BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1259_g2_i1 len=209 path=[827:0-208]

Length=209
                                                                      Score     E

ref|XP_008800119.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  81.3    1e-17   
emb|CDP18641.1|  unnamed protein product                              82.0    6e-17   
gb|ADP02216.1|  Peptidase_C1 domain-containing protein                79.7    2e-16   
ref|XP_010277773.1|  PREDICTED: senescence-specific cysteine prot...  80.1    3e-16   
ref|XP_002522559.1|  cysteine protease, putative                      79.7    4e-16   Ricinus communis
emb|CDP18640.1|  unnamed protein product                              79.0    4e-16   
ref|XP_008780817.1|  PREDICTED: vignain-like                          78.2    4e-16   
ref|XP_008780365.1|  PREDICTED: vignain-like                          78.2    6e-16   
ref|XP_010912725.1|  PREDICTED: zingipain-2-like                      79.3    6e-16   
ref|XP_011014442.1|  PREDICTED: senescence-specific cysteine prot...  79.3    9e-16   
ref|XP_008779585.1|  PREDICTED: zingipain-2-like                      78.6    1e-15   
ref|XP_002280204.1|  PREDICTED: senescence-specific cysteine prot...  78.6    1e-15   Vitis vinifera
gb|AGT97048.1|  senescence-specific cysteine protease                 78.6    1e-15   
ref|XP_008779806.1|  PREDICTED: ervatamin-B-like                      78.2    1e-15   
ref|XP_004975184.1|  PREDICTED: vignain-like                          78.2    1e-15   
emb|CAN64655.1|  hypothetical protein VITISV_005140                   78.2    2e-15   Vitis vinifera
ref|XP_006449486.1|  hypothetical protein CICLE_v10018236mg           77.8    2e-15   
ref|XP_006376349.1|  hypothetical protein POPTR_0013s12260g           78.2    2e-15   
ref|XP_006467666.1|  PREDICTED: vignain-like                          77.8    2e-15   
ref|XP_011086004.1|  PREDICTED: senescence-specific cysteine prot...  77.8    2e-15   
ref|XP_006857797.1|  hypothetical protein AMTR_s00061p00215400        77.8    2e-15   
emb|CDP18645.1|  unnamed protein product                              77.8    3e-15   
ref|XP_004233054.1|  PREDICTED: senescence-specific cysteine prot...  77.8    3e-15   
ref|XP_011038210.1|  PREDICTED: senescence-specific cysteine prot...  77.4    3e-15   
ref|XP_002280230.2|  PREDICTED: LOW QUALITY PROTEIN: senescence-s...  77.4    3e-15   Vitis vinifera
ref|XP_006362420.1|  PREDICTED: vignain-like                          77.4    3e-15   
ref|XP_009759551.1|  PREDICTED: zingipain-2-like                      77.4    3e-15   
gb|ADV41672.1|  cysteine protease                                     77.4    3e-15   
ref|XP_009608954.1|  PREDICTED: zingipain-2-like                      77.4    3e-15   
gb|AAW78661.2|  senescence-specific cysteine protease                 77.4    3e-15   Nicotiana tabacum [American tobacco]
ref|XP_011021998.1|  PREDICTED: senescence-specific cysteine prot...  77.4    3e-15   
ref|XP_011022002.1|  PREDICTED: senescence-specific cysteine prot...  77.8    3e-15   
ref|XP_002307151.2|  hypothetical protein POPTR_0005s09140g           77.0    3e-15   Populus trichocarpa [western balsam poplar]
ref|XP_002306369.1|  hypothetical protein POPTR_0005s09080g           77.0    4e-15   Populus trichocarpa [western balsam poplar]
ref|XP_007025398.1|  Senescence-associated gene 12                    77.0    4e-15   
ref|XP_004975182.1|  PREDICTED: vignain-like                          77.0    4e-15   
ref|XP_002280215.1|  PREDICTED: senescence-specific cysteine prot...  77.0    4e-15   Vitis vinifera
ref|XP_004975183.1|  PREDICTED: vignain-like                          77.0    5e-15   
ref|XP_011009172.1|  PREDICTED: senescence-specific cysteine prot...  77.0    5e-15   
emb|CDP18637.1|  unnamed protein product                              76.3    5e-15   
ref|XP_006446763.1|  hypothetical protein CICLE_v10017432mg           77.0    5e-15   
ref|XP_010045986.1|  PREDICTED: ervatamin-B-like                      77.0    5e-15   
ref|XP_008811650.1|  PREDICTED: vignain-like                          76.3    5e-15   
gb|KDP23983.1|  hypothetical protein JCGZ_25371                       77.0    5e-15   
ref|NP_001176897.1|  Os12g0273900                                     75.5    6e-15   
ref|XP_009601308.1|  PREDICTED: ervatamin-B-like isoform X3           76.6    6e-15   
ref|XP_009601307.1|  PREDICTED: ervatamin-B-like isoform X2           76.6    6e-15   
emb|CAN70559.1|  hypothetical protein VITISV_032465                   76.6    7e-15   Vitis vinifera
gb|ADP02218.1|  Peptidase_C1 domain-containing protein                76.6    7e-15   
ref|XP_011086001.1|  PREDICTED: senescence-specific cysteine prot...  76.6    7e-15   
ref|XP_002280246.1|  PREDICTED: senescence-specific cysteine prot...  76.6    7e-15   Vitis vinifera
gb|ADP02219.1|  Peptidase_C1 domain-containing protein                77.4    8e-15   
gb|KCW76137.1|  hypothetical protein EUGRSUZ_D00513                   76.3    8e-15   
ref|XP_003540013.1|  PREDICTED: vignain-like                          76.3    8e-15   
ref|XP_009601306.1|  PREDICTED: ervatamin-B-like isoform X1           76.3    9e-15   
gb|KHN12137.1|  Thiol protease                                        76.3    9e-15   
ref|XP_010052206.1|  PREDICTED: ervatamin-B-like                      76.3    9e-15   
ref|XP_002446132.1|  hypothetical protein SORBIDRAFT_06g002150        76.3    1e-14   Sorghum bicolor [broomcorn]
ref|XP_010054322.1|  PREDICTED: ervatamin-B-like                      76.3    1e-14   
ref|XP_009604790.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  74.7    1e-14   
gb|EMT08019.1|  Vignain                                               75.5    1e-14   
ref|XP_006388351.1|  hypothetical protein POPTR_0213s00200g           74.7    1e-14   
ref|XP_006384061.1|  hypothetical protein POPTR_0004s05530g           74.7    1e-14   
gb|KHN27806.1|  Vignain                                               75.5    1e-14   
ref|XP_011038211.1|  PREDICTED: senescence-specific cysteine prot...  75.9    1e-14   
ref|XP_010045985.1|  PREDICTED: ervatamin-B-like                      75.5    2e-14   
emb|CDP18644.1|  unnamed protein product                              75.5    2e-14   
gb|KDP23984.1|  hypothetical protein JCGZ_25372                       75.5    2e-14   
gb|EMT08022.1|  Vignain                                               75.5    2e-14   
ref|XP_002446131.1|  hypothetical protein SORBIDRAFT_06g002140        75.1    2e-14   Sorghum bicolor [broomcorn]
ref|XP_002531151.1|  cysteine protease, putative                      75.5    2e-14   Ricinus communis
ref|XP_006376431.1|  hypothetical protein POPTR_0013s12980g           75.5    2e-14   
ref|XP_008805390.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...  75.5    2e-14   
gb|AAP32195.1|  cysteine protease 5                                   75.5    2e-14   Trifolium repens [creeping white clover]
ref|XP_009775915.1|  PREDICTED: ervatamin-B-like                      75.5    2e-14   
ref|XP_004974539.1|  PREDICTED: thiol protease SEN102-like            75.5    2e-14   
ref|XP_011086005.1|  PREDICTED: senescence-specific cysteine prot...  75.5    2e-14   
gb|AAP32198.1|  cysteine protease 12                                  75.5    2e-14   Trifolium repens [creeping white clover]
ref|XP_004974541.1|  PREDICTED: thiol protease SEN102-like            75.5    2e-14   
ref|XP_004974540.1|  PREDICTED: thiol protease SEN102-like            75.5    2e-14   
ref|XP_006582265.1|  PREDICTED: thiol protease SEN102-like            75.5    2e-14   
ref|XP_003526209.1|  PREDICTED: thiol protease SEN102-like            75.5    2e-14   
ref|XP_003526212.1|  PREDICTED: thiol protease SEN102-like            75.1    2e-14   
ref|XP_006380488.1|  hypothetical protein POPTR_0007s07170g           75.1    2e-14   
ref|XP_006380493.1|  hypothetical protein POPTR_0007s07240g           75.1    2e-14   
ref|XP_006371486.1|  hypothetical protein POPTR_0019s11980g           73.6    2e-14   
gb|KDO63329.1|  hypothetical protein CISIN_1g047793mg                 75.1    2e-14   
ref|XP_002310053.1|  hypothetical protein POPTR_0007s07200g           75.1    2e-14   Populus trichocarpa [western balsam poplar]
ref|XP_009786836.1|  PREDICTED: vignain-like                          73.9    2e-14   
ref|XP_011037399.1|  PREDICTED: senescence-specific cysteine prot...  75.1    3e-14   
ref|XP_010045988.1|  PREDICTED: ervatamin-B-like                      75.1    3e-14   
ref|XP_011005484.1|  PREDICTED: senescence-specific cysteine prot...  73.6    3e-14   
gb|EMT12294.1|  Vignain                                               75.1    3e-14   
emb|CAN75313.1|  hypothetical protein VITISV_033592                   73.6    3e-14   Vitis vinifera
ref|XP_006469128.1|  PREDICTED: vignain-like                          74.7    3e-14   
gb|AAR92154.1|  putative cysteine protease 1                          74.7    3e-14   Iris x hollandica [Dutch iris]
gb|AHA62780.1|  RCR3-like cysteine protease                           74.7    4e-14   
ref|XP_006852525.1|  hypothetical protein AMTR_s00021p00178750        73.6    4e-14   
gb|AHA62783.1|  RCR3-like cysteine protease                           74.7    4e-14   
ref|XP_006582266.1|  PREDICTED: thiol protease SEN102-like            74.7    4e-14   
ref|XP_003558756.1|  PREDICTED: senescence-specific cysteine prot...  74.7    4e-14   
gb|AGT16936.1|  vignain-like protein                                  74.7    4e-14   
ref|XP_007227669.1|  hypothetical protein PRUPE_ppa025602mg           74.7    4e-14   
gb|AAU81596.1|  cysteine proteinase                                   72.8    4e-14   Petunia x hybrida [garden petunia]
ref|XP_008223851.1|  PREDICTED: ervatamin-B-like                      74.3    4e-14   
ref|XP_006376351.1|  hypothetical protein POPTR_0013s12280g           74.3    4e-14   
gb|EAY97106.1|  hypothetical protein OsI_19029                        74.7    4e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_008223852.1|  PREDICTED: ervatamin-B-like                      74.3    4e-14   
ref|XP_002446128.1|  hypothetical protein SORBIDRAFT_06g002110        73.2    4e-14   Sorghum bicolor [broomcorn]
ref|XP_008810168.1|  PREDICTED: ervatamin-B-like isoform X2           74.3    4e-14   
gb|ABA97421.1|  Vignain precursor, putative                           74.7    4e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006650241.1|  PREDICTED: xylem cysteine proteinase 2-like      74.7    4e-14   
ref|XP_008780633.1|  PREDICTED: vignain-like                          72.8    5e-14   
ref|XP_008810167.1|  PREDICTED: ervatamin-B-like isoform X1           74.7    5e-14   
ref|XP_004306836.1|  PREDICTED: vignain-like                          74.3    5e-14   
gb|KDP45355.1|  hypothetical protein JCGZ_09604                       73.9    5e-14   
gb|KHN08873.1|  Vignain                                               74.3    5e-14   
ref|XP_006582263.1|  PREDICTED: vignain-like                          74.3    5e-14   
ref|XP_008660792.1|  PREDICTED: vignain-like                          72.4    5e-14   
ref|XP_002436840.1|  hypothetical protein SORBIDRAFT_10g009830        73.9    5e-14   Sorghum bicolor [broomcorn]
ref|XP_008780330.1|  PREDICTED: vignain-like                          72.8    5e-14   
ref|XP_008650514.1|  PREDICTED: vignain-like                          73.2    5e-14   
ref|XP_006582264.1|  PREDICTED: vignain-like                          73.9    5e-14   
ref|XP_010317330.1|  PREDICTED: uncharacterized protein LOC101251741  75.9    5e-14   
ref|XP_002436841.1|  hypothetical protein SORBIDRAFT_10g009840        73.9    6e-14   Sorghum bicolor [broomcorn]
ref|XP_007132883.1|  hypothetical protein PHAVU_011G1328000g          72.4    6e-14   
ref|XP_007132275.1|  hypothetical protein PHAVU_011G081100g           73.9    7e-14   
ref|XP_003596711.1|  Cysteine proteinase                              73.9    7e-14   
ref|XP_011078542.1|  PREDICTED: senescence-specific cysteine prot...  73.9    7e-14   
gb|EMT33085.1|  Vignain                                               73.9    8e-14   
gb|KCW47322.1|  hypothetical protein EUGRSUZ_K01110                   73.2    8e-14   
gb|EYU19040.1|  hypothetical protein MIMGU_mgv1a026538mg              73.6    8e-14   
ref|XP_011078044.1|  PREDICTED: senescence-specific cysteine prot...  73.6    8e-14   
dbj|BAF56429.1|  cysteine proteinase                                  73.6    8e-14   Lotus japonicus
ref|XP_007226492.1|  hypothetical protein PRUPE_ppa026538mg           73.6    9e-14   
dbj|BAD29959.1|  cysteine protease                                    73.9    9e-14   Daucus carota [carrots]
ref|XP_009798361.1|  PREDICTED: ervatamin-B-like                      73.6    9e-14   
ref|XP_004308524.1|  PREDICTED: vignain-like                          73.6    9e-14   
ref|XP_006362426.1|  PREDICTED: vignain-like                          73.6    9e-14   
gb|AFW86314.1|  hypothetical protein ZEAMMB73_546353                  72.4    9e-14   
gb|KDP45578.1|  hypothetical protein JCGZ_17185                       73.6    9e-14   
gb|KCW89618.1|  hypothetical protein EUGRSUZ_A01901                   72.4    1e-13   
ref|XP_009629965.1|  PREDICTED: ervatamin-B-like                      73.6    1e-13   
ref|XP_009767421.1|  PREDICTED: ervatamin-B-like                      73.6    1e-13   
ref|XP_006388353.1|  hypothetical protein POPTR_0213s002202g          71.2    1e-13   
ref|XP_002446222.1|  hypothetical protein SORBIDRAFT_06g005410        73.6    1e-13   Sorghum bicolor [broomcorn]
ref|XP_010038689.1|  PREDICTED: ervatamin-B-like                      73.6    1e-13   
ref|XP_006652104.1|  PREDICTED: vignain-like                          73.6    1e-13   
ref|XP_006362428.1|  PREDICTED: vignain-like                          73.2    1e-13   
ref|XP_009361500.1|  PREDICTED: vignain-like                          73.2    1e-13   
gb|EYU25680.1|  hypothetical protein MIMGU_mgv1a019612mg              73.2    1e-13   
ref|XP_009359967.1|  PREDICTED: vignain-like                          73.2    1e-13   
ref|XP_004973089.1|  PREDICTED: thiol protease SEN102-like            73.2    1e-13   
gb|AFW76902.1|  hypothetical protein ZEAMMB73_056195                  73.2    1e-13   
ref|XP_009359979.1|  PREDICTED: ervatamin-B-like                      73.2    1e-13   
ref|XP_010054319.1|  PREDICTED: zingipain-2-like                      73.2    1e-13   
ref|XP_010906195.1|  PREDICTED: senescence-specific cysteine prot...  72.0    1e-13   
ref|XP_006469012.1|  PREDICTED: vignain-like                          73.2    1e-13   
ref|XP_004974538.1|  PREDICTED: thiol protease SEN102-like            73.2    1e-13   
ref|XP_006469011.1|  PREDICTED: vignain-like                          73.2    1e-13   
ref|XP_003578721.1|  PREDICTED: senescence-specific cysteine prot...  73.2    1e-13   
ref|XP_009617815.1|  PREDICTED: ervatamin-B-like                      72.8    2e-13   
ref|XP_006360707.1|  PREDICTED: vignain-like                          72.8    2e-13   
gb|EAY93078.1|  hypothetical protein OsI_14879                        72.8    2e-13   Oryza sativa Indica Group [Indian rice]
gb|KCW76140.1|  hypothetical protein EUGRSUZ_D00517                   72.4    2e-13   
gb|KCW76139.1|  hypothetical protein EUGRSUZ_D00515                   72.8    2e-13   
ref|XP_002531152.1|  cysteine protease, putative                      72.8    2e-13   Ricinus communis
gb|EYU25672.1|  hypothetical protein MIMGU_mgv1a018700mg              72.8    2e-13   
ref|XP_006388352.1|  hypothetical protein POPTR_0213s00210g           71.2    2e-13   
ref|XP_007025413.1|  Maternal effect embryo arrest 18                 74.7    2e-13   
gb|KHN13721.1|  Vignain                                               72.4    2e-13   
emb|CAH66233.1|  H0825G02.10                                          72.8    2e-13   Oryza sativa [red rice]
gb|AHA62781.1|  RCR3-like cysteine protease                           72.8    2e-13   
ref|XP_007216164.1|  hypothetical protein PRUPE_ppa015341mg           71.2    2e-13   
ref|XP_008382007.1|  PREDICTED: ervatamin-B-like                      72.8    2e-13   
emb|CAD40112.2|  OSJNBa0035O13.5                                      72.4    2e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010052199.1|  PREDICTED: ervatamin-B-like                      72.8    2e-13   
ref|XP_010054320.1|  PREDICTED: ervatamin-B-like                      72.8    2e-13   
gb|KCW76123.1|  hypothetical protein EUGRSUZ_D00500                   72.8    2e-13   
dbj|BAD25828.1|  putative cysteine proteinase                         72.8    2e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008797119.1|  PREDICTED: vignain-like                          71.6    2e-13   
ref|XP_008669676.1|  PREDICTED: ervatamin-B-like                      72.8    2e-13   
ref|NP_001063060.1|  Os09g0381400                                     72.8    2e-13   Oryza sativa Japonica Group [Japonica rice]
gb|AHA62779.1|  RCR3-like cysteine protease                           72.4    2e-13   
gb|EEC84504.1|  hypothetical protein OsI_31195                        72.8    2e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_010906543.1|  PREDICTED: ervatamin-B-like                      72.8    2e-13   
ref|XP_009357172.1|  PREDICTED: ervatamin-B-like                      72.4    2e-13   
gb|AHA62782.1|  RCR3-like cysteine protease                           72.4    2e-13   
ref|XP_003557016.1|  PREDICTED: vignain-like                          72.4    2e-13   
ref|XP_008659446.1|  PREDICTED: ervatamin-B-like                      72.4    3e-13   
gb|EEE69617.1|  hypothetical protein OsJ_29194                        72.8    3e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007132868.1|  hypothetical protein PHAVU_011G1314000g          71.2    3e-13   
ref|XP_008803660.1|  PREDICTED: ervatamin-B-like                      72.4    3e-13   
ref|XP_006446793.1|  hypothetical protein CICLE_v10018274mg           72.4    3e-13   
ref|XP_007018686.1|  Xylem cysteine peptidase 1                       72.4    3e-13   
dbj|BAH79097.1|  cysteine protease                                    70.1    3e-13   Lactuca sativa [cultivated lettuce]
ref|XP_004152297.1|  PREDICTED: vignain-like                          72.4    3e-13   
ref|XP_011045912.1|  PREDICTED: senescence-specific cysteine prot...  72.4    3e-13   
gb|AFW57869.1|  hypothetical protein ZEAMMB73_830006                  73.2    3e-13   
ref|XP_008659445.1|  PREDICTED: ervatamin-B-like                      72.0    3e-13   
ref|XP_007025397.1|  Senescence-associated gene 12, putative          71.6    3e-13   
dbj|BAG16370.1|  cysteine protease                                    72.0    3e-13   Brassica oleracea var. italica [asparagus broccoli]
gb|KCW84689.1|  hypothetical protein EUGRSUZ_B01506                   71.2    3e-13   
ref|XP_010518799.1|  PREDICTED: senescence-specific cysteine prot...  72.0    3e-13   
ref|XP_010054325.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  73.2    4e-13   
ref|XP_009797968.1|  PREDICTED: vignain-like                          72.0    4e-13   
gb|AAM73806.1|AF448505_1  cysteine proteinase                         72.0    4e-13   Brassica napus [oilseed rape]
ref|XP_010054326.1|  PREDICTED: zingipain-2-like                      72.4    4e-13   
ref|XP_008800071.1|  PREDICTED: ervatamin-B-like                      72.0    4e-13   
ref|XP_010906194.1|  PREDICTED: senescence-specific cysteine prot...  72.0    4e-13   
ref|XP_008800073.1|  PREDICTED: ervatamin-B-like                      71.6    4e-13   
ref|XP_008663073.1|  PREDICTED: ervatamin-B-like                      72.0    4e-13   
gb|AFW86317.1|  hypothetical protein ZEAMMB73_339067                  72.4    4e-13   
ref|XP_004306813.1|  PREDICTED: vignain-like                          71.6    4e-13   
ref|XP_010939512.1|  PREDICTED: senescence-specific cysteine prot...  71.6    4e-13   
gb|AAP32194.1|  cysteine protease 1                                   70.9    4e-13   Trifolium repens [creeping white clover]
ref|XP_007132895.1|  hypothetical protein PHAVU_011G134000g           71.6    5e-13   
ref|XP_006663343.1|  PREDICTED: vignain-like                          71.6    5e-13   
ref|XP_008383642.1|  PREDICTED: zingipain-1-like                      71.6    5e-13   
ref|XP_007132875.1|  hypothetical protein PHAVU_011G132100g           71.6    5e-13   
ref|XP_002446133.1|  hypothetical protein SORBIDRAFT_06g002160        71.6    5e-13   Sorghum bicolor [broomcorn]
ref|XP_010912736.1|  PREDICTED: senescence-specific cysteine prot...  71.2    6e-13   
ref|XP_007048796.1|  Senescence-associated gene 12                    71.2    6e-13   
gb|AFO83613.1|  papain-like cysteine protease                         71.6    6e-13   
ref|XP_010045987.1|  PREDICTED: ervatamin-B-like                      71.6    6e-13   
ref|XP_004975180.1|  PREDICTED: thiol protease SEN102-like            71.2    6e-13   
ref|XP_006446792.1|  hypothetical protein CICLE_v10018253mg           71.2    6e-13   
ref|XP_008669668.1|  PREDICTED: ervatamin-B-like                      71.2    6e-13   
ref|XP_004252652.2|  PREDICTED: senescence-specific cysteine prot...  71.2    6e-13   
ref|XP_009390411.1|  PREDICTED: vignain-like                          69.7    7e-13   
ref|XP_010052203.1|  PREDICTED: ervatamin-B-like                      71.2    7e-13   
gb|KCW76125.1|  hypothetical protein EUGRSUZ_D00501                   72.0    7e-13   
ref|XP_009623244.1|  PREDICTED: ervatamin-B-like                      71.2    7e-13   
gb|KFK23231.1|  hypothetical protein AALP_AAs59427U000100             70.1    7e-13   
ref|XP_009344439.1|  PREDICTED: ervatamin-B-like                      71.2    7e-13   
ref|XP_004294729.1|  PREDICTED: vignain-like                          71.2    8e-13   
ref|XP_008450203.1|  PREDICTED: vignain-like                          69.7    8e-13   
ref|XP_003526207.1|  PREDICTED: thiol protease SEN102-like            70.9    8e-13   
gb|EYU19037.1|  hypothetical protein MIMGU_mgv1a018631mg              70.9    8e-13   
ref|XP_002316833.2|  hypothetical protein POPTR_0011s07520g           71.2    8e-13   Populus trichocarpa [western balsam poplar]
ref|XP_008780645.1|  PREDICTED: vignain-like                          70.1    8e-13   
ref|XP_011005599.1|  PREDICTED: vignain-like                          71.2    8e-13   
ref|XP_007132887.1|  hypothetical protein PHAVU_011G133200g           70.9    8e-13   
ref|XP_011008467.1|  PREDICTED: senescence-specific cysteine prot...  70.5    8e-13   
gb|KHN05804.1|  Vignain                                               70.5    8e-13   
ref|XP_010245279.1|  PREDICTED: vignain-like                          71.2    8e-13   
ref|XP_002305073.2|  hypothetical protein POPTR_0004s05540g           70.9    9e-13   Populus trichocarpa [western balsam poplar]
ref|XP_006360708.1|  PREDICTED: vignain-like                          70.9    9e-13   
ref|XP_004172030.1|  PREDICTED: vignain-like                          70.9    9e-13   
ref|XP_010914479.1|  PREDICTED: ervatamin-B-like                      70.9    1e-12   
gb|EYU43350.1|  hypothetical protein MIMGU_mgv1a021555mg              70.5    1e-12   
ref|XP_008454483.1|  PREDICTED: ervatamin-B-like                      70.9    1e-12   
gb|KHN33265.1|  Cysteine proteinase COT44                             68.9    1e-12   
ref|NP_001047923.1|  Os02g0715000                                     71.2    1e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EMT06046.1|  Vignain                                               70.5    1e-12   
ref|XP_002305072.2|  hypothetical protein POPTR_0004s05520g           70.9    1e-12   Populus trichocarpa [western balsam poplar]
gb|EEC84514.1|  hypothetical protein OsI_31214                        70.9    1e-12   Oryza sativa Indica Group [Indian rice]
gb|KGN48503.1|  hypothetical protein Csa_6G490180                     70.9    1e-12   
ref|XP_008340724.1|  PREDICTED: vignain-like                          70.5    1e-12   
ref|XP_006647791.1|  PREDICTED: xylem cysteine proteinase 1-like      70.9    1e-12   
ref|XP_008362418.1|  PREDICTED: vignain-like                          69.3    1e-12   
emb|CAH66275.1|  OSIGBa0147O06.5                                      70.5    1e-12   Oryza sativa [red rice]
ref|XP_008342777.1|  PREDICTED: ervatamin-B-like                      70.5    1e-12   
gb|KCW76128.1|  hypothetical protein EUGRSUZ_D00504                   70.1    1e-12   
ref|XP_010070339.1|  PREDICTED: vignain-like                          68.9    1e-12   
sp|Q7XWK5.2|SAG39_ORYSJ  RecName: Full=Senescence-specific cystei...  70.5    1e-12   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001067630.1|  Os11g0255300                                     70.9    1e-12   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001237379.1|  cysteine proteinase precursor                    70.9    1e-12   
ref|XP_009798777.1|  PREDICTED: oryzain beta chain-like               69.3    1e-12   
ref|XP_008342782.1|  PREDICTED: ervatamin-B-like                      70.5    1e-12   
ref|XP_004306851.1|  PREDICTED: vignain-like                          70.5    1e-12   
ref|XP_009357173.1|  PREDICTED: ervatamin-B-like                      70.5    1e-12   
sp|A2XQE8.1|SAG39_ORYSI  RecName: Full=Senescence-specific cystei...  70.5    1e-12   Oryza sativa Indica Group [Indian rice]
gb|EYU25679.1|  hypothetical protein MIMGU_mgv1a023356mg              70.5    1e-12   
ref|NP_001242660.1|  uncharacterized protein LOC100807362 precursor   70.5    1e-12   
ref|XP_010052200.1|  PREDICTED: ervatamin-B-like                      70.5    1e-12   
gb|KHN04480.1|  Cysteine proteinase RD21a                             70.5    1e-12   
ref|XP_009349242.1|  PREDICTED: vignain-like                          71.2    1e-12   
ref|XP_009354268.1|  PREDICTED: ervatamin-B-like                      70.5    1e-12   
ref|XP_010906196.1|  PREDICTED: senescence-specific cysteine prot...  70.5    2e-12   
gb|EAY80530.1|  hypothetical protein OsI_35710                        70.5    2e-12   
ref|XP_007213554.1|  hypothetical protein PRUPE_ppa018048mg           70.1    2e-12   
gb|AFW86315.1|  hypothetical protein ZEAMMB73_539008                  69.7    2e-12   
ref|XP_007214432.1|  hypothetical protein PRUPE_ppa025658mg           70.1    2e-12   
gb|ABR19827.1|  cysteine proteinase                                   70.9    2e-12   
ref|XP_004252606.1|  PREDICTED: senescence-specific cysteine prot...  70.1    2e-12   
ref|XP_010906541.1|  PREDICTED: oryzain alpha chain-like              70.9    2e-12   
gb|ACU23531.1|  unknown                                               70.5    2e-12   
ref|XP_007132814.1|  hypothetical protein PHAVU_011G126700g           70.1    2e-12   
ref|XP_008228868.1|  PREDICTED: LOW QUALITY PROTEIN: zingipain-2-...  70.1    2e-12   
ref|XP_009769754.1|  PREDICTED: low-temperature-induced cysteine ...  70.9    2e-12   
ref|XP_002306996.2|  XYLEM CYSTEINE PEPTIDASE 2 family protein        70.5    2e-12   
ref|XP_011014387.1|  PREDICTED: senescence-specific cysteine prot...  68.6    2e-12   
gb|KHN08187.1|  Thiol protease SEN102                                 69.7    2e-12   
ref|XP_007132817.1|  hypothetical protein PHAVU_011G127000g           70.1    2e-12   
gb|KCW76141.1|  hypothetical protein EUGRSUZ_D00518                   69.3    2e-12   
ref|XP_011014388.1|  PREDICTED: senescence-specific cysteine prot...  70.1    2e-12   
ref|XP_002890792.1|  hypothetical protein ARALYDRAFT_473117           69.7    2e-12   
ref|XP_006592465.1|  PREDICTED: vignain-like                          69.7    2e-12   
ref|XP_003609015.1|  Cysteine proteinase                              69.7    2e-12   
ref|XP_010052197.1|  PREDICTED: ervatamin-B-like                      70.1    2e-12   
ref|XP_010091715.1|  hypothetical protein L484_001478                 69.7    3e-12   
ref|XP_010054327.1|  PREDICTED: vignain-like                          68.2    3e-12   
gb|KHN28095.1|  Thiol protease                                        69.7    3e-12   
ref|XP_006582267.1|  PREDICTED: thiol protease SEN102-like            69.7    3e-12   
ref|XP_009359957.1|  PREDICTED: ervatamin-B-like                      69.7    3e-12   
gb|KCW70346.1|  hypothetical protein EUGRSUZ_F03589                   68.9    3e-12   
gb|KHN27802.1|  Vignain                                               68.9    3e-12   
gb|KDP21078.1|  hypothetical protein JCGZ_21549                       69.3    3e-12   
ref|XP_008451632.1|  PREDICTED: ervatamin-B-like                      69.7    3e-12   
ref|XP_009365508.1|  PREDICTED: vignain-like                          70.5    3e-12   
gb|EAY87283.1|  hypothetical protein OsI_08685                        69.3    3e-12   
ref|XP_008235821.1|  PREDICTED: xylem cysteine proteinase 1           69.3    4e-12   
ref|XP_008454482.1|  PREDICTED: ervatamin-B-like                      69.3    4e-12   
ref|XP_002971686.1|  hypothetical protein SELMODRAFT_16221            67.8    4e-12   
sp|P12412.1|CYSEP_VIGMU  RecName: Full=Vignain; AltName: Full=Bea...  69.3    4e-12   
ref|XP_008669672.1|  PREDICTED: ervatamin-B-like                      68.6    4e-12   
ref|XP_002436842.1|  hypothetical protein SORBIDRAFT_10g009850        68.6    4e-12   
ref|XP_010052198.1|  PREDICTED: ervatamin-B-like                      69.3    4e-12   
ref|XP_007050023.1|  Cysteine proteinases superfamily protein, pu...  68.9    4e-12   
ref|XP_009631233.1|  PREDICTED: uncharacterized protein LOC104121044  68.6    4e-12   
ref|XP_004252607.1|  PREDICTED: senescence-specific cysteine prot...  68.9    4e-12   
ref|XP_011078435.1|  PREDICTED: senescence-specific cysteine prot...  68.9    5e-12   
ref|XP_004506025.1|  PREDICTED: vignain-like                          68.9    5e-12   
gb|KCW76116.1|  hypothetical protein EUGRSUZ_D00493                   68.9    5e-12   
dbj|BAD29955.1|  cysteine protease                                    69.3    5e-12   
ref|XP_002446135.1|  hypothetical protein SORBIDRAFT_06g002170        68.9    5e-12   
ref|XP_006592475.1|  PREDICTED: vignain-like                          68.9    5e-12   
ref|XP_011041169.1|  PREDICTED: xylem cysteine proteinase 2-like      69.3    5e-12   
gb|KHN33968.1|  Vignain                                               67.4    5e-12   
gb|AAA92063.1|  cysteinyl endopeptidase                               68.9    5e-12   
ref|XP_010052196.1|  PREDICTED: zingipain-2-like                      68.9    5e-12   
gb|KHN27797.1|  Thiol protease SEN102                                 68.6    6e-12   
ref|XP_004150630.1|  PREDICTED: vignain-like                          67.4    6e-12   
ref|XP_004303175.1|  PREDICTED: vignain-like                          68.6    6e-12   
emb|CDP05747.1|  unnamed protein product                              68.6    6e-12   
ref|XP_004290089.1|  PREDICTED: vignain-like                          68.6    6e-12   
ref|XP_003607546.1|  Cysteine proteinase                              68.6    6e-12   
ref|XP_008246197.1|  PREDICTED: vignain-like                          67.8    6e-12   
ref|XP_006857794.1|  hypothetical protein AMTR_s00061p00214890        68.6    6e-12   
ref|XP_003578808.1|  PREDICTED: senescence-specific cysteine prot...  68.6    7e-12   
ref|XP_002523447.1|  cysteine protease, putative                      68.6    7e-12   
ref|XP_002523448.1|  cysteine protease, putative                      68.6    7e-12   
ref|XP_007025415.1|  Senescence-associated gene 12, putative          68.6    7e-12   
ref|XP_007137980.1|  hypothetical protein PHAVU_009G170800g           68.6    7e-12   
ref|XP_010091034.1|  KDEL-tailed cysteine endopeptidase CEP1          68.6    7e-12   
emb|CAA40073.1|  endopeptidase (EP-C1)                                68.6    7e-12   
sp|P25803.2|CYSEP_PHAVU  RecName: Full=Vignain; AltName: Full=Bea...  68.6    7e-12   
ref|XP_004169236.1|  PREDICTED: vignain-like                          67.8    7e-12   
ref|XP_003612210.1|  Cysteine proteinase                              68.6    7e-12   
ref|XP_004297571.1|  PREDICTED: vignain-like                          68.6    7e-12   
emb|CDY58055.1|  BnaA06g40240D                                        68.2    7e-12   
ref|XP_003607571.1|  Cysteine proteinase EP-B                         68.6    8e-12   
ref|XP_007136708.1|  hypothetical protein PHAVU_009G067300g           68.6    8e-12   
ref|XP_008368631.1|  PREDICTED: ervatamin-B-like                      68.6    8e-12   
ref|XP_010928804.1|  PREDICTED: xylem cysteine proteinase 1-like      68.6    8e-12   
ref|XP_007048792.1|  Senescence-associated gene 12                    68.6    8e-12   
ref|XP_009126678.1|  PREDICTED: thiol protease SEN102-like            66.6    8e-12   
ref|XP_007048673.1|  Senescence-associated gene 12, putative          67.8    8e-12   
ref|XP_002510720.1|  cysteine protease, putative                      68.6    8e-12   
ref|XP_008225268.1|  PREDICTED: zingipain-2-like                      68.2    8e-12   
ref|XP_007212585.1|  hypothetical protein PRUPE_ppa015944mg           68.2    8e-12   
gb|EYU37108.1|  hypothetical protein MIMGU_mgv1a019026mg              67.0    8e-12   
dbj|BAG16376.1|  cysteine protease                                    68.2    8e-12   
ref|XP_009101555.1|  PREDICTED: ervatamin-B-like                      68.2    9e-12   
ref|XP_004979206.1|  PREDICTED: vignain-like                          68.6    9e-12   
ref|XP_010054318.1|  PREDICTED: ervatamin-B-like                      68.2    9e-12   
gb|EPS67582.1|  cysteine endopeptidase 1                              66.6    9e-12   
ref|XP_003607548.1|  Cysteine protease                                68.2    1e-11   
gb|AAT34987.1|  putative cysteine protease                            68.2    1e-11   
ref|XP_004306597.1|  PREDICTED: vignain-like                          68.2    1e-11   
ref|XP_008225269.1|  PREDICTED: uncharacterized protein LOC103324934  69.3    1e-11   
ref|XP_003581047.2|  PREDICTED: senescence-specific cysteine prot...  68.2    1e-11   
ref|XP_010103045.1|  KDEL-tailed cysteine endopeptidase CEP1          68.2    1e-11   
gb|KGN65787.1|  hypothetical protein Csa_1G528520                     67.8    1e-11   
gb|ADV74756.1|  cysteine protease                                     68.2    1e-11   
gb|ABR16787.1|  unknown                                               68.2    1e-11   
ref|XP_006663940.1|  PREDICTED: thiol protease SEN102-like            67.8    1e-11   
ref|XP_006857795.1|  hypothetical protein AMTR_s00061p00215070        67.8    1e-11   
emb|CAE03344.2|  OSJNBb0005B05.11                                     67.4    1e-11   
ref|XP_002965654.1|  hypothetical protein SELMODRAFT_230713           67.8    1e-11   
ref|XP_009340788.1|  PREDICTED: xylem cysteine proteinase 1-like      67.8    1e-11   
ref|XP_008228922.1|  PREDICTED: vignain-like                          67.4    1e-11   
gb|AAP32196.1|  cysteine protease 8                                   67.8    1e-11   
gb|AAD55363.1|  cysteine protease                                     65.9    1e-11   
emb|CAL64936.1|  putative cysteine protease 8                         67.8    1e-11   
ref|XP_009400290.1|  PREDICTED: oryzain alpha chain-like              68.2    2e-11   
ref|XP_010058990.1|  PREDICTED: ervatamin-B-like                      66.6    2e-11   
ref|XP_009767259.1|  PREDICTED: xylem cysteine proteinase 1-like      67.8    2e-11   
ref|XP_008244476.1|  PREDICTED: ervatamin-B-like                      67.4    2e-11   
ref|XP_004505502.1|  PREDICTED: vignain-like                          67.4    2e-11   
ref|XP_009354269.1|  PREDICTED: ervatamin-B-like                      67.4    2e-11   
ref|NP_001052232.2|  Os04g0203500                                     67.4    2e-11   
emb|CDM83196.1|  unnamed protein product                              67.8    2e-11   
gb|KHN33962.1|  Vignain                                               67.0    2e-11   
ref|XP_008362421.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...  67.4    2e-11   
ref|NP_956720.1|  cathepsin Sa                                        66.2    2e-11   
emb|CDY25228.1|  BnaC02g30040D                                        68.2    2e-11   
ref|XP_010038688.1|  PREDICTED: ervatamin-B-like                      67.4    2e-11   
ref|XP_008357314.1|  PREDICTED: xylem cysteine proteinase 1-like      67.4    2e-11   
gb|KHN38752.1|  Vignain                                               67.0    2e-11   
ref|XP_004501841.1|  PREDICTED: vignain-like                          67.8    2e-11   
ref|XP_008382503.1|  PREDICTED: xylem cysteine proteinase 1-like      67.4    2e-11   
ref|XP_010501640.1|  PREDICTED: zingipain-2-like                      67.4    2e-11   
ref|XP_003527350.1|  PREDICTED: vignain-like                          67.4    2e-11   
dbj|BAF56428.1|  cysteine proteinase                                  67.4    2e-11   
ref|XP_008342776.1|  PREDICTED: ervatamin-B-like                      67.4    2e-11   
ref|XP_003605890.1|  Cysteine proteinase                              67.4    2e-11   
ref|XP_011100224.1|  PREDICTED: zingipain-2                           67.4    2e-11   
ref|XP_010054324.1|  PREDICTED: ervatamin-B-like                      67.4    2e-11   
ref|XP_008357316.1|  PREDICTED: xylem cysteine proteinase 1-like      67.4    2e-11   
ref|XP_011005485.1|  PREDICTED: senescence-specific cysteine prot...  67.4    2e-11   
ref|XP_010091714.1|  Fruit bromelain                                  68.6    2e-11   
ref|XP_006384060.1|  hypothetical protein POPTR_0004s05510g           67.4    2e-11   
gb|KHN05669.1|  Vignain                                               67.0    2e-11   
ref|XP_007155505.1|  hypothetical protein PHAVU_003G207200g           67.8    2e-11   
ref|XP_004145321.1|  PREDICTED: vignain-like                          65.9    2e-11   
ref|XP_004953685.1|  PREDICTED: xylem cysteine proteinase 1-like      67.4    2e-11   
ref|XP_009407029.1|  PREDICTED: ervatamin-B-like                      67.4    2e-11   
ref|XP_005850783.1|  hypothetical protein CHLNCDRAFT_56822            68.2    2e-11   
gb|AAH66625.1|  Ctssa protein                                         67.0    2e-11   
ref|XP_004298238.1|  PREDICTED: fruit bromelain-like                  66.6    2e-11   
ref|XP_007201382.1|  hypothetical protein PRUPE_ppa007891mg           67.4    2e-11   
ref|XP_005159369.1|  PREDICTED: cathepsin Sa isoform X1               67.0    2e-11   
ref|XP_007050065.1|  Senescence-associated gene 12                    67.4    2e-11   
ref|XP_002525123.1|  cysteine protease, putative                      67.4    2e-11   
ref|XP_008353750.1|  PREDICTED: ervatamin-B-like                      67.4    2e-11   
ref|XP_003559200.1|  PREDICTED: ervatamin-C-like                      67.4    2e-11   
gb|KDP36750.1|  hypothetical protein JCGZ_08041                       67.4    2e-11   
ref|XP_009412837.1|  PREDICTED: vignain-like                          67.8    2e-11   
gb|AAU81592.1|  cysteine proteinase                                   65.5    2e-11   
prf||1910332A  Cys endopeptidase                                      67.4    2e-11
ref|XP_003608898.1|  Cysteine proteinase                              65.9    2e-11   
ref|XP_007132861.1|  hypothetical protein PHAVU_011G130900g           67.0    2e-11   
ref|XP_003527349.1|  PREDICTED: vignain-like                          67.0    2e-11   
ref|XP_003526229.1|  PREDICTED: vignain-like                          66.2    2e-11   
ref|XP_002321655.1|  hypothetical protein POPTR_0015s09900g           67.4    2e-11   
ref|XP_004487578.1|  PREDICTED: vignain-like isoform X2               67.0    2e-11   
ref|XP_010052201.1|  PREDICTED: ervatamin-B-like                      67.0    2e-11   
ref|XP_003556992.1|  PREDICTED: vignain-like                          67.0    2e-11   
ref|XP_009354321.1|  PREDICTED: ervatamin-B-like                      67.4    2e-11   
ref|NP_001237199.1|  cysteine proteinase precursor                    67.4    2e-11   
gb|KHN07963.1|  Vignain                                               66.2    2e-11   
gb|AAP32197.1|  cysteine protease 10                                  66.2    2e-11   
ref|XP_010063152.1|  PREDICTED: xylem cysteine proteinase 2           67.0    2e-11   
ref|XP_004971418.1|  PREDICTED: xylem cysteine proteinase 2-like      67.0    2e-11   
ref|XP_002525124.1|  cysteine protease, putative                      67.0    2e-11   
ref|XP_002450949.1|  hypothetical protein SORBIDRAFT_05g021550        67.4    3e-11   
sp|P60994.1|ERVB_TABDI  RecName: Full=Ervatamin-B; Short=ERV-B        65.5    3e-11   
ref|XP_003607574.1|  Cysteine protease                                67.0    3e-11   
gb|KCW74062.1|  hypothetical protein EUGRSUZ_E02690                   66.6    3e-11   
gb|KCW76118.1|  hypothetical protein EUGRSUZ_D00495                   67.0    3e-11   
gb|KHN05670.1|  Vignain                                               66.2    3e-11   
ref|XP_007048674.1|  Senescence-associated gene 12                    67.0    3e-11   
ref|XP_009149742.1|  PREDICTED: zingipain-2-like                      67.0    3e-11   
ref|XP_009385160.1|  PREDICTED: vignain-like                          67.0    3e-11   
dbj|BAF56430.1|  cysteine proteinase                                  67.0    3e-11   
ref|XP_004487577.1|  PREDICTED: vignain-like isoform X1               66.6    3e-11   
ref|XP_006857796.1|  hypothetical protein AMTR_s00061p00215230        66.6    3e-11   
emb|CDY67777.1|  BnaUnng02560D                                        66.2    3e-11   
ref|XP_003578813.1|  PREDICTED: senescence-specific cysteine prot...  66.6    3e-11   
emb|CAA49836.1|  thiol protease                                       63.9    3e-11   
dbj|BAF46311.1|  cysteine proteinase precursor                        66.6    3e-11   
gb|KDP31986.1|  hypothetical protein JCGZ_12447                       67.0    3e-11   
gb|AEV41119.1|  putative cysteine protease                            67.4    3e-11   
ref|XP_004297572.1|  PREDICTED: vignain-like                          66.6    4e-11   
gb|KEH31736.1|  KDEL-tailed cysteine endopeptidase CEP1               66.6    4e-11   
gb|KHN07749.1|  Vignain                                               66.2    4e-11   
ref|XP_008799257.1|  PREDICTED: xylem cysteine proteinase 1-like      66.6    4e-11   
ref|XP_010239696.1|  PREDICTED: senescence-specific cysteine prot...  66.6    4e-11   
ref|XP_009390984.1|  PREDICTED: oryzain alpha chain-like              67.4    4e-11   
ref|XP_003578815.1|  PREDICTED: senescence-specific cysteine prot...  66.6    4e-11   
gb|AEV41073.1|  putative cysteine protease                            67.4    4e-11   
emb|CDY05926.1|  BnaC08g21030D                                        66.6    4e-11   
gb|ABQ10191.1|  actinidin Act1c                                       66.6    4e-11   
ref|XP_003596314.1|  Cysteine proteinase                              66.6    4e-11   
ref|XP_001745088.1|  hypothetical protein                             65.9    4e-11   
emb|CBI21941.3|  unnamed protein product                              66.6    4e-11   
ref|XP_010441658.1|  PREDICTED: senescence-specific cysteine prot...  66.6    4e-11   
emb|CDY08128.1|  BnaA06g15980D                                        66.2    4e-11   
ref|XP_002275891.1|  PREDICTED: zingipain-2                           66.6    4e-11   
gb|ACY38051.3|  cysteine proteinase C1A                               66.6    4e-11   
dbj|BAF46304.1|  cysteine proteinase precursor                        67.0    4e-11   
emb|CBI21977.3|  unnamed protein product                              65.9    4e-11   
ref|XP_010655789.1|  PREDICTED: senescence-specific cysteine prot...  63.9    4e-11   
gb|EMT15489.1|  Thiol protease SEN102                                 66.2    4e-11   
ref|XP_004505498.1|  PREDICTED: vignain-like                          66.2    4e-11   
ref|XP_004963863.1|  PREDICTED: cysteine proteinase EP-B 2-like       66.2    5e-11   
ref|XP_009341503.1|  PREDICTED: xylem cysteine proteinase 1-like      66.2    5e-11   
ref|XP_009333784.1|  PREDICTED: xylem cysteine proteinase 1-like      66.2    5e-11   
gb|EMT15476.1|  Cysteine proteinase EP-B 2                            66.6    5e-11   
ref|XP_003589134.1|  Cysteine proteinase                              65.9    5e-11   
ref|XP_010481519.1|  PREDICTED: senescence-specific cysteine prot...  66.2    5e-11   
ref|XP_009420878.1|  PREDICTED: vignain-like                          66.2    5e-11   
pir||S02729  actinidain (EC 3.4.22.14) precursor (clone pAC.7) - ...  64.3    5e-11
ref|XP_004515849.1|  PREDICTED: vignain-like                          66.2    5e-11   
ref|XP_010494742.1|  PREDICTED: senescence-specific cysteine prot...  66.2    5e-11   
ref|XP_006844723.1|  hypothetical protein AMTR_s00016p00253110        66.2    5e-11   
ref|XP_006653861.1|  PREDICTED: cysteine protease 1-like              66.6    5e-11   
ref|XP_004505522.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  66.2    6e-11   



>ref|XP_008800119.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP2-like [Phoenix 
dactylifera]
Length=129

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG + + F +++ NRG+TTE NYPY    G C  +K++   A IKG+  VPA +EAA
Sbjct  31   GCDGGLMDNAFKFIINNRGLTTETNYPYKGIDGTCNSKKSASHVASIKGYEDVPANSEAA  90

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  91   LLKAVANQP  99



>emb|CDP18641.1| unnamed protein product [Coffea canephora]
Length=338

 Score = 82.0 bits (201),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG +   F +++ N+G+TTE NYPY    G C   K ++ AAKI GF  VPA NEAA
Sbjct  183  GCNGGLMDDAFTFIINNKGLTTEANYPYQAVDGTCNTNKEAKPAAKITGFEDVPANNEAA  242

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  243  LLKAVANQP  251



>gb|ADP02216.1| Peptidase_C1 domain-containing protein [Triticum aestivum]
Length=195

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE NYPYT + G CK   AS + A IKG+  VPA +E++
Sbjct  115  GCEGGEMDDAFKFIIKNGGLTTEANYPYTAQDGQCKTSIASNSVATIKGYEDVPANDESS  174

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  175  LMKAVANQP  183



>ref|XP_010277773.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Nelumbo 
nucifera]
Length=345

 Score = 80.1 bits (196),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG++ + F ++  N G+TTE NYPY    G C +RK++ +AAKI G+  VPA NE A
Sbjct  190  GCEGGFMDNAFQFIQHNGGLTTEANYPYKQTDGTCDKRKSALSAAKISGYEDVPANNEVA  249

Query  181  LTKAVANQP  207
            L KAV+NQP
Sbjct  250  LLKAVSNQP  258



>ref|XP_002522559.1| cysteine protease, putative [Ricinus communis]
 gb|EEF39859.1| cysteine protease, putative [Ricinus communis]
Length=344

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 38/69 (55%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE NYPY    G C  RKA+  AAKI G+  VPAY+E A
Sbjct  189  GCEGGLMDDAFEFIIENNGLTTEANYPYEGVDGSCNTRKAANHAAKITGYENVPAYDEEA  248

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  249  LRKAVANQP  257



>emb|CDP18640.1| unnamed protein product [Coffea canephora]
Length=254

 Score = 79.0 bits (193),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG +   F +++ N G+TTE NYPY    G C   K + +AAKI G+  VPA NEAA
Sbjct  101  GCNGGLMDDAFTFIIKNNGLTTEANYPYQAVDGTCNTNKEASSAAKITGYEDVPANNEAA  160

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  161  LLKAVANQP  169



>ref|XP_008780817.1| PREDICTED: vignain-like, partial [Phoenix dactylifera]
Length=163

 Score = 78.2 bits (191),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG I   F ++L N G+TTE NYPY    G C  +KAS +A+ +  +  VPA +E+A
Sbjct  12   GCNGGLIDDAFQFILDNGGLTTESNYPYKASDGTCNTKKASSSASTVSDYEDVPANSESA  71

Query  181  LTKAVANQP  207
            L K VANQP
Sbjct  72   LLKVVANQP  80



>ref|XP_008780365.1| PREDICTED: vignain-like [Phoenix dactylifera]
Length=186

 Score = 78.2 bits (191),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG + + F +++ N G+TTE NYPY    G C  +K++  AA IKG+  VPA +EAA
Sbjct  31   GCDGGLMDNAFKFIINNHGLTTETNYPYKGIDGTCNSKKSASHAASIKGYEDVPANSEAA  90

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  91   LLKAVANQP  99



>ref|XP_010912725.1| PREDICTED: zingipain-2-like [Elaeis guineensis]
Length=337

 Score = 79.3 bits (194),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GCHGG++   F YV+ N GITTEENYPY    G C   KAS +AA I G++ VP  +E++
Sbjct  182  GCHGGFMTRAFQYVIDNGGITTEENYPYMAADGTCDTNKASSSAATISGYQNVPVNDESS  241

Query  181  LTKAVANQP  207
            L +AV+ QP
Sbjct  242  LLQAVSKQP  250



>ref|XP_011014442.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=360

 Score = 79.3 bits (194),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG +   F ++  N+G+TTE NYPY    G C  +KA+  AAKI GF +VPA +EAA
Sbjct  206  GCNGGLMDDAFKFIEQNKGLTTEANYPYKGTDGTCNTKKATNHAAKITGFEYVPANSEAA  265

Query  181  LTKAVANQP  207
            L KAVA QP
Sbjct  266  LMKAVAEQP  274



>ref|XP_008779585.1| PREDICTED: zingipain-2-like [Phoenix dactylifera]
Length=326

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GCHGG++   F YV+ N GITTE NYPY    G C   +AS +AA I G+  VPA +E++
Sbjct  171  GCHGGFMTGAFQYVINNGGITTENNYPYRANDGTCDTNRASSSAATIGGYESVPANDESS  230

Query  181  LTKAVANQP  207
            L +AV NQP
Sbjct  231  LLQAVTNQP  239



>ref|XP_002280204.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F ++  N G+TTE NYPY    G C R+KA+  AAKI G+  VPA NE A
Sbjct  186  GCSGGLMDDAFKFIEQNHGLTTEANYPYAGTDGTCNRKKAAHPAAKINGYEDVPANNEKA  245

Query  181  LTKAVANQP  207
            L KAVA+QP
Sbjct  246  LQKAVAHQP  254



>gb|AGT97048.1| senescence-specific cysteine protease [Capsicum annuum]
Length=347

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG + + F +++ N+G+TTE NYPY    G C ++K++ +AAKI G+  VPA NE A
Sbjct  192  GCSGGLLDTAFKFIMKNKGLTTEANYPYEGADGVCNKKKSAVSAAKITGYEDVPANNEKA  251

Query  181  LTKAVANQP  207
            L +AVANQP
Sbjct  252  LLQAVANQP  260



>ref|XP_008779806.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=326

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F YV+ N GITTE+NYPY    G C   +AS +AA I G+  VPA +E++
Sbjct  171  GCDGGLMTRAFQYVIDNGGITTEDNYPYKAADGTCDTNRASSSAATISGYETVPANDESS  230

Query  181  LTKAVANQP  207
            L +AVANQP
Sbjct  231  LLQAVANQP  239



>ref|XP_004975184.1| PREDICTED: vignain-like [Setaria italica]
Length=340

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 38/69 (55%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG + + F +++ N G+TTE NYPYT   G C   KAS  AA IKG+  VPA +EA+
Sbjct  185  GCEGGEMDNAFEFIIDNGGLTTESNYPYTASDGTCNSNKASNDAASIKGYEDVPANDEAS  244

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  245  LRKAVANQP  253



>emb|CAN64655.1| hypothetical protein VITISV_005140 [Vitis vinifera]
Length=341

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F ++  N G+TTE NYPY    G C R+KA+  AAKI G+  VPA NE A
Sbjct  186  GCSGGLMDDAFKFIEQNHGLTTEANYPYAGTDGTCNRKKAAHPAAKINGYEDVPANNEKA  245

Query  181  LTKAVANQP  207
            L KAVA+QP
Sbjct  246  LQKAVAHQP  254



>ref|XP_006449486.1| hypothetical protein CICLE_v10018236mg [Citrus clementina]
 gb|ESR62726.1| hypothetical protein CICLE_v10018236mg [Citrus clementina]
Length=312

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N+G+ TE  YPY    G C +++A+ +AAKI G+  VP+ NEAA
Sbjct  157  GCEGGLMDDAFEFIINNKGLATEAKYPYKASDGSCNKKEANPSAAKISGYEDVPSNNEAA  216

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  217  LMKAVANQP  225



>ref|XP_006376349.1| hypothetical protein POPTR_0013s12260g [Populus trichocarpa]
 gb|ERP54146.1| hypothetical protein POPTR_0013s12260g [Populus trichocarpa]
Length=342

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +  GF +++ N GITTE NYPY    G C  RK +   AKI G+  VPA +EAA
Sbjct  187  GCEGGLMEDGFEFIIKNHGITTEANYPYQAADGTCNSRKEASRIAKITGYESVPANSEAA  246

Query  181  LTKAVANQP  207
            L KAVA+QP
Sbjct  247  LLKAVASQP  255



>ref|XP_006467666.1| PREDICTED: vignain-like [Citrus sinensis]
 gb|KDO77831.1| hypothetical protein CISIN_1g042468mg [Citrus sinensis]
Length=346

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N+G+ TE  YPY    G C +++A+ +AAKI G+  VP+ NEAA
Sbjct  191  GCEGGLMDDAFEFIISNKGLATEAKYPYKASDGSCNKKEANPSAAKISGYEDVPSNNEAA  250

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  251  LMKAVANQP  259



>ref|XP_011086004.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG + + F +++ N GITTE NYPY    G C  +K S +AAKI G+  VPA +E A
Sbjct  186  GCNGGLMDNAFEFIISNGGITTESNYPYEGVDGTCNTKKESSSAAKITGYEDVPANSEPA  245

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  246  LLKAVANQP  254



>ref|XP_006857797.1| hypothetical protein AMTR_s00061p00215400 [Amborella trichopoda]
 gb|ERN19264.1| hypothetical protein AMTR_s00061p00215400 [Amborella trichopoda]
Length=347

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG++   F +++ N G+TTE  YPY    G C  +KAS  AAKI G+  VP  NE A
Sbjct  192  GCNGGFMDDAFEFIINNHGLTTEAKYPYKAVDGTCNTKKASSGAAKITGYEDVPTNNEKA  251

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  252  LVKAVANQP  260



>emb|CDP18645.1| unnamed protein product [Coffea canephora]
Length=337

 Score = 77.8 bits (190),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG +   F +++ N+GI +E  YPYT   G C + K +  AAKI G+  VPA NEAA
Sbjct  182  GCNGGEMEDAFAFIVKNKGIASEATYPYTAADGTCSKTKEASHAAKIAGYEKVPANNEAA  241

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  242  LLKAVANQP  250



>ref|XP_004233054.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=351

 Score = 77.8 bits (190),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG + + F +++ N+G+TTE NYPY    G C ++K++ + AKI G+  VPA NE A
Sbjct  196  GCTGGLLDTAFQFIIKNKGLTTEANYPYQAADGVCNKKKSALSVAKITGYEDVPANNEKA  255

Query  181  LTKAVANQP  207
            L +AVANQP
Sbjct  256  LLQAVANQP  264



>ref|XP_011038210.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +  GF +++ N GIT+E NYPY    G C  +K +   AKI G+  VPA +EAA
Sbjct  187  GCEGGLMEDGFEFIIKNHGITSEANYPYQAADGTCNSKKEASHIAKITGYESVPANSEAA  246

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  247  LLKAVANQP  255



>ref|XP_002280230.2| PREDICTED: LOW QUALITY PROTEIN: senescence-specific cysteine 
protease SAG39 [Vitis vinifera]
Length=341

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG +   F ++  N G+TTE NYPY    G C R+KA+  AAKI G+  VPA NE A
Sbjct  186  GCNGGLMDDAFKFIKQNHGLTTEANYPYAGTDGTCNRKKAAHPAAKINGYEDVPANNEKA  245

Query  181  LTKAVANQP  207
            L KAV +QP
Sbjct  246  LQKAVVHQP  254



>ref|XP_006362420.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=347

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG + + F +++ N+G+TTE NYPY    G C ++K++ + AKI G+  VPA NE A
Sbjct  192  GCTGGLLDTAFQFIIKNKGLTTEANYPYEAADGVCNKKKSAVSVAKITGYEDVPANNEKA  251

Query  181  LTKAVANQP  207
            L +AVANQP
Sbjct  252  LLQAVANQP  260



>ref|XP_009759551.1| PREDICTED: zingipain-2-like [Nicotiana sylvestris]
Length=349

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG + + F ++L N+G+TTE NYPY  + G C ++K++ +AAKI G+  VPA +E A
Sbjct  194  GCSGGLLDTAFDFILKNKGLTTEANYPYKGEDGVCNKKKSALSAAKIAGYEDVPANSEKA  253

Query  181  LTKAVANQP  207
            L +AVANQP
Sbjct  254  LLQAVANQP  262



>gb|ADV41672.1| cysteine protease [Nicotiana tabacum]
Length=349

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG + + F ++L N+G+TTE NYPY  + G C ++K++ +AAKI G+  VPA +E A
Sbjct  194  GCSGGLLDTAFDFILKNKGLTTEANYPYKGEDGVCNKKKSALSAAKIAGYEDVPANSEKA  253

Query  181  LTKAVANQP  207
            L +AVANQP
Sbjct  254  LLQAVANQP  262



>ref|XP_009608954.1| PREDICTED: zingipain-2-like [Nicotiana tomentosiformis]
Length=349

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG + + F ++L N+G+TTE NYPY  + G C ++K++ +AAKI G+  VPA +E A
Sbjct  194  GCSGGLLDTAFDFILKNKGLTTEVNYPYKGEDGVCNKKKSALSAAKITGYEDVPANSEKA  253

Query  181  LTKAVANQP  207
            L +AVANQP
Sbjct  254  LLQAVANQP  262



>gb|AAW78661.2| senescence-specific cysteine protease [Nicotiana tabacum]
Length=349

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG + + F ++L N+G+TTE NYPY  + G C ++K++ +AAKI G+  VPA +E A
Sbjct  194  GCSGGLLDTAFDFILKNKGLTTEVNYPYKGEDGVCNKKKSALSAAKITGYEDVPANSEKA  253

Query  181  LTKAVANQP  207
            L +AVANQP
Sbjct  254  LLQAVANQP  262



>ref|XP_011021998.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=339

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG +   F ++  N+G+TTE NYPYT   G C  +K +  AAKI GF  VPA +EAA
Sbjct  185  GCNGGLMDDAFKFIEQNKGLTTEANYPYTGTDGTCNTQKEANHAAKITGFEDVPANSEAA  244

Query  181  LTKAVANQP  207
            L KAVA QP
Sbjct  245  LIKAVAKQP  253



>ref|XP_011022002.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=365

 Score = 77.8 bits (190),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG +   F ++  N+G+TTE NYPYT   G C  +K +  AAKI GF  VPA +EAA
Sbjct  211  GCNGGLMDDAFKFIEQNKGLTTEANYPYTGTDGTCNTQKEANHAAKITGFEDVPANSEAA  270

Query  181  LTKAVANQP  207
            L KAVA QP
Sbjct  271  LIKAVAKQP  279



>ref|XP_002307151.2| hypothetical protein POPTR_0005s09140g, partial [Populus trichocarpa]
 gb|EEE94147.2| hypothetical protein POPTR_0005s09140g, partial [Populus trichocarpa]
Length=309

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG +   F ++  N+G+TTE NYPYT   G C  +K    AAKI GF+ VPA +EAA
Sbjct  155  GCNGGLMDDAFKFIEQNKGLTTEANYPYTGTDGTCNTQKEVSHAAKITGFQDVPANSEAA  214

Query  181  LTKAVANQP  207
            L KAVA QP
Sbjct  215  LMKAVAKQP  223



>ref|XP_002306369.1| hypothetical protein POPTR_0005s09080g [Populus trichocarpa]
 gb|EEE93365.1| hypothetical protein POPTR_0005s09080g [Populus trichocarpa]
Length=340

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG +   F ++  N+G+TTE NYPYT   G C  +K +  AAKI GF  VPA +EAA
Sbjct  186  GCNGGLMDDAFKFIEQNKGLTTEANYPYTGTDGTCNTQKEATHAAKITGFEDVPANSEAA  245

Query  181  LTKAVANQP  207
            L KAVA QP
Sbjct  246  LMKAVAKQP  254



>ref|XP_007025398.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOY28020.1| Senescence-associated gene 12 [Theobroma cacao]
Length=338

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG++ + F +++ N+G+TTE NYPY    G C ++KA+  AA+I  F  VP+ +EAA
Sbjct  183  GCNGGFMDNAFEFIISNKGLTTESNYPYEGVDGSCNKKKAANHAAQITSFEDVPSNSEAA  242

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  243  LLKAVANQP  251



>ref|XP_004975182.1| PREDICTED: vignain-like [Setaria italica]
Length=338

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 40/69 (58%), Positives = 46/69 (67%), Gaps = 2/69 (3%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GGW+ S F +V+ N G+TTE NYPY    G CK    S++AA IKG   VP  NEAA
Sbjct  185  GCEGGWMDSAFEFVIKNGGLTTESNYPYKAVDGKCK--GGSKSAATIKGHEDVPVNNEAA  242

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  243  LMKAVANQP  251



>ref|XP_002280215.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG +   F ++  N G+ TE NYPY    G C R+KA+  AAKI G+  VPA NE A
Sbjct  186  GCNGGLMDDAFKFIEQNHGLATEANYPYAGTDGTCNRKKAAHPAAKINGYEDVPANNEKA  245

Query  181  LTKAVANQP  207
            L KAVA+QP
Sbjct  246  LQKAVAHQP  254



>ref|XP_004975183.1| PREDICTED: vignain-like [Setaria italica]
Length=338

 Score = 77.0 bits (188),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 40/69 (58%), Positives = 46/69 (67%), Gaps = 2/69 (3%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GGW+ S F +V+ N G+TTE NYPY    G CK    S++AA IKG   VP  NEAA
Sbjct  185  GCEGGWMDSAFEFVIKNGGLTTESNYPYKAVDGKCK--GGSKSAATIKGHEDVPVNNEAA  242

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  243  LMKAVANQP  251



>ref|XP_011009172.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=340

 Score = 77.0 bits (188),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG +   F ++  N+G+TTE NYPY    G C  +KA+  AAKI GF  VPA +EAA
Sbjct  186  GCNGGLMDDAFKFIEKNKGLTTEANYPYKGTHGTCNTKKAANHAAKITGFEDVPANSEAA  245

Query  181  LTKAVANQP  207
            L KAVA QP
Sbjct  246  LMKAVAKQP  254



>emb|CDP18637.1| unnamed protein product [Coffea canephora]
Length=243

 Score = 76.3 bits (186),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG +   F +++ N G+TTE NYPY    G C   K +  AAKI G+  VPA NEAA
Sbjct  88   GCNGGLMDDAFTFIINNNGLTTEANYPYQAVDGTCNSNKEANHAAKITGYEDVPANNEAA  147

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  148  LLKAVANQP  156



>ref|XP_006446763.1| hypothetical protein CICLE_v10017432mg [Citrus clementina]
 gb|ESR60003.1| hypothetical protein CICLE_v10017432mg [Citrus clementina]
Length=343

 Score = 77.0 bits (188),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N GITTE NYPY    G C + K +   AKIKG+  VPA +E A
Sbjct  188  GCEGGEMEDAFKFIIHNDGITTEANYPYQAADGTCNKTKEASHVAKIKGYETVPANSEEA  247

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  248  LLKAVANQP  256



>ref|XP_010045986.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW84688.1| hypothetical protein EUGRSUZ_B01505 [Eucalyptus grandis]
Length=342

 Score = 77.0 bits (188),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG++ + F +++ N G+TTE NYPY    G C  RK + +AAKI G+  VPA +E+A
Sbjct  187  GCEGGFMDNAFEFIIGNHGLTTETNYPYQAVDGTCNARKEASSAAKITGYEDVPANSESA  246

Query  181  LTKAVANQP  207
            L KAVA+QP
Sbjct  247  LLKAVAHQP  255



>ref|XP_008811650.1| PREDICTED: vignain-like [Phoenix dactylifera]
Length=302

 Score = 76.3 bits (186),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG + + F +++ NRG+TTE NYPY    G C  +K++   A IKG+  VPA +EAA
Sbjct  187  GCDGGLMDNAFKFIINNRGLTTETNYPYKGIDGTCNSKKSASHVASIKGYEDVPANSEAA  246

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  247  LLKAVANQP  255



>gb|KDP23983.1| hypothetical protein JCGZ_25371 [Jatropha curcas]
Length=340

 Score = 77.0 bits (188),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F ++  N+G+TTE NYPY    G C  +K +  AAKI G+  VPA NEAA
Sbjct  186  GCQGGLMDDAFKFIENNQGLTTEANYPYVGSDGTCNTKKEANHAAKITGYEDVPANNEAA  245

Query  181  LTKAVANQP  207
            L KAV NQP
Sbjct  246  LLKAVTNQP  254



>ref|NP_001176897.1| Os12g0273900 [Oryza sativa Japonica Group]
 dbj|BAH95625.1| Os12g0273900 [Oryza sativa Japonica Group]
Length=184

 Score = 75.5 bits (184),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG I   F ++L N G+T E NYPYT + G CK   A+  AA I+G+  VPA +E +
Sbjct  31   GCEGGEIDGAFQFILSNGGLTAEANYPYTAEDGRCKTTAAADVAASIRGYEDVPANDEPS  90

Query  181  LTKAVANQP  207
            L KAVA QP
Sbjct  91   LMKAVAGQP  99



>ref|XP_009601308.1| PREDICTED: ervatamin-B-like isoform X3 [Nicotiana tomentosiformis]
Length=323

 Score = 76.6 bits (187),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F Y++ N G+TTE NYPY    G CK  K S+ AAKI G++ VPA +E+A
Sbjct  168  GCQGGLMDYAFKYIIKNHGLTTESNYPYEGIDGTCKTGKKSKHAAKITGYKDVPANSESA  227

Query  181  LTKAVANQP  207
            L KAVA+QP
Sbjct  228  LQKAVAHQP  236



>ref|XP_009601307.1| PREDICTED: ervatamin-B-like isoform X2 [Nicotiana tomentosiformis]
Length=331

 Score = 76.6 bits (187),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F Y++ N G+TTE NYPY    G CK  K S+ AAKI G++ VPA +E+A
Sbjct  176  GCQGGLMDYAFKYIIKNHGLTTESNYPYEGIDGTCKTGKKSKHAAKITGYKDVPANSESA  235

Query  181  LTKAVANQP  207
            L KAVA+QP
Sbjct  236  LQKAVAHQP  244



>emb|CAN70559.1| hypothetical protein VITISV_032465 [Vitis vinifera]
Length=341

 Score = 76.6 bits (187),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F ++  N G+TTE NYPY    G C R+KA+  AAKI G+  VPA NE A
Sbjct  186  GCSGGLMDDAFKFIEQNHGLTTEANYPYAGTDGTCNRKKAAHPAAKINGYEDVPANNEKA  245

Query  181  LTKAVANQP  207
            L KAVA+QP
Sbjct  246  LQKAVAHQP  254



>gb|ADP02218.1| Peptidase_C1 domain-containing protein [Triticum aestivum]
 gb|EMT08021.1| Vignain [Aegilops tauschii]
Length=341

 Score = 76.6 bits (187),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE NYPYT + G CK   AS + A IKG+  VPA +E++
Sbjct  186  GCEGGEMDDAFKFIIKNGGLTTEANYPYTAQDGQCKTSIASNSVATIKGYEDVPANDESS  245

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  246  LMKAVANQP  254



>ref|XP_011086001.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score = 76.6 bits (187),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG + + F +++ N GITTE NYPY    G C  +K S   AKI G+  VPA +E+A
Sbjct  186  GCNGGLMDNAFEFIISNGGITTESNYPYEGVDGTCNSKKESSHVAKITGYEDVPANSESA  245

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  246  LLKAVANQP  254



>ref|XP_002280246.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score = 76.6 bits (187),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F ++  N G+TTE NYPY    G C R+KA+  AAKI G+  VPA NE A
Sbjct  186  GCSGGLMDDAFKFIEQNHGLTTEANYPYAGTDGTCNRKKAAHPAAKINGYEDVPANNEKA  245

Query  181  LTKAVANQP  207
            L KAVA+QP
Sbjct  246  LQKAVAHQP  254



>gb|ADP02219.1| Peptidase_C1 domain-containing protein [Triticum aestivum]
Length=419

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG + + F +++ N G+TTE NYPYT + G CK    S + A IKG+  VPA +E++
Sbjct  186  GCEGGEMDNAFKFIIKNGGLTTEANYPYTAQDGQCKTSTTSNSVATIKGYEDVPANDESS  245

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  246  LMKAVANQP  254



>gb|KCW76137.1| hypothetical protein EUGRSUZ_D00513 [Eucalyptus grandis]
Length=328

 Score = 76.3 bits (186),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG++ + F +++ N G+TTE+NYPY   +G C   +A   AAKI G+  VP+ +E+A
Sbjct  173  GCAGGFVNAAFKFIIDNDGLTTEDNYPYEAVKGTCDAGQAESPAAKITGYEDVPSNSESA  232

Query  181  LTKAVANQP  207
            L++AVANQP
Sbjct  233  LSQAVANQP  241



>ref|XP_003540013.1| PREDICTED: vignain-like [Glycine max]
 ref|XP_003540014.1| PREDICTED: vignain-like [Glycine max]
 gb|KHN27798.1| Vignain [Glycine soja]
 gb|KHN27800.1| Vignain [Glycine soja]
Length=337

 Score = 76.3 bits (186),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG++  GF +++ N GI++E NYPYT   G C   K +  AA+IKG+  VPA +E A
Sbjct  182  GCDGGYMEGGFEFIIKNGGISSEANYPYTAVDGTCDANKEASPAAQIKGYETVPANSEDA  241

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  242  LQKAVANQP  250



>ref|XP_009601306.1| PREDICTED: ervatamin-B-like isoform X1 [Nicotiana tomentosiformis]
Length=341

 Score = 76.3 bits (186),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F Y++ N G+TTE NYPY    G CK  K S+ AAKI G++ VPA +E+A
Sbjct  186  GCQGGLMDYAFKYIIKNHGLTTESNYPYEGIDGTCKTGKKSKHAAKITGYKDVPANSESA  245

Query  181  LTKAVANQP  207
            L KAVA+QP
Sbjct  246  LQKAVAHQP  254



>gb|KHN12137.1| Thiol protease [Glycine soja]
Length=341

 Score = 76.3 bits (186),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG++  GF +++ N GIT+E NYPY    G C    A+   A+IKG+  VP+Y+E A
Sbjct  187  GCEGGFMEDGFEFIIKNGGITSETNYPYKGVDGTCNTTIAASPVAQIKGYEIVPSYSEEA  246

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  247  LQKAVANQP  255



>ref|XP_010052206.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=342

 Score = 76.3 bits (186),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG++ + F +++ N G+TTE+NYPY   +G C   +A   AAKI G+  VP+ +E+A
Sbjct  187  GCAGGFVNAAFKFIIDNDGLTTEDNYPYEAVKGTCDAGQAESPAAKITGYEDVPSNSESA  246

Query  181  LTKAVANQP  207
            L++AVANQP
Sbjct  247  LSQAVANQP  255



>ref|XP_002446132.1| hypothetical protein SORBIDRAFT_06g002150 [Sorghum bicolor]
 gb|EES10460.1| hypothetical protein SORBIDRAFT_06g002150 [Sorghum bicolor]
Length=337

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GGW+ S F +V+ N G+ TE NYPY    G CK    S++AA IKG   VP  NEAA
Sbjct  184  GCEGGWMDSAFEFVIKNGGLATESNYPYKAVDGKCK--GGSKSAATIKGHEDVPVNNEAA  241

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  242  LMKAVANQP  250



>ref|XP_010054322.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76126.1| hypothetical protein EUGRSUZ_D00502 [Eucalyptus grandis]
Length=345

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG + S F +++ N G+TTE NYPY   +G C   KA+  AA I G++ VPA NE A
Sbjct  188  GCIGGLMDSAFEFIVSNGGLTTEANYPYQENKGTCNTAKAANPAASITGYKDVPANNEKA  247

Query  181  LTKAVANQP  207
            L +AVANQP
Sbjct  248  LLQAVANQP  256



>ref|XP_009604790.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP2-like, partial 
[Nicotiana tomentosiformis]
Length=187

 Score = 74.7 bits (182),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE NYPY    G CK  K S    KI G+  VPA +E+A
Sbjct  111  GCEGGLMDDAFAFIIKNHGLTTESNYPYEGTDGTCKTGKESNHVVKITGYEDVPANSESA  170

Query  181  LTKAVANQP  207
            L  AVANQP
Sbjct  171  LLSAVANQP  179



>gb|EMT08019.1| Vignain [Aegilops tauschii]
Length=309

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE NYPYT + G CK   AS + A IKG+  VPA +E++
Sbjct  154  GCEGGEMDDAFKFIIKNGGLTTEANYPYTAQDGQCKTSIASNSVATIKGYEDVPANDESS  213

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  214  LMKAVANQP  222



>ref|XP_006388351.1| hypothetical protein POPTR_0213s00200g, partial [Populus trichocarpa]
 ref|XP_006388355.1| hypothetical protein POPTR_0213s00230g, partial [Populus trichocarpa]
 gb|ERP47265.1| hypothetical protein POPTR_0213s00200g, partial [Populus trichocarpa]
 gb|ERP47269.1| hypothetical protein POPTR_0213s00230g, partial [Populus trichocarpa]
Length=194

 Score = 74.7 bits (182),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GCHGG + + F Y++ N G+T+E+NYPY    G C   KA+  AA+I G   VP  NE A
Sbjct  39   GCHGGLMDTAFQYIIRNEGLTSEDNYPYQGVDGTCSSEKAASIAAEITGDEDVPKNNENA  98

Query  181  LTKAVANQP  207
            L +AVA QP
Sbjct  99   LLQAVAKQP  107



>ref|XP_006384061.1| hypothetical protein POPTR_0004s05530g [Populus trichocarpa]
 gb|ERP61858.1| hypothetical protein POPTR_0004s05530g [Populus trichocarpa]
Length=197

 Score = 74.7 bits (182),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GCHGG + + F Y++ N G+T+E+NYPY    G C   KA+  AA+I G   VP  NE A
Sbjct  42   GCHGGLMDTAFQYIIRNEGLTSEDNYPYQGVDGTCSSEKATSIAAEITGDENVPKNNENA  101

Query  181  LTKAVANQP  207
            L +AVA QP
Sbjct  102  LLQAVAKQP  110



>gb|KHN27806.1| Vignain [Glycine soja]
Length=313

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG++  GF +++ N GI++E NYPYT   G C   K +  AA+IKG+  VPA +E A
Sbjct  158  GCDGGYMEGGFEFIIKNGGISSEANYPYTAVDGTCDANKEASPAAQIKGYETVPANSEDA  217

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  218  LQKAVANQP  226



>ref|XP_011038211.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +  GF +++ N GIT+E NYPY    G C  +K +   AKI G+  VPA +EAA
Sbjct  187  GCEGGLMEDGFEFIIKNHGITSEANYPYQAADGTCNSKKEASHIAKITGYESVPANSEAA  246

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  247  LLKAVANQP  255



>ref|XP_010045985.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW84687.1| hypothetical protein EUGRSUZ_B01504 [Eucalyptus grandis]
Length=342

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG++   F +++   G+TTE NYPY    G C  RKA+ +AAKI G+  VPA NE+A
Sbjct  187  GCEGGYMDDAFKFIIGRHGLTTETNYPYQAVDGTCNARKANSSAAKITGYADVPANNESA  246

Query  181  LTKAVANQP  207
            L KAV +QP
Sbjct  247  LLKAVGHQP  255



>emb|CDP18644.1| unnamed protein product [Coffea canephora]
Length=336

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG++   F +++ N+GI TE  YPYT   G C + K +  AAKI  +  VPA +EAA
Sbjct  181  GCSGGYMEDAFEFIVKNKGIATETTYPYTAADGTCSKTKEASHAAKIASYEKVPANSEAA  240

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  241  LLKAVANQP  249



>gb|KDP23984.1| hypothetical protein JCGZ_25372 [Jatropha curcas]
Length=340

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F ++  N+G+TTE NYPY    G C   K +  AAKI G+  VPA NEAA
Sbjct  186  GCQGGLMDDAFKFIETNQGLTTEANYPYEGSDGTCNSNKEANHAAKITGYEDVPANNEAA  245

Query  181  LTKAVANQP  207
            L KAVA QP
Sbjct  246  LLKAVAKQP  254



>gb|EMT08022.1| Vignain [Aegilops tauschii]
Length=341

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE NYPYT + G CK    S + A IKG+  VPA +E++
Sbjct  186  GCEGGEMDDAFKFIIKNGGLTTEANYPYTAQDGQCKTSTTSNSVATIKGYEDVPANDESS  245

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  246  LMKAVANQP  254



>ref|XP_002446131.1| hypothetical protein SORBIDRAFT_06g002140 [Sorghum bicolor]
 gb|EES10459.1| hypothetical protein SORBIDRAFT_06g002140 [Sorghum bicolor]
Length=328

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 39/69 (57%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GGW+ S F +V+ N G+ TE NYPY    G CK    S++AA IKG   VP  NEAA
Sbjct  175  GCEGGWMDSAFEFVIKNGGLATESNYPYKAVDGKCK--GGSKSAATIKGHEDVPVNNEAA  232

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  233  LMKAVANQP  241



>ref|XP_002531151.1| cysteine protease, putative [Ricinus communis]
 gb|EEF31236.1| cysteine protease, putative [Ricinus communis]
Length=340

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F ++  N+G+TTE NYPY    G C  ++ +  AAKI GF  VPA NE A
Sbjct  186  GCQGGLMDDAFKFIEQNQGLTTEANYPYEGSDGTCNTKQEANHAAKINGFEDVPANNEGA  245

Query  181  LTKAVANQP  207
            L KAVA QP
Sbjct  246  LMKAVAKQP  254



>ref|XP_006376431.1| hypothetical protein POPTR_0013s12980g [Populus trichocarpa]
 gb|ERP54228.1| hypothetical protein POPTR_0013s12980g [Populus trichocarpa]
Length=342

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +  GF +++ N GITTE NYPY    G C  +K +   AKI G+  VPA +EA 
Sbjct  187  GCEGGLMEDGFEFIIKNHGITTEANYPYQAADGTCNSKKQASHIAKITGYESVPANSEAE  246

Query  181  LTKAVANQP  207
            L K VANQP
Sbjct  247  LLKVVANQP  255



>ref|XP_008805390.1| PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG + + F +++ NRG+TTE NYPY    G C  +K++   A IKG+  VPA +EAA
Sbjct  187  GCDGGLMDNAFKFIINNRGLTTETNYPYKGIDGTCNSKKSASHVASIKGYEDVPANSEAA  246

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  247  LLKAVANQP  255



>gb|AAP32195.1| cysteine protease 5 [Trifolium repens]
Length=343

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N GI+TE  YPY    G CK  +AS +AA I G+  VPA NE A
Sbjct  188  GCEGGLMDDAFKFIIQNNGISTEAGYPYQGVDGTCKANEASTSAATITGYEDVPANNENA  247

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  248  LQKAVANQP  256



>ref|XP_009775915.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=340

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE NYPY    G CK RK S   AKI G+  VPA +E+A
Sbjct  185  GCEGGLMDDAFTFIIKNHGLTTESNYPYEGTDGTCKTRKESNHVAKITGYEDVPANSESA  244

Query  181  LTKAVANQP  207
            L  AVANQP
Sbjct  245  LLSAVANQP  253



>ref|XP_004974539.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE  YPYT   G CK    S +AA IKG+  VPA NEAA
Sbjct  187  GCEGGLMDDAFKFIIKNGGLTTESGYPYTAADGKCK--SGSNSAATIKGYEDVPANNEAA  244

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  245  LMKAVANQP  253



>ref|XP_011086005.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG + + F +++ N GITTE NYPY    G C  +K S  AAKI G+  VPA +E+A
Sbjct  186  GCNGGLMDNAFEFIISNGGITTESNYPYEAVDGTCNSKKESSHAAKITGYEDVPANSESA  245

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  246  LLKAVANQP  254



>gb|AAP32198.1| cysteine protease 12 [Trifolium repens]
Length=343

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N GI+TE  YPY    G CK  +AS +AA I G+  VPA NE A
Sbjct  188  GCEGGLMDDAFKFIIQNNGISTEAGYPYQGVDGTCKANEASTSAATITGYEDVPANNENA  247

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  248  LQKAVANQP  256



>ref|XP_004974541.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE  YPYT   G CK    S +AA IKG+  VPA NEAA
Sbjct  187  GCEGGLMDDAFKFIIKNGGLTTESGYPYTAADGKCK--SGSNSAATIKGYEDVPANNEAA  244

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  245  LMKAVANQP  253



>ref|XP_004974540.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE  YPYT   G CK    S +AA IKG+  VPA NEAA
Sbjct  187  GCEGGLMDDAFKFIIKNGGLTTESGYPYTAADGKCK--SGSNSAATIKGYEDVPANNEAA  244

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  245  LMKAVANQP  253



>ref|XP_006582265.1| PREDICTED: thiol protease SEN102-like [Glycine max]
Length=342

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG++  GF +++ N GIT+E NYPY    G C    A+   A+IKG+  VP+Y+E A
Sbjct  188  GCEGGFMEDGFEFIIKNGGITSETNYPYKGVDGTCNTTIAASPVAQIKGYEIVPSYSEEA  247

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  248  LQKAVANQP  256



>ref|XP_003526209.1| PREDICTED: thiol protease SEN102-like [Glycine max]
Length=342

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG++  GF +++ N GIT+E NYPY    G C    A+   A+IKG+  VP+Y+E A
Sbjct  188  GCEGGFMEDGFEFIIKNGGITSETNYPYKGVDGTCNTTIAASPVAQIKGYEIVPSYSEEA  247

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  248  LQKAVANQP  256



>ref|XP_003526212.1| PREDICTED: thiol protease SEN102-like [Glycine max]
Length=342

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG++  GF +++ N GIT+E NYPY    G C    A+   A+IKG+  VP+Y+E A
Sbjct  188  GCEGGFMEDGFEFIIKNGGITSETNYPYKGVDGTCNTTIAASPVAQIKGYEIVPSYSEEA  247

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  248  LKKAVANQP  256



>ref|XP_006380488.1| hypothetical protein POPTR_0007s07170g [Populus trichocarpa]
 gb|ERP58285.1| hypothetical protein POPTR_0007s07170g [Populus trichocarpa]
Length=340

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG +   F ++  N+G+TTE NYPY    G C  +K++  AAKI GF  VPA +EAA
Sbjct  186  GCNGGLMDDAFKFIEQNKGLTTEANYPYKGTDGTCNTKKSAIHAAKITGFEDVPANSEAA  245

Query  181  LTKAVANQP  207
            L KAVA QP
Sbjct  246  LMKAVAKQP  254



>ref|XP_006380493.1| hypothetical protein POPTR_0007s07240g [Populus trichocarpa]
 gb|ERP58290.1| hypothetical protein POPTR_0007s07240g [Populus trichocarpa]
Length=340

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG +   F ++  N+G+TTE NYPY    G C   KA+  AAKI GF  VPA +EAA
Sbjct  186  GCNGGLMDDAFKFIEQNKGLTTEANYPYKGTDGTCNTNKAAIHAAKITGFEDVPANSEAA  245

Query  181  LTKAVANQP  207
            L KAVA QP
Sbjct  246  LMKAVAKQP  254



>ref|XP_006371486.1| hypothetical protein POPTR_0019s11980g, partial [Populus trichocarpa]
 gb|ERP49283.1| hypothetical protein POPTR_0019s11980g, partial [Populus trichocarpa]
Length=173

 Score = 73.6 bits (179),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +  GF +++ N GITTE NYPY    G C  +K +    KI G+  VPA +E  
Sbjct  55   GCEGGLMEDGFEFIIKNHGITTEANYPYQAADGTCNSKKKTSHIDKITGYGRVPANSETT  114

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  115  LLKAVANQP  123



>gb|KDO63329.1| hypothetical protein CISIN_1g047793mg, partial [Citrus sinensis]
Length=324

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N GITTE NYPY    G C +   +   AKIKG+  VPA +E A
Sbjct  169  GCEGGEMEDAFKFIIHNDGITTEANYPYQAVDGTCNKTNEASHVAKIKGYETVPANSEEA  228

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  229  LLKAVANQP  237



>ref|XP_002310053.1| hypothetical protein POPTR_0007s07200g [Populus trichocarpa]
 ref|XP_006380490.1| hypothetical protein POPTR_0007s07190g [Populus trichocarpa]
 gb|EEE90503.1| hypothetical protein POPTR_0007s07200g [Populus trichocarpa]
 gb|ERP58287.1| hypothetical protein POPTR_0007s07190g [Populus trichocarpa]
Length=340

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG +   F ++  N+G+TTE NYPY    G C   KA+  AAKI GF  VPA +EAA
Sbjct  186  GCNGGLMDDAFKFIEQNKGLTTEANYPYKGTDGTCNTNKAAIHAAKITGFEDVPANSEAA  245

Query  181  LTKAVANQP  207
            L KAVA QP
Sbjct  246  LMKAVAKQP  254



>ref|XP_009786836.1| PREDICTED: vignain-like, partial [Nicotiana sylvestris]
Length=195

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG++   F +++ N+GITTE +YPY    G C  +K S   A IKG+  VP  NE A
Sbjct  40   GCEGGYMEDAFDFMVKNKGITTETSYPYEAADGKCNTKKESSHVADIKGYEKVPKNNEKA  99

Query  181  LTKAVANQP  207
            L  AVANQP
Sbjct  100  LLNAVANQP  108



>ref|XP_011037399.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +  GF +++ N GITTE NYPY    G C   K +   AKI G+  VPA +EA 
Sbjct  187  GCEGGLMEDGFEFIIKNHGITTEANYPYQAADGTCNPEKRASHIAKITGYESVPANSEAE  246

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  247  LLKAVANQP  255



>ref|XP_010045988.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=342

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG++ + F +++ N G+TTE NYPY    G C  RK + +AAKI G+  VPA +E+A
Sbjct  187  GCEGGFMDNAFEFIIGNHGLTTETNYPYQAVDGTCNARKEASSAAKINGYEDVPANSESA  246

Query  181  LTKAVANQP  207
            L KAVA+QP
Sbjct  247  LLKAVAHQP  255



>ref|XP_011005484.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=197

 Score = 73.6 bits (179),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GCHGG++ + F Y++ N G+ +E+NYPY    G C   KAS   A+I G+  VP  NE A
Sbjct  42   GCHGGFMDNAFQYIIRNGGLASEDNYPYQGVDGTCNSEKASSIEAEITGYEDVPQNNENA  101

Query  181  LTKAVANQP  207
            L +AVA QP
Sbjct  102  LLQAVAKQP  110



>gb|EMT12294.1| Vignain [Aegilops tauschii]
Length=342

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG + + F +++ N G+TTE NYPYT   G C   K S AAA IKG+  VPA +EA+
Sbjct  187  GCEGGLMDNAFEFIIDNGGLTTEGNYPYTGTDGSCNSNKESNAAASIKGYEDVPANDEAS  246

Query  181  LTKAVANQP  207
            L KAVA QP
Sbjct  247  LQKAVAAQP  255



>emb|CAN75313.1| hypothetical protein VITISV_033592 [Vitis vinifera]
Length=201

 Score = 73.6 bits (179),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG +   F ++  N G+TTE NYPY    G C  +KA+  AAKI G+  VPA NE A
Sbjct  110  GCNGGLMDDAFKFIEQNHGLTTEANYPYAGTDGTCNNKKAAHPAAKINGYEDVPANNEKA  169

Query  181  LTKAVAN  201
            L KAVA+
Sbjct  170  LQKAVAH  176



>ref|XP_006469128.1| PREDICTED: vignain-like [Citrus sinensis]
Length=343

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N GITTE NYPY    G C +   +   AKIKG+  VPA +E A
Sbjct  188  GCEGGEMEDAFKFIIHNDGITTEANYPYQAVDGTCNKTNEASHVAKIKGYETVPANSEEA  247

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  248  LLKAVANQP  256



>gb|AAR92154.1| putative cysteine protease 1 [Iris x hollandica]
Length=340

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG +   F Y++ N+GITTE NYPY    G C  +KA+  AA I G+  V   +EAA
Sbjct  185  GCNGGEMDDAFEYIIKNKGITTEANYPYKAADGTCNTKKAASHAASITGYEDVTVNSEAA  244

Query  181  LTKAVANQP  207
            L KA ANQP
Sbjct  245  LLKAAANQP  253



>gb|AHA62780.1| RCR3-like cysteine protease [Mirabilis jalapa]
Length=344

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/69 (48%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG + + + ++L N G+TTE NYPY    G C  + ++++AA I G++ VPA +EAA
Sbjct  189  GCEGGLLDTAYTFILKNGGLTTESNYPYMATDGICTTKHSAKSAASIGGYQDVPANDEAA  248

Query  181  LTKAVANQP  207
            L KAVA+QP
Sbjct  249  LLKAVAHQP  257



>ref|XP_006852525.1| hypothetical protein AMTR_s00021p00178750 [Amborella trichopoda]
 gb|ERN13992.1| hypothetical protein AMTR_s00021p00178750 [Amborella trichopoda]
Length=227

 Score = 73.6 bits (179),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG++ + F Y+  N G++TE NYPY    G C  R+AS  AA I+G+R VPA NE  
Sbjct  73   GCMGGYMVTAFQYIRANGGLSTESNYPYQAADGNCDTRRASYHAASIRGYREVPANNENE  132

Query  181  LTKAVANQP  207
            L KAV  QP
Sbjct  133  LLKAVVQQP  141



>gb|AHA62783.1| RCR3-like cysteine protease [Mirabilis viscosa]
Length=343

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/69 (48%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG + + + ++L N G+TTE NYPY    G C  + ++++AA I G++ VPA +EAA
Sbjct  189  GCEGGLLDTAYTFILKNGGLTTESNYPYMATDGICTTKHSAKSAASIGGYQDVPANDEAA  248

Query  181  LTKAVANQP  207
            L KAVA+QP
Sbjct  249  LLKAVAHQP  257



>ref|XP_006582266.1| PREDICTED: thiol protease SEN102-like [Glycine max]
Length=341

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG++  GF +++ N GIT+E NYPY    G C    A+   A+IKG+  VP+Y+E A
Sbjct  187  GCKGGFMEHGFEFIVKNGGITSETNYPYKGVDGTCNTTIAASPVAQIKGYEIVPSYSEEA  246

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  247  LQKAVANQP  255



>ref|XP_003558756.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Brachypodium 
distachyon]
Length=346

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GGW+   F +++ N G+TTE NYPYT +   CK  +    AA IKG+  VPA +E+A
Sbjct  191  GCMGGWMDDAFKFIIKNGGLTTEANYPYTGEDDKCKSNETVNVAATIKGYEDVPANDESA  250

Query  181  LTKAVANQP  207
            L KAVA+QP
Sbjct  251  LMKAVAHQP  259



>gb|AGT16936.1| vignain-like protein [Saccharum hybrid cultivar R570]
Length=341

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 38/69 (55%), Positives = 47/69 (68%), Gaps = 2/69 (3%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE +YPYT   G CK R  S +AA IKG+  VPA +EAA
Sbjct  188  GCEGGLMDDAFKFIVKNGGLTTESSYPYTAADGKCKSR--SNSAATIKGYEDVPANDEAA  245

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  246  LMKAVANQP  254



>ref|XP_007227669.1| hypothetical protein PRUPE_ppa025602mg [Prunus persica]
 gb|EMJ28868.1| hypothetical protein PRUPE_ppa025602mg [Prunus persica]
Length=342

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F ++  N G++TE NYPYT   G C  +K +  AAKI G   VPA +EAA
Sbjct  187  GCEGGLMDDAFQFINQNHGLSTETNYPYTGVDGTCNTKKEASHAAKITGHEDVPANSEAA  246

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  247  LLKAVANQP  255



>gb|AAU81596.1| cysteine proteinase, partial [Petunia x hybrida]
Length=154

 Score = 72.8 bits (177),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +1

Query  19   IGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAALTKAVA  198
            + + F +++ N+G+TTE NYPY  + G C + K++ +AAKIKG+  VPA +E AL KAVA
Sbjct  5    LDTAFTFIMKNKGLTTEANYPYKGEDGVCNKEKSALSAAKIKGYEDVPADSEKALLKAVA  64

Query  199  NQP  207
            NQP
Sbjct  65   NQP  67



>ref|XP_008223851.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=342

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F ++  N G++TE NYPYT   G C  +K +  AAKI G   VPA +EAA
Sbjct  187  GCEGGLMDDAFQFINQNHGLSTETNYPYTGVDGTCNTKKEASHAAKITGHEDVPANSEAA  246

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  247  LLKAVANQP  255



>ref|XP_006376351.1| hypothetical protein POPTR_0013s12280g [Populus trichocarpa]
 gb|ERP54148.1| hypothetical protein POPTR_0013s12280g [Populus trichocarpa]
Length=342

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +  GF +++ N GITTE NYPY    G C  +  +   AKI G+  VPA +EAA
Sbjct  187  GCEGGLMEDGFEFIIKNHGITTEANYPYQAADGTCNSKIEASRIAKITGYESVPANSEAA  246

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  247  LLKAVANQP  255



>gb|EAY97106.1| hypothetical protein OsI_19029 [Oryza sativa Indica Group]
Length=350

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG I   F ++L N G+T E NYPYT + G CK   A+  AA I+G+  VPA +E +
Sbjct  197  GCEGGEIDGAFQFILSNGGLTAEANYPYTAEDGRCKTTAAADVAASIRGYEDVPANDEPS  256

Query  181  LTKAVANQP  207
            L KAVA QP
Sbjct  257  LMKAVAGQP  265



>ref|XP_008223852.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=342

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F ++  N G++TE NYPYT   G C  +K +  AAKI G   VPA +EAA
Sbjct  187  GCEGGLMDDAFQFINQNHGLSTETNYPYTGVDGTCNTKKEASHAAKITGHEDVPANSEAA  246

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  247  LLKAVANQP  255



>ref|XP_002446128.1| hypothetical protein SORBIDRAFT_06g002110 [Sorghum bicolor]
 gb|EES10456.1| hypothetical protein SORBIDRAFT_06g002110 [Sorghum bicolor]
Length=186

 Score = 73.2 bits (178),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +V+ N G+TTE  YPYT   G C   +A   AA I G+  VPA +E +
Sbjct  31   GCEGGEMDDAFEFVVDNGGLTTESKYPYTGSDGNCNSDEAKNDAASITGYEDVPANDETS  90

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  91   LRKAVANQP  99



>ref|XP_008810168.1| PREDICTED: ervatamin-B-like isoform X2 [Phoenix dactylifera]
 ref|XP_008810169.1| PREDICTED: ervatamin-B-like isoform X2 [Phoenix dactylifera]
Length=336

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F YV+ N GITTE+NYPY    G C   K S +AA I G+  VPA +E++
Sbjct  181  GCDGGLMTRAFQYVIDNGGITTEDNYPYMAANGTCDTNKTSSSAATISGYESVPANDESS  240

Query  181  LTKAVANQP  207
            L +AVANQP
Sbjct  241  LLQAVANQP  249



>gb|ABA97421.1| Vignain precursor, putative [Oryza sativa Japonica Group]
 gb|EEE62878.1| hypothetical protein OsJ_17681 [Oryza sativa Japonica Group]
Length=350

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG I   F ++L N G+T E NYPYT + G CK   A+  AA I+G+  VPA +E +
Sbjct  197  GCEGGEIDGAFQFILSNGGLTAEANYPYTAEDGRCKTTAAADVAASIRGYEDVPANDEPS  256

Query  181  LTKAVANQP  207
            L KAVA QP
Sbjct  257  LMKAVAGQP  265



>ref|XP_006650241.1| PREDICTED: xylem cysteine proteinase 2-like [Oryza brachyantha]
Length=364

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+ G  G  + +V+ N G+TTE +YPYT +RG C R K++  AAKI GF+ VP  NEAA
Sbjct  210  GCNMGSYGRAYKWVIENGGLTTEADYPYTARRGPCNRAKSAHHAAKITGFQKVPPRNEAA  269

Query  181  LTKAVANQP  207
            L  AVA QP
Sbjct  270  LQAAVARQP  278



>ref|XP_008780633.1| PREDICTED: vignain-like [Phoenix dactylifera]
Length=186

 Score = 72.8 bits (177),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE NYPY    G C   K+   AA I G+  VPA +EAA
Sbjct  31   GCGGGLMDDAFKFIIKNGGLTTEANYPYEATDGTCNTGKSHSHAATIGGYEDVPANSEAA  90

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  91   LLKAVANQP  99



>ref|XP_008810167.1| PREDICTED: ervatamin-B-like isoform X1 [Phoenix dactylifera]
Length=362

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F YV+ N GITTE+NYPY    G C   K S +AA I G+  VPA +E++
Sbjct  207  GCDGGLMTRAFQYVIDNGGITTEDNYPYMAANGTCDTNKTSSSAATISGYESVPANDESS  266

Query  181  LTKAVANQP  207
            L +AVANQP
Sbjct  267  LLQAVANQP  275



>ref|XP_004306836.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score = 74.3 bits (181),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +V+ N GI TE NYPYT   G C  +K +  AA I G   VPA +E+A
Sbjct  186  GCSGGLMDDAFQFVIQNHGINTEANYPYTAADGTCNAKKEAGHAATITGHEDVPANSESA  245

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  246  LLKAVANQP  254



>gb|KDP45355.1| hypothetical protein JCGZ_09604 [Jatropha curcas]
Length=311

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 33/69 (48%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG++ + F Y+L N G+T+E NYPY  + G C ++K + + AKI G+  VP+ +E A
Sbjct  156  GCDGGFMDTAFQYILKNGGLTSEANYPYQGEDGICSKKKTATSMAKITGYEDVPSNSEKA  215

Query  181  LTKAVANQP  207
            L +AVANQP
Sbjct  216  LLQAVANQP  224



>gb|KHN08873.1| Vignain [Glycine soja]
Length=335

 Score = 74.3 bits (181),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +  GF +++ N GI++E NYPYT   G C   K +  AA+IKG+  VPA +E A
Sbjct  179  GCDGGLMEDGFEFIIKNGGISSEANYPYTAVDGTCDASKEASPAAQIKGYETVPANSEEA  238

Query  181  LTKAVANQP  207
            L +AVANQP
Sbjct  239  LQQAVANQP  247



>ref|XP_006582263.1| PREDICTED: vignain-like [Glycine max]
Length=338

 Score = 74.3 bits (181),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +  GF +++ N GI++E NYPYT   G C   K +  AA+IKG+  VPA +E A
Sbjct  182  GCDGGLMEDGFEFIIKNGGISSEANYPYTAVDGTCDASKEASPAAQIKGYETVPANSEEA  241

Query  181  LTKAVANQP  207
            L +AVANQP
Sbjct  242  LQQAVANQP  250



>ref|XP_008660792.1| PREDICTED: vignain-like [Zea mays]
Length=166

 Score = 72.4 bits (176),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 45/67 (67%), Gaps = 2/67 (3%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG + + F +++ N G+T E +YPYT   G CK   AS +AA IKG+  VPA +EAA
Sbjct  102  GCEGGLMDNAFKFIIKNDGLTIESSYPYTAADGMCKS--ASNSAATIKGYEDVPANDEAA  159

Query  181  LTKAVAN  201
            L KAVAN
Sbjct  160  LMKAVAN  166



>ref|XP_002436840.1| hypothetical protein SORBIDRAFT_10g009830 [Sorghum bicolor]
 gb|EER88207.1| hypothetical protein SORBIDRAFT_10g009830 [Sorghum bicolor]
Length=328

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 46/69 (67%), Gaps = 2/69 (3%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE +YPYT   G CK    S +AA +KGF  VPA +EAA
Sbjct  175  GCEGGLMDDAFQFIIKNGGLTTESSYPYTAADGKCK--SGSNSAATVKGFEDVPANDEAA  232

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  233  LMKAVANQP  241



>ref|XP_008780330.1| PREDICTED: vignain-like [Phoenix dactylifera]
Length=186

 Score = 72.8 bits (177),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++   G+TTE NYPY    G C  +K+   AA IKG+  VPA +EAA
Sbjct  31   GCEGGLMDDAFKFIIRTGGLTTETNYPYKGIDGTCNNKKSPSHAASIKGYEDVPANSEAA  90

Query  181  LTKAVANQP  207
            L KAV NQP
Sbjct  91   LLKAVTNQP  99



>ref|XP_008650514.1| PREDICTED: vignain-like [Zea mays]
 gb|AFW76901.1| hypothetical protein ZEAMMB73_101481 [Zea mays]
Length=232

 Score = 73.2 bits (178),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE NYPYT   G CK    S +AA IKG+  VP  +EAA
Sbjct  79   GCEGGLMDDAFKFIIKNGGLTTESNYPYTAADGKCK--SGSNSAANIKGYEDVPTNDEAA  136

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  137  LMKAVANQP  145



>ref|XP_006582264.1| PREDICTED: vignain-like [Glycine max]
 gb|KHN33267.1| Vignain [Glycine soja]
Length=338

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +  GF +++ N GI++E NYPYT   G C   K +  AA+IKG+  VPA +E A
Sbjct  182  GCDGGLMEDGFEFIIKNGGISSEANYPYTAVDGTCDASKEASPAAQIKGYETVPANSEEA  241

Query  181  LTKAVANQP  207
            L +AVANQP
Sbjct  242  LQQAVANQP  250



>ref|XP_010317330.1| PREDICTED: uncharacterized protein LOC101251741 [Solanum lycopersicum]
Length=802

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE NYPY    G CK  K S  AAKI G+  VPA +E++
Sbjct  647  GCEGGLMDDAFKFIIKNHGLTTESNYPYEGTDGTCKTGKKSNGAAKITGYEDVPANSESS  706

Query  181  LTKAVANQP  207
            L  AVANQP
Sbjct  707  LLSAVANQP  715



>ref|XP_002436841.1| hypothetical protein SORBIDRAFT_10g009840 [Sorghum bicolor]
 gb|EER88208.1| hypothetical protein SORBIDRAFT_10g009840 [Sorghum bicolor]
Length=328

 Score = 73.9 bits (180),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 46/69 (67%), Gaps = 2/69 (3%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE +YPYT   G CK    S +AA +KGF  VPA +EAA
Sbjct  175  GCEGGLMDDAFKFIIKNGGLTTESSYPYTAADGKCK--SGSNSAATVKGFEDVPANDEAA  232

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  233  LMKAVANQP  241



>ref|XP_007132883.1| hypothetical protein PHAVU_011G1328000g, partial [Phaseolus vulgaris]
 gb|ESW04877.1| hypothetical protein PHAVU_011G1328000g, partial [Phaseolus vulgaris]
Length=167

 Score = 72.4 bits (176),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+ TE NYP+    G C  + AS  AA I+G+  VPA NE A
Sbjct  12   GCEGGLMDDAFKFIIQNNGLNTEANYPFKGVDGTCNAKAASSHAATIRGYEDVPANNEKA  71

Query  181  LTKAVANQP  207
            L KAV NQP
Sbjct  72   LQKAVTNQP  80



>ref|XP_007132275.1| hypothetical protein PHAVU_011G081100g [Phaseolus vulgaris]
 gb|ESW04269.1| hypothetical protein PHAVU_011G081100g [Phaseolus vulgaris]
Length=341

 Score = 73.9 bits (180),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F ++L N+G+TTE  YPY    G C  +  S  AA IKG+  VPA +E+A
Sbjct  186  GCEGGLMDDAFKFILNNKGLTTEATYPYEGIDGTCNAKAESSHAASIKGYEDVPANSESA  245

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  246  LLKAVANQP  254



>ref|XP_003596711.1| Cysteine proteinase [Medicago truncatula]
 gb|AES66962.1| papain family cysteine protease [Medicago truncatula]
Length=344

 Score = 73.9 bits (180),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG++     +++   GIT+E NYPYT   G C  RK +   AKIKG+  VPA NE A
Sbjct  189  GCNGGYVEDACDFIVKKGGITSETNYPYTRVDGKCNVRKGTYNVAKIKGYEHVPANNEKA  248

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  249  LLKAVANQP  257



>ref|XP_011078542.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score = 73.9 bits (180),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG +   F +++ N GITTE NYPY    G C  +K S  AAKI G+  VPA +E A
Sbjct  186  GCNGGLMDDAFEFIISNGGITTESNYPYEGVDGTCNSKKESSHAAKITGYEDVPANSEPA  245

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  246  LLKAVANQP  254



>gb|EMT33085.1| Vignain [Aegilops tauschii]
Length=342

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG + + F +++ N G+TTE NYPYT     C   K S AAA IKG+  VPA++EA+
Sbjct  187  GCEGGLMDNAFEFIIDNGGLTTEGNYPYTGTDDSCNSNKESNAAASIKGYEDVPAHDEAS  246

Query  181  LTKAVANQP  207
            L KAVA QP
Sbjct  247  LQKAVAAQP  255



>gb|KCW47322.1| hypothetical protein EUGRSUZ_K01110 [Eucalyptus grandis]
Length=305

 Score = 73.2 bits (178),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 44/69 (64%), Gaps = 1/69 (1%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GGW+ S F +V    G+TTE NYPYT   G C  ++ S  A  IKG+  VPA +E A
Sbjct  151  GCEGGWMDSAFQFVE-KHGLTTEMNYPYTGTDGKCNAKRESNRAVTIKGYEDVPANSEEA  209

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  210  LLKAVANQP  218



>gb|EYU19040.1| hypothetical protein MIMGU_mgv1a026538mg [Erythranthe guttata]
Length=325

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG + + F +++ N G+TTE NYPY    G C  +K S   AKI G+  VPA +E+A
Sbjct  170  GCNGGLMDNAFEFIISNNGLTTESNYPYEGVDGTCNSKKESSHVAKITGYEDVPANSESA  229

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  230  LLKAVANQP  238



>ref|XP_011078044.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG +   F +++ N GITTE NYPY    G C  +K S  AAKI G+  VPA +E A
Sbjct  186  GCNGGLMDDAFEFIISNGGITTESNYPYEGVDGTCNSKKESSHAAKITGYEDVPANSEPA  245

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  246  LLKAVANQP  254



>dbj|BAF56429.1| cysteine proteinase [Lotus japonicus]
Length=341

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 46/69 (67%), Gaps = 2/69 (3%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG++  GF +++ N GITTE NYPY    G CK   A+  AA+IKG+  VP  +E A
Sbjct  189  GCEGGYMEDGFEFIIKNGGITTEANYPYKAVDGSCKN--ATAPAAQIKGYEKVPVNSEKA  246

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  247  LLKAVANQP  255



>ref|XP_007226492.1| hypothetical protein PRUPE_ppa026538mg [Prunus persica]
 gb|EMJ27691.1| hypothetical protein PRUPE_ppa026538mg [Prunus persica]
Length=342

 Score = 73.6 bits (179),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F ++  N G+ TE NYPYT   G C  +K +  AAKI G   VPA +EAA
Sbjct  187  GCEGGLMDDAFQFISQNHGLRTETNYPYTGVDGTCNTKKEASHAAKITGHEDVPANSEAA  246

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  247  LLKAVANQP  255



>dbj|BAD29959.1| cysteine protease [Daucus carota]
Length=361

 Score = 73.9 bits (180),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG++  GF +++ N+GI  E +YPYT   G C  ++ +  AAKI G+  VPA +E A
Sbjct  206  GCEGGYMEDGFEFIVKNKGIALEASYPYTAADGTCNSKEEASRAAKISGYEKVPANSETA  265

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  266  LLKAVANQP  274



>ref|XP_009798361.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=339

 Score = 73.6 bits (179),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F Y++ N G+T+E NYPY    G CK  K S   AKI+G++ VP  +E A
Sbjct  184  GCEGGLMDDAFKYIIKNHGLTSESNYPYKGIDGTCKTEKESNHVAKIRGYKDVPENSELA  243

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  244  LLKAVANQP  252



>ref|XP_004308524.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score = 73.6 bits (179),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +V+ N GI TE NYPYT   G C  +KA+  AA I G   VPA +E+A
Sbjct  186  GCSGGLMDDAFQFVIQNHGINTEANYPYTAADGTCNAKKAAGHAATITGHEDVPANSESA  245

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  246  LLKAVANQP  254



>ref|XP_006362426.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score = 73.6 bits (179),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE NYPY    G CK  K S  AAKI G+  VPA +E+A
Sbjct  185  GCEGGLMDDAFKFIIKNHGLTTESNYPYEGTDGTCKTGKESNDAAKITGYEDVPANSESA  244

Query  181  LTKAVANQP  207
            L  AVANQP
Sbjct  245  LLNAVANQP  253



>gb|AFW86314.1| hypothetical protein ZEAMMB73_546353 [Zea mays]
Length=233

 Score = 72.4 bits (176),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 46/69 (67%), Gaps = 2/69 (3%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE +YPYT   G CK    S +AA IKG+  VPA +EAA
Sbjct  80   GCEGGLMDDAFKFIIKNGGLTTESSYPYTAADGKCK--SGSNSAATIKGYEDVPANDEAA  137

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  138  LMKAVANQP  146



>gb|KDP45578.1| hypothetical protein JCGZ_17185 [Jatropha curcas]
Length=340

 Score = 73.6 bits (179),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F ++  N+G+TTE NYPY    G C   K +  AAKI G+  VPA +EAA
Sbjct  186  GCQGGLMDDAFKFIENNQGLTTETNYPYEGSDGTCNANKEANHAAKITGYEDVPANDEAA  245

Query  181  LTKAVANQP  207
            L KAVA QP
Sbjct  246  LLKAVAQQP  254



>gb|KCW89618.1| hypothetical protein EUGRSUZ_A01901 [Eucalyptus grandis]
Length=248

 Score = 72.4 bits (176),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +  GF +++ N G+ TE NYPY    G CK  K +  AAKI  +  VPA +EA 
Sbjct  136  GCEGGLMEDGFQFIINNGGLATEANYPYDGTDGTCKTTKEASHAAKITDYEVVPANDEAT  195

Query  181  LTKAVANQP  207
            L KAVAN+P
Sbjct  196  LLKAVANRP  204



>ref|XP_009629965.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=343

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE NYPY      CK  K S  AAKI G+  VPA +E+A
Sbjct  187  GCEGGLMDDAFKFIIKNNGLTTESNYPYEGTNATCKTGKESNHAAKITGYEDVPANSESA  246

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  247  LLKAVANQP  255



>ref|XP_009767421.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=334

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG++   F +++ N+G+TTE  YPY      C  +K S   A IKG+  VP YNE A
Sbjct  179  GCEGGYMEDAFEFIVKNKGLTTETTYPYKAADEKCNTKKESSHVADIKGYEKVPKYNEKA  238

Query  181  LTKAVANQP  207
            L  AVANQP
Sbjct  239  LLNAVANQP  247



>ref|XP_006388353.1| hypothetical protein POPTR_0213s002202g, partial [Populus trichocarpa]
 gb|ERP47267.1| hypothetical protein POPTR_0213s002202g, partial [Populus trichocarpa]
Length=136

 Score = 71.2 bits (173),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG + + F Y++ N G+T+E+NYPY    G C   KA+   A+I G+  VP  NE A
Sbjct  39   GCQGGLMDTAFQYIIRNGGLTSEDNYPYQGVDGTCSSEKAASTEAQITGYEDVPQNNENA  98

Query  181  LTKAVANQP  207
            L +AVA QP
Sbjct  99   LLQAVAKQP  107



>ref|XP_002446222.1| hypothetical protein SORBIDRAFT_06g005410 [Sorghum bicolor]
 gb|EES10550.1| hypothetical protein SORBIDRAFT_06g005410 [Sorghum bicolor]
Length=340

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 46/69 (67%), Gaps = 2/69 (3%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE +YPYT   G CK    + +AA IKGF  VPA +EAA
Sbjct  187  GCEGGLMDDAFKFIIKNGGLTTESSYPYTATDGKCK--SGTNSAANIKGFEDVPANDEAA  244

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  245  LMKAVANQP  253



>ref|XP_010038689.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=340

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 44/69 (64%), Gaps = 1/69 (1%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GGW+ S F +V    G+TTE NYPYT   G C  ++ S  A  IKG+  VPA +E A
Sbjct  186  GCEGGWMDSAFQFVE-KHGLTTEMNYPYTGTDGKCNAKRESNRAVTIKGYEDVPANSEEA  244

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  245  LLKAVANQP  253



>ref|XP_006652104.1| PREDICTED: vignain-like [Oryza brachyantha]
Length=342

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE NYPYT   G CK    S AAA IKG+  VPA +EAA
Sbjct  188  GCEGGLMDDAFKFIVNNGGLTTESNYPYTAADGKCKGGSGS-AAATIKGYEDVPANDEAA  246

Query  181  LTKAVANQP  207
            L KAVA+QP
Sbjct  247  LMKAVASQP  255



>ref|XP_006362428.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=341

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE NYPY    G CK  K S  AAKI G+  VPA +E+A
Sbjct  186  GCEGGLMDDAFKFIIKNHGLTTESNYPYEGTDGTCKTGKESNDAAKITGYEDVPANSESA  245

Query  181  LTKAVANQP  207
            L  AVANQP
Sbjct  246  LLNAVANQP  254



>ref|XP_009361500.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=342

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F ++  N G++TE NYPYT   G C  +K +  AAKI G   VPA +E A
Sbjct  187  GCEGGLMDDAFQFINQNHGLSTETNYPYTGVDGTCNTKKEANHAAKITGHEDVPANSEEA  246

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  247  LLKAVANQP  255



>gb|EYU25680.1| hypothetical protein MIMGU_mgv1a019612mg [Erythranthe guttata]
Length=328

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG + + F +++ N G+TTE NYPY    G C  +K S  AA+I G+  VP+ +E+A
Sbjct  173  GCNGGLMDNAFEFIISNNGLTTESNYPYEGVDGTCNSKKESSHAARITGYEDVPSNSESA  232

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  233  LLKAVANQP  241



>ref|XP_009359967.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=342

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F ++  N G++TE NYPYT   G C  +K +  AAKI G   VPA +E A
Sbjct  187  GCEGGLMDDAFQFINQNHGLSTETNYPYTGVDGTCNTKKEANHAAKITGHEDVPANSEEA  246

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  247  LLKAVANQP  255



>ref|XP_004973089.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 44/69 (64%), Gaps = 2/69 (3%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE  YPYT   G CK    S +AA IK +  VPA NEAA
Sbjct  187  GCEGGLMDDAFKFIIKNGGLTTESGYPYTAADGKCK--SGSNSAATIKSYEDVPANNEAA  244

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  245  LMKAVANQP  253



>gb|AFW76902.1| hypothetical protein ZEAMMB73_056195 [Zea mays]
Length=340

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE NYPYT   G CK    S +AA IKG+  VP  +EAA
Sbjct  187  GCEGGLMDDAFKFIIKNGGLTTESNYPYTAADGKCK--SGSNSAANIKGYEDVPTNDEAA  244

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  245  LMKAVANQP  253



>ref|XP_009359979.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=342

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F ++  N G++TE NYPYT   G C  +K +  AAKI G+  VPA +E A
Sbjct  187  GCGGGLMDDAFQFINKNHGLSTETNYPYTGVDGTCNTKKEASHAAKITGYEDVPANSEEA  246

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  247  LLKAVANQP  255



>ref|XP_010054319.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
 gb|KCW76119.1| hypothetical protein EUGRSUZ_D00496 [Eucalyptus grandis]
Length=345

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG + S F +++ N G+TTE NYPY    G C   K +  AA I G++ VPA NE A
Sbjct  188  GCGGGLMDSAFKFIVSNGGLTTEANYPYQGDDGTCNTAKTANPAASITGYQDVPANNEKA  247

Query  181  LTKAVANQP  207
            L +AVANQP
Sbjct  248  LLQAVANQP  256



>ref|XP_010906195.1| PREDICTED: senescence-specific cysteine protease SAG39-like isoform 
X2 [Elaeis guineensis]
Length=246

 Score = 72.0 bits (175),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG   +   +++ N G+ TE NYPY    G C  +K++  AA IKG+  VPA +EAA
Sbjct  90   GCNGGLPDAALEFIIKNGGLATETNYPYKGMDGTCNTKKSASHAASIKGYEQVPANSEAA  149

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  150  LLKAVANQP  158



>ref|XP_006469012.1| PREDICTED: vignain-like [Citrus sinensis]
Length=341

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG + + F +V  N+GITTE NYPY    G C  ++ +  AAKI G   VPA +E A
Sbjct  186  GCNGGLMDNAFQFVQKNKGITTETNYPYKGVDGKCNAKEEANHAAKINGHEDVPANSETA  245

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  246  LMKAVANQP  254



>ref|XP_004974538.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 44/69 (64%), Gaps = 2/69 (3%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE  YPYT     CK    S +AA IKG+  VPA NEAA
Sbjct  187  GCEGGLMDDAFKFIIKNGGLTTESGYPYTAADDKCK--SGSNSAATIKGYEDVPANNEAA  244

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  245  LMKAVANQP  253



>ref|XP_006469011.1| PREDICTED: vignain-like [Citrus sinensis]
Length=341

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG + + F +V  N+GITTE NYPY    G C  ++ +  AAKI G   VPA +E A
Sbjct  186  GCNGGLMDNAFQFVQKNKGITTETNYPYKGVDGKCNAKEEANHAAKINGHEDVPANSETA  245

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  246  LMKAVANQP  254



>ref|XP_003578721.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Brachypodium 
distachyon]
Length=349

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+T+E NYPYT + G CK +    + A IKG+  VPA +EA+
Sbjct  194  GCEGGEMDDAFEFIIKNGGLTSETNYPYTAQDGQCKAKNTINSVATIKGYEDVPANDEAS  253

Query  181  LTKAVANQP  207
            L KAVA QP
Sbjct  254  LMKAVAAQP  262



>ref|XP_009617815.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=339

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F Y++ N G+T+E NYPY    G CK  K S   AKI G++ VP  +E+A
Sbjct  184  GCEGGLMDDAFKYIIKNHGLTSESNYPYKGIDGTCKTEKESNHIAKISGYKDVPENSESA  243

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  244  LLKAVANQP  252



>ref|XP_006360707.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE NYPY    G CK  K S  AAKI  +  VPA +E+A
Sbjct  185  GCEGGLMDDAFKFIIKNHGLTTESNYPYEGTDGTCKTGKESSHAAKITSYEDVPANSESA  244

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  245  LLKAVANQP  253



>gb|EAY93078.1| hypothetical protein OsI_14879 [Oryza sativa Indica Group]
Length=339

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 44/69 (64%), Gaps = 2/69 (3%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE  YPYT   G C     S +AA IKG+  VPA NEAA
Sbjct  186  GCEGGLMDDAFKFIIKNGGLTTESKYPYTAADGKC--NGGSNSAATIKGYEEVPANNEAA  243

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  244  LMKAVANQP  252



>gb|KCW76140.1| hypothetical protein EUGRSUZ_D00517 [Eucalyptus grandis]
Length=324

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GGW+ + F Y++ N GI++E NYPY    G C    AS + AKI G+  VPA NE  
Sbjct  169  GCSGGWMDTAFDYIIQNGGISSETNYPYDASDGTCNAHMASLSVAKIVGYEDVPANNEGE  228

Query  181  LTKAVANQP  207
            + KAVA QP
Sbjct  229  ILKAVAMQP  237



>gb|KCW76139.1| hypothetical protein EUGRSUZ_D00515 [Eucalyptus grandis]
Length=339

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GGW+ + F Y++ N GI++E NYPY    G C    AS + AKI G+  VPA NE  
Sbjct  184  GCSGGWMDTAFDYIIQNGGISSETNYPYNASDGTCNAHMASLSVAKIVGYEDVPANNEGE  243

Query  181  LTKAVANQP  207
            + KAVA QP
Sbjct  244  ILKAVAMQP  252



>ref|XP_002531152.1| cysteine protease, putative [Ricinus communis]
 gb|EEF31237.1| cysteine protease, putative [Ricinus communis]
Length=340

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F ++  N+G+TTE NYPY    G C  ++ +  AAKI GF  VPA NE A
Sbjct  186  GCQGGLMDDAFKFIEQNQGLTTEANYPYEGSDGTCNTKQEANHAAKINGFEDVPANNEGA  245

Query  181  LTKAVANQP  207
            L KAVA QP
Sbjct  246  LMKAVAKQP  254



>gb|EYU25672.1| hypothetical protein MIMGU_mgv1a018700mg [Erythranthe guttata]
Length=343

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG + + F +++ N G+TTE NYPY    G C  +K S  AA+I G+  VP+ +E+A
Sbjct  188  GCNGGLMDNAFEFIISNNGLTTESNYPYEGVDGTCNSKKESSHAARITGYEDVPSNSESA  247

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  248  LLKAVANQP  256



>ref|XP_006388352.1| hypothetical protein POPTR_0213s00210g, partial [Populus trichocarpa]
 gb|ERP47266.1| hypothetical protein POPTR_0213s00210g, partial [Populus trichocarpa]
Length=194

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG + + F Y++ N G+T+E+NYPY    G C   KA+   A+I G+  VP  NE A
Sbjct  39   GCQGGLMDTAFQYIIRNGGLTSEDNYPYQGVDGTCSSEKAASTEAQITGYEDVPQNNENA  98

Query  181  LTKAVANQP  207
            L +AVA QP
Sbjct  99   LLQAVAKQP  107



>ref|XP_007025413.1| Maternal effect embryo arrest 18 [Theobroma cacao]
 gb|EOY28035.1| Maternal effect embryo arrest 18 [Theobroma cacao]
Length=1085

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/69 (48%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GGW+   F Y++ N+G+ +E  YPYT   G C  RKA+    KIKG+  VP  NE A
Sbjct  930  GCSGGWMDDAFAYIVKNQGLASETKYPYTSNDGTCSPRKAAIRIVKIKGYEDVPPKNEEA  989

Query  181  LTKAVANQP  207
            L KA + QP
Sbjct  990  LRKAASQQP  998


 Score = 67.8 bits (164),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/64 (47%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = +1

Query  16   WIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAALTKAV  195
            W+ + F Y++ N+G+TTEENYPY   +G C   KA+   A I  +  VP+ +E AL KAV
Sbjct  615  WMTNAFQYIMENQGLTTEENYPYEEMQGTCAIEKATAQVADISDYEQVPSNDEEALLKAV  674

Query  196  ANQP  207
             NQP
Sbjct  675  TNQP  678



>gb|KHN13721.1| Vignain [Glycine soja]
Length=326

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +V+ N G+ TE NYPY    G C   +A+  AA I G+  VPA NE A
Sbjct  171  GCEGGLMDDAFKFVIQNHGLNTEANYPYKGVDGKCNVNEAANDAATITGYEDVPANNEKA  230

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  231  LQKAVANQP  239



>emb|CAH66233.1| H0825G02.10 [Oryza sativa Indica Group]
Length=339

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 44/69 (64%), Gaps = 2/69 (3%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE  YPYT   G C     S +AA IKG+  VPA NEAA
Sbjct  186  GCEGGLMDDAFKFIIKNGGLTTESKYPYTAADGKC--NGGSNSAATIKGYEDVPANNEAA  243

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  244  LMKAVANQP  252



>gb|AHA62781.1| RCR3-like cysteine protease [Mirabilis jalapa]
Length=344

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG + + + ++L N G+TTE NYPY    G C  + ++++ A I G++ VPA +EAA
Sbjct  189  GCEGGLLDTAYTFILKNGGLTTESNYPYMATDGICTTKHSAKSDASIGGYQDVPANDEAA  248

Query  181  LTKAVANQP  207
            L KAVA+QP
Sbjct  249  LLKAVAHQP  257



>ref|XP_007216164.1| hypothetical protein PRUPE_ppa015341mg, partial [Prunus persica]
 gb|EMJ17363.1| hypothetical protein PRUPE_ppa015341mg, partial [Prunus persica]
Length=196

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F ++  N G+ TE NYPY+   G C  +K +  AAKI G+  VP  +E A
Sbjct  41   GCEGGLMDDAFQFIQQNHGLGTEANYPYSGVDGTCNTKKEASIAAKITGYEDVPTNSEQA  100

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  101  LLKAVANQP  109



>ref|XP_008382007.1| PREDICTED: ervatamin-B-like [Malus domestica]
 ref|XP_008365747.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=343

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F ++  NRGI+TE NYPY    G C  +K +  AAKI GF  VPA +E A
Sbjct  188  GCEGGLMDDAFQFIQQNRGISTEANYPYDGVDGTCNAKKEASRAAKITGFEDVPANSEKA  247

Query  181  LTKAVANQP  207
            L  AVA+QP
Sbjct  248  LLTAVAHQP  256



>emb|CAD40112.2| OSJNBa0035O13.5 [Oryza sativa Japonica Group]
 gb|EAZ29777.1| hypothetical protein OsJ_13835 [Oryza sativa Japonica Group]
Length=339

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 44/69 (64%), Gaps = 2/69 (3%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE  YPYT   G C     S +AA IKG+  VPA NEAA
Sbjct  186  GCEGGLMDDAFKFIIKNGGLTTESKYPYTAADGKC--NGGSNSAATIKGYEDVPANNEAA  243

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  244  LMKAVANQP  252



>ref|XP_010052199.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76124.1| hypothetical protein EUGRSUZ_D00500 [Eucalyptus grandis]
Length=345

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG + S F +++ N G+TTE NYPY    G C   K +  AA I G++ VPA NE A
Sbjct  188  GCMGGLMDSAFEFIVSNGGLTTEANYPYQGIDGTCNTAKTANQAASITGYQDVPANNEKA  247

Query  181  LTKAVANQP  207
            L +AVANQP
Sbjct  248  LLQAVANQP  256



>ref|XP_010054320.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76122.1| hypothetical protein EUGRSUZ_D00499 [Eucalyptus grandis]
Length=345

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG + S F +++ N G+TTE NYPY    G C   K +  AA I G++ VPA NE A
Sbjct  188  GCMGGLMDSAFEFIVSNGGLTTEANYPYQGIDGTCNTAKTANQAASITGYQDVPANNEKA  247

Query  181  LTKAVANQP  207
            L +AVANQP
Sbjct  248  LLQAVANQP  256



>gb|KCW76123.1| hypothetical protein EUGRSUZ_D00500 [Eucalyptus grandis]
Length=345

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG + S F +++ N G+TTE NYPY    G C   K +  AA I G++ VPA NE A
Sbjct  188  GCMGGLMDSAFEFIVSNGGLTTEANYPYQGIDGTCNTAKTANQAASITGYQDVPANNEKA  247

Query  181  LTKAVANQP  207
            L +AVANQP
Sbjct  248  LLQAVANQP  256



>dbj|BAD25828.1| putative cysteine proteinase [Oryza sativa Japonica Group]
 dbj|BAD26098.1| putative cysteine proteinase [Oryza sativa Japonica Group]
Length=358

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+ G  G  + +V+ N G+TTE +YPYT +RG C R K++  AAKI GF  VP  NEAA
Sbjct  202  GCNLGSYGRAYKWVVENGGLTTEADYPYTARRGPCNRAKSAHHAAKITGFGKVPPRNEAA  261

Query  181  LTKAVANQP  207
            L  AVA QP
Sbjct  262  LQAAVARQP  270



>ref|XP_008797119.1| PREDICTED: vignain-like [Phoenix dactylifera]
Length=271

 Score = 71.6 bits (174),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG +   F +++ N GITTE  YPY  K G C   K + A   I G+  VPA NEAA
Sbjct  101  GCNGGLMEHAFEFIVRNGGITTEAEYPYRAKDGRCDASKENSAVVTIDGYENVPANNEAA  160

Query  181  LTKAVANQP  207
            L KAVA+QP
Sbjct  161  LMKAVAHQP  169



>ref|XP_008669676.1| PREDICTED: ervatamin-B-like [Zea mays]
 tpg|DAA38581.1| TPA: hypothetical protein ZEAMMB73_156486 [Zea mays]
Length=347

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 47/69 (68%), Gaps = 2/69 (3%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG +   F +++ N G+TTE NYPYT + G CK    S  AA IKG+  VPA +EAA
Sbjct  194  GCNGGEMDDAFKFIIKNGGLTTESNYPYTAQDGQCK--SGSNGAATIKGYEDVPANDEAA  251

Query  181  LTKAVANQP  207
            L KAVA+QP
Sbjct  252  LMKAVASQP  260



>ref|NP_001063060.1| Os09g0381400 [Oryza sativa Japonica Group]
 dbj|BAF24974.1| Os09g0381400 [Oryza sativa Japonica Group]
 dbj|BAG92304.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84502.1| hypothetical protein OsI_31193 [Oryza sativa Indica Group]
Length=362

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+ G  G  + +V+ N G+TTE +YPYT +RG C R K++  AAKI GF  VP  NEAA
Sbjct  206  GCNLGSYGRAYKWVVENGGLTTEADYPYTARRGPCNRAKSAHHAAKITGFGKVPPRNEAA  265

Query  181  LTKAVANQP  207
            L  AVA QP
Sbjct  266  LQAAVARQP  274



>gb|AHA62779.1| RCR3-like cysteine protease [Mirabilis jalapa]
Length=344

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG + + + ++L N G+TTE NYPY    G C  + ++++ A I G++ VPA +EAA
Sbjct  189  GCEGGLLDTAYTFILKNGGLTTESNYPYMATDGICTTKHSAKSDASIGGYQDVPANDEAA  248

Query  181  LTKAVANQP  207
            L KAVA+QP
Sbjct  249  LLKAVAHQP  257



>gb|EEC84504.1| hypothetical protein OsI_31195 [Oryza sativa Indica Group]
Length=362

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+ G  G  + +V+ N G+TTE +YPYT +RG C R K++  AAKI GF  VP  NEAA
Sbjct  206  GCNLGSYGRAYKWVVENGGLTTEADYPYTARRGPCNRAKSAHHAAKITGFGKVPPRNEAA  265

Query  181  LTKAVANQP  207
            L  AVA QP
Sbjct  266  LQAAVARQP  274



>ref|XP_010906543.1| PREDICTED: ervatamin-B-like [Elaeis guineensis]
Length=362

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG   + F +++ N GI TE++YPYT + G C +RK +     I G+  VP  NE A
Sbjct  201  GCNGGVRNNAFRFIIKNGGIDTEKDYPYTARDGKCDQRKKNTKVVSIDGYEVVPVNNEKA  260

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  261  LQKAVANQP  269



>ref|XP_009357172.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=343

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F ++  NRGI+TE NYPY    G C  +K +  AAKI GF  VPA +E A
Sbjct  188  GCEGGLMDDAFQFIQQNRGISTEANYPYDGVDGTCNAKKEASRAAKITGFEDVPANSEKA  247

Query  181  LTKAVANQP  207
            L  AVA+QP
Sbjct  248  LLTAVAHQP  256



>gb|AHA62782.1| RCR3-like cysteine protease [Mirabilis jalapa]
Length=343

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG + + + ++L N G+TTE NYPY    G C  + ++++ A I G++ VPA +EAA
Sbjct  189  GCEGGLLDTAYTFILKNGGLTTESNYPYMATDGICTTKHSAKSDASIGGYQDVPANDEAA  248

Query  181  LTKAVANQP  207
            L KAVA+QP
Sbjct  249  LLKAVAHQP  257



>ref|XP_003557016.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +V+ N G+ TE NYPY    G C   +A+  AA I G+  VPA NE A
Sbjct  188  GCEGGLMDDAFKFVIQNHGLNTEANYPYKGVDGKCNVNEAANDAATITGYEDVPANNEKA  247

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  248  LQKAVANQP  256



>ref|XP_008659446.1| PREDICTED: ervatamin-B-like [Zea mays]
Length=340

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 46/69 (67%), Gaps = 2/69 (3%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE +YPYT   G CK    S +AA IKG+  VPA +EAA
Sbjct  187  GCEGGLMDDAFKFIIKNGGLTTESSYPYTAADGKCK--SGSNSAATIKGYEDVPANDEAA  244

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  245  LMKAVANQP  253



>gb|EEE69617.1| hypothetical protein OsJ_29194 [Oryza sativa Japonica Group]
Length=360

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+ G  G  + +V+ N G+TTE +YPYT +RG C R K++  AAKI GF  VP  NEAA
Sbjct  206  GCNLGSYGRAYKWVVENGGLTTEADYPYTARRGPCNRAKSAHHAAKITGFGKVPPRNEAA  265

Query  181  LTKAVANQP  207
            L  AVA QP
Sbjct  266  LQAAVARQP  274



>ref|XP_007132868.1| hypothetical protein PHAVU_011G1314000g, partial [Phaseolus vulgaris]
 gb|ESW04862.1| hypothetical protein PHAVU_011G1314000g, partial [Phaseolus vulgaris]
Length=256

 Score = 71.2 bits (173),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/69 (48%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+ TE NYP+    G C  + AS  AA I+G+  VPA NE A
Sbjct  188  GCEGGLMDDAFKFIIQNNGLNTEANYPFKGVDGTCNAKAASSHAATIRGYEDVPANNEKA  247

Query  181  LTKAVANQP  207
            L KAV NQP
Sbjct  248  LQKAVTNQP  256



>ref|XP_008803660.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
 ref|XP_008812192.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=338

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F Y++ N+GITTE NYPY  K G C   K+S  AA I G+  VP  +E++
Sbjct  183  GCGGGIMDDAFKYIISNKGITTEANYPYVAKEGTCDTNKSSSVAATISGYEDVPRNSESS  242

Query  181  LTKAVANQP  207
            L +AVA QP
Sbjct  243  LLQAVAKQP  251



>ref|XP_006446793.1| hypothetical protein CICLE_v10018274mg [Citrus clementina]
 gb|ESR60033.1| hypothetical protein CICLE_v10018274mg [Citrus clementina]
Length=341

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG + + F +V  N+GITTE NYPY    G C  ++ +  AAKI G   VPA +E A
Sbjct  186  GCNGGLMDNAFQFVQKNKGITTEINYPYKGVDGKCNAKEEANHAAKINGHEDVPANSETA  245

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  246  LMKAVANQP  254



>ref|XP_007018686.1| Xylem cysteine peptidase 1 [Theobroma cacao]
 gb|EOY15911.1| Xylem cysteine peptidase 1 [Theobroma cacao]
Length=355

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/69 (45%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG + + F Y++ N G+  E++YPY M+ G C+ RK       I G+R VP  NE +
Sbjct  198  GCNGGLMDNAFAYIIANGGLHREDDYPYIMEEGTCEMRKEQSNLVTISGYRDVPKNNEES  257

Query  181  LTKAVANQP  207
            L KA+ANQP
Sbjct  258  LLKALANQP  266



>dbj|BAH79097.1| cysteine protease [Lactuca sativa]
Length=147

 Score = 70.1 bits (170),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG +   F +++ N GI TEE+YPYT + G C   + +     I G+  VP  +E+A
Sbjct  35   GCNGGLMDYAFQFIIKNGGIDTEEDYPYTGRDGKCDTYRKNAKVVSIDGYEDVPVNDESA  94

Query  181  LTKAVANQP  207
            L KAV+NQP
Sbjct  95   LKKAVSNQP  103



>ref|XP_004152297.1| PREDICTED: vignain-like [Cucumis sativus]
Length=340

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG   S F +++ N GIT EENYPY    G+C+RR  +     I G+  VP  NE A
Sbjct  183  GCRGGNYDSAFEFIMQNGGITIEENYPYFAGNGYCRRRGPNSERVTIDGYECVPQNNEYA  242

Query  181  LTKAVANQP  207
            L KAVA+QP
Sbjct  243  LMKAVAHQP  251



>ref|XP_011045912.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=362

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 48/69 (70%), Gaps = 3/69 (4%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG++   F +++ N+G+TTE NYPY    G C    + +AAAKI G+  VPA +EAA
Sbjct  210  GCNGGFMDDAFEFIIQNKGLTTEANYPYQGADGTC---NSGKAAAKITGYEDVPANSEAA  266

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  267  LLKAVANQP  275



>gb|AFW57869.1| hypothetical protein ZEAMMB73_830006 [Zea mays]
Length=443

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE  YPYT   G C   +AS  AA IKG+  VPA +EA+
Sbjct  197  GCEGGEMDDAFDFIVGNGGLTTESRYPYTASDGTCNSNEASGDAASIKGYEDVPANDEAS  256

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  257  LRKAVANQP  265



>ref|XP_008659445.1| PREDICTED: ervatamin-B-like [Zea mays]
 gb|AFW86316.1| hypothetical protein ZEAMMB73_635707 [Zea mays]
Length=340

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 46/69 (67%), Gaps = 2/69 (3%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE +YPYT   G CK    S +AA IKG+  VPA +EAA
Sbjct  187  GCEGGLMDDAFKFIINNGGLTTESSYPYTAADGKCK--SGSNSAATIKGYEDVPANDEAA  244

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  245  LMKAVANQP  253



>ref|XP_007025397.1| Senescence-associated gene 12, putative [Theobroma cacao]
 gb|EOY28019.1| Senescence-associated gene 12, putative [Theobroma cacao]
Length=322

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG + + F ++  NRG+TTE NYPY    G CK + A+ AA  I G+  VPA NE A
Sbjct  168  GCEGGLMDNAFQFIKTNRGLTTEANYPYRGSEGECKNKHATPAAT-IAGYEDVPANNEKA  226

Query  181  LTKAVANQP  207
            L +AVANQP
Sbjct  227  LLQAVANQP  235



>dbj|BAG16370.1| cysteine protease [Brassica oleracea var. italica]
Length=332

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG++ S F Y +   G+T+E NYPY    G C   K  Q A  IKGF  VPA +E A
Sbjct  182  GCMGGYMNSAFNYTMTTGGLTSESNYPYKSTDGTCNINKTKQIATSIKGFEDVPANDEKA  241

Query  181  LTKAVANQP  207
            L KAVA+ P
Sbjct  242  LMKAVAHHP  250



>gb|KCW84689.1| hypothetical protein EUGRSUZ_B01506, partial [Eucalyptus grandis]
Length=295

 Score = 71.2 bits (173),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE NYPY      C  RKA+  AAKI G+  VP+ +E+A
Sbjct  154  GCGGGLMDDAFQFIISNHGLTTEANYPYQAVDNTCNARKAASTAAKISGYEDVPSNSESA  213

Query  181  LTKAVANQP  207
            L KAVA+QP
Sbjct  214  LLKAVAHQP  222



>ref|XP_010518799.1| PREDICTED: senescence-specific cysteine protease SAG12 [Tarenaya 
hassleriana]
Length=348

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG + + F ++  + G+TTE NYPY  + G C  +KAS  AA I G+  VPA +E A
Sbjct  193  GCEGGLLDTAFEHIKESHGLTTEANYPYNGEDGTCNSKKASAKAATITGYEDVPANDEKA  252

Query  181  LTKAVANQP  207
            L KAV NQP
Sbjct  253  LMKAVTNQP  261



>ref|XP_010054325.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP1-like [Eucalyptus 
grandis]
Length=473

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GGW+ + F Y++ N GI++E NYPY    G C    AS + AKI G+  VPA NE  
Sbjct  207  GCSGGWMDTAFDYIIQNGGISSETNYPYNASDGTCNAHMASLSVAKIVGYEDVPANNEGE  266

Query  181  LTKAVANQP  207
            + KAVA QP
Sbjct  267  ILKAVAMQP  275



>ref|XP_009797968.1| PREDICTED: vignain-like [Nicotiana sylvestris]
Length=340

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE NYPY    G CK  K S  AAKI G+  VP  +E+A
Sbjct  185  GCQGGLMDYAFKFIIKNHGLTTESNYPYEGIDGTCKTGKKSNHAAKIAGYEDVPVNSESA  244

Query  181  LTKAVANQP  207
            L KAVA+QP
Sbjct  245  LLKAVAHQP  253



>gb|AAM73806.1|AF448505_1 cysteine proteinase [Brassica napus]
 gb|AAM73807.1|AF448506_1 cysteine proteinase [Brassica napus]
 emb|CDX77621.1| BnaC07g18750D [Brassica napus]
Length=343

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG++ S F Y +   G+T+E NYPY    G C   K  Q A  IKGF  VPA +E A
Sbjct  188  GCMGGYMNSAFNYTMTTGGLTSESNYPYKSTDGTCNINKTKQIATSIKGFEDVPANDEKA  247

Query  181  LTKAVANQP  207
            L KAVA+ P
Sbjct  248  LMKAVAHHP  256



>ref|XP_010054326.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
Length=419

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GGW+ + F Y++ N GI++E NYPY    G C    AS + AKI G+  VPA NE  
Sbjct  184  GCSGGWMDTAFDYIIQNGGISSETNYPYDASDGTCNAHMASLSVAKIVGYEDVPANNEGE  243

Query  181  LTKAVANQP  207
            + KAVA QP
Sbjct  244  ILKAVAMQP  252



>ref|XP_008800071.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE NYPY    G C   K+   AA I G+  VPA +EAA
Sbjct  187  GCGGGLMDDAFKFIIKNGGLTTEANYPYEAADGTCNAGKSHSHAATIGGYEDVPANSEAA  246

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  247  LLKAVANQP  255



>ref|XP_010906194.1| PREDICTED: senescence-specific cysteine protease SAG39-like isoform 
X1 [Elaeis guineensis]
Length=343

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG   +   +++ N G+ TE NYPY    G C  +K++  AA IKG+  VPA +EAA
Sbjct  187  GCNGGLPDAALEFIIKNGGLATETNYPYKGMDGTCNTKKSASHAASIKGYEQVPANSEAA  246

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  247  LLKAVANQP  255



>ref|XP_008800073.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE NYPY    G C   K+   AA I G+  VPA +EAA
Sbjct  187  GCGGGLMDDAFKFIIKNGGLTTEANYPYEAADGTCNAGKSHSHAATIGGYEDVPANSEAA  246

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  247  LLKAVANQP  255



>ref|XP_008663073.1| PREDICTED: ervatamin-B-like [Zea mays]
Length=352

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE  YPYT   G C   +AS  AA IKG+  VPA +EA+
Sbjct  197  GCEGGEMDDAFDFIVGNGGLTTESRYPYTASDGTCNSNEASGDAASIKGYEDVPANDEAS  256

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  257  LRKAVANQP  265



>gb|AFW86317.1| hypothetical protein ZEAMMB73_339067 [Zea mays]
Length=433

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 46/69 (67%), Gaps = 2/69 (3%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE +YPYT   G CK    S +AA IKG+  VPA +EAA
Sbjct  280  GCEGGLMDDAFKFIIKNGGLTTESSYPYTAADGKCK--SGSNSAATIKGYEDVPANDEAA  337

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  338  LMKAVANQP  346



>ref|XP_004306813.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +V+ N GI TE NYPYT   G C  +K +  AA I G   VPA +E+A
Sbjct  186  GCSGGLMDDAFQFVIQNHGINTEANYPYTAADGTCNAKKEAGHAATITGHEDVPANSESA  245

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  246  LLKAVANQP  254



>ref|XP_010939512.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=339

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG++   F YV+ N GIT+E NYPY    G C   KAS + A I G+  VPA +E++
Sbjct  184  GCQGGFMTRAFHYVINNGGITSEANYPYKAADGTCDTNKASSSVATISGYENVPANDESS  243

Query  181  LTKAVANQP  207
            L +AV+ QP
Sbjct  244  LLQAVSKQP  252



>gb|AAP32194.1| cysteine protease 1 [Trifolium repens]
Length=292

 Score = 70.9 bits (172),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G++TE  YPY    G C   KAS  A  I G+  VPA NE A
Sbjct  137  GCEGGLMDDAFKFIIQNHGLSTEVQYPYEGVDGTCNANKASIHAVTITGYEDVPANNELA  196

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  197  LQKAVANQP  205



>ref|XP_007132895.1| hypothetical protein PHAVU_011G134000g [Phaseolus vulgaris]
 gb|ESW04889.1| hypothetical protein PHAVU_011G134000g [Phaseolus vulgaris]
Length=343

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +V+ N+G++TE NYPY      C    AS  AA IKG+  VPA NE A
Sbjct  188  GCEGGLMDDAFKFVIQNQGLSTEANYPYKGTDETCNANAASGHAATIKGYEDVPANNEKA  247

Query  181  LTKAVANQP  207
            L KAV NQP
Sbjct  248  LQKAVVNQP  256



>ref|XP_006663343.1| PREDICTED: vignain-like [Oryza brachyantha]
Length=325

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG +   F ++  N GITTE NYPY   +G C R KAS     I G+  VPA +E+A
Sbjct  145  GCNGGLMDYAFQFIKKNGGITTESNYPYRAVQGRCNRAKASSHDVTIDGYEDVPANDESA  204

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  205  LQKAVANQP  213



>ref|XP_008383642.1| PREDICTED: zingipain-1-like [Malus domestica]
Length=341

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/69 (48%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GGW+ + F Y+  N GIT+EENYPY    G C   K ++AAA+I  +  VP  +E  
Sbjct  186  GCQGGWMVNAFAYIQRNXGITSEENYPYQSLEGTCDTNKENEAAAQITSYAEVPPNSETD  245

Query  181  LTKAVANQP  207
            L KAV+ QP
Sbjct  246  LLKAVSMQP  254



>ref|XP_007132875.1| hypothetical protein PHAVU_011G132100g [Phaseolus vulgaris]
 gb|ESW04869.1| hypothetical protein PHAVU_011G132100g [Phaseolus vulgaris]
Length=343

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+ TE NYP+    G C  + AS  AA I+G+  VPA NE A
Sbjct  188  GCEGGLMDDAFKFIIQNNGLNTEANYPFKGVDGTCNAKAASSHAATIRGYEDVPANNEKA  247

Query  181  LTKAVANQP  207
            L KAV NQP
Sbjct  248  LQKAVTNQP  256



>ref|XP_002446133.1| hypothetical protein SORBIDRAFT_06g002160 [Sorghum bicolor]
 gb|EES10461.1| hypothetical protein SORBIDRAFT_06g002160 [Sorghum bicolor]
Length=338

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GGW+ S F +V+ N G+ TE +YPY    G CK    S++AA IKG   VP  +EAA
Sbjct  185  GCEGGWMDSAFEFVIKNGGLATESSYPYKAVDGKCK--GGSKSAATIKGHEDVPVNDEAA  242

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  243  LMKAVANQP  251



>ref|XP_010912736.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=339

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG +   F YV+ N GITTE NYPY    G C   +AS +AA I G+  VP  +E++
Sbjct  184  GCNGGLMTRAFQYVIDNGGITTENNYPYMAADGTCDTDRASSSAATISGYENVPVNDESS  243

Query  181  LTKAVANQP  207
            L +AV+NQP
Sbjct  244  LLQAVSNQP  252



>ref|XP_007048796.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92953.1| Senescence-associated gene 12 [Theobroma cacao]
Length=343

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F ++  N+G+TTE +YPY    G C   K +  AAKI GF  VPA +E A
Sbjct  188  GCQGGLMDDAFQFIQNNKGLTTESDYPYKGVDGTCNTNKEANHAAKINGFEDVPANSEDA  247

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  248  LQKAVANQP  256



>gb|AFO83613.1| papain-like cysteine protease [Fagopyrum esculentum]
Length=362

 Score = 71.6 bits (174),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG +   F ++L N GI +EE+YPY    G C + K S     I GF  VP +NE A
Sbjct  187  GCNGGLMDHAFEFILKNGGIDSEEDYPYKAVDGQCDQSKKSNNVVSIDGFEDVPPFNERA  246

Query  181  LTKAVANQP  207
            L KAVA+QP
Sbjct  247  LKKAVAHQP  255



>ref|XP_010045987.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=364

 Score = 71.6 bits (174),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE NYPY      C  RKA+  AAKI G+  VP+ +E+A
Sbjct  209  GCGGGLMDDAFQFIISNHGLTTEANYPYQAVDNTCNARKAASTAAKISGYEDVPSNSESA  268

Query  181  LTKAVANQP  207
            L KAVA+QP
Sbjct  269  LLKAVAHQP  277



>ref|XP_004975180.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 47/69 (68%), Gaps = 2/69 (3%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG +   F +++ N G+TTE +YPY  + G CK    S +AA IKG+  VPA +EAA
Sbjct  187  GCNGGEMDDAFTFIIKNGGLTTESSYPYAAQDGQCK--AGSNSAATIKGYEDVPANDEAA  244

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  245  LMKAVANQP  253



>ref|XP_006446792.1| hypothetical protein CICLE_v10018253mg [Citrus clementina]
 gb|ESR60032.1| hypothetical protein CICLE_v10018253mg [Citrus clementina]
Length=341

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG + + F +V  N+GITTE NYPY    G C  ++ +  AAKI G   VPA +E A
Sbjct  186  GCNGGLMDNAFQFVQKNKGITTETNYPYKGVDGKCNAKEEANHAAKINGHEDVPANSETA  245

Query  181  LTKAVANQP  207
            L  AVANQP
Sbjct  246  LMNAVANQP  254



>ref|XP_008669668.1| PREDICTED: ervatamin-B-like [Zea mays]
 tpg|DAA38567.1| TPA: hypothetical protein ZEAMMB73_390779 [Zea mays]
Length=343

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GGW+ S F +V+ N G+ TE +YPY    G CK    S++AA IKG   VP  NEAA
Sbjct  190  GCEGGWMDSAFEFVIKNGGLATESSYPYKAVDGKCK--GGSKSAATIKGHEDVPPNNEAA  247

Query  181  LTKAVANQP  207
            L KAVA+QP
Sbjct  248  LMKAVASQP  256



>ref|XP_004252652.2| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=322

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE NYPY      CK  K S  AAKI  +  VPA +E+A
Sbjct  167  GCEGGLMDDAFKFIIKNHGLTTESNYPYEGTDSTCKTGKESNHAAKITSYEDVPANSESA  226

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  227  LLKAVANQP  235



>ref|XP_009390411.1| PREDICTED: vignain-like, partial [Musa acuminata subsp. malaccensis]
Length=197

 Score = 69.7 bits (169),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 38/68 (56%), Gaps = 0/68 (0%)
 Frame = +1

Query  4    CHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAAL  183
            C GGW    F +V    GITTE NYPY   +G C     S  AA I GF +VP  +E AL
Sbjct  44   CDGGWQDKAFAFVTSTGGITTEANYPYLGYQGICNITMLSDHAASIAGFEYVPVNDEKAL  103

Query  184  TKAVANQP  207
              AVANQP
Sbjct  104  MAAVANQP  111



>ref|XP_010052203.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76130.1| hypothetical protein EUGRSUZ_D00506 [Eucalyptus grandis]
Length=345

 Score = 71.2 bits (173),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG++ S F +V+ N G+TTE  YPY      C + K ++ AA I G++ VPA NE A
Sbjct  190  GCRGGYMDSAFEFVISNGGLTTEAEYPYQGTDRTCNKAKTAKHAASITGYQDVPANNEKA  249

Query  181  LTKAVANQP  207
            L +AVANQP
Sbjct  250  LLQAVANQP  258



>gb|KCW76125.1| hypothetical protein EUGRSUZ_D00501 [Eucalyptus grandis]
Length=415

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            G  GG + S F +++ N G+TTE NYPY   +G C   KA+  AA I G++ VPA NE A
Sbjct  258  GFGGGLVDSAFKFIVSNGGLTTEANYPYQGNKGTCNTAKAANPAASITGYQDVPANNEKA  317

Query  181  LTKAVANQP  207
            L +AVANQP
Sbjct  318  LLQAVANQP  326



>ref|XP_009623244.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=341

 Score = 71.2 bits (173),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE NYPY      CK  K S  AAKI G+  VP  +E+A
Sbjct  186  GCEGGLMDDAFKFIIKNNGLTTESNYPYEGTDATCKTGKESNHAAKITGYEDVPDNSESA  245

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  246  LLKAVANQP  254



>gb|KFK23231.1| hypothetical protein AALP_AAs59427U000100 [Arabis alpina]
Length=248

 Score = 70.1 bits (170),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GGW+ S F +++   G+TTE NYPY  + G C  +K +  A  I G+  VP  +E A
Sbjct  93   GCSGGWMDSAFEHIIATGGLTTESNYPYIGEDGTCNSKKTNPKATSISGYEDVPVNDEQA  152

Query  181  LTKAVANQP  207
            L KAVA+QP
Sbjct  153  LMKAVAHQP  161



>ref|XP_009344439.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
 ref|XP_009344444.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=333

 Score = 71.2 bits (173),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F ++  N GI+TE NYPY    G C  +K +  AAKI GF  VPA +E A
Sbjct  178  GCEGGLMDDAFQFIQQNHGISTEANYPYEGVDGTCNTKKETSHAAKITGFEDVPANSEKA  237

Query  181  LTKAVANQP  207
            L  AVA+QP
Sbjct  238  LLAAVAHQP  246



>ref|XP_004294729.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +V+ N GI TE NYPYT   G C  +K +  AA I G   VPA +E+A
Sbjct  185  GCSGGEMDDAFKFVIQNHGINTEANYPYTAADGTCNAKKEAGHAATITGHEDVPANSESA  244

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  245  LLKAVANQP  253



>ref|XP_008450203.1| PREDICTED: vignain-like [Cucumis melo]
Length=224

 Score = 69.7 bits (169),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 33/69 (48%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG   S F +++ N GIT E+NYPY    G+C+RR+      +I G+  VP  NE A
Sbjct  67   GCRGGHYNSAFEFIMENGGITIEDNYPYYEGDGYCRRRRGYNERVRIDGYENVPRNNEYA  126

Query  181  LTKAVANQP  207
            L KAVA+QP
Sbjct  127  LMKAVAHQP  135



>ref|XP_003526207.1| PREDICTED: thiol protease SEN102-like [Glycine max]
Length=336

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG++  GF +++ N GIT+E NYPY    G C   KA+   A+IKG+  VP  +E A
Sbjct  184  GCEGGYMEDGFEFIIKNGGITSETNYPYKAVDGKC--NKATSPVAQIKGYEKVPPNSETA  241

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  242  LQKAVANQP  250



>gb|EYU19037.1| hypothetical protein MIMGU_mgv1a018631mg [Erythranthe guttata]
Length=325

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+ G + + F +++ N G+TTE NYPY    G C  +K S   AKI G+  VPA +E+A
Sbjct  170  GCNDGLMDNAFEFIISNNGLTTESNYPYEGVDGTCNSKKESSHVAKITGYEDVPANSESA  229

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  230  LLKAVANQP  238



>ref|XP_002316833.2| hypothetical protein POPTR_0011s07520g [Populus trichocarpa]
 gb|EEE97445.2| hypothetical protein POPTR_0011s07520g [Populus trichocarpa]
Length=362

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 47/69 (68%), Gaps = 3/69 (4%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG +   F +++ N+G+TTE NYPY    G C    + +AAAKI G+  VPA +EAA
Sbjct  210  GCNGGLMDDAFDFIIQNKGLTTEANYPYQGADGAC---NSGKAAAKITGYEDVPANSEAA  266

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  267  LLKAVANQP  275



>ref|XP_008780645.1| PREDICTED: vignain-like, partial [Phoenix dactylifera]
Length=286

 Score = 70.1 bits (170),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 33/69 (48%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N+GITTE NYPY  K G C   K+S  AA I G+  VP  +E++
Sbjct  131  GCDGGIMDDAFKFIISNKGITTEANYPYMAKDGTCDTNKSSSVAATISGYEDVPRNSESS  190

Query  181  LTKAVANQP  207
            L +AVA QP
Sbjct  191  LLQAVAKQP  199



>ref|XP_011005599.1| PREDICTED: vignain-like [Populus euphratica]
Length=360

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG +   F ++   +GITTE NYPY  + G C   KA+Q A  I G   VP  NE A
Sbjct  188  GCNGGLMDYAFEFITKQKGITTEANYPYRAQDGHCDANKANQPAVSIDGHEDVPRNNENA  247

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  248  LLKAVANQP  256



>ref|XP_007132887.1| hypothetical protein PHAVU_011G133200g [Phaseolus vulgaris]
 gb|ESW04881.1| hypothetical protein PHAVU_011G133200g [Phaseolus vulgaris]
Length=343

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +V+ N+G+ TE NYPY      C    AS  AA IKG+  VPA NE A
Sbjct  188  GCEGGLMDDAFKFVIQNQGLNTEANYPYKGTDETCNANAASGHAATIKGYEDVPANNEKA  247

Query  181  LTKAVANQP  207
            L KAV NQP
Sbjct  248  LQKAVVNQP  256



>ref|XP_011008467.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=305

 Score = 70.5 bits (171),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 33/69 (48%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GCHGG++ + F Y++ N G+ +E+NYPY    G C   KAS   A+I G+  VP  NE A
Sbjct  150  GCHGGFMDNAFQYIIRNGGLASEDNYPYQGVDGTCNSEKASSIEAEITGYEDVPQNNENA  209

Query  181  LTKAVANQP  207
            L +AVA QP
Sbjct  210  LLQAVAKQP  218



>gb|KHN05804.1| Vignain [Glycine soja]
Length=295

 Score = 70.5 bits (171),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG + S F ++    GITTE NYPYT + G C   KA+  A  I G   VPA +E A
Sbjct  123  GCNGGLMESAFEFIKQKGGITTESNYPYTAQDGTCDASKANDLAVSIDGHENVPANDENA  182

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  183  LLKAVANQP  191



>ref|XP_010245279.1| PREDICTED: vignain-like [Nelumbo nucifera]
Length=361

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC+GG +   F ++    GITTE+NYPYT K+G CK  K +     I G   VPA NE A
Sbjct  191  GCNGGLMEYAFEFIKKTGGITTEKNYPYTAKQGTCKEAKKNAPVVTIDGHENVPANNEYA  250

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  251  LKKAVANQP  259



>ref|XP_002305073.2| hypothetical protein POPTR_0004s05540g [Populus trichocarpa]
 gb|EEE85584.2| hypothetical protein POPTR_0004s05540g [Populus trichocarpa]
Length=340

 Score = 70.9 bits (172),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG + + F Y++ N G+T+E+NYPY    G C   KA+   A+I G+  VP  NE A
Sbjct  185  GCQGGLMDTAFQYIIRNGGLTSEDNYPYQGVDGTCSSEKAASTEAQITGYEDVPQNNENA  244

Query  181  LTKAVANQP  207
            L +AVA QP
Sbjct  245  LLQAVAKQP  253



>ref|XP_006360708.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score = 70.9 bits (172),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG +   F +++ N G+TTE NYPY      CK  K S  AAKI  +  VPA +E+A
Sbjct  185  GCEGGLMDDAFKFIIKNHGLTTESNYPYEGTDNTCKTGKESNHAAKITSYEDVPANSESA  244

Query  181  LTKAVANQP  207
            L KAVANQP
Sbjct  245  LLKAVANQP  253



>ref|XP_004172030.1| PREDICTED: vignain-like [Cucumis sativus]
Length=351

 Score = 70.9 bits (172),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GG+  S F +++ N G+T E+NYPY    G+C+RR       +I G+  VP  NE A
Sbjct  194  GCRGGFYNSAFEFMMDNDGVTIEDNYPYYEGNGYCRRRGGRNKRVRIDGYENVPRNNEYA  253

Query  181  LTKAVANQP  207
            L KAVA+QP
Sbjct  254  LMKAVAHQP  262



>ref|XP_010914479.1| PREDICTED: ervatamin-B-like [Elaeis guineensis]
Length=340

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +1

Query  1    GCHGGWIGSGFLYVLLNRGITTEENYPYTMKRGFCKRRKASQAAAKIKGFRWVPAYNEAA  180
            GC GGW+ + F+YV+ N GI +E NY Y    G C   +    AA I G+ +VP  NE A
Sbjct  182  GCKGGWVSNAFIYVINNGGIASEVNYTYKAVTGSCAANETLYLAATISGYEFVPPNNETA  241

Query  181  LTKAVANQP  207
            L +AVANQP
Sbjct  242  LMQAVANQP  250



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 514307204152