenesis-related protein 5-like [Sesamum indicum]
Length=246

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 75/118 (64%), Gaps = 0/118 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYN+ + V     S  C   GC+  +   CP ELQVV+G G VVAC+SAC AF
Sbjct  127  YDVSLVDGYNVGIGVRPSGGSGDCKYAGCVADVNANCPQELQVVDGGGAVVACRSACAAF  186

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            N   +CC   +G+P+ C P+ YS +FKNACP+  SYA+D  +   +C+   Y  TFCP
Sbjct  187  NKPEYCCSGDHGTPETCGPTQYSLIFKNACPAAYSYAYDDQTSTFTCTGADYLITFCP  244



>emb|CDP12448.1| unnamed protein product [Coffea canephora]
Length=287

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 75/117 (64%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP+ V  I  S  C I GC   +R +CP EL V   NG  VAC+SAC  F
Sbjct  124  YDVSLVDGFNLPIVVTPINGSGNCSIAGCDNDLRPSCPQELSV-KANGKTVACRSACDVF  182

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            N D +CCR  +G+P  C+P+ YSK FK ACP+  SYA+D P+ I +C+   Y   FC
Sbjct  183  NTDEYCCRGVFGNPVTCQPTFYSKRFKQACPAAYSYAYDDPTSIFTCTGTDYVVAFC  239



>ref|XP_010091351.1| hypothetical protein L484_020153 [Morus notabilis]
 gb|EXB44341.1| hypothetical protein L484_020153 [Morus notabilis]
Length=288

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 74/119 (62%), Gaps = 1/119 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP+ V  I     C I GC   +R  CPAEL V   NG  V C+SAC  F
Sbjct  126  YDVSLVDGFNLPMVVTPINGRGNCSIAGCDGDLRTTCPAELSV-KANGKTVGCRSACDVF  184

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            N D +CCR  YG+P  C+P+ YSK FK+ACP   SYA+D P+ I +CS   Y   FC +
Sbjct  185  NTDEYCCRGLYGNPVVCQPTYYSKKFKDACPKAYSYAYDDPTSIFTCSGTDYVIAFCTK  243



>ref|XP_007017454.1| Thaumatin-like protein 3 [Theobroma cacao]
 gb|EOY14679.1| Thaumatin-like protein 3 [Theobroma cacao]
Length=247

 Score =   124 bits (310),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 77/120 (64%), Gaps = 1/120 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYN+ + V ++  +  C   GC+  +   CP EL+V++ +G +VACKSAC AF
Sbjct  128  YDVSLVDGYNVALGVKAVGGTGDCQYAGCVTDLNTNCPTELRVMD-SGSIVACKSACAAF  186

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            NA  FCC   + +P  C P+ YS+MFKNACP+  SYA+D  S   +CS   Y  TFCP  
Sbjct  187  NAPEFCCTGDHATPQTCSPTQYSEMFKNACPTAYSYAYDDASSTRTCSGSDYLITFCPTE  246



>ref|XP_008801392.1| PREDICTED: pathogenesis-related protein 5-like isoform X1 [Phoenix 
dactylifera]
Length=292

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 78/118 (66%), Gaps = 1/118 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLP++ A      +C I GC+  + +ACP ELQV +G+G VVACKSAC AF
Sbjct  126  YDVSLVDGYNLPIAAAPRVPRGRCNITGCVADLNSACPKELQV-DGDGGVVACKSACEAF  184

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
              D +CC  ++G+P  CKPS YS +FK ACP   SYA+D  +   +C +  Y   FCP
Sbjct  185  GLDKYCCSGEFGNPTTCKPSYYSSIFKTACPRAYSYAYDDGTSTFTCKAYDYTIVFCP  242



>ref|NP_001058421.1| Os06g0691200 [Oryza sativa Japonica Group]
 dbj|BAD45633.1| putative thaumatin-protein [Oryza sativa Japonica Group]
 dbj|BAD54510.1| putative thaumatin-protein [Oryza sativa Japonica Group]
 dbj|BAF20335.1| Os06g0691200 [Oryza sativa Japonica Group]
 dbj|BAG98320.1| unnamed protein product [Oryza sativa Japonica Group]
Length=251

 Score =   124 bits (310),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 81/124 (65%), Gaps = 4/124 (3%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVA-SIPSSSKCYIGGCMKSMRNACPAELQVVNGNGD--VVACKSAC  363
            YDVSLVDGYN+P+++  S  S + C   GC+  +   CPA L V  G GD  VV C+SAC
Sbjct  127  YDVSLVDGYNIPIAMTPSHGSGANCVPAGCISDLNRVCPAGLAVRGGGGDNRVVGCRSAC  186

Query  362  LAFNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSD-KYWFTF  186
             A+ A  +CC  Q+GSP +CKP+ YS++FK ACP   SYA+D P+ I++CS+   Y  TF
Sbjct  187  AAYGAPQYCCTGQFGSPQQCKPTAYSRLFKTACPKAYSYAYDDPTSILTCSAGASYIVTF  246

Query  185  CPEN  174
            CP  
Sbjct  247  CPHR  250



>ref|XP_009417646.1| PREDICTED: thaumatin-like protein [Musa acuminata subsp. malaccensis]
Length=251

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNG-NGDVVACKSACLA  357
            YDVSLVDGYNL +S+A    S +C   GC+  +   CPA L V  G +  VVACKSAC A
Sbjct  131  YDVSLVDGYNLGMSMAPFRGSGQCGRAGCVSDLNEVCPAGLAVRAGSDHRVVACKSACSA  190

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            F +  +CC   +G P +CKP+ YS++FK ACP   SYAFD P+ I++C+   Y  TFCP+
Sbjct  191  FGSPRYCCTGSFGGPQQCKPTAYSRLFKAACPRAYSYAFDDPTSILTCTGASYLITFCPQ  250

Query  176  N  174
             
Sbjct  251  R  251



>ref|XP_003549422.2| PREDICTED: pathogenesis-related protein 5-like [Glycine max]
Length=248

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 75/117 (64%), Gaps = 0/117 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYN+ + V +   +  C   GC+  +   CPAELQV +G+G VVACKSACLA 
Sbjct  130  YDVSLVDGYNVGMGVRATGGTGDCQYAGCVADVNGVCPAELQVRDGSGAVVACKSACLAL  189

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            N   +CC   + +P  C P+ YS++FKNACP+  SYA+D  S   +CS   Y  TFC
Sbjct  190  NTAEYCCTGDHNTPQTCPPTHYSEIFKNACPTAYSYAYDDASSTCTCSGSDYRITFC  246



>gb|AAM62907.1| thaumatin-like protein [Arabidopsis thaliana]
 dbj|BAC42848.1| putative thaumatin [Arabidopsis thaliana]
Length=244

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNG-DVVACKSACLA  357
            YDVSLVDGYNL +S+  +  + KC   GC+  +   CP  LQV + +G  VVACKSAC A
Sbjct  122  YDVSLVDGYNLAMSIMPVKGTGKCTYAGCVSDLNRMCPVGLQVRSRDGTQVVACKSACSA  181

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  CKP+ YSK+FK ACP   SYA+D P+ I +CS   Y  TFCP 
Sbjct  182  FNSPRYCCTGLFGNPQSCKPTAYSKIFKVACPKAYSYAYDDPTSIATCSKANYVVTFCPH  241

Query  176  N  174
             
Sbjct  242  R  242



>ref|XP_008790236.1| PREDICTED: pathogenesis-related protein 5 [Phoenix dactylifera]
Length=243

 Score =   123 bits (309),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 77/120 (64%), Gaps = 1/120 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYN+ + +   P+SS C   GC+  +   CPAEL+V    G+ VAC+SAC AF
Sbjct  121  YDVSLVDGYNVGMGLRPTPASSSCQYAGCVADLNGRCPAELRVAGAAGETVACRSACEAF  180

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCS-SDKYWFTFCPE  177
                +CC   +GSP  C P+ YS++FK ACP+  SYA+D  +   +CS +D Y  TFCPE
Sbjct  181  GGPEYCCTGDHGSPSTCGPTRYSQLFKAACPAAYSYAYDDATSTFTCSAADGYLITFCPE  240



>ref|XP_007027490.1| Thaumatin-like protein 1a [Theobroma cacao]
 gb|EOY07992.1| Thaumatin-like protein 1a [Theobroma cacao]
Length=256

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 77/122 (63%), Gaps = 1/122 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP+SV     S  C    C  ++  ACP ELQV   +G V+ACKSACLAF
Sbjct  123  YDVSLVDGFNLPLSVTPQGGSDGCSAASCPANVNAACPPELQVKGSDGAVIACKSACLAF  182

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSD-KYWFTFCPE  177
            N   +CC   Y SP+ C+P++YSK+FK+ CP   SYAFD  S   +C+    Y  TFCP 
Sbjct  183  NQPQYCCTGAYNSPNTCQPTIYSKIFKSQCPQAYSYAFDDKSSTFTCTGGANYLITFCPR  242

Query  176  NF  171
             F
Sbjct  243  RF  244



>ref|XP_002322099.1| hypothetical protein POPTR_0015s04510g [Populus trichocarpa]
 gb|EEF06226.1| hypothetical protein POPTR_0015s04510g [Populus trichocarpa]
Length=248

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 77/122 (63%), Gaps = 1/122 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVN-GNGDVVACKSACLA  357
            YDVSLVDGYNL +S+     S KC   GC++ +   CP  LQV +  N  VVACKSAC A
Sbjct  127  YDVSLVDGYNLAISITPFKGSGKCSYAGCVRDLNMMCPVGLQVRSKDNNRVVACKSACSA  186

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  CKP+ YS++FK ACP   SYA+D P+ I +C+   Y  TFCP 
Sbjct  187  FNSPRYCCTGSFGTPQACKPTAYSRIFKAACPKAYSYAYDDPTSIATCTRGNYLVTFCPN  246

Query  176  NF  171
              
Sbjct  247  QH  248



>ref|XP_006390065.1| hypothetical protein EUTSA_v10019646mg, partial [Eutrema salsugineum]
 gb|ESQ27351.1| hypothetical protein EUTSA_v10019646mg, partial [Eutrema salsugineum]
Length=254

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 78/117 (67%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP+SV  +     C + GC+  +R  CP EL  V  NG V++C+SAC  F
Sbjct  124  YDVSLVDGFNLPMSVTPMNGKGNCSVAGCVADLRPQCPKEL-AVKSNGKVISCRSACDVF  182

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            + D +CCR  YG+P  C+P+ YSK+FK ACP+  SYA+D P+ I +CS   Y  +FC
Sbjct  183  DRDEYCCRGVYGNPVVCQPTFYSKIFKQACPTAYSYAYDDPTSIFTCSGTDYVISFC  239



>ref|XP_003545289.2| PREDICTED: pathogenesis-related protein 5-like [Glycine max]
Length=251

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 74/120 (62%), Gaps = 0/120 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYN+ + V +   +  C   GC+  +   CPAELQV +G G VVACKSAC AF
Sbjct  130  YDVSLVDGYNVGMGVRAAGGTGDCQYAGCVADVNGVCPAELQVRDGAGSVVACKSACAAF  189

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N   FCC   + +P  C P+ +S++FK ACP+  SYA+D  S   +CS   Y  TFCP  
Sbjct  190  NTAEFCCTGDHSTPQTCSPTHHSEIFKKACPTAYSYAYDDASSTCTCSGSDYRITFCPTG  249



>ref|XP_011074598.1| PREDICTED: pathogenesis-related protein 5-like [Sesamum indicum]
Length=265

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 78/120 (65%), Gaps = 0/120 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYN+ +SV +   S  C   GC+  +   CP ELQVV+  G+VVACKSAC AF
Sbjct  146  YDVSLVDGYNVGLSVRASGGSGDCQSAGCVADVNANCPKELQVVDDGGNVVACKSACAAF  205

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N   FCC  ++ +   C P+ YS+MFKNACP+  SYA+D  S   +C+   Y+ TFCP N
Sbjct  206  NTPEFCCTGEHSTSATCSPTPYSQMFKNACPAAYSYAYDDLSSTCTCAGADYFITFCPSN  265



>gb|AIU34434.1| thaumatin-like protein 5, partial [Medicago truncatula var. truncatula]
Length=223

 Score =   123 bits (308),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNG-DVVACKSACLA  357
            YDVSLVDGYNLP+S+     S KC   GC+  +   CP  LQV + +   VV C+SAC A
Sbjct  101  YDVSLVDGYNLPISITPFKGSGKCSYAGCVSDLNLMCPVGLQVRSRDKKHVVGCRSACAA  160

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  CKP+ YS++FK ACP   SYA+D P+ I +C++  Y  TFCP 
Sbjct  161  FNSPRYCCTGNFGTPQTCKPTAYSRIFKTACPKAYSYAYDDPTSIATCTNASYMITFCPR  220

Query  176  N  174
            +
Sbjct  221  H  221



>ref|XP_009785059.1| PREDICTED: thaumatin-like protein isoform X2 [Nicotiana sylvestris]
Length=247

 Score =   123 bits (309),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 76/121 (63%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNG-DVVACKSACLA  357
            YDVSLVDGYNL +S+       KC   GC+  +   CP  LQV + +   VVACKSAC A
Sbjct  127  YDVSLVDGYNLAISITPFRGKGKCSYAGCVSDLNTMCPVGLQVKSHDKRQVVACKSACAA  186

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  CKP+ YS++FK ACP   SYA+D P+ I +C+   Y  TFCP 
Sbjct  187  FNSPRYCCTGTFGNPQSCKPTAYSRIFKTACPKAYSYAYDDPTSIATCTGSSYLLTFCPH  246

Query  176  N  174
            +
Sbjct  247  H  247



>ref|XP_009785058.1| PREDICTED: thaumatin-like protein isoform X1 [Nicotiana sylvestris]
Length=248

 Score =   123 bits (309),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 76/121 (63%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNG-DVVACKSACLA  357
            YDVSLVDGYNL +S+       KC   GC+  +   CP  LQV + +   VVACKSAC A
Sbjct  128  YDVSLVDGYNLAISITPFRGKGKCSYAGCVSDLNTMCPVGLQVKSHDKRQVVACKSACAA  187

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  CKP+ YS++FK ACP   SYA+D P+ I +C+   Y  TFCP 
Sbjct  188  FNSPRYCCTGTFGNPQSCKPTAYSRIFKTACPKAYSYAYDDPTSIATCTGSSYLLTFCPH  247

Query  176  N  174
            +
Sbjct  248  H  248



>gb|KDP23919.1| hypothetical protein JCGZ_27079 [Jatropha curcas]
Length=249

 Score =   123 bits (309),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 77/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVN-GNGDVVACKSACLA  357
            YDVSLVDGYNL +S+     S KC   GC+  +   CP  LQV +  N  VVACKSAC A
Sbjct  128  YDVSLVDGYNLGISITPFKGSGKCSYAGCISDLNLMCPVGLQVRSRDNRRVVACKSACFA  187

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  CKP+ YS++FK ACP   SYA+D P+ I +C+   Y  TFCP 
Sbjct  188  FNSPRYCCTGSFGNPQTCKPTAYSRIFKAACPKAYSYAYDDPTSIATCTRGNYLVTFCPH  247

Query  176  N  174
            +
Sbjct  248  H  248



>ref|XP_004503284.1| PREDICTED: thaumatin-like protein-like [Cicer arietinum]
Length=251

 Score =   123 bits (309),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 78/120 (65%), Gaps = 1/120 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGD-VVACKSACLA  357
            YDVSLVDGYNLP+S+     S KC   GC+  +   CP  LQV + +   VVACKSAC A
Sbjct  130  YDVSLVDGYNLPISITPFKGSGKCSYAGCVSDLNLMCPVGLQVRSRDKKRVVACKSACSA  189

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +GSP  CKP+ YS++FK ACP   SYA+D P+ I +C++  Y  TFCP 
Sbjct  190  FNSPRYCCTGNFGSPQACKPTAYSRIFKTACPKAYSYAYDDPTSISTCTNASYLITFCPH  249



>ref|XP_009414066.1| PREDICTED: thaumatin-like protein [Musa acuminata subsp. malaccensis]
Length=250

 Score =   123 bits (309),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 80/121 (66%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGD-VVACKSACLA  357
            YDVSLVDGYNL +S+     S +C   GC++ +   CPA L V  G+ + VVACKSAC A
Sbjct  130  YDVSLVDGYNLGMSMTPFRGSGRCGRAGCVRDLNEVCPAGLAVRAGHSNRVVACKSACSA  189

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            F +  +CC   +G+P +CKP+ YS++FK ACP   SYA+D P+ I +C+   Y  TFCP+
Sbjct  190  FGSPRYCCTGSFGNPQQCKPTAYSRLFKTACPRAYSYAYDDPTSIFTCTGASYLITFCPQ  249

Query  176  N  174
            +
Sbjct  250  H  250



>emb|CAJ86348.1| H0814G11.15 [Oryza sativa Indica Group]
Length=257

 Score =   123 bits (309),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP+ V  +     C + GC   +R++CP+EL     NG  VAC+SAC  F
Sbjct  121  YDVSLVDGFNLPMVVRPLNGEGNCSVAGCDGDLRDSCPSELSK-KVNGRTVACRSACDVF  179

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            + D +CCR  YG+P  C+P+ YSK FK ACP+  SYA+D P+ I +CS+  Y  TFC   
Sbjct  180  DTDQYCCRGMYGNPSTCQPTFYSKKFKAACPTAYSYAYDDPTSIFTCSNADYTITFCSTR  239

Query  173  F  171
            F
Sbjct  240  F  240



>gb|EYU24132.1| hypothetical protein MIMGU_mgv1a012513mg [Erythranthe guttata]
Length=248

 Score =   123 bits (309),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 77/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGD-VVACKSACLA  357
            YDVSLVDGYNL +S+     S KC   GC+  +   CP  LQV + +   VVACKSAC A
Sbjct  128  YDVSLVDGYNLAISITPFRGSGKCSYAGCVSDLNMMCPVGLQVRSHDKKKVVACKSACFA  187

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  CKP+ YSK+FK ACP   SYA+D P+ I +C+   Y  TFCP 
Sbjct  188  FNSPRYCCTGSFGNPQTCKPTAYSKIFKTACPKAYSYAYDDPTSISTCTGSSYLLTFCPH  247

Query  176  N  174
            +
Sbjct  248  S  248



>ref|XP_003631101.1| Thaumatin-like protein [Medicago truncatula]
 gb|AET05577.1| pathogenesis-related thaumatin family protein [Medicago truncatula]
Length=249

 Score =   123 bits (309),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNG-DVVACKSACLA  357
            YDVSLVDGYNLP+S+     S KC   GC+  +   CP  LQV + +   VV C+SAC A
Sbjct  127  YDVSLVDGYNLPISITPFKGSGKCSYAGCVSDLNLMCPVGLQVRSRDKKHVVGCRSACAA  186

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  CKP+ YS++FK ACP   SYA+D P+ I +C++  Y  TFCP 
Sbjct  187  FNSPRYCCTGNFGTPQTCKPTAYSRIFKTACPKAYSYAYDDPTSIATCTNASYMITFCPR  246

Query  176  N  174
            +
Sbjct  247  H  247



>emb|CDX96487.1| BnaA07g30980D [Brassica napus]
Length=245

 Score =   123 bits (308),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNG-DVVACKSACLA  357
            YDVSLVDGYNL +S+  +  + KC   GC+  +   CP  LQV + +G  VVACKSAC A
Sbjct  123  YDVSLVDGYNLAMSIMPVKGTGKCTYAGCISDLNRMCPVGLQVRSRDGKQVVACKSACSA  182

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  C+P+ YSK+FK ACP   SYA+D P+ I +C+   Y  TFCP 
Sbjct  183  FNSPRYCCTGSFGNPQTCRPTAYSKIFKVACPKAYSYAYDDPTSIATCTKANYVVTFCPH  242

Query  176  N  174
             
Sbjct  243  R  243



>ref|XP_007160787.1| hypothetical protein PHAVU_001G016600g [Phaseolus vulgaris]
 gb|ESW32781.1| hypothetical protein PHAVU_001G016600g [Phaseolus vulgaris]
Length=244

 Score =   123 bits (308),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 74/118 (63%), Gaps = 0/118 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYN+ + V +   +  C   GC   +  ACP ELQV +  G VVACKSAC AF
Sbjct  127  YDVSLVDGYNVGIGVLATGGTGDCRYAGCAADLNAACPEELQVRDSGGVVVACKSACAAF  186

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            N   FCC  ++G+P  C  + YS++FKNACP+  SYA+D  S   +CS+  Y   FCP
Sbjct  187  NTPEFCCTGEHGTPQTCSATHYSEIFKNACPTAYSYAYDDASSTRTCSTADYVIAFCP  244



>ref|NP_001288837.1| thaumatin-like protein precursor [Brassica rapa]
 gb|ABV89611.1| thaumatin-like protein [Brassica rapa]
Length=245

 Score =   123 bits (308),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNG-DVVACKSACLA  357
            YDVSLVDGYNL +S+  +  + KC   GC+  +   CP  LQV + +G  VVACKSAC A
Sbjct  123  YDVSLVDGYNLAMSIMPVKGTGKCTYAGCVSDLNRMCPVGLQVRSRDGKQVVACKSACSA  182

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  C+P+ YSK+FK ACP   SYA+D P+ I +C+   Y  TFCP 
Sbjct  183  FNSPRYCCTGSFGNPQTCRPTAYSKIFKVACPKAYSYAYDDPTSIATCTKANYVVTFCPH  242

Query  176  N  174
             
Sbjct  243  R  243



>gb|AFK48181.1| unknown [Medicago truncatula]
Length=249

 Score =   123 bits (309),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNG-DVVACKSACLA  357
            YDVSLVDGYNLP+S+     S KC   GC+  +   CP  LQV + +   VV C+SAC A
Sbjct  127  YDVSLVDGYNLPISITPFKGSGKCSYAGCVSDLNLMCPVGLQVRSRDKKHVVGCRSACAA  186

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  CKP+ YS++FK ACP   SYA+D P+ I +C++  Y  TFCP 
Sbjct  187  FNSPRYCCTGNFGTPQTCKPTAYSRIFKTACPKAYSYAYDDPTSIATCTNASYMITFCPR  246

Query  176  N  174
            +
Sbjct  247  H  247



>ref|XP_004238367.1| PREDICTED: pathogenesis-related protein 5 [Solanum lycopersicum]
Length=325

 Score =   125 bits (313),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 75/118 (64%), Gaps = 4/118 (3%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YD+SLVDGYNLP+++ ++  S  C   GC+K +   CP EL+V    GD  ACKSAC AF
Sbjct  132  YDISLVDGYNLPMAIQAVGGSGSCDTTGCVKDLNRMCPNELRV----GDGQACKSACEAF  187

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
                +CC   YGSP  CKPS YS MFKNACP   SYA+D P+   +C+   Y  TFCP
Sbjct  188  GTPEYCCSGAYGSPSTCKPSSYSAMFKNACPKSYSYAYDDPTSTFTCTGADYTITFCP  245



>ref|NP_177503.1| pathogenesis-related thaumatin-like protein [Arabidopsis thaliana]
 gb|AAG52086.1|AC012679_24 thaumatin-like protein; 9376-10898 [Arabidopsis thaliana]
 gb|AEE35486.1| pathogenesis-related thaumatin-like protein [Arabidopsis thaliana]
Length=264

 Score =   123 bits (309),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNG-DVVACKSACLA  357
            YDVSLVDGYNL +S+  +  + KC   GC+  +   CP  LQV + +G  VVACKSAC A
Sbjct  142  YDVSLVDGYNLAMSIMPVKGTGKCTYAGCVSDLNRMCPVGLQVRSRDGTQVVACKSACSA  201

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  CKP+ YSK+FK ACP   SYA+D P+ I +CS   Y  TFCP 
Sbjct  202  FNSPRYCCTGLFGNPQSCKPTAYSKIFKVACPKAYSYAYDDPTSIATCSKANYVVTFCPH  261

Query  176  N  174
             
Sbjct  262  R  262



>ref|XP_011083577.1| PREDICTED: thaumatin-like protein 1b [Sesamum indicum]
Length=311

 Score =   124 bits (312),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 79/119 (66%), Gaps = 1/119 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSS-KCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLA  357
            YDVSLVDGYNLP+ V     S   C   GC+  +  ACP++L+V + +G+ VACKSAC A
Sbjct  128  YDVSLVDGYNLPMLVVPQGGSGVNCSNTGCVFDLNGACPSDLRVTSSDGEGVACKSACEA  187

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            F  D +CCR  YG+PD CKPS YS+ FKNACP   SYA+D  +   +C++  Y  TFCP
Sbjct  188  FRNDQYCCRGAYGTPDACKPSQYSQAFKNACPHAYSYAYDDRTSTFTCTAADYVITFCP  246



>ref|XP_009128246.1| PREDICTED: pathogenesis-related protein 5-like [Brassica rapa]
Length=286

 Score =   124 bits (310),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 78/117 (67%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP+SV  +     C + GC+  +R+ CP EL  V   G VV+C+SAC  F
Sbjct  124  YDVSLVDGFNLPMSVTPMNGKGNCSVAGCVADLRSKCPPEL-AVKSKGKVVSCRSACDVF  182

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            + D +CCR  YG+P  C+P+ YSKMFK ACP+  SYA+D P+ I +CS   Y  +FC
Sbjct  183  DRDEYCCRGVYGNPVTCRPTNYSKMFKEACPTAYSYAYDDPTSIFTCSGTDYVISFC  239



>ref|XP_002887695.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63954.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=259

 Score =   123 bits (309),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 80/117 (68%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP+SV  +     C + GC+  +R  CP EL  V  NG V++C+SAC  F
Sbjct  142  YDVSLVDGFNLPMSVTPMNGIGNCSVAGCVADLRPHCPQEL-AVKSNGKVISCRSACDVF  200

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            + D +CCR  YG+P  C+P+ YSK+FK ACP+  SYA+D P+ I++C++  Y  +FC
Sbjct  201  DRDEYCCRGVYGNPVVCQPTYYSKIFKQACPTAYSYAYDDPTSIMTCTASDYVISFC  257



>ref|XP_009596997.1| PREDICTED: thaumatin-like protein [Nicotiana tomentosiformis]
Length=248

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 76/121 (63%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNG-DVVACKSACLA  357
            YDVSLVDGYNL +S+       KC   GC+  +   CP  LQV + +   VVACKSAC A
Sbjct  128  YDVSLVDGYNLAISITPFRGKGKCSYAGCVSDLNTMCPVGLQVKSHDKRQVVACKSACAA  187

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  CKP+ YS++FK ACP   SYA+D P+ I +C+   Y  TFCP 
Sbjct  188  FNSPRYCCTGTFGNPQSCKPTAYSRIFKTACPKAYSYAYDDPTSIATCTGGSYLLTFCPR  247

Query  176  N  174
            +
Sbjct  248  H  248



>emb|CDY44520.1| BnaCnng11310D [Brassica napus]
Length=285

 Score =   124 bits (310),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 78/117 (67%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP+SV  +     C + GC+  +R+ CP EL  V   G VV+C+SAC  F
Sbjct  124  YDVSLVDGFNLPMSVTPMNGKGNCSVAGCVADLRSKCPPEL-AVKSKGKVVSCRSACDVF  182

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            + D +CCR  YG+P  C+P+ YSKMFK ACP+  SYA+D P+ I +CS   Y  +FC
Sbjct  183  DRDEYCCRGVYGNPVTCRPTNYSKMFKEACPTAYSYAYDDPTSIFTCSGTDYVISFC  239



>ref|XP_003543788.1| PREDICTED: pathogenesis-related protein 5-like [Glycine max]
 gb|KHN26034.1| Pathogenesis-related protein 5 [Glycine soja]
Length=287

 Score =   124 bits (310),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 74/117 (63%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+N+P++V  I     C   GC   +RN+CP EL +   NG  V C+SAC  F
Sbjct  124  YDVSLVDGFNVPMAVKPINGKGNCSTAGCDSDLRNSCPKELSL-RANGKTVGCRSACDVF  182

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            N D +CC+  YG+P  CKP+ YSK FK ACP+  SYA+D P+ I +C+   Y   FC
Sbjct  183  NTDEYCCKGNYGNPSTCKPTFYSKKFKEACPTSYSYAYDDPTSIFTCTGTDYVIAFC  239



>ref|XP_007160648.1| hypothetical protein PHAVU_001G005000g [Phaseolus vulgaris]
 gb|ESW32642.1| hypothetical protein PHAVU_001G005000g [Phaseolus vulgaris]
Length=315

 Score =   124 bits (311),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 85/122 (70%), Gaps = 6/122 (5%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIP---SSSKCYIGGCMKSMRNACPAELQVVNGNG-DVVACKSA  366
            +DVSLVDGYN+P+ V  +P   S  KC   GC+  + +ACP+EL+V++ +G + VACKSA
Sbjct  126  FDVSLVDGYNVPMLV--VPQGGSGEKCTATGCVGDLNDACPSELKVMSADGREGVACKSA  183

Query  365  CLAFNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTF  186
            C AFN+  +CC   YGSPD CKPS YS++FKNACP   SYA+D  +   +C+S  Y  TF
Sbjct  184  CEAFNSPQYCCSGAYGSPDTCKPSSYSEIFKNACPRAYSYAYDDKTSTFTCASADYTITF  243

Query  185  CP  180
            CP
Sbjct  244  CP  245



>ref|XP_009630387.1| PREDICTED: thaumatin-like protein 1b [Nicotiana tomentosiformis]
Length=298

 Score =   124 bits (311),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 77/122 (63%), Gaps = 2/122 (2%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGD--VVACKSACL  360
            YDVS+VDGYNLP+  A       C I GC+ ++   CP ELQVV G+G+  VVACKSAC 
Sbjct  128  YDVSIVDGYNLPMVAAPEGVHGGCNITGCVSNLNMGCPKELQVVGGDGEGNVVACKSACE  187

Query  359  AFNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            AF  D +CC  ++ +P  C+PS YS +FK ACP   SYA+D  +   +C +D Y   FCP
Sbjct  188  AFGLDQYCCAGEFANPTTCRPSFYSSIFKRACPRAYSYAYDDGTSTFTCKADDYSIIFCP  247

Query  179  EN  174
             N
Sbjct  248  MN  249



>emb|CDO98353.1| unnamed protein product [Coffea canephora]
Length=249

 Score =   123 bits (308),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 77/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGD-VVACKSACLA  357
            YDVSLVDGYNL +S+     S KC   GC+  +   CP  LQV + +   VVACKSAC A
Sbjct  128  YDVSLVDGYNLAISITPFRGSGKCSYAGCVSDLNMMCPVGLQVRSHDKRRVVACKSACFA  187

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  CKP+ YSK+FK ACP   SYA+D P+ I +C+   Y  TFCP 
Sbjct  188  FNSPRYCCTGSFGNPQSCKPTAYSKIFKAACPRAYSYAYDDPTSIATCTGGNYLVTFCPH  247

Query  176  N  174
            +
Sbjct  248  H  248



>ref|XP_006390535.1| hypothetical protein EUTSA_v10019050mg [Eutrema salsugineum]
 gb|ESQ27821.1| hypothetical protein EUTSA_v10019050mg [Eutrema salsugineum]
Length=244

 Score =   122 bits (307),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 79/121 (65%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNG-DVVACKSACLA  357
            YDVSLVDGYNL +S+  +  + KC   GC+  +   CP  LQV + +G  VVACKSAC A
Sbjct  122  YDVSLVDGYNLAMSIMPVKGTGKCSYAGCVSDLNRMCPVGLQVRSRDGKQVVACKSACSA  181

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  C+P+ YSK+FK ACP   SYA+D P+ I +CS   Y  TFCP 
Sbjct  182  FNSPRYCCTGPFGNPQSCRPTAYSKIFKVACPKAYSYAYDDPTSIATCSKANYVVTFCPH  241

Query  176  N  174
            +
Sbjct  242  H  242



>ref|XP_011005199.1| PREDICTED: pathogenesis-related protein 5-like [Populus euphratica]
Length=299

 Score =   124 bits (310),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 76/117 (65%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YD+SLVDGYNLP+ ++ I     C I GC   +R  CP+EL  V  NG V+AC+SAC AF
Sbjct  135  YDLSLVDGYNLPIVISPINGKGNCSIAGCEGDLRQNCPSEL-AVKSNGKVIACRSACDAF  193

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            N D +CCR  +  P  C+PS YS+ FK  CP+  SYAFD  + I++CS+ +Y   FC
Sbjct  194  NTDEYCCRGAFADPAACQPSNYSRSFKQVCPAASSYAFDDRASIITCSASEYIIIFC  250



>ref|XP_009106020.1| PREDICTED: thaumatin-like protein isoform X2 [Brassica rapa]
Length=264

 Score =   123 bits (308),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNG-DVVACKSACLA  357
            YDVSLVDGYNL +S+  +  + KC   GC+  +   CP  LQV + +G  VVACKSAC A
Sbjct  142  YDVSLVDGYNLAMSIMPVKGTGKCTYAGCVSDLNRMCPVGLQVRSRDGKQVVACKSACSA  201

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  C+P+ YSK+FK ACP   SYA+D P+ I +C+   Y  TFCP 
Sbjct  202  FNSPRYCCTGSFGNPQTCRPTAYSKIFKVACPKAYSYAYDDPTSIATCTKANYVVTFCPH  261

Query  176  N  174
             
Sbjct  262  R  262



>ref|XP_008377347.1| PREDICTED: LOW QUALITY PROTEIN: pathogenesis-related protein 
5-like [Malus domestica]
Length=246

 Score =   122 bits (307),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVN-GNGDVVACKSACLA  357
            YDVSLVDGYN+ + + +   +  C   GC+  +  +CPAEL+V++ G+G VVAC+SAC A
Sbjct  124  YDVSLVDGYNVGMGLWATGGTGDCQYAGCVTDLNGSCPAELRVMDSGSGVVVACRSACAA  183

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN   FCC  ++ +P  C P+ YS+MFK ACPS  SYA+D  S   +CS   Y  TFCP 
Sbjct  184  FNTPEFCCTGEHATPQTCSPTQYSEMFKTACPSAYSYAYDDASSTCTCSGSDYLITFCPA  243

Query  176  N  174
             
Sbjct  244  G  244



>emb|CDX72995.1| BnaC06g34430D [Brassica napus]
Length=265

 Score =   123 bits (308),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNG-DVVACKSACLA  357
            YDVSLVDGYNL +S+  +  + KC   GC+  +   CP  LQV + +G  VVACKSAC A
Sbjct  143  YDVSLVDGYNLAMSIMPVKGTGKCTYAGCVSDLNRMCPVGLQVRSRDGKQVVACKSACSA  202

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  C+P+ YSK+FK ACP   SYA+D P+ I +C+   Y  TFCP 
Sbjct  203  FNSPRYCCTGSFGNPQTCRPTAYSKIFKVACPKAYSYAYDDPTSIATCTKANYVVTFCPH  262

Query  176  N  174
             
Sbjct  263  R  263



>ref|XP_007160647.1| hypothetical protein PHAVU_001G005000g [Phaseolus vulgaris]
 gb|ESW32641.1| hypothetical protein PHAVU_001G005000g [Phaseolus vulgaris]
Length=278

 Score =   123 bits (309),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVA-SIPSSSKCYIGGCMKSMRNACPAELQVVNGNG-DVVACKSACL  360
            +DVSLVDGYN+P+ V     S  KC   GC+  + +ACP+EL+V++ +G + VACKSAC 
Sbjct  126  FDVSLVDGYNVPMLVVPQGGSGEKCTATGCVGDLNDACPSELKVMSADGREGVACKSACE  185

Query  359  AFNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            AFN+  +CC   YGSPD CKPS YS++FKNACP   SYA+D  +   +C+S  Y  TFCP
Sbjct  186  AFNSPQYCCSGAYGSPDTCKPSSYSEIFKNACPRAYSYAYDDKTSTFTCASADYTITFCP  245



>ref|XP_006342237.1| PREDICTED: pathogenesis-related protein 5-like [Solanum tuberosum]
Length=289

 Score =   124 bits (310),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 74/118 (63%), Gaps = 4/118 (3%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YD+SLVDGYNLP+++ ++  S  C   GC K +   CP EL+V    GD  ACKSAC AF
Sbjct  130  YDISLVDGYNLPMAIQAVGGSGPCETMGCAKDLNRMCPNELRV----GDGQACKSACEAF  185

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
                +CC   YGSP  CKPS YS MFKNACP   SYA+D P+   +C+   Y  TFCP
Sbjct  186  GTPEYCCSGAYGSPSTCKPSSYSAMFKNACPKSYSYAYDDPTSTFTCTGADYTITFCP  243



>ref|XP_010262463.1| PREDICTED: thaumatin-like protein isoform X1 [Nelumbo nucifera]
Length=248

 Score =   122 bits (307),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 74/121 (61%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVV-NGNGDVVACKSACLA  357
            YDVSLVDGYNL +S+       KC   GC+  +   CP  LQV  + N  VVACKSAC A
Sbjct  128  YDVSLVDGYNLAISITPFRGKGKCSYAGCVSDLNLMCPVGLQVRSHDNRRVVACKSACFA  187

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            F +  +CC   YG+P  CKP+ YS++FK ACP   SYA+D P+ I +CS   Y  TFCP 
Sbjct  188  FQSPKYCCTGTYGNPQSCKPTAYSRIFKTACPKAYSYAYDDPTSIATCSGGSYLVTFCPH  247

Query  176  N  174
             
Sbjct  248  R  248



>ref|XP_010262514.1| PREDICTED: thaumatin-like protein isoform X2 [Nelumbo nucifera]
Length=247

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 74/121 (61%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVV-NGNGDVVACKSACLA  357
            YDVSLVDGYNL +S+       KC   GC+  +   CP  LQV  + N  VVACKSAC A
Sbjct  127  YDVSLVDGYNLAISITPFRGKGKCSYAGCVSDLNLMCPVGLQVRSHDNRRVVACKSACFA  186

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            F +  +CC   YG+P  CKP+ YS++FK ACP   SYA+D P+ I +CS   Y  TFCP 
Sbjct  187  FQSPKYCCTGTYGNPQSCKPTAYSRIFKTACPKAYSYAYDDPTSIATCSGGSYLVTFCPH  246

Query  176  N  174
             
Sbjct  247  R  247



>ref|XP_008364687.1| PREDICTED: LOW QUALITY PROTEIN: thaumatin-like protein, partial 
[Malus domestica]
Length=236

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 76/121 (63%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVV-NGNGDVVACKSACLA  357
            Y VSLVDGYNL +S+     S KC   GC+  +   CP  LQV  + N  VVACKSAC A
Sbjct  115  YXVSLVDGYNLAISITPFKGSGKCSYAGCVSDLNMMCPVGLQVRSHDNRRVVACKSACSA  174

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +GSP  CKP+ YSK+FK ACP   SYA+D P+ I +C+   Y  TFCP 
Sbjct  175  FNSPRYCCTGSFGSPQSCKPTAYSKIFKAACPKAYSYAYDDPTSIATCTRGNYLVTFCPH  234

Query  176  N  174
            +
Sbjct  235  H  235



>ref|XP_002532822.1| Protein P21, putative [Ricinus communis]
 gb|EEF29561.1| Protein P21, putative [Ricinus communis]
Length=248

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNG-NGDVVACKSACLA  357
            YDVSLVDGYNL +S+     S KC   GC+  +   CP  LQV +  N  VVACKSAC A
Sbjct  127  YDVSLVDGYNLAMSITPFKGSGKCSYAGCVSDLNLMCPVGLQVRSKDNRRVVACKSACSA  186

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC  ++G+P  CKP+ YSK+FK ACP   SYA+D P+ I +C+   Y  TFCP 
Sbjct  187  FNSPRYCCTGKFGNPQSCKPTAYSKIFKAACPKAYSYAYDDPTSIATCTRGNYLVTFCPH  246

Query  176  N  174
            +
Sbjct  247  H  247



>ref|XP_008357219.1| PREDICTED: pathogenesis-related protein 5-like, partial [Malus 
domestica]
Length=248

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 78/119 (66%), Gaps = 1/119 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVN-GNGDVVACKSACLA  357
            YDVSLVDGYN+ + + +   +  C   GC+  +  +CPAEL+V++ G+G VVAC+SAC A
Sbjct  126  YDVSLVDGYNVGMGLWATGGTGDCQYAGCVTDLNGSCPAELRVMDSGSGVVVACRSACAA  185

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            FN   FCC  ++ +P  C P+ YS+MFK ACPS  SYA+D  S   +CS   Y  TFCP
Sbjct  186  FNTPEFCCTGEHATPQTCSPTQYSEMFKTACPSAYSYAYDDASSTCTCSGSDYLITFCP  244



>ref|XP_002467254.1| hypothetical protein SORBIDRAFT_01g022110 [Sorghum bicolor]
 gb|EER94252.1| hypothetical protein SORBIDRAFT_01g022110 [Sorghum bicolor]
Length=296

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 86/131 (66%), Gaps = 10/131 (8%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSS---KCYIGGCMKSMRNACPAELQVV------NGNGDVV  381
            YDVSLVDGYNLPV+V++  + +   KC I GC K++   CP ELQV        G   VV
Sbjct  150  YDVSLVDGYNLPVAVSATGTGADPNKCAIAGCAKNVNAVCPPELQVTATGGGGGGGKTVV  209

Query  380  ACKSACLAFNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVS-CSSD  204
            ACKSACLAF  D+FCCR  Y +P  C+ ++YS++FK+ACP+Y SYA+D  +   S C + 
Sbjct  210  ACKSACLAFGLDAFCCRGAYATPATCRGTVYSRLFKDACPAYYSYAYDTTAATASGCYAQ  269

Query  203  KYWFTFCPENF  171
            +Y  TFCP  +
Sbjct  270  EYVITFCPSRW  280



>gb|KDO80739.1| hypothetical protein CISIN_1g023852mg [Citrus sinensis]
Length=276

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 76/117 (65%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP+SV  I     C + GC   +R  CP+EL V    G  VAC+SAC  F
Sbjct  112  YDVSLVDGFNLPMSVKPINGKGNCSVAGCDGDLRLTCPSELSV-KSKGKTVACRSACDVF  170

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            N D +CCR  YG+P  C+P+ YSK FK+ACP+  SYA+D P+ I +C+   Y  TFC
Sbjct  171  NTDEYCCRGVYGNPVVCQPTYYSKKFKDACPTAYSYAYDDPTSIFTCAGTDYVITFC  227



>ref|XP_006302655.1| hypothetical protein CARUB_v10020759mg [Capsella rubella]
 gb|EOA35553.1| hypothetical protein CARUB_v10020759mg [Capsella rubella]
Length=280

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 79/117 (68%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP+SV        C + GC+  +R  CP+EL  V  NG V++C+SAC  F
Sbjct  124  YDVSLVDGFNLPMSVNPRNGKGNCSVAGCVADLRPHCPSEL-AVKSNGKVISCRSACDVF  182

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            + D +CCR  YG+P  C+P+ YSK+FK ACP+  SYA+D P+ I +CS+  Y  TFC
Sbjct  183  DRDEYCCRGVYGNPVVCQPTYYSKIFKQACPTAYSYAYDDPTSIFTCSASDYIITFC  239



>emb|CAN70296.1| hypothetical protein VITISV_007440 [Vitis vinifera]
Length=243

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYN+ +S+ S   +  C   GC+  + + CPAELQ+ + +G VVACKSAC AF
Sbjct  124  YDVSLVDGYNVGMSIESSGGTGDCQRAGCVADLNSNCPAELQITD-SGSVVACKSACAAF  182

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N   +CC   + +P  C P+ YS++FK ACP+  SYA+D P+   +C+   Y  TFCP  
Sbjct  183  NTAQYCCTGDHSTPQTCSPTQYSEIFKKACPTAYSYAYDDPTSTCTCTGANYLITFCPTA  242

Query  173  F  171
            F
Sbjct  243  F  243



>ref|XP_003574984.1| PREDICTED: pathogenesis-related protein 5-like [Brachypodium 
distachyon]
Length=290

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 74/119 (62%), Gaps = 2/119 (2%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSS--KCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACL  360
            YDVSLVDG+NLP++V  +   +   C   GC   +R  CP EL V    G  +AC+SAC 
Sbjct  127  YDVSLVDGFNLPITVRPVNGRAPGNCSAAGCDGDLRETCPDELAVKGAGGKTIACRSACD  186

Query  359  AFNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
             FN D +CCR Q+G+P  C P+ YSK FK ACP+  SYA+D PS + SCS   Y  TFC
Sbjct  187  VFNTDEYCCRGQFGNPSTCPPTKYSKKFKEACPTAYSYAYDDPSSLFSCSGSDYIVTFC  245



>ref|XP_010471966.1| PREDICTED: pathogenesis-related protein 5-like [Camelina sativa]
Length=279

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 80/117 (68%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP++V  +     C + GC+  +R  CP+EL  V  NG V++C+SAC  F
Sbjct  124  YDVSLVDGFNLPMAVTPMNGKGNCSVAGCVADLRPHCPSEL-AVKSNGKVISCRSACDVF  182

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            + D +CCR  YG+P  C+P+ YSK+FK ACP+  SYA+D P+ I +CS+  Y  +FC
Sbjct  183  DRDEYCCRGVYGNPVVCQPTYYSKIFKQACPTAYSYAYDDPTSIFTCSASDYIISFC  239



>ref|XP_006472729.1| PREDICTED: thaumatin-like protein-like [Citrus sinensis]
Length=288

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 76/117 (65%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP+SV  I     C + GC   +R  CP+EL V    G  VAC+SAC  F
Sbjct  124  YDVSLVDGFNLPMSVKPINGKGNCSVAGCDGDLRLTCPSELSV-KSKGKTVACRSACDVF  182

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            N D +CCR  YG+P  C+P+ YSK FK+ACP+  SYA+D P+ I +C+   Y  TFC
Sbjct  183  NTDEYCCRGVYGNPVVCQPTYYSKKFKDACPTAYSYAYDDPTSIFTCAGTDYVITFC  239



>ref|XP_006434136.1| hypothetical protein CICLE_v10002069mg [Citrus clementina]
 gb|ESR47376.1| hypothetical protein CICLE_v10002069mg [Citrus clementina]
Length=288

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 76/117 (65%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP+SV  I     C + GC   +R  CP+EL V    G  VAC+SAC  F
Sbjct  124  YDVSLVDGFNLPMSVKPINGKGNCSVAGCDGDLRLTCPSELSV-KSKGKTVACRSACDVF  182

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            N D +CCR  YG+P  C+P+ YSK FK+ACP+  SYA+D P+ I +C+   Y  TFC
Sbjct  183  NTDEYCCRGVYGNPVVCQPTYYSKKFKDACPTAYSYAYDDPTSIFTCAGTDYVITFC  239



>ref|XP_010246990.1| PREDICTED: pathogenesis-related protein 5 [Nelumbo nucifera]
Length=248

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 74/118 (63%), Gaps = 0/118 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYN+ + V     +  C   GC+  +  +CPAELQV +   +VVACKSAC AF
Sbjct  127  YDVSLVDGYNVGMGVRPSGGTGDCQYAGCLTDLNGSCPAELQVTDTGNNVVACKSACAAF  186

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            N   FCC   + +P  C P+ YS+MFK+ACP+  SYA+D  S   +C+   Y  TFCP
Sbjct  187  NTPEFCCTGDHSTPQTCSPTQYSEMFKSACPTAYSYAYDDASSTCTCTGSDYLITFCP  244



>gb|ACU65941.1| pathogenesis-related 5 protein [Brassica rapa subsp. chinensis]
 dbj|BAJ16221.1| pathogenesis-related 5 [Brassica rapa subsp. chinensis]
Length=243

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGD-VVACKSACLA  357
            YDVSLVDGYNL +S+  +    +C   GC+  +   CP  LQV + NG  V+ACKSAC A
Sbjct  121  YDVSLVDGYNLAMSIMPLKGRGQCSYAGCVSDLNRMCPVGLQVRSRNGKRVLACKSACSA  180

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  CKP+ YSK+FK ACP   SYA+D P+ I +CS   Y  TFCP 
Sbjct  181  FNSPQYCCTGLFGNPQSCKPTSYSKIFKVACPKAYSYAYDDPTSIATCSKANYIVTFCPH  240

Query  176  N  174
            +
Sbjct  241  H  241



>ref|XP_011035010.1| PREDICTED: thaumatin-like protein 1 [Populus euphratica]
Length=319

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 79/119 (66%), Gaps = 1/119 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSK-CYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLA  357
            +DVSLVDGYNLP+ V     S + C   GC+  +  ACP+EL+V +  G+ VACKSAC A
Sbjct  129  FDVSLVDGYNLPLLVVPQGGSGQNCTSTGCVVDLNGACPSELKVTSTGGESVACKSACEA  188

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            F +  +CC   YG+PD CKPS YS++FKNACP   SYA+D  +   +C+S  Y  TFCP
Sbjct  189  FRSPQYCCNGAYGTPDTCKPSSYSEIFKNACPRAYSYAYDDKTSTFTCASADYQITFCP  247



>ref|XP_011096945.1| PREDICTED: thaumatin-like protein 1 [Sesamum indicum]
Length=319

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 77/118 (65%), Gaps = 4/118 (3%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLP+ V     S +C   GC++ +   CPAEL+   G     AC+SAC AF
Sbjct  122  YDVSLVDGYNLPLMVDVRGGSGQCASTGCVEDLNQRCPAELRTEGGG----ACRSACDAF  177

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            N   +CC+ +YGSP  CKPS+YS++FKNACP   SYA+D  +   +C++  Y  TFCP
Sbjct  178  NTPEYCCKGEYGSPSTCKPSMYSQLFKNACPKSYSYAYDDATSTFTCTAADYVITFCP  235



>ref|XP_010106041.1| hypothetical protein L484_021218 [Morus notabilis]
 gb|EXC07311.1| hypothetical protein L484_021218 [Morus notabilis]
Length=251

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 74/121 (61%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGN-GDVVACKSACLA  357
            YDVSLVDGYN+ + V ++  +  C   GC+  +   CP EL+V   N G VVACKSAC A
Sbjct  128  YDVSLVDGYNVGMGVKAVGGTGDCQYAGCVADLNGNCPPELRVTGSNSGSVVACKSACEA  187

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FNA  FCC   + +P  C P+ YS MFKNACP+  SYA+D  +   +CS   Y  TFCP 
Sbjct  188  FNAPEFCCTGDHATPQTCSPTQYSAMFKNACPTAYSYAYDDATSTCTCSGSDYLITFCPT  247

Query  176  N  174
             
Sbjct  248  G  248



>ref|XP_003614785.1| Pathogenesis-related protein [Medicago truncatula]
 gb|AES97743.1| pathogenesis-related thaumatin family protein [Medicago truncatula]
Length=282

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 73/120 (61%), Gaps = 1/120 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+N+P+SV  I     C   GC   +R  CP EL V   NG  V C+SAC  F
Sbjct  124  YDVSLVDGFNVPISVKPINGKGNCSTAGCDSDLRLTCPKELSV-RSNGKTVGCRSACDVF  182

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N D +CCR  +G+P  C+P+ YSK FK ACP+  SYA+D P+ I +C+   Y   FC + 
Sbjct  183  NTDEYCCRGNFGNPSTCRPTFYSKKFKEACPTSYSYAYDDPTSIFTCTGTDYVVAFCADR  242



>ref|XP_008444682.1| PREDICTED: pathogenesis-related protein 5-like [Cucumis melo]
Length=243

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 76/120 (63%), Gaps = 1/120 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YD+SLVDGYN+ + V +   +  C   GC+  +   CP+ELQV N +G VVACKSAC AF
Sbjct  125  YDISLVDGYNVGMGVRANGGTGDCQYAGCVSDVNGICPSELQVTN-SGSVVACKSACAAF  183

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N   FCC N + +P  C P+ YS+MFKNACPS  SYA+D  S   +C+   Y  +FCP  
Sbjct  184  NTPEFCCTNDHSTPQTCPPTKYSEMFKNACPSAYSYAYDDASSTCTCTGSDYLISFCPSG  243



>ref|XP_002301969.2| hypothetical protein POPTR_0002s02200g [Populus trichocarpa]
 gb|EEE81242.2| hypothetical protein POPTR_0002s02200g [Populus trichocarpa]
Length=305

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 79/119 (66%), Gaps = 1/119 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSK-CYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLA  357
            +DVSLVDGYNLP+ V     S + C   GC+  +  ACP+EL+V +  G+ VACKSAC A
Sbjct  115  FDVSLVDGYNLPLLVVPQGGSGQNCTSTGCVVDLNGACPSELKVTSTGGESVACKSACEA  174

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            F +  +CC   YG+PD CKPS YS++FKNACP   SYA+D  +   +C+S  Y  TFCP
Sbjct  175  FRSPQYCCSGAYGTPDTCKPSSYSEIFKNACPRAYSYAYDDKTSTFTCASADYQITFCP  233



>ref|XP_002301968.2| hypothetical protein POPTR_0002s02200g [Populus trichocarpa]
 gb|ABK94768.1| unknown [Populus trichocarpa]
 gb|EEE81241.2| hypothetical protein POPTR_0002s02200g [Populus trichocarpa]
Length=319

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 79/119 (66%), Gaps = 1/119 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSK-CYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLA  357
            +DVSLVDGYNLP+ V     S + C   GC+  +  ACP+EL+V +  G+ VACKSAC A
Sbjct  129  FDVSLVDGYNLPLLVVPQGGSGQNCTSTGCVVDLNGACPSELKVTSTGGESVACKSACEA  188

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            F +  +CC   YG+PD CKPS YS++FKNACP   SYA+D  +   +C+S  Y  TFCP
Sbjct  189  FRSPQYCCSGAYGTPDTCKPSSYSEIFKNACPRAYSYAYDDKTSTFTCASADYQITFCP  247



>ref|XP_008374844.1| PREDICTED: thaumatin-like protein [Malus domestica]
Length=250

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 76/121 (63%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVV-NGNGDVVACKSACLA  357
            YDVSLVDGYNL +S+     S KC   GC+  +   CP  LQV  + N  VVACKSAC A
Sbjct  129  YDVSLVDGYNLAISITPFKGSGKCSYAGCVSDLNMMCPVGLQVRSHDNRRVVACKSACSA  188

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +GSP  CKP+ YSK+FK A P   SYA+D P+ I +C+   Y  TFCP 
Sbjct  189  FNSPRYCCTGSFGSPQSCKPTAYSKIFKAAXPKAYSYAYDDPTSIATCTRGNYLVTFCPH  248

Query  176  N  174
            +
Sbjct  249  H  249



>ref|XP_007222068.1| hypothetical protein PRUPE_ppa009575mg [Prunus persica]
 gb|EMJ23267.1| hypothetical protein PRUPE_ppa009575mg [Prunus persica]
Length=286

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 76/117 (65%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP+ V  +  +  C + GC   +R++CP+ L V   NG  V C+SAC  F
Sbjct  125  YDVSLVDGFNLPMVVTPLNGTGNCSVSGCDGDLRSSCPSVLSV-KANGKTVGCRSACDVF  183

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            N D +CCR  +G+P  CKP+ YSKMFK ACP+  SYA+D P+ I +CS   Y   FC
Sbjct  184  NTDEYCCRGVFGNPVTCKPTYYSKMFKEACPTAYSYAYDDPTSIFTCSGTDYVVAFC  240



>ref|XP_009391386.1| PREDICTED: thaumatin-like protein [Musa acuminata subsp. malaccensis]
Length=247

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGD-VVACKSACLA  357
            YDVSLVDGYNL +S+     S +C   GC+  +   CPA L V  G  + VVACKSAC A
Sbjct  127  YDVSLVDGYNLGMSMTPFRGSGQCGRAGCVSDLNEVCPAGLAVRGGTDNRVVACKSACSA  186

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            F +  +CC   +G P +CKP+ YS++FK ACP   SYA+D P+ I++C+   Y  TFCP+
Sbjct  187  FGSPRYCCTGSFGGPQQCKPTAYSRLFKAACPRAYSYAYDDPTSILTCTGASYLVTFCPQ  246

Query  176  N  174
            +
Sbjct  247  H  247



>ref|XP_002990777.1| hypothetical protein SELMODRAFT_236128 [Selaginella moellendorffii]
 gb|EFJ08050.1| hypothetical protein SELMODRAFT_236128 [Selaginella moellendorffii]
Length=257

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 75/119 (63%), Gaps = 3/119 (3%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLPV +   P SS C   GC   +   CP ELQV N  G VVACKSAC AF
Sbjct  119  YDVSLVDGYNLPVRM--YPLSSGCTNVGCHSDVNAVCPQELQVRNSGGHVVACKSACEAF  176

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSS-DKYWFTFCP  180
              D+FCCR  + +P  C P+LYS++FKN CP   SYA+D  +   +C+S   Y   FCP
Sbjct  177  QTDAFCCRGNHSTPQTCSPTLYSRLFKNDCPQAYSYAYDDQTSTFTCTSGGGYVIQFCP  235



>ref|XP_010428854.1| PREDICTED: thaumatin-like protein [Camelina sativa]
Length=279

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 80/117 (68%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP++V  +     C + GC+  +R  CP+EL  V  NG V++C+SAC  F
Sbjct  124  YDVSLVDGFNLPMAVTPMNGKGNCSVAGCVADLRPHCPSEL-AVKSNGKVISCRSACDVF  182

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            + D +CCR  YG+P  C+P+ YSK+FK ACP+  SYA+D P+ I +CS+  Y  +FC
Sbjct  183  DRDEYCCRGVYGNPVVCQPTYYSKIFKQACPTAYSYAYDDPTSIFTCSAADYIISFC  239



>dbj|BAA95017.1| thaumatin-like protein [Cestrum elegans]
Length=177

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 75/118 (64%), Gaps = 1/118 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYN+ + V +   S  C   GC+  +   CP +L+VV+ NG VVACKSAC AF
Sbjct  58   YDVSLVDGYNVGIGVRATGGSGDCQYAGCVTDLNVNCPTDLRVVD-NGVVVACKSACAAF  116

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            N   +CC   + +P  C P+ YSK+FK+ACPS  SYA+D  S   +CS   Y  TFCP
Sbjct  117  NTSEYCCTGDHATPTTCPPTQYSKLFKDACPSAYSYAYDDASSTCTCSGSDYLITFCP  174



>gb|KGN62571.1| hypothetical protein Csa_2G361370 [Cucumis sativus]
Length=243

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 76/120 (63%), Gaps = 1/120 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YD+SLVDGYN+ + V +   +  C   GC+  +   CP+ELQV N +G VVACKSAC AF
Sbjct  125  YDISLVDGYNVGMGVRANGGTGDCQYAGCVSDVNGICPSELQVTN-SGSVVACKSACAAF  183

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N   FCC N + +P  C P+ YS+MFKNACPS  SYA+D  S   +C+   Y  +FCP  
Sbjct  184  NTPEFCCTNDHSTPQTCPPTKYSEMFKNACPSAYSYAYDDASSTCTCTGSDYLISFCPSG  243



>ref|XP_008233902.1| PREDICTED: pathogenesis-related protein 5 [Prunus mume]
Length=286

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 76/117 (65%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP+ V  +  +  C + GC   +R++CP+ L V   NG  V C+SAC  F
Sbjct  125  YDVSLVDGFNLPMVVTPLNGTGNCSVSGCDGDLRSSCPSVLSV-KANGKTVGCRSACDVF  183

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            N D +CCR  +G+P  CKP+ YSKMFK ACP+  SYA+D P+ I +CS   Y   FC
Sbjct  184  NTDEYCCRGVFGNPVTCKPTYYSKMFKEACPTAYSYAYDDPTSIFTCSGTDYVVAFC  240



>ref|XP_004499121.1| PREDICTED: pathogenesis-related protein 5-like [Cicer arietinum]
Length=251

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGN-GDVVACKSACLA  357
            YDVSLVDGYN+ + V +   +  C   GC+  +   CP EL++ +G  G VVACKSACLA
Sbjct  129  YDVSLVDGYNVGMGVWATGGTGDCQYAGCIADLNRVCPTELRINDGGSGAVVACKSACLA  188

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN + FCC  ++ +PD+C  + YS++FK ACP+  SYA+D  S   +CS   Y  TFCP+
Sbjct  189  FNTEVFCCTGKHSTPDRCSATHYSEIFKKACPTAYSYAYDDASSTCTCSGSDYRITFCPK  248

Query  176  N  174
             
Sbjct  249  G  249



>ref|XP_010416727.1| PREDICTED: pathogenesis-related protein 5-like [Camelina sativa]
Length=279

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 80/117 (68%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP++V  +     C + GC+  +R  CP+EL  V  NG V++C+SAC  F
Sbjct  124  YDVSLVDGFNLPMAVTPMNGKGNCSVAGCVADLRPHCPSEL-AVKSNGKVISCRSACDVF  182

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            + D +CCR  YG+P  C+P+ YSK+FK ACP+  SYA+D P+ I +C++  Y  +FC
Sbjct  183  DRDEYCCRGVYGNPVVCQPTYYSKIFKQACPTAYSYAYDDPTSIFTCTASDYIISFC  239



>gb|KHG17165.1| hypothetical protein F383_22419 [Gossypium arboreum]
Length=247

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 76/121 (63%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYN+ + V +I  S  C   GC+  +   CP EL+V++ +G VVACKSAC AF
Sbjct  128  YDVSLVDGYNVALGVKAIGGSGDCQYAGCVTDLNANCPVELRVLD-SGSVVACKSACTAF  186

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N   FCC   + +P  C P+ YSKMFK+ACP+  SYA+D  S   +CS   Y  TFCP  
Sbjct  187  NTPEFCCIGDHATPQTCSPTQYSKMFKSACPTAYSYAYDDASSTRTCSGSDYVITFCPTG  246

Query  173  F  171
             
Sbjct  247  L  247



>ref|NP_001268088.1| SCUTL2 precursor [Vitis vinifera]
 gb|AAF06347.1|AF195654_1 SCUTL2 [Vitis vinifera]
Length=243

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYN+ +S+ S   +  C   GC+  + + CPAELQ+ + +G VVACKSAC AF
Sbjct  124  YDVSLVDGYNVGMSIESSGGTGDCQRAGCVADLNSNCPAELQITD-SGSVVACKSACAAF  182

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N   +CC   + +P  C P+ YS++FK ACP+  SYA+D P+   +C+   Y  TFCP  
Sbjct  183  NTAQYCCTGDHSTPQTCSPTQYSEIFKKACPTAYSYAYDDPTSTCTCTGANYLITFCPPA  242

Query  173  F  171
            F
Sbjct  243  F  243



>gb|EYU23904.1| hypothetical protein MIMGU_mgv1a011450mg [Erythranthe guttata]
Length=281

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 75/117 (64%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP+ V  +     C + GC   +R  CPAEL  V G G  VAC+SAC  F
Sbjct  119  YDVSLVDGFNLPIVVTPLNGRGNCSVAGCDADLRTNCPAEL-AVKGGGRNVACRSACDVF  177

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            + D +CCR  YG+P  C+P+ YSK FK ACP+  SYA+D P+ I +CS   Y  +FC
Sbjct  178  DTDEYCCRGVYGNPVTCQPTYYSKTFKKACPTAYSYAYDDPTSIFTCSGTDYVVSFC  234



>ref|XP_008466475.1| PREDICTED: thaumatin-like protein 1 [Cucumis melo]
Length=309

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 80/120 (67%), Gaps = 2/120 (2%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVA-SIPSSSKCYIGGCMKSMRNACPAELQVVN-GNGDVVACKSACL  360
            +DVSLVDGYN+P+ V     S  KC   GC+  + +ACP EL+V++   GD VACKSAC 
Sbjct  127  FDVSLVDGYNIPMLVVPQGGSGEKCMSTGCVVDLNDACPQELKVMSVDGGDNVACKSACE  186

Query  359  AFNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
            AFN   +CC  +YG+PD CKPS YS++FKNACP   SYA+D  +   +C+   Y  TFCP
Sbjct  187  AFNQPQYCCSGEYGTPDTCKPSAYSQVFKNACPRAYSYAYDDKTSTFTCADADYIITFCP  246



>ref|XP_010678327.1| PREDICTED: pathogenesis-related protein 5-like [Beta vulgaris 
subsp. vulgaris]
Length=249

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 76/119 (64%), Gaps = 2/119 (2%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSV--ASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACL  360
            YDVSLVDGYN+ + V      +S  C   GC+  +  +CP ELQV + NG VVACKSAC 
Sbjct  127  YDVSLVDGYNVGIGVKPTGDGASGNCQYAGCVNDLNASCPPELQVRDSNGSVVACKSACA  186

Query  359  AFNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            AFN+  +CC   +GSP  C P+ YS+MFKNACP+  SYA+D  S   +C+   Y  TFC
Sbjct  187  AFNSPEYCCTGDHGSPQTCSPTQYSEMFKNACPTAYSYAYDDASSTCTCTGSDYIITFC  245



>ref|XP_007036794.1| Pathogenesis-related thaumatin superfamily protein [Theobroma 
cacao]
 gb|EOY21295.1| Pathogenesis-related thaumatin superfamily protein [Theobroma 
cacao]
Length=275

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 76/121 (63%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVN-GNGDVVACKSACLA  357
            YDVSLVDGYN+ +S+     S KC   GC+  +   CP  LQV +  N  V+ACKSAC A
Sbjct  154  YDVSLVDGYNIAMSITPFKGSGKCSYAGCVSDLNLMCPVGLQVRSRDNKRVLACKSACFA  213

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +GSP  CKP+ YSK+FK ACP   SYA+D P+ I +C+   Y  TFCP 
Sbjct  214  FNSPRYCCTGSFGSPQSCKPTAYSKIFKAACPKAYSYAYDDPTSIATCTRGSYLVTFCPH  273

Query  176  N  174
             
Sbjct  274  R  274



>ref|NP_001288814.1| thaumatin-like protein precursor [Brassica rapa]
 gb|AAB95118.1| pathogenesis-related group 5 protein [Brassica rapa]
Length=243

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGD-VVACKSACLA  357
            YDVSLVDGYNL +S+  +    +C   GC+  +   CP  LQV + NG  V+ACKSAC A
Sbjct  121  YDVSLVDGYNLAMSIMPLKGRGQCSYAGCVSDLNRMCPVGLQVRSRNGKRVLACKSACSA  180

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  CKP+ YSK+FK ACP   SYA+D P+ I +CS   Y  TFCP 
Sbjct  181  FNSPQYCCTGTFGNPLTCKPTSYSKIFKVACPKAYSYAYDDPTSIATCSKANYIVTFCPH  240

Query  176  N  174
            +
Sbjct  241  H  241



>ref|XP_007141088.1| hypothetical protein PHAVU_008G166500g [Phaseolus vulgaris]
 gb|ESW13082.1| hypothetical protein PHAVU_008G166500g [Phaseolus vulgaris]
Length=286

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 72/117 (62%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+N+P++V  I     C   GC   +R  CP EL  +  NG  V C+SAC  F
Sbjct  124  YDVSLVDGFNVPIAVRPINGKGNCSSAGCDSDLRTTCPNEL-ALKANGKTVGCRSACDVF  182

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            N D +CCR  YG+P  CKP+ YSK FK ACP+  SYA+D P+ I +CS   Y   FC
Sbjct  183  NTDEYCCRGLYGNPSTCKPTFYSKKFKEACPTSYSYAYDDPTSIFTCSGTDYVIAFC  239



>gb|KFK41805.1| hypothetical protein AALP_AA2G174200 [Arabis alpina]
Length=244

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGD-VVACKSACLA  357
            YDVSLVDGYNL +S+  +    KC   GC+  +   CP  LQV + +G  VVACKSAC A
Sbjct  122  YDVSLVDGYNLAMSIMPVKGKGKCSYAGCVSDLNRMCPVGLQVRSRDGRRVVACKSACSA  181

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +GSP  C+P+ YSK+FK ACP   SYA+D P+ I +CS   Y  +FCP 
Sbjct  182  FNSPQYCCTGSFGSPQSCRPTAYSKIFKVACPKAYSYAYDDPTSISTCSKANYIVSFCPR  241

Query  176  N  174
            +
Sbjct  242  H  242



>ref|XP_002447372.1| hypothetical protein SORBIDRAFT_06g033910 [Sorghum bicolor]
 gb|EES11700.1| hypothetical protein SORBIDRAFT_06g033910 [Sorghum bicolor]
Length=285

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 77/117 (66%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP+ +  +     C   GC   +R +CP+EL  V  NG  VAC+SAC  F
Sbjct  124  YDVSLVDGFNLPMVIKPVNGQGNCSAAGCDGDLRLSCPSEL-AVKANGRTVACRSACDVF  182

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            + D +CCR  +G+P KC+P+ YSK FK ACP+  SYA+D P+ I +CS+  Y  TFC
Sbjct  183  DTDQYCCRGLFGNPAKCQPTFYSKKFKAACPTAYSYAYDDPTSIFTCSNADYVITFC  239



>ref|XP_006653913.1| PREDICTED: pathogenesis-related protein 5-like [Oryza brachyantha]
Length=283

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 76/117 (65%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP+ V  +     C   GC   +R  CP+EL +  G G  VAC+SAC  F
Sbjct  123  YDVSLVDGFNLPMVVRPLNGQGNCTAAGCDGDLRERCPSELAMKVG-GRTVACRSACDVF  181

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            + D +CCR  YG+P  C+P+ YSK FK+ACP+  SYA+D PS I +CS+  Y  TFC
Sbjct  182  DTDQYCCRGLYGNPSTCQPTFYSKKFKDACPTAYSYAYDDPSSIFTCSNADYTITFC  238



>gb|KHG03900.1| hypothetical protein F383_27474 [Gossypium arboreum]
Length=245

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 76/121 (63%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVN-GNGDVVACKSACLA  357
            YDVSLVDGYN+ +S+     S KC   GC+  +   CP  LQV +  N  VVACKSAC A
Sbjct  124  YDVSLVDGYNIAMSITPFKGSGKCSYAGCVSDLNLMCPVGLQVRSKDNKRVVACKSACFA  183

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  CKP+ YSK+FK ACP   SYA+D P+ I +C+   Y  TFCP 
Sbjct  184  FNSPRYCCTGTFGNPQSCKPTAYSKIFKAACPKAYSYAYDDPTSIATCTRGNYLVTFCPH  243

Query  176  N  174
             
Sbjct  244  R  244



>ref|XP_011031355.1| PREDICTED: pathogenesis-related protein 5 [Populus euphratica]
Length=247

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 75/120 (63%), Gaps = 1/120 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYN+ + V ++  S  C   GC+  +   CPAEL+VV+ +G  VACKSAC AF
Sbjct  127  YDVSLVDGYNVGLGVKALGGSGDCQYAGCVTDLNGNCPAELRVVD-SGSTVACKSACAAF  185

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            NA  FCC   + +P  C P+ YS MFK ACP+  SYA+D  S   +C+   Y  TFCP  
Sbjct  186  NAPEFCCTADHATPQTCSPTQYSVMFKTACPTAYSYAYDDASSTCTCTGSDYLITFCPSG  245



>ref|XP_010428288.1| PREDICTED: thaumatin-like protein [Camelina sativa]
Length=244

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGN-GDVVACKSACLA  357
            YDVSLVDGYNL +S+  +  + KC   GC+  +   CP  LQV + +   VVACKSAC A
Sbjct  122  YDVSLVDGYNLAMSIMPVKGTGKCTYAGCVSDLNRMCPVGLQVRSRDRKQVVACKSACSA  181

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  CKP+ YSK+FK ACP   SYA+D P+ I +CS   Y  TFCP 
Sbjct  182  FNSPRYCCTGLFGNPQSCKPTAYSKIFKVACPKAYSYAYDDPTSIATCSKANYVVTFCPH  241

Query  176  N  174
            +
Sbjct  242  H  242



>ref|XP_009412932.1| PREDICTED: thaumatin-like protein 1b [Musa acuminata subsp. malaccensis]
Length=312

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 79/121 (65%), Gaps = 4/121 (3%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLP+ V +      C   GC   +   CPAEL+V  G+GD  AC+SAC AF
Sbjct  130  YDVSLVDGYNLPMLVEAA-GREGCAASGCAADLNRLCPAELKV--GHGDSAACRSACGAF  186

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCS-SDKYWFTFCPE  177
                FCC  +YGSPD+C+PS YS+MFK+ACP   SYAFD  +   +C+ +  Y  TFCPE
Sbjct  187  GRPEFCCSGEYGSPDRCRPSAYSQMFKSACPRSYSYAFDDATSTFTCAGAQGYSITFCPE  246

Query  176  N  174
            +
Sbjct  247  S  247



>ref|XP_009365665.1| PREDICTED: pathogenesis-related protein 5-like [Pyrus x bretschneideri]
Length=246

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 77/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVN-GNGDVVACKSACLA  357
            YD+SLVDGYN+ + + +   +  C   GC+  +   CPAEL+V++ G+G VVAC+SAC A
Sbjct  124  YDISLVDGYNVGMGLWATGGTGDCQYAGCVADLNGRCPAELRVMDAGSGAVVACRSACAA  183

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN   FCC  ++ +P  C P+ YS+MFK ACP+  SYA+D  S   +CS   Y  TFCP 
Sbjct  184  FNTPEFCCTGEHATPQTCSPTQYSEMFKTACPTAYSYAYDDASSTCTCSGSDYLITFCPS  243

Query  176  N  174
             
Sbjct  244  G  244



>ref|XP_009778054.1| PREDICTED: pathogenesis-related protein 5-like [Nicotiana sylvestris]
Length=247

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 75/120 (63%), Gaps = 0/120 (0%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YD+SLVDGYN+ V + +   S  C    C+  +   CP ELQV++ +G VVACKSAC  F
Sbjct  127  YDLSLVDGYNVGVGIQTSGGSGDCQYASCIADVNGNCPKELQVLDNSGKVVACKSACAQF  186

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N   +CC   + +P  C+P+ YS++FKNACP+  SYA+D  S   +CS   Y  TFCP +
Sbjct  187  NKPEYCCTGDHATPQTCQPTHYSQLFKNACPTAYSYAYDHASSTFTCSGSDYLITFCPSS  246



>ref|XP_004513301.1| PREDICTED: pathogenesis-related protein 5-like [Cicer arietinum]
Length=287

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 73/120 (61%), Gaps = 1/120 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+N+P+SV  +     C   GC   +R  CP EL V   NG  + C+SAC  F
Sbjct  124  YDVSLVDGFNVPISVKPLNGKGNCSTAGCDSDLRLTCPKELSV-KANGKTIGCRSACDVF  182

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPEN  174
            N D +CCR  +G+P  C+P+ YSK FK ACP+  SYA+D P+ I +C+   Y   FC + 
Sbjct  183  NTDEYCCRGNFGNPSTCRPTFYSKKFKEACPTSYSYAYDDPTSIFTCTGTDYIIAFCADR  242



>emb|CDY19198.1| BnaC05g13990D [Brassica napus]
Length=242

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGD-VVACKSACLA  357
            YDVSLVDGYNL +S+  +    +C   GC+  +   CP  LQV + NG  V+ACKSAC A
Sbjct  120  YDVSLVDGYNLAMSIMPVKGRGQCSYAGCVSDLNRMCPVGLQVRSRNGKRVLACKSACSA  179

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  C+P+ YSK+FK ACP   SYA+D P+ I +CS   Y  TFCP 
Sbjct  180  FNSPQYCCTGTFGNPLTCRPTSYSKIFKVACPKAYSYAYDDPTSIATCSKANYIVTFCPH  239

Query  176  N  174
            +
Sbjct  240  H  240



>gb|EEC78305.1| hypothetical protein OsI_18027 [Oryza sativa Indica Group]
Length=278

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 77/117 (66%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP+ V  +     C + GC   +R++CP+EL     NG  VAC+SAC  F
Sbjct  121  YDVSLVDGFNLPMVVRPLNGEGNCSVAGCDGDLRDSCPSELSK-KVNGRTVACRSACDVF  179

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            + D +CCR  YG+P  C+P+ YSK FK ACP+  SYA+D P+ I +CS+  Y  TFC
Sbjct  180  DTDQYCCRGMYGNPSTCQPTFYSKKFKAACPTAYSYAYDDPTSIFTCSNADYTITFC  236



>ref|NP_001054348.1| Os04g0689900 [Oryza sativa Japonica Group]
 emb|CAE01803.2| OSJNBa0039K24.22 [Oryza sativa Japonica Group]
 dbj|BAF16262.1| Os04g0689900 [Oryza sativa Japonica Group]
 dbj|BAG87668.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61958.1| hypothetical protein OsJ_16724 [Oryza sativa Japonica Group]
Length=278

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 77/117 (66%), Gaps = 1/117 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP+ V  +     C + GC   +R++CP+EL     NG  VAC+SAC  F
Sbjct  121  YDVSLVDGFNLPMVVRPLNGEGNCSVAGCDGDLRDSCPSELSK-KVNGRTVACRSACDVF  179

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC  183
            + D +CCR  YG+P  C+P+ YSK FK ACP+  SYA+D P+ I +CS+  Y  TFC
Sbjct  180  DTDQYCCRGMYGNPSTCQPTFYSKKFKAACPTAYSYAYDDPTSIFTCSNADYTITFC  236



>ref|XP_008364957.1| PREDICTED: pathogenesis-related protein 5-like [Malus domestica]
Length=246

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 77/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVN-GNGDVVACKSACLA  357
            YDVSLVDGYN+ + + +   +  C   GC+  +   CPAEL+V++ G+G VVAC+SAC A
Sbjct  124  YDVSLVDGYNVGMGLWATGGTGDCQYAGCVADLNGRCPAELRVMDAGSGAVVACRSACAA  183

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN   FCC  ++ +P  C P+ YS+MFK ACP+  SYA+D  +   +CS   Y  TFCP 
Sbjct  184  FNTPEFCCTGEHATPQTCSPTQYSEMFKTACPTAYSYAYDDATSTCTCSGSDYLITFCPS  243

Query  176  N  174
             
Sbjct  244  G  244



>ref|XP_010471424.1| PREDICTED: thaumatin-like protein [Camelina sativa]
Length=245

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGN-GDVVACKSACLA  357
            YDVSLVDGYNL +S+  +  + KC   GC+  +   CP  LQV + +   VVACKSAC A
Sbjct  123  YDVSLVDGYNLAMSIMPVKGTGKCTYAGCVSDLNRMCPVGLQVRSRDRKQVVACKSACSA  182

Query  356  FNADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCPE  177
            FN+  +CC   +G+P  CKP+ YSK+FK ACP   SYA+D P+ I +CS   Y  TFCP 
Sbjct  183  FNSPRYCCTGLFGNPQSCKPTAYSKIFKVACPKAYSYAYDDPTSIATCSKANYVVTFCPH  242

Query  176  N  174
            +
Sbjct  243  H  243



>ref|XP_010063355.1| PREDICTED: pathogenesis-related protein 5 [Eucalyptus grandis]
 gb|KCW70570.1| hypothetical protein EUGRSUZ_F03757 [Eucalyptus grandis]
Length=287

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 77/121 (64%), Gaps = 2/121 (2%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDG+NLP++V  I     C + GC + +R  CP+EL V    G  V C+SAC  F
Sbjct  124  YDVSLVDGFNLPLAVTPINGQGNCSVAGCDRDLRPTCPSELSV-KMKGKTVGCRSACDVF  182

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFC-PE  177
            N D +CC+  YG+P  C+P+ YSK+FK ACP+  SYA+D P+ I +C    Y  TFC P 
Sbjct  183  NTDEYCCKGVYGNPVICQPTYYSKLFKQACPTAYSYAYDDPTSIFTCVGTDYVITFCSPR  242

Query  176  N  174
            N
Sbjct  243  N  243



>ref|XP_009767579.1| PREDICTED: pathogenesis-related protein 5-like [Nicotiana sylvestris]
Length=324

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 75/118 (64%), Gaps = 4/118 (3%)
 Frame = -2

Query  533  YDVSLVDGYNLPVSVASIPSSSKCYIGGCMKSMRNACPAELQVVNGNGDVVACKSACLAF  354
            YDVSLVDGYNLP+++ ++  S  C   GC+K +   CP EL+V    GD  ACKSAC AF
Sbjct  130  YDVSLVDGYNLPMAIQAVGGSGACDTTGCVKDLNRMCPNELRV----GDGQACKSACEAF  185

Query  353  NADSFCCRNQYGSPDKCKPSLYSKMFKNACPSYVSYAFDRPSPIVSCSSDKYWFTFCP  180
             +  +CC   Y SP  CKPS YS MFKNACP   SYA+D P+   +C+   Y  TFCP
Sbjct  186  GSPEYCCSGAYASPSTCKPSSYSAMFKNACPKSYSYAYDDPTSTFTCTGADYTITFCP  243



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 510262503360