BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c126230_g1_i1 len=127 path=[1:0-126]

Length=127
                                                                      Score     E

gb|AES86810.2|  TIR-NBS-LRR class disease resistance protein          57.8    4e-08   
ref|XP_003604613.1|  TIR-NBS-LRR RCT1-like resistance protein         57.8    5e-08   
ref|XP_010498956.1|  PREDICTED: TMV resistance protein N-like         57.4    8e-08   
gb|KEH25094.1|  disease resistance protein (TIR-NBS-LRR class)        56.2    1e-07   
gb|KEH25085.1|  disease resistance protein (TIR-NBS-LRR class)        55.8    2e-07   
ref|XP_010263414.1|  PREDICTED: TMV resistance protein N-like         55.5    3e-07   
gb|AHG28995.1|  NBS-LRR protein                                       55.1    3e-07   
ref|XP_003604824.1|  NBS resistance protein                           53.5    4e-07   
ref|XP_004506792.1|  PREDICTED: TMV resistance protein N-like iso...  55.1    4e-07   
ref|XP_004506794.1|  PREDICTED: TMV resistance protein N-like iso...  55.1    4e-07   
gb|AES86811.2|  disease resistance protein (TIR-NBS-LRR class)        54.7    5e-07   
ref|XP_003604614.1|  TIR-NBS-LRR RCT1-like resistance protein         54.7    5e-07   
ref|XP_010646551.1|  PREDICTED: TMV resistance protein N-like         54.3    7e-07   
ref|XP_009115449.1|  PREDICTED: TMV resistance protein N isoform X2   54.3    8e-07   
gb|ACP30614.1|  disease resistance protein                            54.3    8e-07   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_009115448.1|  PREDICTED: TMV resistance protein N isoform X1   54.3    8e-07   
emb|CBI40966.3|  unnamed protein product                              54.3    8e-07   
emb|CDY16226.1|  BnaA09g29600D                                        54.3    8e-07   
ref|XP_009115450.1|  PREDICTED: TMV resistance protein N isoform X3   54.3    8e-07   
ref|XP_010251790.1|  PREDICTED: LOW QUALITY PROTEIN: TMV resistan...  54.3    8e-07   
emb|CDY14693.1|  BnaC05g19500D                                        53.9    9e-07   
ref|XP_010251791.1|  PREDICTED: TMV resistance protein N-like         53.9    1e-06   
gb|ACF19651.1|  TIR-NBS-LRR RCT1-like resistance protein              53.5    1e-06   Medicago sativa [alfalfa]
ref|XP_003627640.1|  NBS-LRR resistance-like protein 4T               53.5    1e-06   
gb|KEH18958.1|  disease resistance protein (TIR-NBS-LRR class)        53.5    1e-06   
ref|XP_006492496.1|  PREDICTED: TMV resistance protein N-like         53.1    2e-06   
ref|XP_010477757.1|  PREDICTED: TMV resistance protein N-like iso...  53.1    2e-06   
ref|XP_010477756.1|  PREDICTED: TMV resistance protein N-like iso...  53.1    2e-06   
ref|XP_010477755.1|  PREDICTED: TMV resistance protein N-like iso...  53.1    2e-06   
ref|XP_003604611.1|  TIR-NBS-LRR RCT1-like resistance protein         52.8    2e-06   
ref|XP_010498957.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  52.8    3e-06   
ref|XP_010477758.1|  PREDICTED: TMV resistance protein N-like         52.8    3e-06   
gb|KEH25116.1|  disease resistance protein (TIR-NBS-LRR class)        52.4    3e-06   
ref|XP_002321497.2|  hypothetical protein POPTR_0015s04030g           52.4    3e-06   Populus trichocarpa [western balsam poplar]
gb|KEH25073.1|  disease resistance protein (TIR-NBS-LRR class)        52.4    3e-06   
gb|AHG29005.1|  NBS-LRR protein                                       52.4    3e-06   
gb|KHN02149.1|  TMV resistance protein N                              52.0    4e-06   
ref|XP_006576565.1|  PREDICTED: TMV resistance protein N-like         52.0    4e-06   
ref|XP_009115451.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  52.0    4e-06   
gb|KDP26071.1|  hypothetical protein JCGZ_21104                       52.0    4e-06   
ref|XP_002530559.1|  conserved hypothetical protein                   51.6    5e-06   Ricinus communis
gb|KEH25080.1|  disease resistance protein (TIR-NBS-LRR class), p...  52.0    5e-06   
emb|CBI39286.3|  unnamed protein product                              51.2    5e-06   
ref|XP_004489473.1|  PREDICTED: TMV resistance protein N-like iso...  51.6    6e-06   
ref|XP_010501578.1|  PREDICTED: TMV resistance protein N              50.8    6e-06   
ref|XP_010495706.1|  PREDICTED: probable WRKY transcription facto...  51.2    6e-06   
ref|XP_004489474.1|  PREDICTED: TMV resistance protein N-like iso...  51.6    6e-06   
ref|XP_009348201.1|  PREDICTED: TMV resistance protein N-like         51.2    7e-06   
ref|XP_004489499.1|  PREDICTED: TMV resistance protein N-like         51.2    7e-06   
emb|CBI31340.3|  unnamed protein product                              50.8    7e-06   
gb|KEH25106.1|  disease resistance protein (TIR-NBS-LRR class), p...  51.2    8e-06   
gb|KEH16160.1|  TIR-NBS-LRR class disease resistance protein          51.2    8e-06   
emb|CDY55270.1|  BnaC07g18270D                                        50.8    8e-06   
ref|XP_003604607.1|  TIR-NBS-LRR RCT1 resistance protein              51.2    9e-06   
gb|AES86804.2|  disease resistance protein (TIR-NBS-LRR class)        51.2    9e-06   
gb|ACF19650.1|  TIR-NBS-LRR RCT1 resistance protein                   51.2    9e-06   Medicago truncatula
gb|KDO43813.1|  hypothetical protein CISIN_1g046086mg                 50.8    9e-06   
ref|XP_006470767.1|  PREDICTED: TMV resistance protein N-like         51.2    1e-05   
ref|XP_007034212.1|  Disease resistance protein family, putative      50.8    1e-05   
ref|XP_010645907.1|  PREDICTED: TMV resistance protein N-like         50.8    1e-05   
ref|XP_009770076.1|  PREDICTED: TMV resistance protein N-like         50.8    1e-05   
gb|KHN42294.1|  TMV resistance protein N                              50.8    1e-05   
emb|CDK13054.1|  TIR-NBS-LRR disease resistance protein               50.8    1e-05   
ref|XP_008350782.1|  PREDICTED: TMV resistance protein N-like         50.8    1e-05   
ref|XP_002523481.1|  TMV resistance protein N, putative               50.8    1e-05   Ricinus communis
emb|CBI39287.3|  unnamed protein product                              50.8    1e-05   
ref|XP_010070566.1|  PREDICTED: TMV resistance protein N-like         50.1    1e-05   
ref|XP_010665364.1|  PREDICTED: TMV resistance protein N-like         50.8    1e-05   
ref|XP_010477751.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  50.8    1e-05   
ref|XP_010477750.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  50.8    1e-05   
ref|XP_010263320.1|  PREDICTED: TMV resistance protein N-like         50.8    1e-05   
ref|XP_010460211.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  50.8    1e-05   
ref|XP_006306587.1|  hypothetical protein CARUB_v10008094mg           50.8    1e-05   
ref|XP_006306588.1|  hypothetical protein CARUB_v10008094mg           50.8    1e-05   
ref|XP_009597750.1|  PREDICTED: TMV resistance protein N-like         50.4    1e-05   
ref|XP_011016521.1|  PREDICTED: TMV resistance protein N-like         50.4    1e-05   
ref|XP_002893351.1|  predicted protein                                50.4    1e-05   
emb|CDK13059.1|  TIR-NBS-LRR disease resistance protein               50.4    1e-05   
ref|XP_010665371.1|  PREDICTED: TMV resistance protein N-like         50.4    1e-05   
ref|XP_002318534.1|  disease resistance family protein                50.4    2e-05   Populus trichocarpa [western balsam poplar]
ref|XP_002862525.1|  predicted protein                                50.1    2e-05   
ref|NP_199334.1|  TIR-NBS-LRR class disease resistance protein        50.1    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010245559.1|  PREDICTED: uncharacterized protein LOC104589071  50.4    2e-05   
emb|CAN83385.1|  hypothetical protein VITISV_004581                   50.4    2e-05   Vitis vinifera
gb|KEH25077.1|  disease resistance protein (TIR-NBS-LRR class)        50.1    2e-05   
gb|KEH25076.1|  disease resistance protein (TIR-NBS-LRR class)        50.1    2e-05   
ref|XP_010645914.1|  PREDICTED: TMV resistance protein N-like         50.1    2e-05   
ref|XP_008357580.1|  PREDICTED: TMV resistance protein N-like         50.1    2e-05   
ref|XP_010256443.1|  PREDICTED: TMV resistance protein N-like iso...  50.1    2e-05   
ref|XP_010256441.1|  PREDICTED: TMV resistance protein N-like iso...  50.1    2e-05   
gb|AFC90336.1|  nucleotide-binding site leucine-rich repeat protein   48.5    2e-05   
ref|XP_006576576.1|  PREDICTED: TMV resistance protein N-like iso...  49.7    3e-05   
ref|XP_008371343.1|  PREDICTED: TMV resistance protein N-like         49.3    3e-05   
ref|XP_009605717.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  49.7    3e-05   
ref|XP_003604898.1|  Nbs-lrr resistance protein                       49.3    3e-05   
emb|CDK13056.1|  TIR-NBS-LRR disease resistance protein               49.3    3e-05   
ref|XP_006576577.1|  PREDICTED: TMV resistance protein N-like iso...  49.3    3e-05   
ref|XP_003627837.1|  NBS resistance protein                           49.7    3e-05   
gb|KCW59393.1|  hypothetical protein EUGRSUZ_H02098                   49.3    3e-05   
ref|XP_008359988.1|  PREDICTED: TMV resistance protein N-like         49.3    3e-05   
ref|XP_002893349.1|  hypothetical protein ARALYDRAFT_889995           49.3    3e-05   
ref|XP_006360962.1|  PREDICTED: TMV resistance protein N-like         49.3    4e-05   
ref|XP_002893348.1|  predicted protein                                49.3    4e-05   
ref|XP_006446207.1|  hypothetical protein CICLE_v10014074mg           49.3    4e-05   
ref|XP_006441679.1|  hypothetical protein CICLE_v10023907mg           48.9    4e-05   
ref|XP_002321495.2|  hypothetical protein POPTR_0015s04000g           49.3    4e-05   Populus trichocarpa [western balsam poplar]
ref|XP_004301464.1|  PREDICTED: TMV resistance protein N-like         49.3    4e-05   
gb|KDP41073.1|  hypothetical protein JCGZ_03179                       49.3    4e-05   
ref|XP_006360922.1|  PREDICTED: TMV resistance protein N-like iso...  49.3    4e-05   
gb|AES86763.2|  disease resistance protein (TIR-NBS-LRR class)        49.3    4e-05   
ref|XP_003604566.1|  Disease resistance protein                       49.3    4e-05   
gb|ABV30885.1|  NBS-containing resistance-like protein                48.1    4e-05   Platanus x hispanica [London plane tree]
ref|XP_006360923.1|  PREDICTED: TMV resistance protein N-like iso...  49.3    4e-05   
gb|KDP42291.1|  hypothetical protein JCGZ_01615                       48.5    4e-05   
gb|AFC90257.1|  nucleotide-binding site leucine-rich repeat protein   47.8    4e-05   
ref|XP_006388457.1|  hypothetical protein POPTR_0182s002201g          48.9    4e-05   
ref|XP_010665089.1|  PREDICTED: TMV resistance protein N-like         48.9    5e-05   
ref|XP_009364579.1|  PREDICTED: TMV resistance protein N-like         48.9    5e-05   
ref|XP_002517696.1|  TMV resistance protein N, putative               48.9    5e-05   Ricinus communis
ref|XP_006478463.1|  PREDICTED: TMV resistance protein N-like         48.9    5e-05   
ref|NP_195337.1|  putative TIR-NBS-LRR class disease resistance p...  48.9    5e-05   Arabidopsis thaliana [mouse-ear cress]
gb|KEH25086.1|  disease resistance protein (TIR-NBS-LRR class)        48.9    5e-05   
gb|AES87095.2|  disease resistance protein (TIR-NBS-LRR class)        48.9    5e-05   
ref|XP_011046325.1|  PREDICTED: TMV resistance protein N-like iso...  48.9    6e-05   
ref|XP_011046323.1|  PREDICTED: TMV resistance protein N-like iso...  48.9    6e-05   
ref|XP_008244985.1|  PREDICTED: TMV resistance protein N-like         48.9    6e-05   
ref|XP_004489498.1|  PREDICTED: uncharacterized protein LOC101494533  48.9    6e-05   
ref|XP_006440968.1|  hypothetical protein CICLE_v10018693mg           48.5    6e-05   
emb|CDY14687.1|  BnaC05g19440D                                        48.5    6e-05   
gb|AFC90318.1|  nucleotide-binding site leucine-rich repeat protein   47.4    6e-05   
ref|XP_006441672.1|  hypothetical protein CICLE_v10018578mg           48.5    6e-05   
emb|CDK13058.1|  TIR-NBS-LRR disease resistance protein               48.5    6e-05   
ref|XP_010108456.1|  TMV resistance protein N                         48.5    6e-05   
ref|XP_009607522.1|  PREDICTED: TMV resistance protein N-like         48.5    7e-05   
ref|XP_010645953.1|  PREDICTED: TMV resistance protein N-like         48.5    7e-05   
gb|KEH19117.1|  disease resistance protein (TIR-NBS-LRR class)        48.5    7e-05   
gb|KDO37857.1|  hypothetical protein CISIN_1g0011611mg                48.1    7e-05   
ref|XP_006478279.1|  PREDICTED: TMV resistance protein N-like iso...  48.5    7e-05   
ref|XP_008244976.1|  PREDICTED: TMV resistance protein N-like         48.5    7e-05   
ref|XP_006478278.1|  PREDICTED: TMV resistance protein N-like iso...  48.5    7e-05   
gb|KCW85843.1|  hypothetical protein EUGRSUZ_B02580                   47.8    7e-05   
ref|XP_006398177.1|  hypothetical protein EUTSA_v10001238mg           48.1    7e-05   
ref|XP_002276075.2|  PREDICTED: TMV resistance protein N-like iso...  48.5    7e-05   Vitis vinifera
ref|XP_009760885.1|  PREDICTED: TMV resistance protein N-like         48.5    7e-05   
ref|XP_004489475.1|  PREDICTED: TMV resistance protein N-like         48.5    7e-05   
emb|CDY36329.1|  BnaA01g30890D                                        46.6    7e-05   
ref|XP_006478274.1|  PREDICTED: TMV resistance protein N-like iso...  48.5    8e-05   
ref|XP_007224738.1|  hypothetical protein PRUPE_ppa024525mg           48.5    8e-05   
gb|KFK44609.1|  hypothetical protein AALP_AA1G281100                  48.5    8e-05   
gb|KFK44610.1|  hypothetical protein AALP_AA1G281100                  48.5    8e-05   
ref|XP_009336913.1|  PREDICTED: TMV resistance protein N-like         48.5    8e-05   
ref|XP_008245426.1|  PREDICTED: TMV resistance protein N-like         47.8    8e-05   
ref|XP_006577459.1|  PREDICTED: TMV resistance protein N-like         48.1    8e-05   
ref|XP_003627827.1|  NBS-LRR resistance-like protein 4G               48.5    8e-05   
emb|CDK13060.1|  TIR-NBS-LRR disease resistance protein               48.1    8e-05   
ref|XP_006440972.1|  hypothetical protein CICLE_v10018595mg           48.1    8e-05   
gb|AAQ93077.1|  putative TIR-NBS type R protein 11                    48.1    8e-05   Malus domestica [apple tree]
gb|AES87048.2|  disease resistance protein (TIR-NBS-LRR class)        48.5    8e-05   
emb|CAD56845.1|  putative resistance gene analogue protein            47.4    8e-05   Lens culinaris
gb|KDO42422.1|  hypothetical protein CISIN_1g041923mg                 47.8    9e-05   
ref|XP_010645905.1|  PREDICTED: TMV resistance protein N-like         48.1    9e-05   
ref|XP_003605840.1|  NBS-LRR resistance-like protein 4G               48.1    9e-05   
ref|XP_008352803.1|  PREDICTED: TMV resistance protein N-like         48.1    9e-05   
ref|XP_006576513.1|  PREDICTED: TMV resistance protein N-like iso...  48.1    9e-05   
ref|XP_006576512.1|  PREDICTED: TMV resistance protein N-like iso...  48.1    9e-05   
gb|KEH16042.1|  disease resistance protein (TIR-NBS-LRR class)        48.1    9e-05   
ref|XP_007224475.1|  hypothetical protein PRUPE_ppa022336mg           48.1    1e-04   
ref|XP_006282986.1|  hypothetical protein CARUB_v10003971mg           48.1    1e-04   
ref|XP_006282987.1|  hypothetical protein CARUB_v10003971mg           48.1    1e-04   
ref|XP_006485790.1|  PREDICTED: TMV resistance protein N-like         48.1    1e-04   
gb|KFK44608.1|  hypothetical protein AALP_AA1G281000                  48.1    1e-04   
ref|XP_006605620.1|  PREDICTED: TMV resistance protein N-like iso...  48.1    1e-04   
ref|XP_010665349.1|  PREDICTED: TMV resistance protein N-like iso...  48.1    1e-04   
gb|KEH25111.1|  disease resistance protein (TIR-NBS-LRR class)        48.1    1e-04   
emb|CDK13053.1|  TIR-NBS-LRR disease resistance protein               48.1    1e-04   
ref|XP_010645912.1|  PREDICTED: TMV resistance protein N-like iso...  47.8    1e-04   
ref|XP_007157556.1|  hypothetical protein PHAVU_002G079200g           48.1    1e-04   
ref|XP_006586404.1|  PREDICTED: TMV resistance protein N-like         48.1    1e-04   
gb|KEH25117.1|  disease resistance protein (TIR-NBS-LRR class)        47.8    1e-04   
ref|XP_009591454.1|  PREDICTED: TMV resistance protein N-like         45.4    1e-04   
gb|KHN11283.1|  TMV resistance protein N                              48.1    1e-04   
ref|XP_006441748.1|  hypothetical protein CICLE_v10023641mg           47.8    1e-04   
gb|KEH29523.1|  disease resistance protein (TIR-NBS-LRR class)        47.8    1e-04   
gb|KEH17605.1|  disease resistance protein (TIR-NBS-LRR class)        47.8    1e-04   
ref|XP_010043845.1|  PREDICTED: probable WRKY transcription facto...  47.8    1e-04   
ref|XP_010665217.1|  PREDICTED: TMV resistance protein N-like         47.8    1e-04   
ref|XP_010043844.1|  PREDICTED: TMV resistance protein N-like iso...  47.8    1e-04   
ref|XP_009589492.1|  PREDICTED: TMV resistance protein N-like         47.8    1e-04   
emb|CBI18156.3|  unnamed protein product                              47.4    1e-04   
emb|CAN75471.1|  hypothetical protein VITISV_010349                   47.8    1e-04   Vitis vinifera
ref|XP_006605619.1|  PREDICTED: TMV resistance protein N-like iso...  47.8    1e-04   
ref|XP_010315476.1|  PREDICTED: uncharacterized protein LOC101251930  48.1    1e-04   
gb|KDP26906.1|  hypothetical protein JCGZ_18064                       47.8    1e-04   
ref|XP_009773802.1|  PREDICTED: TMV resistance protein N-like         47.8    1e-04   
ref|XP_008345881.1|  PREDICTED: TMV resistance protein N-like         47.8    1e-04   
ref|XP_002524855.1|  ATP binding protein, putative                    47.8    1e-04   Ricinus communis
gb|KEH29524.1|  disease resistance protein (TIR-NBS-LRR class)        47.8    1e-04   
ref|XP_008390203.1|  PREDICTED: TMV resistance protein N-like         47.8    1e-04   
gb|KDP26904.1|  hypothetical protein JCGZ_18062                       47.8    1e-04   
ref|XP_010026366.1|  PREDICTED: TMV resistance protein N-like         47.4    1e-04   
gb|KGN52644.1|  hypothetical protein Csa_5G648650                     47.8    1e-04   
ref|XP_006605615.1|  PREDICTED: TMV resistance protein N-like iso...  47.8    1e-04   
gb|KHN15002.1|  TMV resistance protein N                              47.8    1e-04   
ref|XP_006491606.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  47.8    1e-04   
ref|XP_008390171.1|  PREDICTED: TMV resistance protein N-like         47.0    1e-04   
emb|CDP00246.1|  unnamed protein product                              47.8    1e-04   
ref|XP_002525460.1|  hypothetical protein RCOM_1122080                47.4    1e-04   Ricinus communis
gb|KDP45045.1|  hypothetical protein JCGZ_01545                       47.8    1e-04   
ref|XP_007199198.1|  hypothetical protein PRUPE_ppa021587mg           47.8    1e-04   
ref|XP_003604851.1|  NBS-containing resistance-like protein           47.8    1e-04   
emb|CAN72303.1|  hypothetical protein VITISV_009715                   47.8    1e-04   Vitis vinifera
ref|XP_004141627.1|  PREDICTED: TMV resistance protein N-like         47.8    1e-04   
ref|XP_006391686.1|  hypothetical protein EUTSA_v10023218mg           47.8    1e-04   
ref|XP_006441860.1|  hypothetical protein CICLE_v10024544mg           47.8    1e-04   
gb|KEH18959.1|  disease resistance protein (TIR-NBS-LRR class)        47.8    1e-04   
gb|KFK35949.1|  hypothetical protein AALP_AA4G059300                  47.4    1e-04   
gb|KFK44611.1|  hypothetical protein AALP_AA1G281200                  47.8    1e-04   
emb|CDX98624.1|  BnaA03g44090D                                        47.4    1e-04   
ref|XP_003604881.1|  TIR-NBS-LRR RCT1 resistance protein              47.4    1e-04   
ref|XP_004156244.1|  PREDICTED: TMV resistance protein N-like         47.8    2e-04   
gb|KDP42430.1|  hypothetical protein JCGZ_00227                       47.4    2e-04   
ref|XP_010645387.1|  PREDICTED: TMV resistance protein N-like         47.4    2e-04   
ref|XP_006358466.1|  PREDICTED: TMV resistance protein N-like         47.4    2e-04   
gb|KEH25109.1|  disease resistance protein (TIR-NBS-LRR class)        47.4    2e-04   
ref|XP_009758995.1|  PREDICTED: TMV resistance protein N-like iso...  47.4    2e-04   
ref|XP_010652777.1|  PREDICTED: TMV resistance protein N-like iso...  47.4    2e-04   
ref|XP_010652774.1|  PREDICTED: TMV resistance protein N-like iso...  47.4    2e-04   
ref|XP_009758994.1|  PREDICTED: TMV resistance protein N-like iso...  47.4    2e-04   
ref|XP_006370901.1|  hypothetical protein POPTR_0019s01560g           47.4    2e-04   
ref|XP_010263366.1|  PREDICTED: TMV resistance protein N-like         47.4    2e-04   
ref|XP_006573081.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  47.4    2e-04   
ref|XP_007201606.1|  hypothetical protein PRUPE_ppa019497mg           47.4    2e-04   
ref|XP_009110747.1|  PREDICTED: TMV resistance protein N-like         47.4    2e-04   
emb|CAD56823.1|  putative resistance gene analogue protein            46.2    2e-04   Lens culinaris
ref|XP_006573080.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  47.4    2e-04   
gb|KDP26901.1|  hypothetical protein JCGZ_18059                       47.4    2e-04   
ref|XP_006388459.1|  hypothetical protein POPTR_0182s00240g           47.4    2e-04   
ref|XP_009146644.1|  PREDICTED: probable WRKY transcription facto...  47.4    2e-04   
emb|CAD56846.1|  putative resistance gene analogue protein            46.2    2e-04   Lens culinaris
ref|XP_003627638.1|  Tir-nbs-lrr resistance protein                   47.4    2e-04   
gb|ACP30608.1|  disease resistance protein                            47.4    2e-04   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_009622118.1|  PREDICTED: TMV resistance protein N-like iso...  47.0    2e-04   
ref|XP_007224218.1|  hypothetical protein PRUPE_ppa017550mg           47.0    2e-04   
ref|XP_009374162.1|  PREDICTED: TMV resistance protein N-like         47.0    2e-04   
emb|CDX75556.1|  BnaA01g01460D                                        47.4    2e-04   
gb|KEH25074.1|  disease resistance protein (TIR-NBS-LRR class)        47.0    2e-04   
ref|XP_010263198.1|  PREDICTED: TMV resistance protein N-like iso...  47.0    2e-04   
ref|XP_010263195.1|  PREDICTED: TMV resistance protein N-like iso...  47.0    2e-04   
emb|CDY16227.1|  BnaA09g29610D                                        47.0    2e-04   
ref|XP_006440971.1|  hypothetical protein CICLE_v10018595mg           47.0    2e-04   
ref|XP_006441827.1|  hypothetical protein CICLE_v100236471mg          46.6    2e-04   
gb|ACN87482.1|  NBS-containing resistance-like protein                45.8    2e-04   Corylus avellana [European hazelnut]
gb|ADL36726.1|  HD domain class transcription factor                  47.0    2e-04   
ref|XP_006485791.1|  PREDICTED: TMV resistance protein N-like         47.0    2e-04   
gb|KEH25115.1|  disease resistance protein (TIR-NBS-LRR class)        47.0    2e-04   
gb|AGV28084.1|  NBS-LRR protein                                       47.0    2e-04   
ref|XP_008339119.1|  PREDICTED: TMV resistance protein N-like         47.0    2e-04   
gb|AES86764.2|  TIR-NBS-LRR class disease resistance protein          47.0    2e-04   
ref|XP_003627687.1|  NBS resistance protein                           47.0    2e-04   
ref|XP_003604567.1|  Tir-nbs-lrr resistance protein                   47.0    2e-04   
ref|XP_006491604.1|  PREDICTED: TMV resistance protein N-like         47.0    2e-04   
gb|KEH29032.1|  disease resistance protein (TIR-NBS-LRR class)        47.0    2e-04   
emb|CDY23150.1|  BnaC09g19040D                                        46.6    2e-04   
emb|CDY26392.1|  BnaA02g23780D                                        47.0    2e-04   
ref|XP_010481620.1|  PREDICTED: probable WRKY transcription facto...  47.0    2e-04   
ref|XP_009128770.1|  PREDICTED: probable WRKY transcription facto...  47.0    2e-04   
ref|XP_010481619.1|  PREDICTED: probable WRKY transcription facto...  47.0    2e-04   
ref|XP_009799389.1|  PREDICTED: TMV resistance protein N-like iso...  46.6    2e-04   
gb|KEH16028.1|  TIR-NBS-LRR class disease resistance protein          46.2    3e-04   
ref|XP_006576517.1|  PREDICTED: TMV resistance protein N-like iso...  47.0    3e-04   
ref|XP_006576516.1|  PREDICTED: TMV resistance protein N-like iso...  47.0    3e-04   
ref|XP_010087987.1|  TMV resistance protein N                         47.0    3e-04   
ref|XP_002867033.1|  predicted protein                                47.0    3e-04   
gb|KDP46536.1|  hypothetical protein JCGZ_08508                       47.0    3e-04   
emb|CAN68234.1|  hypothetical protein VITISV_039221                   46.2    3e-04   Vitis vinifera
ref|XP_006576515.1|  PREDICTED: TMV resistance protein N-like iso...  47.0    3e-04   
gb|KEH25078.1|  disease resistance protein (TIR-NBS-LRR class)        47.0    3e-04   
ref|XP_006360964.1|  PREDICTED: TMV resistance protein N-like         47.0    3e-04   
ref|XP_009622117.1|  PREDICTED: TMV resistance protein N-like iso...  46.6    3e-04   
ref|XP_009622115.1|  PREDICTED: TMV resistance protein N-like iso...  46.6    3e-04   
ref|XP_008362924.1|  PREDICTED: TMV resistance protein N-like         46.6    3e-04   
ref|XP_009368502.1|  PREDICTED: TMV resistance protein N-like         46.6    3e-04   
ref|XP_003636848.1|  Tir-nbs-lrr resistance protein                   46.6    3e-04   
ref|XP_008371688.1|  PREDICTED: TMV resistance protein N-like         45.8    3e-04   
ref|XP_007224771.1|  hypothetical protein PRUPE_ppa024045mg           46.6    3e-04   
ref|XP_003635135.2|  PREDICTED: uncharacterized protein LOC100853815  46.6    3e-04   
ref|XP_003628577.1|  Tir-nbs-lrr resistance protein                   46.6    3e-04   
ref|XP_002264704.2|  PREDICTED: TMV resistance protein N              46.6    3e-04   
ref|XP_009757877.1|  PREDICTED: TMV resistance protein N-like iso...  46.6    3e-04   
ref|XP_009757876.1|  PREDICTED: TMV resistance protein N-like iso...  46.6    3e-04   
ref|XP_008459550.1|  PREDICTED: TMV resistance protein N-like         46.6    3e-04   
gb|ACN87481.1|  NBS-containing resistance-like protein                45.4    3e-04   
ref|XP_009375828.1|  PREDICTED: TMV resistance protein N-like         46.6    3e-04   
gb|KEH29031.1|  disease resistance protein (TIR-NBS-LRR class)        46.6    3e-04   
ref|XP_010551473.1|  PREDICTED: TMV resistance protein N-like iso...  46.6    3e-04   
ref|XP_010551472.1|  PREDICTED: TMV resistance protein N-like iso...  46.6    3e-04   
gb|KCW59181.1|  hypothetical protein EUGRSUZ_H01834                   46.2    3e-04   
emb|CBI23887.3|  unnamed protein product                              46.6    3e-04   
ref|XP_003636294.1|  Tir-nbs-lrr resistance protein                   46.6    3e-04   
gb|KDO42944.1|  hypothetical protein CISIN_1g044535mg                 46.6    3e-04   
ref|XP_011015524.1|  PREDICTED: TMV resistance protein N              46.6    3e-04   
ref|XP_010519809.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  46.6    4e-04   
ref|XP_008352286.1|  PREDICTED: TMV resistance protein N-like         46.2    4e-04   
ref|XP_010445818.1|  PREDICTED: probable WRKY transcription facto...  45.4    4e-04   
ref|XP_006371403.1|  hypothetical protein POPTR_0019s09900g           46.2    4e-04   
ref|XP_004308481.1|  PREDICTED: TMV resistance protein N-like         46.6    4e-04   
ref|XP_011032761.1|  PREDICTED: TMV resistance protein N-like iso...  46.2    4e-04   
ref|XP_009758997.1|  PREDICTED: TMV resistance protein N-like         46.2    4e-04   
ref|XP_010263399.1|  PREDICTED: TMV resistance protein N-like         46.6    4e-04   
ref|XP_006441677.1|  hypothetical protein CICLE_v10024179mg           46.2    4e-04   
ref|XP_007224521.1|  hypothetical protein PRUPE_ppa023909mg           46.2    4e-04   
ref|XP_002325500.2|  hypothetical protein POPTR_0019s09870g           46.2    4e-04   
ref|XP_009799386.1|  PREDICTED: TMV resistance protein N-like iso...  46.2    4e-04   
ref|XP_003627179.1|  NBS resistance protein                           46.2    4e-04   
gb|ABV30890.1|  NBS-containing resistance-like protein                45.1    4e-04   
ref|XP_006360971.1|  PREDICTED: TMV resistance protein N-like         46.2    4e-04   
ref|XP_010494626.1|  PREDICTED: probable WRKY transcription facto...  46.2    4e-04   
ref|XP_008218838.1|  PREDICTED: LOW QUALITY PROTEIN: TMV resistan...  46.2    4e-04   
gb|AET01655.2|  disease resistance protein (TIR-NBS-LRR class)        46.2    4e-04   
gb|AGH33842.1|  RGH14                                                 46.2    4e-04   
ref|XP_010245185.1|  PREDICTED: TMV resistance protein N-like         46.2    4e-04   
gb|ABV30901.1|  NBS-containing resistance-like protein                45.1    4e-04   
ref|XP_009132863.1|  PREDICTED: probable WRKY transcription facto...  46.2    4e-04   
ref|XP_010645945.1|  PREDICTED: TMV resistance protein N-like         46.2    4e-04   
gb|KDP34368.1|  hypothetical protein JCGZ_11251                       46.2    4e-04   
emb|CAN68265.1|  hypothetical protein VITISV_020931                   46.2    4e-04   
ref|XP_007133979.1|  hypothetical protein PHAVU_010G008700g           46.2    4e-04   
ref|XP_008337420.1|  PREDICTED: TMV resistance protein N-like         46.2    4e-04   
ref|XP_009132855.1|  PREDICTED: probable WRKY transcription facto...  46.2    4e-04   
ref|XP_009132847.1|  PREDICTED: probable WRKY transcription facto...  46.2    4e-04   
ref|XP_006492495.1|  PREDICTED: TMV resistance protein N-like         46.2    4e-04   
emb|CDX78937.1|  BnaA01g10040D                                        46.2    4e-04   
ref|XP_007153879.1|  hypothetical protein PHAVU_003G072500g           46.2    5e-04   
ref|XP_010665287.1|  PREDICTED: TMV resistance protein N-like         46.2    5e-04   
gb|KEH29013.1|  disease resistance protein (TIR-NBS-LRR class), p...  46.2    5e-04   
ref|XP_008378862.1|  PREDICTED: TMV resistance protein N-like         46.2    5e-04   
ref|XP_010658914.1|  PREDICTED: TMV resistance protein N-like         46.2    5e-04   
ref|XP_007221841.1|  hypothetical protein PRUPE_ppa023819mg           45.8    5e-04   
gb|KEH29016.1|  disease resistance protein (TIR-NBS-LRR class), p...  46.2    5e-04   
ref|XP_008222667.1|  PREDICTED: TMV resistance protein N-like         46.2    5e-04   
ref|XP_008221717.1|  PREDICTED: LOW QUALITY PROTEIN: TMV resistan...  46.2    5e-04   
ref|XP_007227357.1|  hypothetical protein PRUPE_ppa000268mg           46.2    5e-04   
gb|KEH29014.1|  disease resistance protein (TIR-NBS-LRR class), p...  46.2    5e-04   
gb|AET03874.2|  disease resistance protein (TIR-NBS-LRR class)        45.8    5e-04   
ref|XP_010657863.1|  PREDICTED: TMV resistance protein N-like         46.2    5e-04   
ref|XP_010263244.1|  PREDICTED: TMV resistance protein N-like         46.2    5e-04   
gb|KDO57452.1|  hypothetical protein CISIN_1g009306mg                 45.8    5e-04   
ref|XP_009353023.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  46.2    5e-04   
ref|XP_008375770.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  46.2    5e-04   
ref|XP_010026371.1|  PREDICTED: TMV resistance protein N-like         45.1    5e-04   
ref|XP_006441671.1|  hypothetical protein CICLE_v10018612mg           45.8    5e-04   
ref|XP_003629398.1|  Tir-nbs-lrr resistance protein                   45.8    5e-04   
ref|XP_003604857.1|  NBS-LRR resistance protein                       46.2    5e-04   
ref|XP_007226259.1|  hypothetical protein PRUPE_ppa018622mg           45.8    5e-04   
ref|XP_011032756.1|  PREDICTED: TMV resistance protein N-like iso...  45.8    5e-04   
ref|XP_006370902.1|  hypothetical protein POPTR_0019s01570g           45.8    5e-04   
gb|KDO51239.1|  hypothetical protein CISIN_1g0488311mg                45.4    5e-04   
ref|XP_008358270.1|  PREDICTED: TMV resistance protein N-like         45.8    5e-04   
emb|CDK13057.1|  TIR-NBS-LRR disease resistance protein               45.8    5e-04   
ref|XP_010244457.1|  PREDICTED: TMV resistance protein N-like         45.8    5e-04   
gb|KDO43814.1|  hypothetical protein CISIN_1g002299mg                 45.8    5e-04   
ref|XP_008367905.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  45.8    5e-04   
ref|XP_006441822.1|  hypothetical protein CICLE_v10024380mg           45.4    5e-04   
gb|KEH29011.1|  disease resistance protein (TIR-NBS-LRR class)        45.8    5e-04   
gb|ACN87479.1|  NBS-containing resistance-like protein                44.7    5e-04   
gb|KEH29017.1|  disease resistance protein (TIR-NBS-LRR class), p...  45.8    6e-04   
gb|KDP38820.1|  hypothetical protein JCGZ_04977                       45.8    6e-04   
ref|XP_006416010.1|  hypothetical protein EUTSA_v10006573mg           45.8    6e-04   
ref|XP_002300861.2|  hypothetical protein POPTR_0002s05700g           45.8    6e-04   
ref|XP_003604861.1|  Nbs-lrr resistance protein                       45.8    6e-04   
ref|XP_007226714.1|  hypothetical protein PRUPE_ppa019834mg           45.8    6e-04   
gb|AES69132.2|  disease resistance protein (TIR-NBS-LRR class)        45.8    6e-04   
ref|XP_008381702.1|  PREDICTED: TMV resistance protein N-like         45.8    6e-04   
ref|XP_006478419.1|  PREDICTED: putative disease resistance prote...  45.8    6e-04   
ref|XP_003598881.1|  TMV resistance protein N                         45.8    6e-04   
ref|XP_009368501.1|  PREDICTED: TMV resistance protein N-like         45.8    6e-04   
ref|XP_008221716.1|  PREDICTED: TMV resistance protein N-like         45.8    6e-04   
ref|XP_011013409.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  45.8    6e-04   
ref|XP_002869985.1|  predicted protein                                45.8    6e-04   
ref|XP_011032759.1|  PREDICTED: TMV resistance protein N-like iso...  45.8    6e-04   
ref|XP_010449350.1|  PREDICTED: probable WRKY transcription facto...  45.8    6e-04   
ref|XP_010494568.1|  PREDICTED: probable WRKY transcription facto...  45.8    6e-04   
ref|XP_010494567.1|  PREDICTED: probable WRKY transcription facto...  45.8    6e-04   
gb|ABF81418.1|  NBS type disease resistance protein                   45.4    6e-04   
ref|NP_174038.1|  TIR-NBS-LRR class disease resistance protein        45.8    6e-04   
gb|AAG13419.1|AC000348_16  T7N9.24                                    45.8    6e-04   
ref|XP_008390215.1|  PREDICTED: TMV resistance protein N-like         45.8    7e-04   
ref|XP_009779815.1|  PREDICTED: TMV resistance protein N-like         45.8    7e-04   
ref|XP_004289274.1|  PREDICTED: TMV resistance protein N-like         45.4    7e-04   
ref|XP_011026208.1|  PREDICTED: TMV resistance protein N-like         45.8    7e-04   
ref|XP_006441685.1|  hypothetical protein CICLE_v10024161mg           45.4    7e-04   
ref|XP_007203843.1|  hypothetical protein PRUPE_ppa023165m1g          45.4    7e-04   
ref|XP_006427001.1|  hypothetical protein CICLE_v10024735mg           45.4    7e-04   
ref|XP_006427002.1|  hypothetical protein CICLE_v10024735mg           45.4    7e-04   
gb|AES87058.2|  disease resistance protein (TIR-NBS-LRR class)        45.8    7e-04   
ref|XP_009625402.1|  PREDICTED: TMV resistance protein N-like iso...  45.8    7e-04   
ref|XP_009625401.1|  PREDICTED: TMV resistance protein N-like iso...  45.8    7e-04   
ref|XP_010326869.1|  PREDICTED: TMV resistance protein N isoform X1   45.4    7e-04   
ref|XP_004247886.1|  PREDICTED: TMV resistance protein N isoform X2   45.4    7e-04   
ref|XP_008238072.1|  PREDICTED: uncharacterized protein LOC103336752  45.8    7e-04   
ref|XP_010434408.1|  PREDICTED: probable WRKY transcription facto...  45.4    7e-04   
ref|XP_009804962.1|  PREDICTED: TMV resistance protein N-like iso...  45.4    7e-04   
ref|XP_009804951.1|  PREDICTED: TMV resistance protein N-like iso...  45.4    7e-04   
ref|XP_008368273.1|  PREDICTED: TMV resistance protein N-like         45.4    7e-04   
ref|XP_006466583.1|  PREDICTED: TMV resistance protein N-like         45.4    7e-04   
gb|KDP42288.1|  hypothetical protein JCGZ_01612                       45.1    7e-04   
gb|KDO39753.1|  hypothetical protein CISIN_1g003683mg                 45.4    7e-04   
ref|XP_003620587.1|  Tir-nbs-lrr resistance protein                   45.4    7e-04   
gb|KDO39752.1|  hypothetical protein CISIN_1g003683mg                 45.4    7e-04   
ref|XP_010026502.1|  PREDICTED: TMV resistance protein N-like         45.4    7e-04   
ref|XP_004231677.2|  PREDICTED: TMV resistance protein N-like         45.4    8e-04   
gb|KCW59186.1|  hypothetical protein EUGRSUZ_H01841                   45.1    8e-04   
gb|KEH25083.1|  disease resistance protein (TIR-NBS-LRR class)        45.4    8e-04   
gb|KEH29020.1|  disease resistance protein (TIR-NBS-LRR class)        45.4    8e-04   
ref|XP_009607719.1|  PREDICTED: TMV resistance protein N-like         45.4    8e-04   
ref|XP_010494612.1|  PREDICTED: LOW QUALITY PROTEIN: probable WRK...  45.4    8e-04   
gb|KEH29015.1|  disease resistance protein (TIR-NBS-LRR class), p...  45.4    8e-04   
gb|AAQ93075.1|  TIR-NBS-LRR type R protein 7                          45.4    8e-04   
ref|XP_006494858.1|  PREDICTED: TMV resistance protein N-like iso...  45.4    8e-04   
ref|XP_006441764.1|  hypothetical protein CICLE_v10023258mg           45.4    8e-04   
ref|XP_002520182.1|  leucine-rich repeat containing protein, puta...  45.4    8e-04   
emb|CDX99365.1|  BnaC01g11870D                                        45.4    8e-04   
gb|KEH25082.1|  disease resistance protein (TIR-NBS-LRR class)        45.4    8e-04   
ref|XP_008339867.1|  PREDICTED: TMV resistance protein N-like iso...  45.4    8e-04   
ref|XP_010494569.1|  PREDICTED: probable WRKY transcription facto...  45.4    8e-04   
ref|XP_006585991.1|  PREDICTED: TMV resistance protein N-like iso...  45.4    8e-04   
ref|XP_006585990.1|  PREDICTED: TMV resistance protein N-like iso...  45.4    8e-04   
ref|XP_006585989.1|  PREDICTED: TMV resistance protein N-like iso...  45.4    8e-04   
ref|XP_008339858.1|  PREDICTED: TMV resistance protein N-like iso...  45.4    8e-04   
ref|XP_011014729.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  45.4    9e-04   
ref|XP_007199627.1|  hypothetical protein PRUPE_ppa016158mg           45.4    9e-04   
ref|XP_007200715.1|  hypothetical protein PRUPE_ppa015500m2g          45.1    9e-04   
ref|XP_008244870.1|  PREDICTED: TMV resistance protein N-like         45.4    9e-04   
ref|XP_010439702.1|  PREDICTED: probable WRKY transcription facto...  45.1    0.001   
ref|NP_199318.2|  putative WRKY transcription factor 16               45.4    0.001   
ref|NP_851133.1|  putative WRKY transcription factor 16               45.4    0.001   
ref|XP_008219018.1|  PREDICTED: LOW QUALITY PROTEIN: TMV resistan...  45.4    0.001   
ref|XP_006478421.1|  PREDICTED: TMV resistance protein N-like iso...  45.1    0.001   
ref|XP_010436479.1|  PREDICTED: probable WRKY transcription facto...  45.1    0.001   
ref|XP_010652769.1|  PREDICTED: TMV resistance protein N              45.4    0.001   
ref|XP_009371423.1|  PREDICTED: TMV resistance protein N-like         45.1    0.001   
gb|ACN87587.1|  NBS-containing resistance-like protein                44.3    0.001   
ref|XP_002863534.1|  predicted protein                                45.1    0.001   
gb|KFK30245.1|  hypothetical protein AALP_AA7G236500                  45.1    0.001   
gb|ACN87584.1|  NBS-containing resistance-like protein                44.3    0.001   
gb|ACN87480.1|  NBS-containing resistance-like protein                44.3    0.001   



>gb|AES86810.2| TIR-NBS-LRR class disease resistance protein [Medicago truncatula]
Length=881

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L+DD+Q+ IFLDI+CFF     D  +++RILNGCGFFA+
Sbjct  347  YDGLNDDTQKEIFLDISCFFIG--MDRNDVIRILNGCGFFAE  386



>ref|XP_003604613.1| TIR-NBS-LRR RCT1-like resistance protein [Medicago truncatula]
Length=1637

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L+DD+Q+ IFLDI+CFF     D  +++RILNGCGFFA+
Sbjct  347  YDGLNDDTQKEIFLDISCFFIG--MDRNDVIRILNGCGFFAE  386



>ref|XP_010498956.1| PREDICTED: TMV resistance protein N-like [Camelina sativa]
Length=1782

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD+LDD+ +++FLDIAC F       EEIV +LNGCGF A+
Sbjct  429  YDSLDDEEKKVFLDIACLFLRMTISKEEIVEVLNGCGFNAE  469



>gb|KEH25094.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=826

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD LDDD Q+ IFLD+ACFF     D  +++ ILNGCGFFA+
Sbjct  356  YDGLDDDYQKSIFLDVACFFIG--MDRNDVIHILNGCGFFAE  395



>gb|KEH25085.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=917

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD LDDD Q+ IFLD+ACFF     D  +++ ILNGCGFFA+
Sbjct  230  YDGLDDDYQKSIFLDVACFFIG--MDRNDVIHILNGCGFFAE  269



>ref|XP_010263414.1| PREDICTED: TMV resistance protein N-like [Nelumbo nucifera]
Length=1134

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +DALDD  + IFLDIACFF     D + ++RIL+GCGFF++
Sbjct  434  FDALDDQMRDIFLDIACFFIG--MDRDHVIRILDGCGFFSE  472



>gb|AHG28995.1| NBS-LRR protein [Cicer arietinum]
Length=695

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L+DD+++ IFLDIACFF     D  +++ ILNGCGFFA+
Sbjct  213  YDGLNDDTEKEIFLDIACFFIG--MDRNDVIHILNGCGFFAE  252



>ref|XP_003604824.1| NBS resistance protein, partial [Medicago truncatula]
Length=260

 Score = 53.5 bits (127),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L+DD+Q+ IFLDI+CFF     D  +++RILNGCGFFA+
Sbjct  204  YDGLNDDTQKEIFLDISCFFIG--MDRNDVIRILNGCGFFAE  243



>ref|XP_004506792.1| PREDICTED: TMV resistance protein N-like isoform X1 [Cicer arietinum]
 ref|XP_004506793.1| PREDICTED: TMV resistance protein N-like isoform X2 [Cicer arietinum]
Length=1159

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L+DD+++ IFLDIACFF     D  +++ ILNGCGFFA+
Sbjct  514  YDGLNDDTEKEIFLDIACFFIG--MDRNDVIHILNGCGFFAE  553



>ref|XP_004506794.1| PREDICTED: TMV resistance protein N-like isoform X3 [Cicer arietinum]
Length=1020

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L+DD+++ IFLDIACFF     D  +++ ILNGCGFFA+
Sbjct  514  YDGLNDDTEKEIFLDIACFFIG--MDRNDVIHILNGCGFFAE  553



>gb|AES86811.2| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1113

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 3/41 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD L+DD+Q+ IFLDI+CFF     D  +++RIL+GCGFFA
Sbjct  464  YDGLNDDTQKEIFLDISCFFIG--MDRNDVIRILDGCGFFA  502



>ref|XP_003604614.1| TIR-NBS-LRR RCT1-like resistance protein [Medicago truncatula]
Length=1160

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 3/41 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD L+DD+Q+ IFLDI+CFF     D  +++RIL+GCGFFA
Sbjct  464  YDGLNDDTQKEIFLDISCFFIG--MDRNDVIRILDGCGFFA  502



>ref|XP_010646551.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010646552.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010646553.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010646554.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010646555.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1158

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD LDD  + IFLDIACFF     D + +++IL+GCGFFA
Sbjct  419  YDGLDDKEKNIFLDIACFFKGE--DKDHVIKILDGCGFFA  456



>ref|XP_009115449.1| PREDICTED: TMV resistance protein N isoform X2 [Brassica rapa]
Length=1211

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D+LDD+ + +FLDIAC F       EEIV +LNGCGF A+
Sbjct  263  FDSLDDEEKNVFLDIACLFLKMQIKKEEIVDVLNGCGFNAE  303



>gb|ACP30614.1| disease resistance protein [Brassica rapa subsp. pekinensis]
Length=1309

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D+LDD+ + +FLDIAC F       EEIV +LNGCGF A+
Sbjct  308  FDSLDDEEKNVFLDIACLFLKMQIKKEEIVDVLNGCGFNAE  348



>ref|XP_009115448.1| PREDICTED: TMV resistance protein N isoform X1 [Brassica rapa]
Length=1376

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D+LDD+ + +FLDIAC F       EEIV +LNGCGF A+
Sbjct  428  FDSLDDEEKNVFLDIACLFLKMQIKKEEIVDVLNGCGFNAE  468



>emb|CBI40966.3| unnamed protein product [Vitis vinifera]
Length=1201

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD LDD  + IFLDIACFF     D + +++IL+GCGFFA
Sbjct  419  YDGLDDKEKNIFLDIACFFKGE--DKDHVIKILDGCGFFA  456



>emb|CDY16226.1| BnaA09g29600D [Brassica napus]
Length=1536

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D+LDD+ + +FLDIAC F       EEIV +LNGCGF A+
Sbjct  590  FDSLDDEEKNVFLDIACLFLKMQIKKEEIVDVLNGCGFNAE  630



>ref|XP_009115450.1| PREDICTED: TMV resistance protein N isoform X3 [Brassica rapa]
Length=1544

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D+LDD+ + +FLDIAC F       EEIV +LNGCGF A+
Sbjct  596  FDSLDDEEKNVFLDIACLFLKMQIKKEEIVDVLNGCGFNAE  636



>ref|XP_010251790.1| PREDICTED: LOW QUALITY PROTEIN: TMV resistance protein N-like 
[Nelumbo nucifera]
Length=1382

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YDALD++++RIFLDIACFF+      E  + I  GCGF A+
Sbjct  425  YDALDEENKRIFLDIACFFSSMDMSRESAIDIFKGCGFHAE  465



>emb|CDY14693.1| BnaC05g19500D [Brassica napus]
Length=1323

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D+LDD+ + +FLDIAC F       EEIV +LNGCGF A+
Sbjct  377  FDSLDDEEKNVFLDIACLFLKMQITKEEIVDVLNGCGFNAE  417



>ref|XP_010251791.1| PREDICTED: TMV resistance protein N-like [Nelumbo nucifera]
Length=1380

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YDALD++ +RIFLDIACFF       E  + IL GCGF A+
Sbjct  425  YDALDEECKRIFLDIACFFCSMDMSRENAIDILKGCGFHAE  465



>gb|ACF19651.1| TIR-NBS-LRR RCT1-like resistance protein [Medicago sativa]
Length=1125

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L+DD+++  FLDIACFF     D  ++++ILNGCGFFA+
Sbjct  478  YDGLNDDTEKSTFLDIACFFIG--MDRNDVIQILNGCGFFAE  517



>ref|XP_003627640.1| NBS-LRR resistance-like protein 4T [Medicago truncatula]
 gb|AET02116.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1151

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 1/40 (3%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD LDD  + IFLD+ACFF  G+  S  + +ILN CGFFA
Sbjct  425  YDELDDTEKNIFLDVACFFK-GFGSSSSVTKILNACGFFA  463



>gb|KEH18958.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1067

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 1/40 (3%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD LDD  + IFLD+ACFF  G+  S  + +ILN CGFFA
Sbjct  425  YDELDDTEKNIFLDVACFFK-GFGSSSSVTKILNACGFFA  463



>ref|XP_006492496.1| PREDICTED: TMV resistance protein N-like [Citrus sinensis]
Length=1414

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD LDD  Q IFLDIACF      D ++++R LN CGFFA+
Sbjct  530  YDGLDDHEQDIFLDIACFLVGE--DRDQVMRFLNSCGFFAE  568



>ref|XP_010477757.1| PREDICTED: TMV resistance protein N-like isoform X3 [Camelina 
sativa]
Length=1297

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            Y++LDD+ +++FLDIAC F       EEIV +L GCGF A+
Sbjct  349  YESLDDEEKKVFLDIACLFLRMTISKEEIVEVLKGCGFNAE  389



>ref|XP_010477756.1| PREDICTED: TMV resistance protein N-like isoform X2 [Camelina 
sativa]
Length=1376

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            Y++LDD+ +++FLDIAC F       EEIV +L GCGF A+
Sbjct  428  YESLDDEEKKVFLDIACLFLRMTISKEEIVEVLKGCGFNAE  468



>ref|XP_010477755.1| PREDICTED: TMV resistance protein N-like isoform X1 [Camelina 
sativa]
Length=1377

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            Y++LDD+ +++FLDIAC F       EEIV +L GCGF A+
Sbjct  429  YESLDDEEKKVFLDIACLFLRMTISKEEIVEVLKGCGFNAE  469



>ref|XP_003604611.1| TIR-NBS-LRR RCT1-like resistance protein [Medicago truncatula]
 gb|AES86808.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1116

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L+DD+++ IFLDIACFF     D  ++++ILNGCG FA+
Sbjct  480  YDGLNDDTEKSIFLDIACFFIG--MDRNDVIQILNGCGLFAE  519



>ref|XP_010498957.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
[Camelina sativa]
Length=1164

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +++LDD+ +++FLDIAC F       +E+V ILNGCGF A+
Sbjct  250  FESLDDEEKKVFLDIACLFLRTKITKDEVVDILNGCGFHAE  290



>ref|XP_010477758.1| PREDICTED: TMV resistance protein N-like [Camelina sativa]
 ref|XP_010477759.1| PREDICTED: TMV resistance protein N-like [Camelina sativa]
 ref|XP_010477760.1| PREDICTED: TMV resistance protein N-like [Camelina sativa]
Length=1329

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +++LDD+ +++FLDIAC F       +E+V ILNGCGF A+
Sbjct  414  FESLDDEEKKVFLDIACLFLRTKITKDEVVDILNGCGFHAE  454



>gb|KEH25116.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1069

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 31/42 (74%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YDAL+DD+++ IFLDIACFF     D  ++  ILNGCG FA+
Sbjct  468  YDALNDDTEKEIFLDIACFFIG--MDRNDVTLILNGCGLFAE  507



>ref|XP_002321497.2| hypothetical protein POPTR_0015s04030g [Populus trichocarpa]
 gb|EEF05624.2| hypothetical protein POPTR_0015s04030g [Populus trichocarpa]
Length=1205

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD LD+D + +FLDIACFF       EE + IL GCGF A+
Sbjct  414  YDELDEDEKHVFLDIACFFIKMGMKREEAIDILKGCGFSAE  454



>gb|KEH25073.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1138

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 31/42 (74%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YDAL+DD+++ IFLDIACFF     D  ++  ILNGCG FA+
Sbjct  464  YDALNDDTEKEIFLDIACFFIG--MDRNDVTLILNGCGLFAE  503



>gb|AHG29005.1| NBS-LRR protein [Cicer arietinum]
Length=912

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD LDDD Q+ IFLDIACFF     D  +++ ILNGC  FA+
Sbjct  421  YDGLDDDYQKAIFLDIACFFIG--MDRSDVINILNGCSLFAE  460



>gb|KHN02149.1| TMV resistance protein N [Glycine soja]
Length=930

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L DD++R IFLDIACFF     D  +++ ILNGCG FA+
Sbjct  373  YDGLSDDTEREIFLDIACFFIG--MDRNDVICILNGCGLFAE  412



>ref|XP_006576565.1| PREDICTED: TMV resistance protein N-like [Glycine max]
Length=1127

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L DD++R IFLDIACFF     D  +++ ILNGCG FA+
Sbjct  478  YDGLSDDTEREIFLDIACFFIG--MDRNDVICILNGCGLFAE  517



>ref|XP_009115451.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
[Brassica rapa]
 gb|ACP30615.1| disease resistance protein [Brassica rapa subsp. pekinensis]
Length=1147

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D+LDD+ +++FLDIAC F       EEIV +L GCGF A+
Sbjct  426  FDSLDDEEKKVFLDIACLFLKMDMTKEEIVDVLKGCGFNAE  466



>gb|KDP26071.1| hypothetical protein JCGZ_21104 [Jatropha curcas]
Length=1112

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 26/40 (65%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD L+   Q IFLDIACFF     D   + RILNGCGFFA
Sbjct  423  YDGLESSEQSIFLDIACFFKGE--DRTRVQRILNGCGFFA  460



>ref|XP_002530559.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31827.1| conserved hypothetical protein [Ricinus communis]
Length=833

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD LD+  + IFLDIACFF  GY D + +  +LNGCGFFA+
Sbjct  372  YDGLDEKQKEIFLDIACFFK-GY-DKDIVTNVLNGCGFFAK  410



>gb|KEH25080.1| disease resistance protein (TIR-NBS-LRR class), putative [Medicago 
truncatula]
Length=1513

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YDAL++D ++ IFL+IACFF D   D+ ++  ILNGCG FA+
Sbjct  806  YDALNEDIEKEIFLNIACFFID--MDTNDVTHILNGCGLFAE  845



>emb|CBI39286.3| unnamed protein product [Vitis vinifera]
Length=447

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 28/40 (70%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD LDD  + IFLDIACFF     D + ++ IL+GCGFF+
Sbjct  285  YDGLDDKEKNIFLDIACFFKGE--DKDYVIEILDGCGFFS  322



>ref|XP_004489473.1| PREDICTED: TMV resistance protein N-like isoform X1 [Cicer arietinum]
Length=1145

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD LDDD Q+ IFLDIACFF     D  +++ ILNGC  FA+
Sbjct  516  YDGLDDDYQKAIFLDIACFFIG--MDRSDVINILNGCSLFAE  555



>ref|XP_010501578.1| PREDICTED: TMV resistance protein N [Camelina sativa]
Length=347

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +++LDD+ ++IFLDIAC F       EE+V IL GCG+ A+
Sbjct  230  FESLDDEQKKIFLDIACLFLKMEITKEEVVDILKGCGYHAE  270



>ref|XP_010495706.1| PREDICTED: probable WRKY transcription factor 16 [Camelina sativa]
Length=756

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 2/39 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFF  119
            YDAL+D+ + IF+DIACFF      S+ ++RIL GCGFF
Sbjct  403  YDALNDNERSIFMDIACFFNGE--PSDNVMRILEGCGFF  439



>ref|XP_004489474.1| PREDICTED: TMV resistance protein N-like isoform X2 [Cicer arietinum]
Length=1136

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD LDDD Q+ IFLDIACFF     D  +++ ILNGC  FA+
Sbjct  507  YDGLDDDYQKAIFLDIACFFIG--MDRSDVINILNGCSLFAE  546



>ref|XP_009348201.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=807

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 30/40 (75%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            ++ LDD  + IFLDI+CFF    +D +++ ++LNGCGFFA
Sbjct  446  FEGLDDAQKAIFLDISCFFIG--WDKDDVAKVLNGCGFFA  483



>ref|XP_004489499.1| PREDICTED: TMV resistance protein N-like [Cicer arietinum]
Length=715

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L+DD +R IFLDIACFF     D  +++ ILNGCG +A+
Sbjct  111  YDGLNDDFEREIFLDIACFFIG--MDRNDVIHILNGCGLYAE  150



>emb|CBI31340.3| unnamed protein product [Vitis vinifera]
Length=407

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD LDD+ + IFLDIACFF     D + +V IL GCGF A+
Sbjct  303  YDRLDDEEKNIFLDIACFFKGE--DKDHVVEILKGCGFSAK  341



>gb|KEH25106.1| disease resistance protein (TIR-NBS-LRR class), putative [Medicago 
truncatula]
Length=1160

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 32/42 (76%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L+D++++ IFLDIACFF     D  ++++ILNGCG FA+
Sbjct  508  YDGLNDETEKEIFLDIACFFIG--MDRNDVIQILNGCGLFAE  547



>gb|KEH16160.1| TIR-NBS-LRR class disease resistance protein [Medicago truncatula]
Length=904

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 3/41 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD L+DD+++ IFLDIACFF     D  ++ +ILNGCG FA
Sbjct  281  YDGLNDDTEKDIFLDIACFFIG--MDRNDVTQILNGCGLFA  319



>emb|CDY55270.1| BnaC07g18270D [Brassica napus]
Length=537

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 26/39 (67%), Gaps = 2/39 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFF  119
            YD L D  + IFLDIACFF D   D   I+RIL GCGFF
Sbjct  249  YDTLTDHERNIFLDIACFFKDEKLDY--ILRILEGCGFF  285



>ref|XP_003604607.1| TIR-NBS-LRR RCT1 resistance protein [Medicago truncatula]
 gb|KEH28850.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=936

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L+DD+++ IFLDIACFF     D  +++ ILNG GFFA+
Sbjct  453  YDGLNDDTEKSIFLDIACFFIG--MDRNDVIHILNGSGFFAE  492



>gb|AES86804.2| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1098

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L+DD+++ IFLDIACFF     D  +++ ILNG GFFA+
Sbjct  453  YDGLNDDTEKSIFLDIACFFIG--MDRNDVIHILNGSGFFAE  492



>gb|ACF19650.1| TIR-NBS-LRR RCT1 resistance protein [Medicago truncatula]
Length=1098

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L+DD+++ IFLDIACFF     D  +++ ILNG GFFA+
Sbjct  453  YDGLNDDTEKSIFLDIACFFIG--MDRNDVIHILNGSGFFAE  492



>gb|KDO43813.1| hypothetical protein CISIN_1g046086mg, partial [Citrus sinensis]
Length=966

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD LDD  Q IFLDI+CF      D ++++R LN CGFFA+
Sbjct  370  YDGLDDHEQGIFLDISCFLVGE--DRDQVMRFLNSCGFFAE  408



>ref|XP_006470767.1| PREDICTED: TMV resistance protein N-like [Citrus sinensis]
Length=1185

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD LDD+ Q IFLDIACFF     D + ++R L+GCGF A+
Sbjct  431  YDGLDDEEQNIFLDIACFFKGE--DKDCVIRFLDGCGFSAE  469



>ref|XP_007034212.1| Disease resistance protein family, putative [Theobroma cacao]
 gb|EOY05138.1| Disease resistance protein family, putative [Theobroma cacao]
Length=1047

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D LDD  + IFLDIACFF     D E +++IL+GCGFF +
Sbjct  405  FDGLDDQMKAIFLDIACFFIG--MDKEYVMKILDGCGFFPE  443



>ref|XP_010645907.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010645908.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1070

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD LDD+ + IFLDIACFF     D + +V IL GCGF A+
Sbjct  419  YDRLDDEEKNIFLDIACFFKGE--DKDHVVEILKGCGFSAK  457



>ref|XP_009770076.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
Length=829

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D LDD++Q +FLDIAC F    FD  E+  ILN CGF A+
Sbjct  193  FDGLDDETQTVFLDIACAFHG--FDGHEVTEILNACGFRAK  231



>gb|KHN42294.1| TMV resistance protein N [Glycine soja]
Length=1227

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            Y  L DD++R IFLDIACFF     D  +++RILNGCG FA+
Sbjct  635  YYGLSDDTEREIFLDIACFFIG--MDRFDVIRILNGCGLFAE  674



>emb|CDK13054.1| TIR-NBS-LRR disease resistance protein [Malus domestica]
Length=1207

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 3/41 (7%)
 Frame = +3

Query  3    YDALDDD-SQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD L+D+  +RIFLDIACFF     D  ++V+IL+GCGF+A
Sbjct  516  YDGLNDNYKRRIFLDIACFFIG--MDKNDVVQILDGCGFYA  554



>ref|XP_008350782.1| PREDICTED: TMV resistance protein N-like, partial [Malus domestica]
Length=888

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 3/41 (7%)
 Frame = +3

Query  3    YDALDDD-SQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD L+D+  +RIFLDIACFF     D  ++V+IL+GCGF+A
Sbjct  217  YDGLNDNYKRRIFLDIACFFIG--MDKNDVVQILDGCGFYA  255



>ref|XP_002523481.1| TMV resistance protein N, putative [Ricinus communis]
 gb|EEF38940.1| TMV resistance protein N, putative [Ricinus communis]
Length=944

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD LDD+ + IFLD+ACFF     D + + RILNGCGF A
Sbjct  424  YDGLDDEEKDIFLDVACFFNGE--DRDFVTRILNGCGFSA  461



>emb|CBI39287.3| unnamed protein product [Vitis vinifera]
Length=1166

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/39 (56%), Positives = 27/39 (69%), Gaps = 2/39 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFF  119
            YD LDD  + IFLDIACFF     D + ++ IL+GCGFF
Sbjct  477  YDGLDDKEKNIFLDIACFFKGE--DKDYVIEILDGCGFF  513



>ref|XP_010070566.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=337

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 2/38 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGF  116
            YD LDD+++ I+LDIACFFT GY   E I+++L+ CGF
Sbjct  142  YDGLDDNAREIYLDIACFFT-GY-SKEYIMKVLDSCGF  177



>ref|XP_010665364.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010665365.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010665366.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010665367.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010665368.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010665369.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010665370.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1110

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/39 (56%), Positives = 27/39 (69%), Gaps = 2/39 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFF  119
            YD LDD  + IFLDIACFF     D + ++ IL+GCGFF
Sbjct  422  YDGLDDKEKNIFLDIACFFKGE--DKDYVIEILDGCGFF  458



>ref|XP_010477751.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
isoform X2 [Camelina sativa]
Length=1213

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +++LDD+ ++IFLDIAC F       EE+V IL GCG+ A+
Sbjct  264  FESLDDEQKKIFLDIACLFLKMEITKEEVVDILKGCGYHAE  304



>ref|XP_010477750.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
isoform X1 [Camelina sativa]
Length=1245

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +++LDD+ ++IFLDIAC F       EE+V IL GCG+ A+
Sbjct  296  FESLDDEQKKIFLDIACLFLKMEITKEEVVDILKGCGYHAE  336



>ref|XP_010263320.1| PREDICTED: TMV resistance protein N-like [Nelumbo nucifera]
Length=1151

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +DALDD  + IFLDIACFF     D +  V+IL+ CGFF++
Sbjct  430  FDALDDKEKSIFLDIACFFIG--MDKDYAVKILDSCGFFSE  468



>ref|XP_010460211.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
[Camelina sativa]
Length=1390

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +++LDD+ ++IFLDIAC F       EE+V IL GCG+ A+
Sbjct  442  FESLDDEQKKIFLDIACLFLKMEITKEEVVDILKGCGYHAE  482



>ref|XP_006306587.1| hypothetical protein CARUB_v10008094mg [Capsella rubella]
 gb|EOA39485.1| hypothetical protein CARUB_v10008094mg [Capsella rubella]
Length=1226

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +++LDD+ +++FLDIAC F       EE+V +L GCGF A+
Sbjct  283  FESLDDEEKKVFLDIACLFLRMQMTKEEVVEVLKGCGFNAE  323



>ref|XP_006306588.1| hypothetical protein CARUB_v10008094mg [Capsella rubella]
 ref|XP_006306589.1| hypothetical protein CARUB_v10008094mg [Capsella rubella]
 gb|EOA39486.1| hypothetical protein CARUB_v10008094mg [Capsella rubella]
 gb|EOA39487.1| hypothetical protein CARUB_v10008094mg [Capsella rubella]
Length=1371

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +++LDD+ +++FLDIAC F       EE+V +L GCGF A+
Sbjct  428  FESLDDEEKKVFLDIACLFLRMQMTKEEVVEVLKGCGFNAE  468



>ref|XP_009597750.1| PREDICTED: TMV resistance protein N-like [Nicotiana tomentosiformis]
Length=1058

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D LDD++Q +FLDIAC F    FD  E+  ILN CGF A+
Sbjct  430  FDGLDDETQTVFLDIACAFHG--FDEHEVTEILNACGFHAK  468



>ref|XP_011016521.1| PREDICTED: TMV resistance protein N-like, partial [Populus euphratica]
Length=953

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D LDD+ + +FLDIAC F       EE + ILNGCGF A+
Sbjct  277  FDGLDDEEKCVFLDIACLFIKMRMKREEAIDILNGCGFRAE  317



>ref|XP_002893351.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69610.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1385

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +++LDD+ +++FLDIAC F       EE+V +L GCGF A+
Sbjct  427  FESLDDEEKKVFLDIACLFLRMQITKEEVVEVLKGCGFNAE  467



>emb|CDK13059.1| TIR-NBS-LRR disease resistance protein [Malus domestica]
Length=1182

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 3/41 (7%)
 Frame = +3

Query  3    YDALDDD-SQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD L+D+  +RIFLDIACFF     D  ++V+IL+GCGF+A
Sbjct  490  YDGLNDNYKRRIFLDIACFFIG--MDKNDVVQILDGCGFYA  528



>ref|XP_010665371.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1136

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 28/40 (70%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD LDD  + IFLDIACFF     D + ++ IL+GCGFF+
Sbjct  422  YDGLDDKEKNIFLDIACFFKGE--DKDYVIEILDGCGFFS  459



>ref|XP_002318534.1| disease resistance family protein [Populus trichocarpa]
 gb|EEE96754.1| disease resistance family protein [Populus trichocarpa]
Length=1360

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D LDD+ + +FLDIAC F       EE + ILNGCGF A+
Sbjct  426  FDGLDDEEKCVFLDIACLFIKMRMKREEAIDILNGCGFRAE  466



>ref|XP_002862525.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38783.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=497

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/39 (56%), Positives = 26/39 (67%), Gaps = 2/39 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFF  119
            YD L +D + IFLDIACFF     D   ++RIL GCGFF
Sbjct  191  YDVLSEDERSIFLDIACFFNGENLDY--VIRILEGCGFF  227



>ref|NP_199334.1| TIR-NBS-LRR class disease resistance protein [Arabidopsis thaliana]
 dbj|BAB11394.1| disease resistance protein-like [Arabidopsis thaliana]
 gb|AED95217.1| TIR-NBS-LRR class disease resistance protein [Arabidopsis thaliana]
Length=697

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 2/39 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFF  119
            YDAL+D+ + IFLDIACFF     D  +++RIL GCGFF
Sbjct  403  YDALNDNERSIFLDIACFFNGEPCD--DVMRILEGCGFF  439



>ref|XP_010245559.1| PREDICTED: uncharacterized protein LOC104589071 [Nelumbo nucifera]
Length=2320

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            +DALDD+ + IFLDIACFF     D   + RIL GCGFF+
Sbjct  416  FDALDDNEKFIFLDIACFFIG--MDKNYVSRILLGCGFFS  453


 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = +3

Query  3     YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
             +DALDD+ + IFLDIACFF     D   + +IL+GC FF +
Sbjct  1576  FDALDDNEKFIFLDIACFFIG--MDRNYVSKILHGCDFFPE  1614



>emb|CAN83385.1| hypothetical protein VITISV_004581 [Vitis vinifera]
Length=1024

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD LDD+ + IFLDIACFF     D + +V IL GCGF A+
Sbjct  419  YDRLDDEEKNIFLDIACFFKGE--DKDHVVEILKGCGFSAK  457



>gb|KEH25077.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=905

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YDAL+DD ++ IFLD+ACFF     D  ++  ILNGCG FA+
Sbjct  284  YDALNDDIEKEIFLDVACFFIG--MDRNDVTLILNGCGLFAE  323



>gb|KEH25076.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1098

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YDAL+DD ++ IFLD+ACFF     D  ++  ILNGCG FA+
Sbjct  477  YDALNDDIEKEIFLDVACFFIG--MDRNDVTLILNGCGLFAE  516



>ref|XP_010645914.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=524

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 28/40 (70%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD LDD  + IFLDIACFF     D + ++ IL+GCGFF+
Sbjct  423  YDGLDDKEKNIFLDIACFFKGE--DKDYVMEILDGCGFFS  460



>ref|XP_008357580.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=682

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +DAL D+ +R IFLDI+CFF     D   + RIL+GCGFFA+
Sbjct  433  FDALSDEDEREIFLDISCFFIG--MDKNYVTRILDGCGFFAE  472



>ref|XP_010256443.1| PREDICTED: TMV resistance protein N-like isoform X2 [Nelumbo 
nucifera]
Length=1116

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +DALD++ + IFLDIACFF     + E++V +L+ CGFF++
Sbjct  451  FDALDENEKDIFLDIACFFIR--IEKEDVVTVLDSCGFFSE  489



>ref|XP_010256441.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010256442.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nelumbo 
nucifera]
Length=1120

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +DALD++ + IFLDIACFF     + E++V +L+ CGFF++
Sbjct  451  FDALDENEKDIFLDIACFFIR--IEKEDVVTVLDSCGFFSE  489



>gb|AFC90336.1| nucleotide-binding site leucine-rich repeat protein, partial 
[Rhododendron rubropunctatum]
Length=270

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 29/40 (73%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            +D+L D+ + +FLD+ACFFT  Y DS   ++IL GC FFA
Sbjct  209  FDSLSDEVKELFLDMACFFTGTYGDS--TIKILEGCNFFA  246



>ref|XP_006576576.1| PREDICTED: TMV resistance protein N-like isoform X1 [Glycine 
max]
Length=1128

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L DD++R IFLDIACFF     D  + + ILNGCG FA+
Sbjct  446  YDGLSDDTERDIFLDIACFFIG--MDRNDAMCILNGCGLFAE  485



>ref|XP_008371343.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=544

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 3/41 (7%)
 Frame = +3

Query  3    YDALDDD-SQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD L+D+  +RIFLDIACFF     D  ++++IL+GCGF+A
Sbjct  79   YDGLNDNYKRRIFLDIACFFIG--MDKNBVMQILDGCGFYA  117



>ref|XP_009605717.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104100237 
[Nicotiana tomentosiformis]
Length=1928

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D LDD +Q +FLDIAC F    FD  E+  ILN CGF A+
Sbjct  433  FDGLDDGTQTVFLDIACAFHG--FDEHEVTEILNACGFHAK  471



>ref|XP_003604898.1| Nbs-lrr resistance protein [Medicago truncatula]
Length=1191

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 3/41 (7%)
 Frame = +3

Query  3     YDALDD-DSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
             +D L D   Q+IFLDIACFF     D  ++++ILNGCGFFA
Sbjct  986   FDGLKDVTEQQIFLDIACFFIG--MDQNDVIQILNGCGFFA  1024



>emb|CDK13056.1| TIR-NBS-LRR disease resistance protein, partial [Malus domestica]
Length=1220

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 3/41 (7%)
 Frame = +3

Query  3    YDALDDD-SQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD L+D+  +RIFLDIACFF     D  ++V+IL+GCGF++
Sbjct  516  YDGLNDNYKRRIFLDIACFFIG--MDKNDVVQILDGCGFYS  554



>ref|XP_006576577.1| PREDICTED: TMV resistance protein N-like isoform X2 [Glycine 
max]
Length=851

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L DD++R IFLDIACFF     D  + + ILNGCG FA+
Sbjct  446  YDGLSDDTERDIFLDIACFFIG--MDRNDAMCILNGCGLFAE  485



>ref|XP_003627837.1| NBS resistance protein [Medicago truncatula]
Length=1731

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 26/40 (65%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD LDD  + IFLDIACFF     +   I +ILN CGFFA
Sbjct  429  YDELDDKEKDIFLDIACFFKG--HERNSITKILNECGFFA  466



>gb|KCW59393.1| hypothetical protein EUGRSUZ_H02098 [Eucalyptus grandis]
Length=543

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 2/38 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGF  116
            YD LDD+++ I+LDIACFFT GY   E I+++L+ CGF
Sbjct  430  YDGLDDNAREIYLDIACFFT-GY-SKEYIMKVLDSCGF  465



>ref|XP_008359988.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=823

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDD-SQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L D+  +RIFLDIACFF     D  ++V+IL+GCGF+A+
Sbjct  513  YDGLSDNYKRRIFLDIACFFIG--MDKNDVVQILDGCGFYAR  552



>ref|XP_002893349.1| hypothetical protein ARALYDRAFT_889995 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69608.1| hypothetical protein ARALYDRAFT_889995 [Arabidopsis lyrata subsp. 
lyrata]
Length=1401

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +++LDD+ ++IFLDIAC F       +E+V IL GCGF A+
Sbjct  436  FESLDDEEKKIFLDIACLFLKMEITKDELVDILKGCGFNAE  476



>ref|XP_006360962.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=884

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D LDD++Q +FLDIAC F  G+F+ +E+   LN CGF+++
Sbjct  401  FDGLDDNTQSVFLDIACAF-QGFFE-DEVTNTLNACGFYSE  439



>ref|XP_002893348.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69607.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1488

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +++LDD+ ++IFLDIAC F       +E+V IL GCGF A+
Sbjct  528  FESLDDEEKKIFLDIACLFLKMEITKDELVDILKGCGFNAE  568



>ref|XP_006446207.1| hypothetical protein CICLE_v10014074mg [Citrus clementina]
 gb|ESR59447.1| hypothetical protein CICLE_v10014074mg [Citrus clementina]
Length=1200

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD LDD+ Q IFLDIACFF     D + ++R L+GCGF ++
Sbjct  431  YDGLDDEEQNIFLDIACFFKGE--DKDCVIRFLDGCGFSSE  469



>ref|XP_006441679.1| hypothetical protein CICLE_v10023907mg, partial [Citrus clementina]
 gb|ESR54919.1| hypothetical protein CICLE_v10023907mg, partial [Citrus clementina]
Length=529

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D LDD+ + IFLDIACFF     D E +++ L+ CGF AQ
Sbjct  273  FDGLDDEQKNIFLDIACFFKGE--DKEFVIKFLDACGFAAQ  311



>ref|XP_002321495.2| hypothetical protein POPTR_0015s04000g [Populus trichocarpa]
 gb|EEF05622.2| hypothetical protein POPTR_0015s04000g [Populus trichocarpa]
Length=1421

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD LD+D + +FLDIAC F       EE + IL GCGF A+
Sbjct  421  YDELDEDGKHVFLDIACLFFKMGMKREEAIDILKGCGFSAE  461



>ref|XP_004301464.1| PREDICTED: TMV resistance protein N-like [Fragaria vesca subsp. 
vesca]
Length=1124

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 32/42 (76%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D L+DD+++ IFLDI+CFF     D + + +IL+GCGFFA+
Sbjct  438  FDGLNDDTEKNIFLDISCFFIG--MDKKHVSQILDGCGFFAE  477



>gb|KDP41073.1| hypothetical protein JCGZ_03179 [Jatropha curcas]
Length=807

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 25/40 (63%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD L+   Q IFLDIACFF     D   I  ILNGCGFFA
Sbjct  425  YDGLESSEQSIFLDIACFFKGE--DRTRIQSILNGCGFFA  462



>ref|XP_006360922.1| PREDICTED: TMV resistance protein N-like isoform X1 [Solanum 
tuberosum]
Length=1093

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D LDD++Q +FLDIAC F  G+F+ +E+   LN CGF+++
Sbjct  434  FDGLDDNTQSVFLDIACAF-HGFFE-DEVTSTLNACGFYSE  472



>gb|AES86763.2| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1137

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L+D  + IFLDIACF      D  +++ ILNGCG FA+
Sbjct  493  YDGLNDTEKSIFLDIACFLIG--MDRNDVILILNGCGLFAE  531



>ref|XP_003604566.1| Disease resistance protein [Medicago truncatula]
Length=1161

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L+D  + IFLDIACF      D  +++ ILNGCG FA+
Sbjct  517  YDGLNDTEKSIFLDIACFLIG--MDRNDVILILNGCGLFAE  555



>gb|ABV30885.1| NBS-containing resistance-like protein [Platanus x acerifolia]
Length=268

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +DALDD  + +FLDIACFF     D +  +RIL+GCGFF +
Sbjct  204  FDALDDIQKDLFLDIACFFIGS--DKDYAIRILDGCGFFPE  242



>ref|XP_006360923.1| PREDICTED: TMV resistance protein N-like isoform X2 [Solanum 
tuberosum]
Length=1066

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D LDD++Q +FLDIAC F  G+F+ +E+   LN CGF+++
Sbjct  434  FDGLDDNTQSVFLDIACAF-HGFFE-DEVTSTLNACGFYSE  472



>gb|KDP42291.1| hypothetical protein JCGZ_01615 [Jatropha curcas]
Length=417

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD LD + Q +FLDIAC F +GY D +E+ +I+   GF A+
Sbjct  318  YDGLDRNEQSLFLDIACLFGEGYPDGDELEKIIECFGFLAK  358



>gb|AFC90257.1| nucleotide-binding site leucine-rich repeat protein, partial 
[Rhododendron hyperythrum]
Length=263

 Score = 47.8 bits (112),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 29/40 (73%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            +D+L D+ + +FLD+ACFFT  Y DS   +++L GC FFA
Sbjct  203  FDSLSDEVKELFLDMACFFTGTYGDS--TIKVLEGCNFFA  240



>ref|XP_006388457.1| hypothetical protein POPTR_0182s002201g, partial [Populus trichocarpa]
 gb|ERP47371.1| hypothetical protein POPTR_0182s002201g, partial [Populus trichocarpa]
Length=567

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 3/41 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            +D L+DD+Q+ IFLDI+CFF     D E ++ ILNGC FFA
Sbjct  266  FDGLNDDTQKDIFLDISCFFVG--MDKEYVLPILNGCDFFA  304



>ref|XP_010665089.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1028

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            Y+ L +  + IFLDIACFF   Y D   +++IL+GCGFFA+
Sbjct  427  YEGLSNTQKNIFLDIACFFKGEYKDF--VIKILDGCGFFAE  465



>ref|XP_009364579.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=845

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 3/41 (7%)
 Frame = +3

Query  3    YDALDDD-SQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD L+D+  +RIFLDIACF+     D  ++++IL+GCGF+A
Sbjct  157  YDGLNDNYKRRIFLDIACFYIG--MDKNDVIQILDGCGFYA  195



>ref|XP_002517696.1| TMV resistance protein N, putative [Ricinus communis]
 gb|EEF44860.1| TMV resistance protein N, putative [Ricinus communis]
Length=1186

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 3/41 (7%)
 Frame = +3

Query  3    YDALDDD-SQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            +D+L DD  +R+FLDIACFFT    D   + RIL+GCGF+A
Sbjct  433  FDSLQDDHDKRLFLDIACFFTG--MDIGYVFRILDGCGFYA  471



>ref|XP_006478463.1| PREDICTED: TMV resistance protein N-like [Citrus sinensis]
Length=1087

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D LDD+ + IFLDIACFF     D E +++ L+ CGF AQ
Sbjct  443  FDGLDDEQKNIFLDIACFFKGE--DKEFVIKFLDACGFAAQ  481



>ref|NP_195337.1| putative TIR-NBS-LRR class disease resistance protein [Arabidopsis 
thaliana]
 emb|CAA18120.1| putative disease resistance protein [Arabidopsis thaliana]
 emb|CAB81523.1| putative disease resistance protein [Arabidopsis thaliana]
 gb|AEE86624.1| putative TIR-NBS-LRR class disease resistance protein [Arabidopsis 
thaliana]
Length=1607

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 2/39 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFF  119
            Y+ LDD+ + IFLDIACFF+    D   ++R+L GCGFF
Sbjct  817  YETLDDNEKNIFLDIACFFSGENVDY--VMRLLEGCGFF  853



>gb|KEH25086.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1085

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YDAL DD+++ IFLDIACFF     D  +++ ILNG  FFA+
Sbjct  464  YDALSDDTEKEIFLDIACFFIG--MDRNDVIHILNGSEFFAE  503



>gb|AES87095.2| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1673

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 3/41 (7%)
 Frame = +3

Query  3    YDALDD-DSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            +D L D   Q+IFLDIACFF     D  ++++ILNGCGFFA
Sbjct  917  FDGLKDVTEQQIFLDIACFFIG--MDQNDVIQILNGCGFFA  955



>ref|XP_011046325.1| PREDICTED: TMV resistance protein N-like isoform X2 [Populus 
euphratica]
Length=1110

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 3/41 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            +D L+DD+Q+ IFLDI+CFF     D E ++ ILNGC FFA
Sbjct  437  FDGLNDDTQKDIFLDISCFFVG--MDKEYVLPILNGCDFFA  475



>ref|XP_011046323.1| PREDICTED: TMV resistance protein N-like isoform X1 [Populus 
euphratica]
Length=1114

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 3/41 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            +D L+DD+Q+ IFLDI+CFF     D E ++ ILNGC FFA
Sbjct  441  FDGLNDDTQKDIFLDISCFFVG--MDKEYVLPILNGCDFFA  479



>ref|XP_008244985.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1126

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 3/41 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD L DD++R IFLDI+CFF     D + + +IL+GCGFFA
Sbjct  441  YDGLPDDTKREIFLDISCFFIG--MDKDYVTQILDGCGFFA  479



>ref|XP_004489498.1| PREDICTED: uncharacterized protein LOC101494533 [Cicer arietinum]
Length=2185

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 29/42 (69%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L DD+++ IFLD+ACFF     D  ++  ILNGCG FA+
Sbjct  455  YDGLKDDTEKEIFLDVACFFIG--MDRNDVTLILNGCGLFAK  494


 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 3/42 (7%)
 Frame = +3

Query  3     YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
             YD L+DD+++ IFLDIACFF     D  +++ ILNGC  +A+
Sbjct  1577  YDGLNDDTEKEIFLDIACFFIG--MDRNDVIHILNGCELYAE  1616



>ref|XP_006440968.1| hypothetical protein CICLE_v10018693mg [Citrus clementina]
 gb|ESR54208.1| hypothetical protein CICLE_v10018693mg [Citrus clementina]
Length=992

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 26/40 (65%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD LDD  Q +FLDIACFF D   D + + + L+ C FFA
Sbjct  287  YDGLDDKEQNVFLDIACFFIDD--DRDTVTKFLDDCEFFA  324



>emb|CDY14687.1| BnaC05g19440D [Brassica napus]
Length=1021

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 18/41 (44%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D+LDD+ +++FLD AC F       EE++ +L GCGF A+
Sbjct  428  FDSLDDEEKKVFLDTACLFLKMDMTKEEVLDVLKGCGFTAE  468



>gb|AFC90318.1| nucleotide-binding site leucine-rich repeat protein, partial 
[Rhododendron oldhamii]
Length=269

 Score = 47.4 bits (111),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 29/40 (73%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            +D+L+D+ + +FLD+ACFF   Y DS   ++IL GC FFA
Sbjct  209  FDSLNDEVKELFLDMACFFVGTYGDS--TIKILEGCNFFA  246



>ref|XP_006441672.1| hypothetical protein CICLE_v10018578mg [Citrus clementina]
 gb|ESR54912.1| hypothetical protein CICLE_v10018578mg [Citrus clementina]
Length=1158

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D LDD+ + IFLDIACFF     D E +++ L+ CGF AQ
Sbjct  441  FDGLDDEQKNIFLDIACFFKGE--DKEFVIKFLDACGFAAQ  479



>emb|CDK13058.1| TIR-NBS-LRR disease resistance protein [Malus domestica]
Length=1190

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 3/41 (7%)
 Frame = +3

Query  3    YDALDDD-SQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD L+D+  +RIFLDIACFF     D  ++ +IL+GCGF+A
Sbjct  519  YDGLNDNYKRRIFLDIACFFIG--MDKNDVAQILDGCGFYA  557



>ref|XP_010108456.1| TMV resistance protein N [Morus notabilis]
 gb|EXC19497.1| TMV resistance protein N [Morus notabilis]
Length=1203

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L+   Q+IFLDIACFF       +E+  ILN CGFFA+
Sbjct  430  YDGLNQKDQQIFLDIACFFKG--MRRDEVENILNACGFFAK  468



>ref|XP_009607522.1| PREDICTED: TMV resistance protein N-like [Nicotiana tomentosiformis]
Length=1019

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D LD ++Q +FLDIAC F    FD  E+  ILN CGF A+
Sbjct  433  FDGLDGETQTVFLDIACAFHG--FDEHEVTEILNACGFHAK  471



>ref|XP_010645953.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1398

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD LDD  Q+IFLDIACFF     + + + RIL+ C F+A+
Sbjct  618  YDELDDTQQQIFLDIACFFNGE--EKDFVTRILDACNFYAE  656



>gb|KEH19117.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=664

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 26/40 (65%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD LDD  + IFLDIACFF     +   I +ILN CGFFA
Sbjct  144  YDELDDKEKDIFLDIACFFKG--HERNSITKILNECGFFA  181



>gb|KDO37857.1| hypothetical protein CISIN_1g0011611mg, partial [Citrus sinensis]
Length=629

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 26/40 (65%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD LDD  Q +FLDIACFF D   D + + + L+ C FFA
Sbjct  430  YDGLDDKEQNVFLDIACFFIDD--DRDTVTKFLDDCEFFA  467



>ref|XP_006478279.1| PREDICTED: TMV resistance protein N-like isoform X6 [Citrus sinensis]
Length=799

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 2/38 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGF  116
            YDALDD+ + IFLDIACFF     + + +  IL+GCGF
Sbjct  438  YDALDDEEKAIFLDIACFFKGD--NRDHVTTILDGCGF  473



>ref|XP_008244976.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1135

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D L DD QR IFLDI+CFF     D   + +IL+GCGFFA+
Sbjct  431  FDGLSDDKQRDIFLDISCFFIGK--DKNYVKQILDGCGFFAE  470



>ref|XP_006478278.1| PREDICTED: TMV resistance protein N-like isoform X5 [Citrus sinensis]
Length=807

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 2/38 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGF  116
            YDALDD+ + IFLDIACFF     + + +  IL+GCGF
Sbjct  438  YDALDDEEKAIFLDIACFFKGD--NRDHVTTILDGCGF  473



>gb|KCW85843.1| hypothetical protein EUGRSUZ_B02580 [Eucalyptus grandis]
Length=399

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD LDD ++ IFLD AC F   +   EE + I  GCGF A+
Sbjct  266  YDGLDDATKPIFLDAACLFVKTHMTREEAIEIWKGCGFQAE  306



>ref|XP_006398177.1| hypothetical protein EUTSA_v10001238mg, partial [Eutrema salsugineum]
 gb|ESQ39630.1| hypothetical protein EUTSA_v10001238mg, partial [Eutrema salsugineum]
Length=682

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 26/39 (67%), Gaps = 2/39 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFF  119
            YDAL D+ + IFLDIACFF     D   +++I  GCGFF
Sbjct  394  YDALSDNERSIFLDIACFFNGEQLD--RVMKIFEGCGFF  430



>ref|XP_002276075.2| PREDICTED: TMV resistance protein N-like isoform X1 [Vitis vinifera]
 ref|XP_010645910.1| PREDICTED: TMV resistance protein N-like isoform X1 [Vitis vinifera]
 ref|XP_010645911.1| PREDICTED: TMV resistance protein N-like isoform X1 [Vitis vinifera]
Length=1154

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 27/40 (68%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD LDD  + I LDIACFF     D + ++ IL+GCGFF+
Sbjct  422  YDGLDDKEKNILLDIACFFKGE--DKDYVMEILDGCGFFS  459



>ref|XP_009760885.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
Length=1127

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D LDD++Q +FLDIAC F  G F+  EI  ILN CGF A+
Sbjct  508  FDGLDDETQAVFLDIACAF-QGLFEY-EITEILNACGFHAK  546



>ref|XP_004489475.1| PREDICTED: TMV resistance protein N-like [Cicer arietinum]
Length=1136

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 29/42 (69%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDS-QRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L+DD+ + IFLDIACF      D  +++ ILNGCG FA+
Sbjct  483  YDGLNDDTVKEIFLDIACFLIG--LDRNDVILILNGCGLFAE  522



>emb|CDY36329.1| BnaA01g30890D [Brassica napus]
Length=205

 Score = 46.6 bits (109),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 25/39 (64%), Gaps = 2/39 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFF  119
            YD L D+ + IFLD+ACFF     D   I++I  GCGFF
Sbjct  25   YDVLSDNERSIFLDVACFFNGEELD--RIMQIFEGCGFF  61



>ref|XP_006478274.1| PREDICTED: TMV resistance protein N-like isoform X1 [Citrus sinensis]
 ref|XP_006478275.1| PREDICTED: TMV resistance protein N-like isoform X2 [Citrus sinensis]
 ref|XP_006478276.1| PREDICTED: TMV resistance protein N-like isoform X3 [Citrus sinensis]
 ref|XP_006478277.1| PREDICTED: TMV resistance protein N-like isoform X4 [Citrus sinensis]
Length=1024

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 2/38 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGF  116
            YDALDD+ + IFLDIACFF     + + +  IL+GCGF
Sbjct  438  YDALDDEEKAIFLDIACFFKGD--NRDHVTTILDGCGF  473



>ref|XP_007224738.1| hypothetical protein PRUPE_ppa024525mg [Prunus persica]
 gb|EMJ25937.1| hypothetical protein PRUPE_ppa024525mg [Prunus persica]
Length=1145

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 28/42 (67%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L DD +R IF DIACFF     D   + +IL+GCGFFA+
Sbjct  435  YDGLSDDYERDIFRDIACFFIG--MDKNYVTQILDGCGFFAE  474



>gb|KFK44609.1| hypothetical protein AALP_AA1G281100 [Arabis alpina]
Length=1344

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +++LDD+ +++FLD+AC F       EE+V IL GCGF A+
Sbjct  396  FESLDDEEKQVFLDLACLFLRMDITKEEVVDILQGCGFNAE  436



>gb|KFK44610.1| hypothetical protein AALP_AA1G281100 [Arabis alpina]
Length=1346

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +++LDD+ +++FLD+AC F       EE+V IL GCGF A+
Sbjct  398  FESLDDEEKQVFLDLACLFLRMDITKEEVVDILQGCGFNAE  438



>ref|XP_009336913.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1092

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 19/40 (48%), Positives = 29/40 (73%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            ++ LDD  + IFLDI+CFF    +D + + ++L+GCGFFA
Sbjct  448  FEGLDDTQKAIFLDISCFFIG--WDKDYVAKVLDGCGFFA  485



>ref|XP_008245426.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=480

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 28/38 (74%), Gaps = 2/38 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGF  116
            YD L++  Q+IFLD+ACF    ++D EE++ IL+ CGF
Sbjct  327  YDGLEEMQQKIFLDVACFHK--FYDKEEVIEILDSCGF  362



>ref|XP_006577459.1| PREDICTED: TMV resistance protein N-like [Glycine max]
Length=786

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 29/42 (69%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L DD+++ IFLDIACFF     D  +++ ILNGCG  A+
Sbjct  364  YDGLTDDTEKGIFLDIACFFIG--MDRNDVIHILNGCGLCAE  403



>ref|XP_003627827.1| NBS-LRR resistance-like protein 4G [Medicago truncatula]
Length=1266

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 26/40 (65%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD LDD  + IFLDIACF      D + + R+L+ CGF+A
Sbjct  428  YDGLDDTEKEIFLDIACFLNGK--DRQHVTRLLDACGFYA  465



>emb|CDK13060.1| TIR-NBS-LRR disease resistance protein [Malus domestica]
Length=1116

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 3/40 (8%)
 Frame = +3

Query  3    YDALDDD-SQRIFLDIACFFTDGYFDSEEIVRILNGCGFF  119
            YD L+D   +RIFLDIACFF     D  ++V+IL+GCGF+
Sbjct  425  YDGLNDTYKRRIFLDIACFFIG--MDKNDVVQILDGCGFY  462



>ref|XP_006440972.1| hypothetical protein CICLE_v10018595mg [Citrus clementina]
 gb|ESR54212.1| hypothetical protein CICLE_v10018595mg [Citrus clementina]
Length=961

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 25/40 (63%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD LDD  Q IFLDIACFF D   D +   + L+ C FFA
Sbjct  430  YDGLDDKEQNIFLDIACFFIDE--DRDTATKFLDDCEFFA  467



>gb|AAQ93077.1| putative TIR-NBS type R protein 11 [Malus domestica]
Length=634

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 3/41 (7%)
 Frame = +3

Query  3    YDALDDD-SQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD L+D+  +RIFLDIACFF     D  ++V+IL+GCGF++
Sbjct  513  YDGLNDNYKRRIFLDIACFFIG--MDKNDVVQILDGCGFYS  551



>gb|AES87048.2| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1714

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 3/41 (7%)
 Frame = +3

Query  3     YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
             +D L D +++ IFLDIACFF     D  ++++ILNGCGFFA
Sbjct  1089  FDGLKDVTEKHIFLDIACFFIG--MDRNDVIQILNGCGFFA  1127



>emb|CAD56845.1| putative resistance gene analogue protein [Lens culinaris]
Length=275

 Score = 47.4 bits (111),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L+DD++R IFLDIA FF     D  +++ ILNGCG FA+
Sbjct  209  YDGLNDDTERDIFLDIAFFFIG--MDKNDVMHILNGCGLFAE  248



>gb|KDO42422.1| hypothetical protein CISIN_1g041923mg, partial [Citrus sinensis]
Length=529

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D LDD+ + IFLDIACFF     D E +++ L+ CGF AQ
Sbjct  430  FDGLDDEQKNIFLDIACFFKGE--DKEFVIKFLDACGFAAQ  468



>ref|XP_010645905.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010645906.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1129

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 27/40 (68%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            Y  LDD  + IFLDIACFF     D + ++ IL+GCGFF+
Sbjct  422  YKGLDDKEKNIFLDIACFFKGE--DKDYVMEILDGCGFFS  459



>ref|XP_003605840.1| NBS-LRR resistance-like protein 4G [Medicago truncatula]
 gb|AES88037.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1264

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 26/40 (65%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD LDD  + IFLDIACF      D + + R+L+ CGF+A
Sbjct  428  YDGLDDTEKEIFLDIACFLNGK--DRQHVTRLLDACGFYA  465



>ref|XP_008352803.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=1021

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            +D LDD  + IFLDI+CFF     + + + +IL+GCGFFA
Sbjct  444  FDGLDDRQKAIFLDISCFFIR--MNKDYVAKILDGCGFFA  481



>ref|XP_006576513.1| PREDICTED: TMV resistance protein N-like isoform X2 [Glycine 
max]
Length=1444

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 29/42 (69%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L DD+++ IFLDIACFF     D  +++ ILNGCG  A+
Sbjct  692  YDGLTDDTEKGIFLDIACFFIG--MDRNDVIHILNGCGLCAE  731



>ref|XP_006576512.1| PREDICTED: TMV resistance protein N-like isoform X1 [Glycine 
max]
Length=1445

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 29/42 (69%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L DD+++ IFLDIACFF     D  +++ ILNGCG  A+
Sbjct  693  YDGLTDDTEKGIFLDIACFFIG--MDRNDVIHILNGCGLCAE  732



>gb|KEH16042.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
 gb|KEH19116.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=949

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 26/40 (65%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD LDD  + IFLDIACFF     +   I +ILN CGFFA
Sbjct  429  YDELDDKEKDIFLDIACFFKG--HERNSITKILNECGFFA  466



>ref|XP_007224475.1| hypothetical protein PRUPE_ppa022336mg [Prunus persica]
 gb|EMJ25674.1| hypothetical protein PRUPE_ppa022336mg [Prunus persica]
Length=888

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D L DD QR IFLDI+CFF     D   + +IL+GCGFFA+
Sbjct  434  FDGLSDDKQRDIFLDISCFFIGK--DKNYVKQILDGCGFFAE  473



>ref|XP_006282986.1| hypothetical protein CARUB_v10003971mg [Capsella rubella]
 gb|EOA15884.1| hypothetical protein CARUB_v10003971mg [Capsella rubella]
Length=1946

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 26/39 (67%), Gaps = 2/39 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFF  119
            YD LDD+ + IFLDIACFF     D   ++R+L  CGFF
Sbjct  904  YDTLDDNEKNIFLDIACFFNGENVDY--VMRLLEACGFF  940



>ref|XP_006282987.1| hypothetical protein CARUB_v10003971mg [Capsella rubella]
 gb|EOA15885.1| hypothetical protein CARUB_v10003971mg [Capsella rubella]
Length=1947

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 26/39 (67%), Gaps = 2/39 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFF  119
            YD LDD+ + IFLDIACFF     D   ++R+L  CGFF
Sbjct  904  YDTLDDNEKNIFLDIACFFNGENVDY--VMRLLEACGFF  940



>ref|XP_006485790.1| PREDICTED: TMV resistance protein N-like [Citrus sinensis]
Length=1134

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 26/40 (65%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD LDD  Q +FLDIACFF D   D + + + L+ C FFA
Sbjct  430  YDGLDDKEQNVFLDIACFFIDE--DRDTVTKFLDDCEFFA  467



>gb|KFK44608.1| hypothetical protein AALP_AA1G281000 [Arabis alpina]
Length=1382

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 18/40 (45%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            +++LDD+ +++FLDI+C F       EE+V +L GCGF A
Sbjct  428  FESLDDEEKKVFLDISCLFLKMEITKEEVVDVLKGCGFNA  467



>ref|XP_006605620.1| PREDICTED: TMV resistance protein N-like isoform X6 [Glycine 
max]
Length=895

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 25/40 (63%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YDALDD  Q IFLDIACFF     D E +  ++  C FFA
Sbjct  429  YDALDDSQQDIFLDIACFFNGE--DKEWVTSLMEACEFFA  466



>ref|XP_010665349.1| PREDICTED: TMV resistance protein N-like isoform X1 [Vitis vinifera]
 ref|XP_010665350.1| PREDICTED: TMV resistance protein N-like isoform X1 [Vitis vinifera]
 ref|XP_010665351.1| PREDICTED: TMV resistance protein N-like isoform X1 [Vitis vinifera]
Length=1367

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 2/38 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGF  116
            YD LDD  +++FLDIACFF   Y D + + RIL GC F
Sbjct  435  YDGLDDKCKKLFLDIACFFK--YKDEKFVTRILEGCKF  470



>gb|KEH25111.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1076

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 30/42 (71%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YDAL+DD ++ IFLD+ACFF     D  ++  IL+GCG FA+
Sbjct  467  YDALNDDYEKEIFLDVACFFIGK--DRNDVTLILDGCGLFAE  506



>emb|CDK13053.1| TIR-NBS-LRR disease resistance protein [Malus domestica]
Length=1183

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 3/41 (7%)
 Frame = +3

Query  3    YDALDDD-SQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            Y+ L+D+  +RIFLDIACFF     D  ++++IL+GCGF+A
Sbjct  488  YEGLNDNYKRRIFLDIACFFIG--MDKNDVIQILDGCGFYA  526



>ref|XP_010645912.1| PREDICTED: TMV resistance protein N-like isoform X2 [Vitis vinifera]
Length=889

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 27/40 (68%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD LDD  + I LDIACFF     D + ++ IL+GCGFF+
Sbjct  422  YDGLDDKEKNILLDIACFFKGE--DKDYVMEILDGCGFFS  459



>ref|XP_007157556.1| hypothetical protein PHAVU_002G079200g [Phaseolus vulgaris]
 gb|ESW29550.1| hypothetical protein PHAVU_002G079200g [Phaseolus vulgaris]
Length=1374

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGF  116
            +DALD++ Q IFLDIAC F       +++V ILNGC F
Sbjct  427  FDALDEEEQCIFLDIACLFVQMEMKRDDVVDILNGCDF  464



>ref|XP_006586404.1| PREDICTED: TMV resistance protein N-like, partial [Glycine max]
Length=999

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 26/40 (65%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD LDD  + IFLDIACFF     DS  + ++LN CGF A
Sbjct  426  YDGLDDGDKNIFLDIACFFKGQKGDS--VTKVLNACGFSA  463



>gb|KEH25117.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=951

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD LDD SQ+ IFLDIACFF     +  +++ ILNGC  FA+
Sbjct  429  YDGLDDKSQKAIFLDIACFFIGK--ERNDVIHILNGCRLFAE  468



>ref|XP_009591454.1| PREDICTED: TMV resistance protein N-like, partial [Nicotiana 
tomentosiformis]
Length=168

 Score = 45.4 bits (106),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D LDD++Q +FLDIAC F  G F+  EI  ILN CGF A+
Sbjct  74   FDGLDDETQAVFLDIACAF-QGLFEC-EITEILNTCGFHAK  112



>gb|KHN11283.1| TMV resistance protein N [Glycine soja]
Length=1159

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 26/40 (65%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD LDD  + IFLDIACFF     DS  + ++LN CGF A
Sbjct  426  YDGLDDGDKNIFLDIACFFKGQKGDS--VTKVLNACGFSA  463



>ref|XP_006441748.1| hypothetical protein CICLE_v10023641mg [Citrus clementina]
 gb|ESR54988.1| hypothetical protein CICLE_v10023641mg [Citrus clementina]
Length=985

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YDALDD  Q IFLDIACF      D ++++  L  CGFFA+
Sbjct  430  YDALDDHEQDIFLDIACFLLGE--DRDQVMMFLGSCGFFAE  468



>gb|KEH29523.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1162

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 26/40 (65%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD LDD  + IFLDIACF      D + + R+L+ CGF+A
Sbjct  428  YDGLDDTEKEIFLDIACFLNGK--DRQHVTRLLDACGFYA  465



>gb|KEH17605.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1169

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 26/40 (65%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD LDD  + IFLDIACF      D + + R+L+ CGF+A
Sbjct  428  YDGLDDTEKEIFLDIACFLNGK--DRQHVTRLLDACGFYA  465



>ref|XP_010043845.1| PREDICTED: probable WRKY transcription factor 19 isoform X2 [Eucalyptus 
grandis]
 ref|XP_010043846.1| PREDICTED: probable WRKY transcription factor 19 isoform X2 [Eucalyptus 
grandis]
Length=1249

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD LDD ++ IFLD AC F   +   EE + I  GCGF A+
Sbjct  299  YDGLDDATKPIFLDAACLFVKTHMTREEAIEIWKGCGFQAE  339



>ref|XP_010665217.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=532

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD LD   + IFLDIACFF     D E + RIL+GC F+A+
Sbjct  429  YDGLDRTQREIFLDIACFFKGQ--DKEFVSRILDGCDFYAK  467



>ref|XP_010043844.1| PREDICTED: TMV resistance protein N-like isoform X1 [Eucalyptus 
grandis]
Length=1379

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD LDD ++ IFLD AC F   +   EE + I  GCGF A+
Sbjct  429  YDGLDDATKPIFLDAACLFVKTHMTREEAIEIWKGCGFQAE  469



>ref|XP_009589492.1| PREDICTED: TMV resistance protein N-like [Nicotiana tomentosiformis]
Length=1074

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D LDD++Q +FLDI C F    F+  E+  ILN CGF A+
Sbjct  430  FDGLDDETQTVFLDITCAFHG--FNEREVTEILNACGFHAK  468



>emb|CBI18156.3| unnamed protein product [Vitis vinifera]
Length=426

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            Y+ L +  + IFLDIACFF   Y D   +++IL+GCGFFA+
Sbjct  290  YEGLSNTQKNIFLDIACFFKGEYKDF--VIKILDGCGFFAE  328



>emb|CAN75471.1| hypothetical protein VITISV_010349 [Vitis vinifera]
Length=553

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 2/38 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGF  116
            YD LDD  +++FLDIACFF D   D + + RIL GC F
Sbjct  11   YDGLDDKWKKLFLDIACFFKDE--DEKFVTRILEGCKF  46



>ref|XP_006605619.1| PREDICTED: TMV resistance protein N-like isoform X5 [Glycine 
max]
Length=1090

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 25/40 (63%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YDALDD  Q IFLDIACFF     D E +  ++  C FFA
Sbjct  429  YDALDDSQQDIFLDIACFFNGE--DKEWVTSLMEACEFFA  466



>ref|XP_010315476.1| PREDICTED: uncharacterized protein LOC101251930 [Solanum lycopersicum]
Length=1850

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 3/41 (7%)
 Frame = +3

Query  3     YDALDDDS-QRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
             YD LDDD  Q+IFLDI CFF     D +  V IL+GCGFF+
Sbjct  1041  YDLLDDDDVQKIFLDIVCFFVGK--DRDYAVTILDGCGFFS  1079



>gb|KDP26906.1| hypothetical protein JCGZ_18064 [Jatropha curcas]
Length=1226

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 2/39 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFF  119
            YD LD  SQ IFLDIACFF     +++ ++++L  CGFF
Sbjct  427  YDGLDRTSQEIFLDIACFFKG--METDYVLKVLESCGFF  463



>ref|XP_009773802.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
Length=1064

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D LD ++Q +FLDIAC F    FD  E+  ILN CGF A+
Sbjct  430  FDGLDGETQIVFLDIACTFHG--FDEHEVTEILNACGFHAK  468



>ref|XP_008345881.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=986

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 3/41 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            Y+ L+DD +R IFLDIACFF     D   ++ IL+GCGF+A
Sbjct  255  YNGLNDDYERGIFLDIACFFIG--MDKNYVIXILDGCGFYA  293



>ref|XP_002524855.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF37479.1| ATP binding protein, putative [Ricinus communis]
Length=673

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D LDDD  + IFLDIACFF     D +  V+IL+GCGFF +
Sbjct  437  FDTLDDDKVKDIFLDIACFFIGT--DRDYAVKILDGCGFFPE  476



>gb|KEH29524.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1174

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 26/40 (65%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD LDD  + IFLDIACF      D + + R+L+ CGF+A
Sbjct  428  YDGLDDTEKEIFLDIACFLNGK--DRQHVTRLLDACGFYA  465



>ref|XP_008390203.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=1042

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/40 (48%), Positives = 28/40 (70%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            ++ LDD  + IFLDI+CFF     D + + ++L+GCGFFA
Sbjct  467  FEGLDDTQKAIFLDISCFFIGN--DKDYVAKVLDGCGFFA  504



>gb|KDP26904.1| hypothetical protein JCGZ_18062 [Jatropha curcas]
Length=1799

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 2/39 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFF  119
            YD LD  SQ IFLDIACFF     +++ ++++L  CGFF
Sbjct  427  YDGLDRTSQEIFLDIACFFKG--METDYVLKVLESCGFF  463


 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 2/39 (5%)
 Frame = +3

Query  3     YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFF  119
             YD LD  SQ IFLDIACFF     +++ ++++L  CGFF
Sbjct  1064  YDGLDRTSQEIFLDIACFFKG--METDYVLKVLESCGFF  1100



>ref|XP_010026366.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=623

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 29/38 (76%), Gaps = 2/38 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGF  116
            YD LDD+++ IFLD+ACFFT GY   E I+++L+ C F
Sbjct  427  YDGLDDNAKEIFLDVACFFT-GY-TKEYIMKVLDSCDF  462



>gb|KGN52644.1| hypothetical protein Csa_5G648650 [Cucumis sativus]
Length=739

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD LD+  + IFLD+ACFF       E +  ILNGCGF+A+
Sbjct  70   YDGLDEREREIFLDVACFFNGK--RREVVEEILNGCGFYAK  108



>ref|XP_006605615.1| PREDICTED: TMV resistance protein N-like isoform X1 [Glycine 
max]
 ref|XP_006605616.1| PREDICTED: TMV resistance protein N-like isoform X2 [Glycine 
max]
 ref|XP_006605617.1| PREDICTED: TMV resistance protein N-like isoform X3 [Glycine 
max]
 ref|XP_006605618.1| PREDICTED: TMV resistance protein N-like isoform X4 [Glycine 
max]
Length=1121

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 25/40 (63%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YDALDD  Q IFLDIACFF     D E +  ++  C FFA
Sbjct  429  YDALDDSQQDIFLDIACFFNGE--DKEWVTSLMEACEFFA  466



>gb|KHN15002.1| TMV resistance protein N [Glycine soja]
Length=955

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 25/40 (63%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YDALDD  Q IFLDIACFF     D E +  ++  C FFA
Sbjct  301  YDALDDSQQDIFLDIACFFNGE--DKEWVTSLMEACEFFA  338



>ref|XP_006491606.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
[Citrus sinensis]
Length=943

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD LDD+ Q IFLDIACFF     D + ++  L+ CGF A+
Sbjct  435  YDGLDDEEQNIFLDIACFFKGN--DRDLVMNFLDACGFSAK  473



>ref|XP_008390171.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=349

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/40 (48%), Positives = 28/40 (70%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            ++ LDD  + IFLDI+CFF     D + + ++L+GCGFFA
Sbjct  208  FEGLDDTEKAIFLDISCFFIGK--DKDYVAKVLDGCGFFA  245



>emb|CDP00246.1| unnamed protein product [Coffea canephora]
Length=1374

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 18/41 (44%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +  LDD  +R+FLD+ACFF +     E+ + I  GCGF A+
Sbjct  431  FKGLDDQEKRVFLDLACFFVNSNLIREDAIDIFKGCGFNAE  471



>ref|XP_002525460.1| hypothetical protein RCOM_1122080 [Ricinus communis]
 gb|EEF36950.1| hypothetical protein RCOM_1122080 [Ricinus communis]
Length=642

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D LD   + +FLDIACFF  G  D + + +IL+ CGFFA+
Sbjct  266  FDGLDKKEKEVFLDIACFFKGG--DKDAVTKILDSCGFFAK  304



>gb|KDP45045.1| hypothetical protein JCGZ_01545 [Jatropha curcas]
Length=1051

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD LD+ S++IFLDIACFF       E ++++L  CGFF +
Sbjct  427  YDVLDEVSRKIFLDIACFFKG--MKKEYVIKVLESCGFFPE  465



>ref|XP_007199198.1| hypothetical protein PRUPE_ppa021587mg [Prunus persica]
 gb|EMJ00397.1| hypothetical protein PRUPE_ppa021587mg [Prunus persica]
Length=1047

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 2/38 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGF  116
            YD LD++ + IFLDIACFF   Y    ++++ILN CGF
Sbjct  415  YDRLDEEQKNIFLDIACFFKGKY--KYQVLKILNSCGF  450



>ref|XP_003604851.1| NBS-containing resistance-like protein [Medicago truncatula]
Length=1890

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 3/41 (7%)
 Frame = +3

Query  3     YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
             +D L D +++ IFLDIACFF     D  ++++ILNGCGFFA
Sbjct  1266  FDGLKDVTEKHIFLDIACFFIG--MDRNDVIQILNGCGFFA  1304



>emb|CAN72303.1| hypothetical protein VITISV_009715 [Vitis vinifera]
Length=1135

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 27/40 (68%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD LDD  + I LDIACFF     D + ++ IL+GCGFF+
Sbjct  402  YDGLDDKEKNIXLDIACFFKGE--DKDYVMEILDGCGFFS  439



>ref|XP_004141627.1| PREDICTED: TMV resistance protein N-like [Cucumis sativus]
Length=1127

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD LD+  + IFLD+ACFF       E +  ILNGCGF+A+
Sbjct  468  YDGLDEREREIFLDVACFFNGK--RREVVEEILNGCGFYAK  506



>ref|XP_006391686.1| hypothetical protein EUTSA_v10023218mg [Eutrema salsugineum]
 gb|ESQ28972.1| hypothetical protein EUTSA_v10023218mg [Eutrema salsugineum]
Length=1377

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +++LDD+ ++IFLDIAC F       EE+V +L GCG  A+
Sbjct  431  FESLDDEEKKIFLDIACLFMIMKITEEEVVDVLKGCGLNAE  471



>ref|XP_006441860.1| hypothetical protein CICLE_v10024544mg, partial [Citrus clementina]
 gb|ESR55100.1| hypothetical protein CICLE_v10024544mg, partial [Citrus clementina]
Length=1147

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 2/38 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGF  116
            YDALDD+ + IFLDIACFF     + + +  IL+GCGF
Sbjct  434  YDALDDEEKAIFLDIACFFKGD--NRDHVTTILDGCGF  469



>gb|KEH18959.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1277

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 26/40 (65%), Gaps = 1/40 (3%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD LDD  + IFLDIACFF  G   S  + +ILN C FFA
Sbjct  519  YDELDDTEKDIFLDIACFFK-GCGRSSRVTKILNVCDFFA  557



>gb|KFK35949.1| hypothetical protein AALP_AA4G059300 [Arabis alpina]
Length=705

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 27/39 (69%), Gaps = 2/39 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFF  119
            Y+AL D  + IFLDIACFF     D+  ++RIL GCGF+
Sbjct  413  YNALSDKERSIFLDIACFFKGELHDN--VMRILEGCGFY  449



>gb|KFK44611.1| hypothetical protein AALP_AA1G281200 [Arabis alpina]
Length=2232

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 18/41 (44%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +++LDD+ +++FLDI+C F       EE+V +L GCGF A+
Sbjct  303  FESLDDEEKKVFLDISCLFLKMEMTKEEVVDVLIGCGFNAE  343


 Score = 46.6 bits (109),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  3     YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
             + +LDD+ +++FLDIAC         EE+V IL GCGF A+
Sbjct  1273  FKSLDDEEKKVFLDIACLLLKMERKKEEVVDILKGCGFNAE  1313



>emb|CDX98624.1| BnaA03g44090D [Brassica napus]
Length=1010

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 2/39 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFF  119
            +D  DD+ + IFLD+ACFF   Y   + +V IL+GCGFF
Sbjct  543  FDGRDDNEKSIFLDLACFFRGKY--KKRVVNILDGCGFF  579



>ref|XP_003604881.1| TIR-NBS-LRR RCT1 resistance protein [Medicago truncatula]
Length=524

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 3/41 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            +D L D +++ IFLDIACFF     D  + ++ILNGCGFFA
Sbjct  396  FDGLKDCTEKQIFLDIACFFIG--MDQNDAIQILNGCGFFA  434



>ref|XP_004156244.1| PREDICTED: TMV resistance protein N-like [Cucumis sativus]
Length=1676

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 2/41 (5%)
 Frame = +3

Query  3     YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
             YD LD+  + IFLD+ACFF       E +  ILNGCGF+A+
Sbjct  1078  YDGLDEREREIFLDVACFFNGK--RREVVEEILNGCGFYAK  1116



>gb|KDP42430.1| hypothetical protein JCGZ_00227 [Jatropha curcas]
Length=1063

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD LD + Q IFLDIACFF +G     E+ +I+   GFFA+
Sbjct  261  YDGLDRNEQSIFLDIACFFGNGDKAENELEKIIESFGFFAR  301



>ref|XP_010645387.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1210

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD LD   + IFLDIACFF D   D + ++RIL+GC F A+
Sbjct  432  YDGLDRTEKNIFLDIACFFKDE--DRDFVLRILDGCNFHAE  470



>ref|XP_006358466.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=1238

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 28/42 (67%), Gaps = 4/42 (10%)
 Frame = +3

Query  3    YDAL--DDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD L  DDD Q+IFLDI CFF     D +  V IL+GCGFF+
Sbjct  430  YDLLPDDDDVQKIFLDIVCFFVGK--DRDYAVTILDGCGFFS  469



>gb|KEH25109.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1109

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 29/42 (69%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L+DD+++ IFLDIACFF     D  +   ILNGCG +A+
Sbjct  460  YDGLNDDAEKEIFLDIACFFIG--IDRNDATLILNGCGLYAE  499



>ref|XP_009758995.1| PREDICTED: TMV resistance protein N-like isoform X2 [Nicotiana 
sylvestris]
Length=718

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D LDD++Q IFLDIAC F    F  + +  ILN CGF A+
Sbjct  433  FDGLDDETQTIFLDIACAFYG--FREDRVTEILNACGFHAR  471



>ref|XP_010652777.1| PREDICTED: TMV resistance protein N-like isoform X2 [Vitis vinifera]
Length=1380

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            +D LD+  + IFLDIACFF       E+ + IL GCGF A
Sbjct  436  FDGLDEQEKDIFLDIACFFVKMRLKREDAIDILKGCGFRA  475



>ref|XP_010652774.1| PREDICTED: TMV resistance protein N-like isoform X1 [Vitis vinifera]
Length=1383

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            +D LD+  + IFLDIACFF       E+ + IL GCGF A
Sbjct  439  FDGLDEQEKDIFLDIACFFVKMRLKREDAIDILKGCGFRA  478



>ref|XP_009758994.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
sylvestris]
Length=1045

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D LDD++Q IFLDIAC F    F  + +  ILN CGF A+
Sbjct  433  FDGLDDETQTIFLDIACAFYG--FREDRVTEILNACGFHAR  471



>ref|XP_006370901.1| hypothetical protein POPTR_0019s01560g, partial [Populus trichocarpa]
 gb|ERP48698.1| hypothetical protein POPTR_0019s01560g, partial [Populus trichocarpa]
Length=758

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 3/41 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            +D L+DD+Q+ +FLDI+CFF     D E ++ ILNGC FFA
Sbjct  405  FDGLNDDTQKDLFLDISCFFVG--MDKEYVLPILNGCDFFA  443



>ref|XP_010263366.1| PREDICTED: TMV resistance protein N-like [Nelumbo nucifera]
Length=1098

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDAL-DDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YDAL DDD + IFLDIACFFT    + + +  IL+GCGF+ +
Sbjct  431  YDALEDDDLKNIFLDIACFFTG--MNVDYVSTILDGCGFYPK  470



>ref|XP_006573081.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
isoform X2 [Glycine max]
Length=1202

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGF  116
            +DALD+  + IFLDIAC F       E++V ILNGC F
Sbjct  254  FDALDEQEKCIFLDIACLFVQMEMKREDVVDILNGCNF  291



>ref|XP_007201606.1| hypothetical protein PRUPE_ppa019497mg, partial [Prunus persica]
 gb|EMJ02805.1| hypothetical protein PRUPE_ppa019497mg, partial [Prunus persica]
Length=1063

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 28/38 (74%), Gaps = 2/38 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGF  116
            YD L++  ++IFLD+ACF    ++D EE++ IL+ CGF
Sbjct  435  YDGLEEMQKKIFLDVACFHK--FYDKEEVIEILDSCGF  470



>ref|XP_009110747.1| PREDICTED: TMV resistance protein N-like [Brassica rapa]
Length=1366

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/41 (44%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            + +LDD+ + +FLDIAC F       EE++ +L GCGF A+
Sbjct  420  FKSLDDEEKTVFLDIACLFLKMEIKKEEVIDVLKGCGFKAE  460



>emb|CAD56823.1| putative resistance gene analogue protein [Lens culinaris]
Length=275

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 3/41 (7%)
 Frame = +3

Query  3    YDALDD-DSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            +D L D   Q+IFLDIACFF     D  +++ ILNGCGFFA
Sbjct  209  FDGLKDVTEQQIFLDIACFFIG--MDRNDVIHILNGCGFFA  247



>ref|XP_006573080.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
isoform X1 [Glycine max]
Length=1379

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGF  116
            +DALD+  + IFLDIAC F       E++V ILNGC F
Sbjct  431  FDALDEQEKCIFLDIACLFVQMEMKREDVVDILNGCNF  468



>gb|KDP26901.1| hypothetical protein JCGZ_18059 [Jatropha curcas]
Length=1184

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 25/39 (64%), Gaps = 2/39 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFF  119
            YD LD   Q +FLDIACFF     D E +V++L  CGFF
Sbjct  435  YDGLDKILQEMFLDIACFFKG--MDEEYVVKVLESCGFF  471



>ref|XP_006388459.1| hypothetical protein POPTR_0182s00240g [Populus trichocarpa]
 gb|ERP47373.1| hypothetical protein POPTR_0182s00240g [Populus trichocarpa]
Length=1026

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 3/41 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            +D L+DD+Q+ +FLDI+CFF     D E ++ ILNGC FFA
Sbjct  439  FDGLNDDTQKDLFLDISCFFVG--MDKEYVLPILNGCDFFA  477



>ref|XP_009146644.1| PREDICTED: probable WRKY transcription factor 52 [Brassica rapa]
Length=1441

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 28/39 (72%), Gaps = 2/39 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFF  119
            Y  LDD+ + IFLDIACFF     D + ++++L+GCGFF
Sbjct  445  YKTLDDNEKNIFLDIACFFVGE--DVDYVMQLLDGCGFF  481



>emb|CAD56846.1| putative resistance gene analogue protein [Lens culinaris]
Length=275

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 3/41 (7%)
 Frame = +3

Query  3    YDALDD-DSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            +D L D   Q+IFLDIACFF     D  +++ ILNGCGFFA
Sbjct  209  FDGLKDVTEQQIFLDIACFFIG--MDRNDVIHILNGCGFFA  247



>ref|XP_003627638.1| Tir-nbs-lrr resistance protein [Medicago truncatula]
 gb|AET02114.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1184

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 26/40 (65%), Gaps = 1/40 (3%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD LDD  + IFLDIACFF  G   S  + +ILN C FFA
Sbjct  426  YDELDDTEKDIFLDIACFFK-GCGRSSRVTKILNVCDFFA  464



>gb|ACP30608.1| disease resistance protein [Brassica rapa subsp. pekinensis]
Length=1373

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 28/39 (72%), Gaps = 2/39 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFF  119
            Y  LDD+ + IFLDIACFF     D + ++++L+GCGFF
Sbjct  445  YKTLDDNEKNIFLDIACFFVGE--DVDYVMQLLDGCGFF  481



>ref|XP_009622118.1| PREDICTED: TMV resistance protein N-like isoform X3 [Nicotiana 
tomentosiformis]
Length=678

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D LD D+Q +FLDIAC F  G+++  E+  ILN CGF A+
Sbjct  430  FDGLDGDTQTVFLDIACAF-HGFYE-REVTEILNACGFHAK  468



>ref|XP_007224218.1| hypothetical protein PRUPE_ppa017550mg, partial [Prunus persica]
 gb|EMJ25417.1| hypothetical protein PRUPE_ppa017550mg, partial [Prunus persica]
Length=807

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 28/42 (67%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L DD +R IF DIACFF     D   + +IL+GCGFFA+
Sbjct  409  YDGLSDDYERDIFRDIACFFIG--MDKNYVTQILDGCGFFAE  448



>ref|XP_009374162.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=748

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 26/41 (63%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L+ D QRIFLDIACFF     D   +   L+ CGF+A+
Sbjct  428  YDDLEHDEQRIFLDIACFFN--LKDKNRVRETLDACGFYAE  466



>emb|CDX75556.1| BnaA01g01460D [Brassica napus]
Length=1429

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 28/39 (72%), Gaps = 2/39 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFF  119
            Y  LDD+ + IFLDIACFF     D + ++++L+GCGFF
Sbjct  433  YKTLDDNEKNIFLDIACFFVGE--DVDYVMQLLDGCGFF  469



>gb|KEH25074.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1045

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 29/42 (69%), Gaps = 3/42 (7%)
 Frame = +3

Query  3    YDALDDDSQR-IFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            YD L+DD+++ IFLDIACFF     D  ++  ILNGC  FA+
Sbjct  424  YDGLNDDTEKKIFLDIACFFIG--MDRNDVTLILNGCELFAE  463



>ref|XP_010263198.1| PREDICTED: TMV resistance protein N-like isoform X2 [Nelumbo 
nucifera]
Length=1147

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D LD   + IFLDIACFF   Y D  +++ ILNGCGF ++
Sbjct  436  FDGLDHSERDIFLDIACFFNGMYKD--DVMTILNGCGFHSE  474



>ref|XP_010263195.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010263196.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010263197.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nelumbo 
nucifera]
Length=1148

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            +D LD   + IFLDIACFF   Y D  +++ ILNGCGF ++
Sbjct  436  FDGLDHSERDIFLDIACFFNGMYKD--DVMTILNGCGFHSE  474



>emb|CDY16227.1| BnaA09g29610D [Brassica napus]
Length=1140

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/40 (48%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +3

Query  6    DALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFAQ  125
            ++LDD+ +++FLD AC F       EEIV +L GCGF A+
Sbjct  427  ESLDDEEKKVFLDTACLFLKMDMTKEEIVDVLKGCGFNAE  466



>ref|XP_006440971.1| hypothetical protein CICLE_v10018595mg [Citrus clementina]
 gb|ESR54211.1| hypothetical protein CICLE_v10018595mg [Citrus clementina]
Length=1127

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 25/40 (63%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    YDALDDDSQRIFLDIACFFTDGYFDSEEIVRILNGCGFFA  122
            YD LDD  Q IFLDIACFF D   D +   + L+ C FFA
Sbjct  430  YDGLDDKEQNIFLDIACFFIDE--DRDTATKFLDDCEFFA  467



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 515174157784