BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1259_g1_i1 len=343 path=[1:0-342]

Length=343
                                                                      Score     E

gb|KDP38777.1|  hypothetical protein JCGZ_05113                         133   8e-36   
gb|KDP38776.1|  hypothetical protein JCGZ_05112                         131   3e-35   
gb|KDP38773.1|  hypothetical protein JCGZ_05109                         130   4e-35   
ref|XP_007132896.1|  hypothetical protein PHAVU_011G134100g             130   3e-34   
ref|XP_002523447.1|  cysteine protease, putative                        131   3e-34   Ricinus communis
ref|XP_004306851.1|  PREDICTED: vignain-like                            130   5e-34   
dbj|BAF56428.1|  cysteine proteinase                                    130   6e-34   Lotus japonicus
ref|XP_007216164.1|  hypothetical protein PRUPE_ppa015341mg             127   8e-34   
gb|KDP23193.1|  hypothetical protein JCGZ_00326                         123   1e-33   
ref|XP_007132883.1|  hypothetical protein PHAVU_011G1328000g            124   3e-33   
emb|CDP06286.1|  unnamed protein product                                127   4e-33   
emb|CDP18641.1|  unnamed protein product                                128   5e-33   
ref|XP_002316833.2|  hypothetical protein POPTR_0011s07520g             128   8e-33   Populus trichocarpa [western balsam poplar]
ref|XP_006469128.1|  PREDICTED: vignain-like                            127   8e-33   
ref|XP_006469012.1|  PREDICTED: vignain-like                            127   8e-33   
ref|XP_006446763.1|  hypothetical protein CICLE_v10017432mg             127   8e-33   
gb|KDO63329.1|  hypothetical protein CISIN_1g047793mg                   127   8e-33   
ref|XP_011045912.1|  PREDICTED: senescence-specific cysteine prot...    128   9e-33   
ref|XP_008228868.1|  PREDICTED: LOW QUALITY PROTEIN: zingipain-2-...    127   1e-32   
ref|XP_002523448.1|  cysteine protease, putative                        127   1e-32   Ricinus communis
ref|XP_002522559.1|  cysteine protease, putative                        127   2e-32   Ricinus communis
ref|XP_004301218.1|  PREDICTED: vignain-like                            122   2e-32   
ref|XP_003526232.1|  PREDICTED: vignain-like                            126   2e-32   
ref|XP_007132874.1|  hypothetical protein PHAVU_011G132000g             126   2e-32   
ref|XP_006380495.1|  hypothetical protein POPTR_0007s07290g             126   2e-32   
ref|XP_006857797.1|  hypothetical protein AMTR_s00061p00215400          126   2e-32   
gb|KHN23485.1|  Vignain                                                 123   2e-32   
ref|XP_007132865.1|  hypothetical protein PHAVU_011G131200g             126   3e-32   
ref|XP_002310053.1|  hypothetical protein POPTR_0007s07200g             126   3e-32   Populus trichocarpa [western balsam poplar]
ref|XP_006380488.1|  hypothetical protein POPTR_0007s07170g             126   3e-32   
ref|XP_006380493.1|  hypothetical protein POPTR_0007s07240g             126   3e-32   
ref|XP_006446792.1|  hypothetical protein CICLE_v10018253mg             126   3e-32   
gb|KDP21078.1|  hypothetical protein JCGZ_21549                         125   4e-32   
ref|XP_006449486.1|  hypothetical protein CICLE_v10018236mg             125   4e-32   
gb|KHN33963.1|  Vignain                                                 121   4e-32   
ref|XP_003540013.1|  PREDICTED: vignain-like                            125   5e-32   
ref|XP_006469011.1|  PREDICTED: vignain-like                            125   5e-32   
ref|XP_010035848.1|  PREDICTED: zingipain-2-like                        125   5e-32   
ref|XP_006467666.1|  PREDICTED: vignain-like                            125   5e-32   
gb|KHN27806.1|  Vignain                                                 125   5e-32   
ref|XP_003557016.1|  PREDICTED: vignain-like                            125   6e-32   
ref|XP_007132888.1|  hypothetical protein PHAVU_011G133300g             125   7e-32   
gb|KHN32069.1|  Vignain                                                 125   7e-32   
ref|XP_007132860.1|  hypothetical protein PHAVU_011G130800g             125   7e-32   
ref|XP_007048792.1|  Senescence-associated gene 12                      125   7e-32   
ref|XP_008244499.1|  PREDICTED: ervatamin-B-like                        125   7e-32   
ref|XP_008244498.1|  PREDICTED: ervatamin-B-like                        125   8e-32   
emb|CBI21973.3|  unnamed protein product                                124   8e-32   
ref|XP_007213386.1|  hypothetical protein PRUPE_ppa026372mg             125   8e-32   
ref|XP_008362423.1|  PREDICTED: vignain-like                            120   8e-32   
ref|XP_004252652.2|  PREDICTED: senescence-specific cysteine prot...    124   8e-32   
ref|XP_004306597.1|  PREDICTED: vignain-like                            125   8e-32   
ref|XP_006446793.1|  hypothetical protein CICLE_v10018274mg             125   8e-32   
ref|XP_008780365.1|  PREDICTED: vignain-like                            121   9e-32   
emb|CDP18637.1|  unnamed protein product                                123   9e-32   
ref|XP_006592465.1|  PREDICTED: vignain-like                            125   9e-32   
ref|XP_007132275.1|  hypothetical protein PHAVU_011G081100g             125   9e-32   
ref|XP_011086004.1|  PREDICTED: senescence-specific cysteine prot...    125   9e-32   
ref|XP_011038211.1|  PREDICTED: senescence-specific cysteine prot...    125   9e-32   
gb|KHN27802.1|  Vignain                                                 124   9e-32   
gb|KHN08187.1|  Thiol protease SEN102                                   124   1e-31   
ref|XP_006360708.1|  PREDICTED: vignain-like                            124   1e-31   
emb|CBI21972.3|  unnamed protein product                                124   1e-31   
ref|XP_006360707.1|  PREDICTED: vignain-like                            124   1e-31   
gb|KHN13721.1|  Vignain                                                 124   1e-31   
gb|KHN27804.1|  KDEL-tailed cysteine endopeptidase CEP1                 120   1e-31   
ref|XP_003607574.1|  Cysteine protease                                  124   1e-31   
ref|XP_002280204.1|  PREDICTED: senescence-specific cysteine prot...    124   1e-31   Vitis vinifera
ref|XP_006592467.1|  PREDICTED: vignain-like                            124   1e-31   
ref|XP_006376349.1|  hypothetical protein POPTR_0013s12260g             124   1e-31   
ref|XP_002280246.1|  PREDICTED: senescence-specific cysteine prot...    124   1e-31   Vitis vinifera
ref|XP_008228966.1|  PREDICTED: vignain-like                            121   1e-31   
ref|XP_011078542.1|  PREDICTED: senescence-specific cysteine prot...    124   1e-31   
ref|XP_009359957.1|  PREDICTED: ervatamin-B-like                        124   1e-31   
gb|AAA50755.1|  cysteine proteinase                                     124   2e-31   Alnus glutinosa
ref|XP_011078044.1|  PREDICTED: senescence-specific cysteine prot...    124   2e-31   
ref|XP_008780330.1|  PREDICTED: vignain-like                            120   2e-31   
ref|XP_007132895.1|  hypothetical protein PHAVU_011G134000g             124   2e-31   
ref|XP_006376351.1|  hypothetical protein POPTR_0013s12280g             124   2e-31   
ref|XP_007132861.1|  hypothetical protein PHAVU_011G130900g             124   2e-31   
ref|XP_004506025.1|  PREDICTED: vignain-like                            124   2e-31   
gb|AAP32195.1|  cysteine protease 5                                     124   2e-31   Trifolium repens [creeping white clover]
emb|CAN70559.1|  hypothetical protein VITISV_032465                     124   2e-31   Vitis vinifera
gb|AAP32198.1|  cysteine protease 12                                    124   2e-31   Trifolium repens [creeping white clover]
ref|XP_004252606.1|  PREDICTED: senescence-specific cysteine prot...    124   2e-31   
ref|XP_007132887.1|  hypothetical protein PHAVU_011G133200g             124   2e-31   
ref|XP_008362418.1|  PREDICTED: vignain-like                            120   2e-31   
ref|XP_006857796.1|  hypothetical protein AMTR_s00061p00215230          124   2e-31   
dbj|BAF56427.1|  cysteine proteinase                                    124   2e-31   Lotus japonicus
ref|XP_007050065.1|  Senescence-associated gene 12                      124   2e-31   
ref|XP_004297572.1|  PREDICTED: vignain-like                            123   3e-31   
gb|KDP23983.1|  hypothetical protein JCGZ_25371                         123   3e-31   
ref|XP_007025398.1|  Senescence-associated gene 12                      123   3e-31   
emb|CAN62459.1|  hypothetical protein VITISV_015168                     121   3e-31   Vitis vinifera
ref|XP_008225269.1|  PREDICTED: uncharacterized protein LOC103324934    127   3e-31   
ref|XP_011009172.1|  PREDICTED: senescence-specific cysteine prot...    123   3e-31   
ref|XP_011014442.1|  PREDICTED: senescence-specific cysteine prot...    123   3e-31   
ref|XP_007132875.1|  hypothetical protein PHAVU_011G132100g             123   3e-31   
ref|XP_009354319.1|  PREDICTED: vignain-like                            120   4e-31   
ref|XP_002531152.1|  cysteine protease, putative                        123   4e-31   Ricinus communis
ref|XP_002531151.1|  cysteine protease, putative                        123   4e-31   Ricinus communis
ref|XP_004297571.1|  PREDICTED: vignain-like                            123   4e-31   
ref|XP_011037399.1|  PREDICTED: senescence-specific cysteine prot...    123   4e-31   
ref|XP_002307151.2|  hypothetical protein POPTR_0005s09140g             122   5e-31   Populus trichocarpa [western balsam poplar]
ref|XP_003605890.1|  Cysteine proteinase                                123   5e-31   
ref|XP_006376431.1|  hypothetical protein POPTR_0013s12980g             123   5e-31   
ref|XP_010045986.1|  PREDICTED: ervatamin-B-like                        123   5e-31   
ref|XP_009354265.1|  PREDICTED: ervatamin-B-like                        123   5e-31   
ref|XP_010045988.1|  PREDICTED: ervatamin-B-like                        122   5e-31   
ref|XP_007214432.1|  hypothetical protein PRUPE_ppa025658mg             122   5e-31   
ref|XP_008353753.1|  PREDICTED: vignain-like                            118   5e-31   
emb|CAN64655.1|  hypothetical protein VITISV_005140                     122   5e-31   Vitis vinifera
gb|KHN33968.1|  Vignain                                                 120   5e-31   
dbj|BAF56430.1|  cysteine proteinase                                    122   6e-31   Lotus japonicus
ref|XP_008780633.1|  PREDICTED: vignain-like                            119   6e-31   
ref|XP_007212667.1|  hypothetical protein PRUPE_ppa018342mg             122   6e-31   
ref|XP_008228922.1|  PREDICTED: vignain-like                            122   6e-31   
ref|XP_009629965.1|  PREDICTED: ervatamin-B-like                        122   6e-31   
ref|XP_011086001.1|  PREDICTED: senescence-specific cysteine prot...    122   6e-31   
ref|XP_011022002.1|  PREDICTED: senescence-specific cysteine prot...    122   7e-31   
gb|AAP32196.1|  cysteine protease 8                                     122   7e-31   Trifolium repens [creeping white clover]
ref|XP_004290089.1|  PREDICTED: vignain-like                            122   7e-31   
gb|KHN07749.1|  Vignain                                                 121   7e-31   
ref|XP_010038688.1|  PREDICTED: ervatamin-B-like                        122   8e-31   
ref|XP_004505502.1|  PREDICTED: vignain-like                            122   8e-31   
ref|XP_008342800.1|  PREDICTED: thiol protease SEN102-like              120   8e-31   
ref|XP_008244476.1|  PREDICTED: ervatamin-B-like                        122   9e-31   
ref|XP_007212585.1|  hypothetical protein PRUPE_ppa015944mg             122   9e-31   
gb|KHN07750.1|  KDEL-tailed cysteine endopeptidase CEP1                 121   9e-31   
ref|XP_003609015.1|  Cysteine proteinase                                122   1e-30   
ref|XP_003607571.1|  Cysteine proteinase EP-B                           122   1e-30   
ref|XP_006857795.1|  hypothetical protein AMTR_s00061p00215070          122   1e-30   
ref|XP_003612210.1|  Cysteine proteinase                                122   1e-30   
ref|XP_006852525.1|  hypothetical protein AMTR_s00021p00178750          119   1e-30   
ref|XP_008800071.1|  PREDICTED: ervatamin-B-like                        122   1e-30   
ref|XP_004303175.1|  PREDICTED: vignain-like                            122   1e-30   
ref|XP_009775915.1|  PREDICTED: ervatamin-B-like                        122   1e-30   
ref|XP_003607548.1|  Cysteine protease                                  122   1e-30   
ref|XP_011086005.1|  PREDICTED: senescence-specific cysteine prot...    122   1e-30   
dbj|BAF46311.1|  cysteine proteinase precursor                          122   1e-30   Ipomoea nil [qian niu]
ref|XP_002306369.1|  hypothetical protein POPTR_0005s09080g             121   1e-30   Populus trichocarpa [western balsam poplar]
gb|AAK27968.1|AF242372_1  cysteine protease                             121   1e-30   Ipomoea batatas [batate]
ref|XP_003527388.1|  PREDICTED: vignain-like                            121   2e-30   
ref|XP_007213554.1|  hypothetical protein PRUPE_ppa018048mg             121   2e-30   
ref|XP_010091034.1|  KDEL-tailed cysteine endopeptidase CEP1            121   2e-30   
ref|XP_004505500.1|  PREDICTED: vignain-like                            121   2e-30   
gb|AAL14199.1|  cysteine proteinase precursor                           121   2e-30   Ipomoea batatas [batate]
gb|AAT34987.1|  putative cysteine protease                              121   2e-30   Gossypium hirsutum [American cotton]
ref|XP_007048796.1|  Senescence-associated gene 12                      121   2e-30   
dbj|BAB13759.1|  cysteine proteinase                                    121   2e-30   Astragalus sinicus
gb|KCW47322.1|  hypothetical protein EUGRSUZ_K01110                     120   2e-30   
emb|CAL64936.1|  putative cysteine protease 8                           121   2e-30   Trifolium pratense [peavine clover]
ref|XP_004505461.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    121   2e-30   
ref|XP_008800073.1|  PREDICTED: ervatamin-B-like                        121   2e-30   
emb|CDP18645.1|  unnamed protein product                                121   2e-30   
ref|XP_010103045.1|  KDEL-tailed cysteine endopeptidase CEP1            121   2e-30   
dbj|BAD29955.1|  cysteine protease                                      121   2e-30   Daucus carota [carrots]
ref|XP_010038689.1|  PREDICTED: ervatamin-B-like                        121   2e-30   
gb|AFV30165.1|  cysteine proteinase                                     121   2e-30   
gb|EYU19040.1|  hypothetical protein MIMGU_mgv1a026538mg                120   2e-30   
ref|XP_003527350.1|  PREDICTED: vignain-like                            121   2e-30   
gb|EYU19037.1|  hypothetical protein MIMGU_mgv1a018631mg                120   2e-30   
ref|XP_004252607.1|  PREDICTED: senescence-specific cysteine prot...    120   3e-30   
ref|XP_008340724.1|  PREDICTED: vignain-like                            120   3e-30   
gb|AAU81592.1|  cysteine proteinase                                     117   3e-30   Petunia x hybrida [garden petunia]
gb|KHN32068.1|  Vignain                                                 120   3e-30   
gb|KHN13720.1|  Vignain                                                 120   3e-30   
ref|XP_003539970.1|  PREDICTED: vignain-like                            120   3e-30   
emb|CCI46913.1|  unnamed protein product                                122   3e-30   
ref|XP_004505498.1|  PREDICTED: vignain-like                            120   3e-30   
ref|XP_011038210.1|  PREDICTED: senescence-specific cysteine prot...    120   3e-30   
ref|XP_003539989.1|  PREDICTED: vignain-like                            120   3e-30   
ref|XP_010442505.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    121   3e-30   
ref|XP_006857794.1|  hypothetical protein AMTR_s00061p00214890          120   3e-30   
gb|AAP32194.1|  cysteine protease 1                                     120   3e-30   Trifolium repens [creeping white clover]
ref|XP_008223852.1|  PREDICTED: ervatamin-B-like                        120   3e-30   
ref|XP_003529366.1|  PREDICTED: thiol protease SEN102-like              120   4e-30   
ref|XP_002525124.1|  cysteine protease, putative                        120   4e-30   Ricinus communis
gb|KDP40484.1|  hypothetical protein JCGZ_24483                         120   4e-30   
gb|KHN33962.1|  Vignain                                                 120   4e-30   
ref|XP_003527349.1|  PREDICTED: vignain-like                            120   4e-30   
ref|XP_003556992.1|  PREDICTED: vignain-like                            120   4e-30   
gb|AAP32197.1|  cysteine protease 10                                    119   4e-30   Trifolium repens [creeping white clover]
gb|EYU25672.1|  hypothetical protein MIMGU_mgv1a018700mg                120   4e-30   
ref|XP_008353750.1|  PREDICTED: ervatamin-B-like                        120   4e-30   
ref|XP_008368631.1|  PREDICTED: ervatamin-B-like                        120   4e-30   
ref|XP_007048674.1|  Senescence-associated gene 12                      120   5e-30   
gb|KDP31767.1|  hypothetical protein JCGZ_12228                         119   5e-30   
ref|XP_004515849.1|  PREDICTED: vignain-like                            120   5e-30   
emb|CBI21975.3|  unnamed protein product                                119   5e-30   
emb|CBI21976.3|  unnamed protein product                                119   6e-30   
ref|XP_008342781.1|  PREDICTED: ervatamin-B-like                        120   6e-30   
ref|XP_008223851.1|  PREDICTED: ervatamin-B-like                        120   6e-30   
ref|XP_009354269.1|  PREDICTED: ervatamin-B-like                        120   6e-30   
ref|XP_008342782.1|  PREDICTED: ervatamin-B-like                        120   6e-30   
ref|XP_008342777.1|  PREDICTED: ervatamin-B-like                        120   6e-30   
ref|XP_010052206.1|  PREDICTED: ervatamin-B-like                        120   6e-30   
ref|XP_008362421.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...    120   6e-30   
gb|KHN05669.1|  Vignain                                                 119   7e-30   
ref|XP_002280230.2|  PREDICTED: LOW QUALITY PROTEIN: senescence-s...    120   7e-30   Vitis vinifera
gb|KCW76137.1|  hypothetical protein EUGRSUZ_D00513                     119   7e-30   
emb|CDP18644.1|  unnamed protein product                                119   7e-30   
ref|XP_009354268.1|  PREDICTED: ervatamin-B-like                        119   7e-30   
ref|XP_004294729.1|  PREDICTED: vignain-like                            119   7e-30   
ref|XP_010317330.1|  PREDICTED: uncharacterized protein LOC101251741    123   8e-30   
ref|XP_009359967.1|  PREDICTED: vignain-like                            119   8e-30   
ref|XP_009361500.1|  PREDICTED: vignain-like                            119   9e-30   
ref|XP_009359979.1|  PREDICTED: ervatamin-B-like                        119   9e-30   
ref|XP_004979206.1|  PREDICTED: vignain-like                            120   9e-30   
ref|XP_009357171.1|  PREDICTED: ervatamin-B-like                        119   9e-30   
dbj|BAB70668.1|  cysteine proteinase                                    115   1e-29   Daucus carota [carrots]
ref|XP_009344439.1|  PREDICTED: ervatamin-B-like                        119   1e-29   
ref|XP_009623244.1|  PREDICTED: ervatamin-B-like                        119   1e-29   
ref|XP_010277773.1|  PREDICTED: senescence-specific cysteine prot...    119   1e-29   
gb|EYU25679.1|  hypothetical protein MIMGU_mgv1a023356mg                119   1e-29   
ref|XP_009357173.1|  PREDICTED: ervatamin-B-like                        119   1e-29   
ref|XP_006582264.1|  PREDICTED: vignain-like                            119   1e-29   
ref|XP_008348586.1|  PREDICTED: ervatamin-B-like                        119   1e-29   
ref|XP_009354321.1|  PREDICTED: ervatamin-B-like                        119   1e-29   
ref|XP_009357172.1|  PREDICTED: ervatamin-B-like                        119   1e-29   
gb|KHN08873.1|  Vignain                                                 119   2e-29   
ref|NP_001130571.1|  uncharacterized protein LOC100191670               115   2e-29   Zea mays [maize]
ref|XP_008382007.1|  PREDICTED: ervatamin-B-like                        119   2e-29   
ref|XP_004148072.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    118   2e-29   
ref|XP_004487576.1|  PREDICTED: vignain-like                            119   2e-29   
gb|KHN38752.1|  Vignain                                                 118   2e-29   
ref|XP_002280215.1|  PREDICTED: senescence-specific cysteine prot...    119   2e-29   Vitis vinifera
gb|KDP23984.1|  hypothetical protein JCGZ_25372                         119   2e-29   
ref|NP_001151278.1|  LOC100284911 precursor                             119   2e-29   Zea mays [maize]
ref|XP_003526229.1|  PREDICTED: vignain-like                            117   2e-29   
ref|XP_007048673.1|  Senescence-associated gene 12, putative            118   2e-29   
ref|XP_008805390.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...    118   2e-29   
gb|KGN62053.1|  hypothetical protein Csa_2G292830                       118   2e-29   
gb|EYU43350.1|  hypothetical protein MIMGU_mgv1a021555mg                118   2e-29   
ref|XP_004306836.1|  PREDICTED: vignain-like                            118   2e-29   
ref|XP_003538185.1|  PREDICTED: vignain-like                            118   2e-29   
ref|XP_009349242.1|  PREDICTED: vignain-like                            119   2e-29   
ref|XP_011078435.1|  PREDICTED: senescence-specific cysteine prot...    118   2e-29   
ref|XP_008221945.1|  PREDICTED: vignain-like                            119   2e-29   
ref|XP_011021998.1|  PREDICTED: senescence-specific cysteine prot...    118   2e-29   
emb|CBI30671.3|  unnamed protein product                                118   2e-29   
gb|EYU25680.1|  hypothetical protein MIMGU_mgv1a019612mg                118   2e-29   
tpg|DAA48694.1|  TPA: vignain                                           119   2e-29   
ref|XP_003624039.1|  Cysteine protease                                  113   3e-29   
ref|XP_002274223.1|  PREDICTED: senescence-specific cysteine prot...    118   3e-29   Vitis vinifera
ref|XP_010906196.1|  PREDICTED: senescence-specific cysteine prot...    118   3e-29   
ref|XP_008342776.1|  PREDICTED: ervatamin-B-like                        118   3e-29   
gb|ACN27279.1|  unknown                                                 117   3e-29   Zea mays [maize]
tpg|DAA42119.1|  TPA: hypothetical protein ZEAMMB73_388689              116   3e-29   
gb|KDP45578.1|  hypothetical protein JCGZ_17185                         118   3e-29   
ref|XP_010102922.1|  hypothetical protein L484_018940                   118   3e-29   
ref|XP_007226517.1|  hypothetical protein PRUPE_ppa025615mg             118   3e-29   
ref|XP_006362426.1|  PREDICTED: vignain-like                            118   3e-29   
ref|XP_006582263.1|  PREDICTED: vignain-like                            117   3e-29   
ref|XP_009767421.1|  PREDICTED: ervatamin-B-like                        117   4e-29   
ref|XP_009365508.1|  PREDICTED: vignain-like                            119   4e-29   
ref|XP_007132814.1|  hypothetical protein PHAVU_011G126700g             117   4e-29   
emb|CAN62838.1|  hypothetical protein VITISV_003391                     117   4e-29   Vitis vinifera
ref|XP_002450949.1|  hypothetical protein SORBIDRAFT_05g021550          118   4e-29   Sorghum bicolor [broomcorn]
gb|AAU81596.1|  cysteine proteinase                                     113   4e-29   Petunia x hybrida [garden petunia]
ref|XP_007137980.1|  hypothetical protein PHAVU_009G170800g             118   4e-29   
ref|XP_009786836.1|  PREDICTED: vignain-like                            114   4e-29   
ref|XP_007227669.1|  hypothetical protein PRUPE_ppa025602mg             117   4e-29   
ref|XP_007226492.1|  hypothetical protein PRUPE_ppa026538mg             117   4e-29   
sp|P25803.2|CYSEP_PHAVU  RecName: Full=Vignain; AltName: Full=Bea...    117   5e-29   Phaseolus vulgaris [French bean]
emb|CAA40073.1|  endopeptidase (EP-C1)                                  117   5e-29   Phaseolus vulgaris [French bean]
ref|XP_009774957.1|  PREDICTED: vignain-like                            117   5e-29   
ref|XP_002525123.1|  cysteine protease, putative                        117   5e-29   Ricinus communis
gb|KHG19293.1|  Vignain                                                 114   5e-29   
ref|XP_010441769.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    117   6e-29   
ref|XP_009617207.1|  PREDICTED: vignain-like                            117   6e-29   
ref|XP_009779832.1|  PREDICTED: vignain-like                            117   6e-29   
gb|KHG13330.1|  Vignain                                                 117   6e-29   
ref|XP_004487578.1|  PREDICTED: vignain-like isoform X2                 117   6e-29   
emb|CBI21977.3|  unnamed protein product                                116   7e-29   
ref|XP_004306813.1|  PREDICTED: vignain-like                            117   7e-29   
ref|XP_003638507.1|  Cysteine proteinase                                117   7e-29   
ref|XP_002280263.1|  PREDICTED: senescence-specific cysteine prot...    117   7e-29   Vitis vinifera
ref|XP_008805113.1|  PREDICTED: vignain-like                            117   7e-29   
ref|XP_004487577.1|  PREDICTED: vignain-like isoform X1                 117   7e-29   
dbj|BAD29959.1|  cysteine protease                                      117   7e-29   
ref|XP_002445702.1|  hypothetical protein SORBIDRAFT_07g024430          117   7e-29   
ref|XP_004308524.1|  PREDICTED: vignain-like                            117   8e-29   
ref|XP_002976004.1|  hypothetical protein SELMODRAFT_104486             116   8e-29   
emb|CDY34045.1|  BnaC03g27700D                                          117   8e-29   
ref|XP_004236298.1|  PREDICTED: vignain-like                            117   8e-29   
emb|CDP05747.1|  unnamed protein product                                117   9e-29   
ref|XP_007132822.1|  hypothetical protein PHAVU_011G127400g             116   9e-29   
gb|AAW78660.1|  cysteine protease                                       117   1e-28   
ref|XP_009798361.1|  PREDICTED: ervatamin-B-like                        116   1e-28   
gb|ACG38044.1|  vignain precursor                                       117   1e-28   
ref|XP_009601308.1|  PREDICTED: ervatamin-B-like isoform X3             116   1e-28   
gb|AFK44139.1|  unknown                                                 116   1e-28   
ref|XP_003607647.1|  Cysteine proteinase                                116   1e-28   
ref|XP_006592475.1|  PREDICTED: vignain-like                            116   1e-28   
gb|KHN27797.1|  Thiol protease SEN102                                   116   1e-28   
ref|XP_002456807.1|  hypothetical protein SORBIDRAFT_03g043220          117   1e-28   
ref|XP_010045987.1|  PREDICTED: ervatamin-B-like                        116   1e-28   
ref|XP_009601307.1|  PREDICTED: ervatamin-B-like isoform X2             116   1e-28   
ref|XP_006281607.1|  hypothetical protein CARUB_v10027725mg             116   1e-28   
ref|XP_009601306.1|  PREDICTED: ervatamin-B-like isoform X1             116   1e-28   
gb|AAR92154.1|  putative cysteine protease 1                            116   1e-28   
ref|XP_002968178.1|  hypothetical protein SELMODRAFT_89437              116   1e-28   
emb|CDM83196.1|  unnamed protein product                                116   1e-28   
gb|KHN07963.1|  Vignain                                                 115   1e-28   
ref|XP_002525147.1|  cysteine protease, putative                        116   2e-28   
gb|KDP45355.1|  hypothetical protein JCGZ_09604                         115   2e-28   
ref|XP_002515048.1|  cysteine protease, putative                        116   2e-28   
ref|XP_007132817.1|  hypothetical protein PHAVU_011G127000g             116   2e-28   
ref|XP_004489011.1|  PREDICTED: vignain-like                            116   2e-28   
ref|XP_006388352.1|  hypothetical protein POPTR_0213s00210g             113   2e-28   
ref|XP_009617815.1|  PREDICTED: ervatamin-B-like                        116   2e-28   
ref|XP_009392372.1|  PREDICTED: ervatamin-B-like                        114   2e-28   
gb|AIG55389.1|  secreted protein                                        117   2e-28   
gb|AFP20583.1|  cysteine endopeptidase                                  112   2e-28   
ref|XP_010519533.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    116   2e-28   
ref|XP_009797968.1|  PREDICTED: vignain-like                            115   2e-28   
ref|XP_006659684.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    116   2e-28   
ref|XP_010099379.1|  KDEL-tailed cysteine endopeptidase CEP1            115   2e-28   
ref|XP_003599736.1|  Cysteine proteinase                                115   2e-28   
ref|NP_568722.1|  KDEL-tailed cysteine endopeptidase CEP1               115   2e-28   
ref|XP_007214244.1|  hypothetical protein PRUPE_ppa023515mg             115   2e-28   
ref|XP_004501841.1|  PREDICTED: vignain-like                            115   2e-28   
emb|CDP15086.1|  unnamed protein product                                115   2e-28   
gb|AAD10337.1|  cysteine proteinase precursor                           115   3e-28   
ref|XP_010927557.1|  PREDICTED: thiol protease SEN102-like              110   3e-28   
ref|XP_006351440.1|  PREDICTED: vignain-like                            115   3e-28   
ref|XP_008229136.1|  PREDICTED: zingipain-2                             115   3e-28   
emb|CAB09699.1|  cysteine endopeptidase EP-A                            115   3e-28   
emb|CAB09697.1|  cysteine endopeptidase EP-A                            115   3e-28   
gb|ABV22590.1|  KDEL-tailed cysteine endopeptidase                      115   3e-28   
gb|EMT09278.1|  Vignain                                                 109   3e-28   
gb|AEP83812.2|  cysteine endopeptidase EP8                              115   3e-28   
sp|P12412.1|CYSEP_VIGMU  RecName: Full=Vignain; AltName: Full=Bea...    115   3e-28   
ref|XP_002446128.1|  hypothetical protein SORBIDRAFT_06g002110          112   3e-28   
ref|XP_004169046.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    115   3e-28   
prf||1910332A  Cys endopeptidase                                        115   3e-28
gb|ACB70409.1|  cysteine protease                                       115   3e-28   
ref|XP_010906195.1|  PREDICTED: senescence-specific cysteine prot...    113   3e-28   
ref|XP_007025415.1|  Senescence-associated gene 12, putative            115   4e-28   
ref|XP_006645196.1|  PREDICTED: cysteine proteinase EP-B 2-like         115   4e-28   
gb|AAC35211.1|  cysteine proteinase                                     115   4e-28   
pdb|2FO5|A  Chain A, Crystal Structure Of Recombinant Barley Cyst...    113   4e-28   
ref|XP_004505458.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    115   4e-28   
gb|EMT15476.1|  Cysteine proteinase EP-B 2                              115   5e-28   
ref|XP_006280686.1|  hypothetical protein CARUB_v10026650mg             115   5e-28   
gb|AHA62780.1|  RCR3-like cysteine protease                             114   5e-28   
gb|AHA62781.1|  RCR3-like cysteine protease                             114   5e-28   
gb|AHA62779.1|  RCR3-like cysteine protease                             114   5e-28   
gb|EMS68721.1|  Cysteine proteinase EP-B 2                              111   5e-28   
ref|XP_004974180.1|  PREDICTED: vignain-like                            115   5e-28   
ref|XP_004515851.1|  PREDICTED: vignain-like                            115   6e-28   
gb|KHN32338.1|  KDEL-tailed cysteine endopeptidase CEP2                 109   6e-28   
ref|XP_006582267.1|  PREDICTED: thiol protease SEN102-like              114   6e-28   
sp|P25249.1|CYSP1_HORVU  RecName: Full=Cysteine proteinase EP-B 1...    115   6e-28   
ref|XP_008458487.1|  PREDICTED: ervatamin-B-like                        114   6e-28   
ref|XP_006362420.1|  PREDICTED: vignain-like                            114   6e-28   
gb|KHN05804.1|  Vignain                                                 114   6e-28   
ref|XP_004233054.1|  PREDICTED: senescence-specific cysteine prot...    114   6e-28   
ref|XP_010906194.1|  PREDICTED: senescence-specific cysteine prot...    114   7e-28   
ref|XP_010929952.1|  PREDICTED: vignain isoform X1                      114   7e-28   
gb|KHN28095.1|  Thiol protease                                          114   7e-28   
ref|XP_003526207.1|  PREDICTED: thiol protease SEN102-like              114   7e-28   
ref|XP_002321655.1|  hypothetical protein POPTR_0015s09900g             114   7e-28   
ref|XP_002980210.1|  hypothetical protein SELMODRAFT_153766             115   8e-28   
ref|XP_010477339.1|  PREDICTED: xylem cysteine proteinase 2-like        109   8e-28   
ref|XP_009592654.1|  PREDICTED: zingipain-2-like                        113   9e-28   
gb|ADV74756.1|  cysteine protease                                       114   9e-28   
emb|CAH66275.1|  OSIGBa0147O06.5                                        114   9e-28   
gb|ACY38051.3|  cysteine proteinase C1A                                 114   9e-28   
ref|XP_011071164.1|  PREDICTED: vignain-like                            114   9e-28   
ref|XP_008780645.1|  PREDICTED: vignain-like                            113   9e-28   
ref|XP_011072006.1|  PREDICTED: vignain-like                            114   9e-28   
ref|XP_008650514.1|  PREDICTED: vignain-like                            112   9e-28   
ref|XP_009420878.1|  PREDICTED: vignain-like                            114   9e-28   
ref|XP_010682353.1|  PREDICTED: vignain-like                            114   9e-28   
gb|EAZ43631.1|  hypothetical protein OsJ_28254                          114   9e-28   
ref|XP_006367781.1|  PREDICTED: LOW QUALITY PROTEIN: KDEL-tailed ...    114   1e-27   
gb|AAA92063.1|  cysteinyl endopeptidase                                 114   1e-27   
ref|XP_002864049.1|  hypothetical protein ARALYDRAFT_495086             114   1e-27   
ref|XP_009366072.1|  PREDICTED: zingipain-2-like                        114   1e-27   
ref|XP_009759551.1|  PREDICTED: zingipain-2-like                        114   1e-27   
tpg|DAA42116.1|  TPA: hypothetical protein ZEAMMB73_388689              114   1e-27   
ref|NP_001237199.1|  cysteine proteinase precursor                      114   1e-27   
ref|NP_001237379.1|  cysteine proteinase precursor                      114   1e-27   
tpg|DAA56254.1|  TPA: hypothetical protein ZEAMMB73_708930              114   1e-27   
ref|NP_001052232.2|  Os04g0203500                                       114   1e-27   
ref|XP_011005599.1|  PREDICTED: vignain-like                            114   1e-27   
ref|XP_008869517.1|  hypothetical protein H310_06290                    115   1e-27   
sp|A2XQE8.1|SAG39_ORYSI  RecName: Full=Senescence-specific cystei...    114   1e-27   
sp|Q7XWK5.2|SAG39_ORYSJ  RecName: Full=Senescence-specific cystei...    114   1e-27   
ref|XP_010279240.1|  PREDICTED: zingipain-2                             114   1e-27   
ref|XP_009608954.1|  PREDICTED: zingipain-2-like                        114   1e-27   
gb|ADV41672.1|  cysteine protease                                       114   1e-27   
gb|AAW78661.2|  senescence-specific cysteine protease                   114   1e-27   
ref|NP_001062479.1|  Os08g0556900                                       114   1e-27   
gb|KDP23192.1|  hypothetical protein JCGZ_00325                         108   1e-27   
gb|AFK46775.1|  unknown                                                 114   1e-27   
ref|XP_007208485.1|  hypothetical protein PRUPE_ppa018558mg             111   1e-27   
gb|ACJ85307.1|  unknown                                                 114   1e-27   
ref|NP_001045138.1|  Os01g0907600                                       114   1e-27   
gb|AAA79915.1|  cysteine proteinase                                     114   1e-27   
ref|XP_002963113.1|  hypothetical protein SELMODRAFT_270344             114   1e-27   
ref|XP_008869518.1|  hypothetical protein H310_06291                    114   1e-27   
gb|KEH31736.1|  KDEL-tailed cysteine endopeptidase CEP1                 114   1e-27   
emb|CAE03344.2|  OSJNBb0005B05.11                                       113   1e-27   
ref|XP_003564878.1|  PREDICTED: cysteine proteinase EP-B 1-like         114   1e-27   
ref|XP_006341791.1|  PREDICTED: vignain-like                            113   1e-27   
gb|AFW86314.1|  hypothetical protein ZEAMMB73_546353                    111   2e-27   
gb|ABQ10204.1|  cysteine protease Cp6                                   114   2e-27   
dbj|BAA11170.1|  cysteine proteinase                                    113   2e-27   
ref|XP_010477341.1|  PREDICTED: xylem cysteine proteinase 2-like        109   2e-27   
ref|XP_004231872.1|  PREDICTED: zingipain-2-like                        113   2e-27   
ref|XP_011009181.1|  PREDICTED: senescence-specific cysteine prot...    112   2e-27   
ref|XP_003596711.1|  Cysteine proteinase                                113   2e-27   
gb|KDO77830.1|  hypothetical protein CISIN_1g043883mg                   113   2e-27   
gb|AFW84254.1|  hypothetical protein ZEAMMB73_933931                    114   2e-27   
gb|EPS57605.1|  cysteine proteinase                                     110   2e-27   
ref|XP_011005600.1|  PREDICTED: vignain                                 113   2e-27   
gb|AAD20453.1|  cysteine endopeptidase precursor                        113   2e-27   
ref|XP_008225221.1|  PREDICTED: vignain-like                            110   2e-27   
gb|KHN12136.1|  KDEL-tailed cysteine endopeptidase CEP1                 108   2e-27   
ref|XP_006439985.1|  hypothetical protein CICLE_v10020781mg             113   2e-27   
gb|AGT97048.1|  senescence-specific cysteine protease                   113   2e-27   
sp|P25250.1|CYSP2_HORVU  RecName: Full=Cysteine proteinase EP-B 2...    113   2e-27   
ref|XP_004239155.1|  PREDICTED: vignain-like                            113   2e-27   
ref|XP_006476933.1|  PREDICTED: vignain-like                            113   2e-27   
ref|XP_008678577.1|  PREDICTED: oryzain alpha chain-like                113   2e-27   
ref|XP_009333898.1|  PREDICTED: vignain                                 113   2e-27   
ref|XP_003578815.1|  PREDICTED: senescence-specific cysteine prot...    113   2e-27   
dbj|BAC75924.1|  cysteine protease-2                                    113   2e-27   
ref|XP_010045985.1|  PREDICTED: ervatamin-B-like                        113   2e-27   
ref|XP_007132818.1|  hypothetical protein PHAVU_011G127100g             113   2e-27   
ref|XP_002436841.1|  hypothetical protein SORBIDRAFT_10g009840          112   2e-27   
ref|XP_007025397.1|  Senescence-associated gene 12, putative            112   2e-27   
ref|XP_006663940.1|  PREDICTED: thiol protease SEN102-like              113   2e-27   
ref|XP_002436842.1|  hypothetical protein SORBIDRAFT_10g009850          112   3e-27   
ref|XP_008659445.1|  PREDICTED: ervatamin-B-like                        112   3e-27   
ref|XP_010426325.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    113   3e-27   
ref|XP_007214465.1|  hypothetical protein PRUPE_ppa023848mg             112   3e-27   
ref|NP_001176897.1|  Os12g0273900                                       109   3e-27   
emb|CCA19507.1|  cysteine protease family C01A putative                 114   3e-27   
ref|XP_006449485.1|  hypothetical protein CICLE_v10017834mg             112   3e-27   
ref|XP_003607546.1|  Cysteine proteinase                                112   3e-27   
gb|KDP30997.1|  hypothetical protein JCGZ_11373                         112   3e-27   
ref|NP_001140873.1|  uncharacterized protein LOC100272949 precursor     112   3e-27   
ref|XP_010536661.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    112   3e-27   
ref|XP_003578808.1|  PREDICTED: senescence-specific cysteine prot...    112   3e-27   
gb|AFW84255.1|  hypothetical protein ZEAMMB73_933931                    112   3e-27   
ref|NP_001104879.1|  cysteine proteinase Mir3 precursor                 113   3e-27   
ref|XP_008246379.1|  PREDICTED: vignain-like                            111   3e-27   
gb|AAR92155.1|  putative cysteine protease 2                            112   3e-27   
ref|XP_008364019.1|  PREDICTED: zingipain-2-like                        112   4e-27   
ref|XP_011014387.1|  PREDICTED: senescence-specific cysteine prot...    109   4e-27   
gb|AFW76902.1|  hypothetical protein ZEAMMB73_056195                    112   4e-27   
ref|XP_010099502.1|  KDEL-tailed cysteine endopeptidase CEP2            112   4e-27   
ref|XP_006384061.1|  hypothetical protein POPTR_0004s05530g             109   4e-27   
pdb|1S4V|A  Chain A, The 2.0 A Crystal Structure Of The Kdel-Tail...    110   4e-27   
ref|XP_007050023.1|  Cysteine proteinases superfamily protein, pu...    112   4e-27   
ref|XP_008779806.1|  PREDICTED: ervatamin-B-like                        112   4e-27   
ref|XP_011005484.1|  PREDICTED: senescence-specific cysteine prot...    109   4e-27   
dbj|BAJ85145.1|  predicted protein                                      112   4e-27   
ref|XP_010691718.1|  PREDICTED: cysteine proteinase RD21a-like          113   4e-27   
dbj|BAF56429.1|  cysteine proteinase                                    112   4e-27   
ref|XP_010052197.1|  PREDICTED: ervatamin-B-like                        112   4e-27   
gb|KHG19386.1|  KDEL-tailed cysteine endopeptidase CEP2 -like pro...    111   4e-27   
ref|XP_004970977.1|  PREDICTED: cysteine proteinase EP-B 2-like         112   4e-27   
emb|CDO96765.1|  unnamed protein product                                111   5e-27   
ref|XP_002312656.2|  hypothetical protein POPTR_0008s18350g             112   5e-27   
ref|XP_008663073.1|  PREDICTED: ervatamin-B-like                        112   5e-27   
gb|EMT20796.1|  Vignain                                                 112   5e-27   
ref|XP_006468204.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    112   5e-27   
ref|XP_008451198.1|  PREDICTED: xylem cysteine proteinase 1-like        112   5e-27   
gb|ABW37112.1|  cysteine proteinase                                     108   5e-27   
gb|EMT29822.1|  Vignain                                                 112   5e-27   
gb|EMS56453.1|  KDEL-tailed cysteine endopeptidase CEP1                 112   5e-27   
ref|XP_006362428.1|  PREDICTED: vignain-like                            112   6e-27   
ref|XP_004975184.1|  PREDICTED: vignain-like                            112   6e-27   
gb|EMT09279.1|  Thiol protease SEN102                                   111   6e-27   
ref|XP_006339859.1|  PREDICTED: cysteine proteinase RD21a-like          112   6e-27   
gb|AFW86317.1|  hypothetical protein ZEAMMB73_339067                    112   6e-27   
ref|XP_003578807.1|  PREDICTED: senescence-specific cysteine prot...    112   6e-27   
ref|XP_008659446.1|  PREDICTED: ervatamin-B-like                        112   6e-27   
gb|EMT15475.1|  Cysteine proteinase EP-B 2                              112   6e-27   
gb|EMT20795.1|  Vignain                                                 112   6e-27   
ref|XP_003635767.1|  Cysteine proteinase                                112   6e-27   
ref|XP_006291361.1|  hypothetical protein CARUB_v10017500mg             112   6e-27   
ref|XP_003578813.1|  PREDICTED: senescence-specific cysteine prot...    111   6e-27   
gb|EMT15489.1|  Thiol protease SEN102                                   111   6e-27   
ref|XP_008374352.1|  PREDICTED: vignain                                 112   6e-27   
gb|EMT29821.1|  Thiol protease SEN102                                   111   7e-27   
ref|XP_010912736.1|  PREDICTED: senescence-specific cysteine prot...    111   7e-27   
emb|CDM83197.1|  unnamed protein product                                112   7e-27   
ref|XP_009134051.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    112   7e-27   
ref|XP_008803660.1|  PREDICTED: ervatamin-B-like                        111   7e-27   
emb|CDX83168.1|  BnaA03g23380D                                          111   8e-27   
ref|XP_010052200.1|  PREDICTED: ervatamin-B-like                        111   8e-27   
ref|XP_004487579.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    111   8e-27   
gb|KDO47943.1|  hypothetical protein CISIN_1g048276mg                   111   8e-27   
emb|CDP18638.1|  unnamed protein product                                111   9e-27   



>gb|KDP38777.1| hypothetical protein JCGZ_05113 [Jatropha curcas]
Length=222

 Score =   133 bits (334),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 75/94 (80%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGSAFQFY  G++  DC  +++HGVTAVGYG SDDG K+WL+KNSW
Sbjct  129  KAVANQPVSVAIDASGSAFQFYSGGVFTGDCGTELDHGVTAVGYGTSDDGTKYWLVKNSW  188

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ +D   ++G CGI   PS+PTA
Sbjct  189  GTSWGENGYIRMERDIDAKEGLCGIAMEPSYPTA  222



>gb|KDP38776.1| hypothetical protein JCGZ_05112 [Jatropha curcas]
Length=222

 Score =   131 bits (330),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+V IDASGSAFQFY  G++  DC  +++HGVTAVGYG SDDG K+WL+KNSW
Sbjct  129  KAVANQPVSVTIDASGSAFQFYSGGVFTGDCGTELDHGVTAVGYGTSDDGTKYWLVKNSW  188

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ +D   ++G CGI   PS+PTA
Sbjct  189  GTSWGENGYIRMERDIDAKEGLCGIAMEPSYPTA  222



>gb|KDP38773.1| hypothetical protein JCGZ_05109 [Jatropha curcas]
Length=215

 Score =   130 bits (328),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+V IDASGSAFQFY  G++  DC  +++HGVTAVGYG SDDG K+WL+KNSW
Sbjct  122  KAVANQPVSVTIDASGSAFQFYSGGVFTGDCGTELDHGVTAVGYGTSDDGTKYWLVKNSW  181

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ +D   ++G CGI   PS+PTA
Sbjct  182  GTSWGENGYIRMERDIDAKEGLCGIAMEPSYPTA  215



>ref|XP_007132896.1| hypothetical protein PHAVU_011G134100g [Phaseolus vulgaris]
 gb|ESW04890.1| hypothetical protein PHAVU_011G134100g [Phaseolus vulgaris]
Length=308

 Score =   130 bits (328),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDGKFWLIKNSWG  164
            KAVANQPV+VAIDASGS FQFYK G++   C  +++HGVTAVGYG SDDGK+WL+KNSWG
Sbjct  216  KAVANQPVSVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSDDGKYWLVKNSWG  275

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGEEGY+++ +     +G CGI    S+PTA
Sbjct  276  TEWGEEGYIRMQRGVAAEEGLCGIAMMASYPTA  308



>ref|XP_002523447.1| cysteine protease, putative [Ricinus communis]
 gb|EEF38906.1| cysteine protease, putative [Ricinus communis]
Length=342

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 76/94 (81%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVA+QPV+VAIDASGSAFQFY  G++  DC  +++HGVTAVGYG SDDG K+WL+KNSW
Sbjct  249  KAVASQPVSVAIDASGSAFQFYSGGVFTGDCGTELDHGVTAVGYGTSDDGTKYWLVKNSW  308

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE+GY+++ +D   ++G CGI   PS+PTA
Sbjct  309  GTSWGEDGYIRMERDIEAKEGLCGIAMQPSYPTA  342



>ref|XP_004306851.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   130 bits (328),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDASGS FQFY  G++   C   ++HGVTAVGYG SDDG KFWL+KNSW
Sbjct  247  KAVANQPISVAIDASGSGFQFYSSGVFTGPCGTSLDHGVTAVGYGVSDDGTKFWLVKNSW  306

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +D    +G CGI   PS+PTA
Sbjct  307  GAQWGEEGYIRMQRDIPAPEGLCGIAMEPSYPTA  340



>dbj|BAF56428.1| cysteine proteinase [Lotus japonicus]
Length=342

 Score =   130 bits (328),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDASGS FQFY  G++   C  +++HGVTAVGYG SDDG K+WL+KNSW
Sbjct  249  KAVANQPISVAIDASGSEFQFYSSGLFTGSCGTELDHGVTAVGYGVSDDGTKYWLVKNSW  308

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G++WGEEGY+++ +D    +G CGI    S+PTA
Sbjct  309  GEQWGEEGYIRMQRDVAAEEGLCGIAMQASYPTA  342



>ref|XP_007216164.1| hypothetical protein PRUPE_ppa015341mg, partial [Prunus persica]
 gb|EMJ17363.1| hypothetical protein PRUPE_ppa015341mg, partial [Prunus persica]
Length=196

 Score =   127 bits (318),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGS FQFY  G++   C   ++HGVTAVGYG  DDG KFWL+KNSW
Sbjct  103  KAVANQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVGDDGTKFWLVKNSW  162

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +D    +G CGI  + S+PTA
Sbjct  163  GTEWGEEGYIRMQRDVDAAEGLCGIAMSASYPTA  196



>gb|KDP23193.1| hypothetical protein JCGZ_00326 [Jatropha curcas]
Length=94

 Score =   123 bits (309),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 70/92 (76%), Gaps = 1/92 (1%)
 Frame = -1

Query  337  VANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWGD  161
            VANQPV+VAIDA  SAFQ Y  GI+  DC  +++HGVT VGYG SDDG K+WL+KNSWG 
Sbjct  3    VANQPVSVAIDAGESAFQHYSSGIFTGDCGTELDHGVTVVGYGTSDDGNKYWLVKNSWGT  62

Query  160  KWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             WGE+GY+++ +D   ++G CGI   PS+PTA
Sbjct  63   SWGEDGYIRMQRDIDAKEGLCGIAMQPSYPTA  94



>ref|XP_007132883.1| hypothetical protein PHAVU_011G1328000g, partial [Phaseolus vulgaris]
 gb|ESW04877.1| hypothetical protein PHAVU_011G1328000g, partial [Phaseolus vulgaris]
Length=167

 Score =   124 bits (312),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAV NQPV+VAIDASGS FQFYK G++   C  +++HGVTAVGYG SDDG ++WL+KNSW
Sbjct  74   KAVTNQPVSVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSDDGTEYWLVKNSW  133

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +   + +G CGI    S+PTA
Sbjct  134  GTEWGEEGYIRMQRGVDSEEGLCGIAMQASYPTA  167



>emb|CDP06286.1| unnamed protein product [Coffea canephora]
Length=300

 Score =   127 bits (320),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGSAFQFY  G++  DC  +++HGVTAVGYG S DG K+WL+KNSW
Sbjct  204  KAVANQPVSVAIDASGSAFQFYSSGVFTGDCGTELDHGVTAVGYGTSTDGTKYWLVKNSW  263

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPT  68
            G  WGE GY+++ +D   ++G CGI    S+PT
Sbjct  264  GTSWGENGYIRMQRDIDAKEGLCGIAMQASYPT  296



>emb|CDP18641.1| unnamed protein product [Coffea canephora]
Length=338

 Score =   128 bits (321),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGSAFQFY  G++  DC  +++HGVTAVGYG+S DG K+WL+KNSW
Sbjct  245  KAVANQPVSVAIDASGSAFQFYSSGVFTGDCGTELDHGVTAVGYGKSSDGTKYWLVKNSW  304

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+ + +D   ++G CGI    S+PTA
Sbjct  305  GTSWGENGYILMQRDIDAKEGLCGIAMQSSYPTA  338



>ref|XP_002316833.2| hypothetical protein POPTR_0011s07520g [Populus trichocarpa]
 gb|EEE97445.2| hypothetical protein POPTR_0011s07520g [Populus trichocarpa]
Length=362

 Score =   128 bits (321),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDA GSAFQFY  G++  DC   ++HGVTAVGYG SDDG K+WL+KNSW
Sbjct  269  KAVANQPVSVAIDAGGSAFQFYSSGVFTGDCGTDLDHGVTAVGYGMSDDGTKYWLVKNSW  328

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ +D   ++G CGI    S+PTA
Sbjct  329  GTSWGENGYIRMERDIDAQEGLCGIAMEASYPTA  362



>ref|XP_006469128.1| PREDICTED: vignain-like [Citrus sinensis]
Length=343

 Score =   127 bits (320),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 75/94 (80%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPVAV+IDASGSAFQFY  G++  DC  +++HGVTAVGYG + +G K+WL+KNSW
Sbjct  250  KAVANQPVAVSIDASGSAFQFYSSGVFTGDCGTELDHGVTAVGYGATANGTKYWLVKNSW  309

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+++ +D   ++G CGI  + S+PTA
Sbjct  310  GTSWGEEGYIRMKRDIDAKEGLCGIAMDSSYPTA  343



>ref|XP_006469012.1| PREDICTED: vignain-like [Citrus sinensis]
Length=341

 Score =   127 bits (320),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDA GS FQFY  G++  DC  +++HGVTAVGYG +DDG K+WL+KNSW
Sbjct  248  KAVANQPVSVAIDAGGSDFQFYSSGVFTGDCGTELDHGVTAVGYGAADDGTKYWLVKNSW  307

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+++ +D   ++G CGI    S+PTA
Sbjct  308  GTSWGEEGYIRMQRDIDAKEGLCGIAMQASYPTA  341



>ref|XP_006446763.1| hypothetical protein CICLE_v10017432mg [Citrus clementina]
 gb|ESR60003.1| hypothetical protein CICLE_v10017432mg [Citrus clementina]
Length=343

 Score =   127 bits (320),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 75/94 (80%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPVAV+IDASGSAFQFY  G++  DC  +++HGVTAVGYG + +G K+WL+KNSW
Sbjct  250  KAVANQPVAVSIDASGSAFQFYSSGVFTGDCGTELDHGVTAVGYGATANGTKYWLVKNSW  309

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+++ +D   ++G CGI  + S+PTA
Sbjct  310  GTSWGEEGYIRMKRDIDAKEGLCGIAMDSSYPTA  343



>gb|KDO63329.1| hypothetical protein CISIN_1g047793mg, partial [Citrus sinensis]
Length=324

 Score =   127 bits (319),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 75/94 (80%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPVAV+IDASGSAFQFY  G++  DC  +++HGVTAVGYG + +G K+WL+KNSW
Sbjct  231  KAVANQPVAVSIDASGSAFQFYSSGVFTGDCGTELDHGVTAVGYGATANGTKYWLVKNSW  290

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+++ +D   ++G CGI  + S+PTA
Sbjct  291  GTSWGEEGYIRMKRDIDAKEGLCGIAMDSSYPTA  324



>ref|XP_011045912.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=362

 Score =   128 bits (321),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDA GSAFQFY  G++  DC   ++HGVTAVGYG SDDG K+WL+KNSW
Sbjct  269  KAVANQPVSVAIDAGGSAFQFYSSGVFTGDCGTDLDHGVTAVGYGMSDDGTKYWLVKNSW  328

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ +D   ++G CGI    S+PTA
Sbjct  329  GTSWGENGYIRMERDIDAKEGLCGIAMEASYPTA  362



>ref|XP_008228868.1| PREDICTED: LOW QUALITY PROTEIN: zingipain-2-like [Prunus mume]
Length=345

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGS FQFY  G++   C   ++HGVTAVGYG  DDG KFWL+KNSW
Sbjct  252  KAVANQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVGDDGTKFWLVKNSW  311

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +D    +G CGI  + S+PTA
Sbjct  312  GTEWGEEGYIRMQRDVDAAEGLCGIAMSASYPTA  345



>ref|XP_002523448.1| cysteine protease, putative [Ricinus communis]
 gb|EEF38907.1| cysteine protease, putative [Ricinus communis]
Length=341

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDGKFWLIKNSWG  164
            KAVA+QPV+VAIDASGSAFQFY  G++  DC  +++HGVTAVGYG SD  K+WL+KNSWG
Sbjct  249  KAVASQPVSVAIDASGSAFQFYSGGVFTGDCGTELDHGVTAVGYGTSDGTKYWLVKNSWG  308

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
              WGE+GY+++ +D   ++G CGI    S+PTA
Sbjct  309  TSWGEDGYIRMERDIEAKEGLCGIAMQSSYPTA  341



>ref|XP_002522559.1| cysteine protease, putative [Ricinus communis]
 gb|EEF39859.1| cysteine protease, putative [Ricinus communis]
Length=344

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDA  SAFQ Y  GI+  DC  +++HGVT VGYG SDDG K+WL+KNSW
Sbjct  251  KAVANQPVSVAIDAGESAFQHYSSGIFTGDCGTELDHGVTVVGYGTSDDGTKYWLVKNSW  310

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE+GY+++ +D   ++G CGI   PS+PTA
Sbjct  311  GTSWGEDGYIRMERDIDAKEGLCGIAMEPSYPTA  344



>ref|XP_004301218.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=151

 Score =   122 bits (305),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAID+SG A QFY  G++   C ++++HGVTAVGYG SDDG KFWL+KNSW
Sbjct  56   KAVANQPVSVAIDSSGVAMQFYSSGVFTGQCGSQLDHGVTAVGYGTSDDGTKFWLVKNSW  115

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE+ Y+++ +D   + G CGIT   S+PT 
Sbjct  116  GRSWGEDEYIRIQRDVNVKGGLCGITEQASYPTV  149



>ref|XP_003526232.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGS FQFYK G++   C  +++HGVTAVGYG SDDG ++WL+KNSW
Sbjct  250  KAVANQPVSVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSDDGTEYWLVKNSW  309

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +   + +G CGI    S+PTA
Sbjct  310  GTEWGEEGYIRMQRGVDSEEGLCGIAMQASYPTA  343



>ref|XP_007132874.1| hypothetical protein PHAVU_011G132000g [Phaseolus vulgaris]
 gb|ESW04868.1| hypothetical protein PHAVU_011G132000g [Phaseolus vulgaris]
Length=329

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAV++QPV+VAIDASGS FQFYK G++   C  +++HGVTAVGYG SDDG K+WL+KNSW
Sbjct  236  KAVSSQPVSVAIDASGSDFQFYKSGVFSGSCGTELDHGVTAVGYGVSDDGKKYWLVKNSW  295

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +D    +G CGI    S+PTA
Sbjct  296  GTEWGEEGYIRMQRDVAAAEGLCGIAMMASYPTA  329



>ref|XP_006380495.1| hypothetical protein POPTR_0007s07290g [Populus trichocarpa]
 gb|ERP58292.1| hypothetical protein POPTR_0007s07290g [Populus trichocarpa]
Length=321

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDGKFWLIKNSWG  164
            KAVA QPV+VAIDA GS FQFY  GI+   C  +++HGVTAVGYG SD  K+WL+KNSWG
Sbjct  229  KAVAKQPVSVAIDAGGSDFQFYSSGIFTGSCDTQLDHGVTAVGYGVSDGSKYWLVKNSWG  288

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGEEGY+++ KD   ++G CGI    S+PTA
Sbjct  289  AQWGEEGYIRMQKDISAKEGLCGIAMQASYPTA  321



>ref|XP_006857797.1| hypothetical protein AMTR_s00061p00215400 [Amborella trichopoda]
 gb|ERN19264.1| hypothetical protein AMTR_s00061p00215400 [Amborella trichopoda]
Length=347

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 75/94 (80%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASG  FQFY  G++  DC  +++HGVTAVGYG S DG K+WL+KNSW
Sbjct  254  KAVANQPVSVAIDASGYEFQFYSGGVFNGDCGTELDHGVTAVGYGVSSDGTKYWLVKNSW  313

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G++WGE+GY+++ +D  +++G CGI    S+PTA
Sbjct  314  GEEWGEKGYIRMQRDVASKEGLCGIAMEASYPTA  347



>gb|KHN23485.1| Vignain, partial [Glycine soja]
Length=198

 Score =   123 bits (308),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDAS S FQFYK G++   C  +++HGVTAVGYG SD G K+WL+KNSW
Sbjct  105  KAVANQPVSVAIDASSSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSDHGTKYWLVKNSW  164

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +   + +G CGI    S+PTA
Sbjct  165  GTEWGEEGYIRMQRGVDSEEGVCGIAMQASYPTA  198



>ref|XP_007132865.1| hypothetical protein PHAVU_011G131200g [Phaseolus vulgaris]
 gb|ESW04859.1| hypothetical protein PHAVU_011G131200g [Phaseolus vulgaris]
Length=344

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAV++QPV+VAIDASGS FQFYK G++   C  +++HGVTAVGYG SDDG K+WL+KNSW
Sbjct  251  KAVSSQPVSVAIDASGSDFQFYKSGVFSGSCGTELDHGVTAVGYGVSDDGKKYWLVKNSW  310

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +D    +G CGI    S+PTA
Sbjct  311  GTEWGEEGYIRMQRDVAAAEGLCGIAMMASYPTA  344



>ref|XP_002310053.1| hypothetical protein POPTR_0007s07200g [Populus trichocarpa]
 ref|XP_006380490.1| hypothetical protein POPTR_0007s07190g [Populus trichocarpa]
 gb|EEE90503.1| hypothetical protein POPTR_0007s07200g [Populus trichocarpa]
 gb|ERP58287.1| hypothetical protein POPTR_0007s07190g [Populus trichocarpa]
Length=340

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDGKFWLIKNSWG  164
            KAVA QPV+VAIDA GS FQFY  GI+   C  +++HGVTAVGYG SD  K+WL+KNSWG
Sbjct  248  KAVAKQPVSVAIDAGGSDFQFYSSGIFTGSCDTQLDHGVTAVGYGVSDGSKYWLVKNSWG  307

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGEEGY+++ KD   ++G CGI    S+PTA
Sbjct  308  AQWGEEGYIRMQKDISAKEGLCGIAMQASYPTA  340



>ref|XP_006380488.1| hypothetical protein POPTR_0007s07170g [Populus trichocarpa]
 gb|ERP58285.1| hypothetical protein POPTR_0007s07170g [Populus trichocarpa]
Length=340

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDGKFWLIKNSWG  164
            KAVA QPV+VAIDA GS FQFY  GI+   C  +++HGVTAVGYG SD  K+WL+KNSWG
Sbjct  248  KAVAKQPVSVAIDAGGSDFQFYSSGIFTGSCDTQLDHGVTAVGYGVSDGSKYWLVKNSWG  307

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGEEGY+++ KD   ++G CGI    S+PTA
Sbjct  308  AQWGEEGYIRMQKDISAKEGLCGIAMQASYPTA  340



>ref|XP_006380493.1| hypothetical protein POPTR_0007s07240g [Populus trichocarpa]
 gb|ERP58290.1| hypothetical protein POPTR_0007s07240g [Populus trichocarpa]
Length=340

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDGKFWLIKNSWG  164
            KAVA QPV+VAIDA GS FQFY  GI+   C  +++HGVTAVGYG SD  K+WL+KNSWG
Sbjct  248  KAVAKQPVSVAIDAGGSDFQFYSSGIFTGSCDTQLDHGVTAVGYGVSDGSKYWLVKNSWG  307

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGEEGY+++ KD   ++G CGI    S+PTA
Sbjct  308  AQWGEEGYIRMQKDISAKEGLCGIAMQASYPTA  340



>ref|XP_006446792.1| hypothetical protein CICLE_v10018253mg [Citrus clementina]
 gb|ESR60032.1| hypothetical protein CICLE_v10018253mg [Citrus clementina]
Length=341

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVANQPV+VAIDA GS FQFY  G++  DC  +++HGVTAVGYG +DDG K+WL+KNSWG
Sbjct  249  AVANQPVSVAIDAGGSDFQFYSSGVFTGDCGTELDHGVTAVGYGAADDGTKYWLVKNSWG  308

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
              WGEEGY+++ +D   ++G CGI    S+PTA
Sbjct  309  TSWGEEGYIRMQRDIDAKEGLCGIAMQASYPTA  341



>gb|KDP21078.1| hypothetical protein JCGZ_21549 [Jatropha curcas]
Length=326

 Score =   125 bits (315),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVANQPV+VAIDA  SAFQ Y  GI+  DC  +++HGVT VGYG SDDG K+WL+KNSWG
Sbjct  234  AVANQPVSVAIDAGESAFQHYSSGIFTGDCGTELDHGVTVVGYGTSDDGTKYWLVKNSWG  293

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
              WGE+GY+++ +D   ++G CGI   PS+PTA
Sbjct  294  TSWGEDGYIRMQRDIDAKEGLCGIAMQPSYPTA  326



>ref|XP_006449486.1| hypothetical protein CICLE_v10018236mg [Citrus clementina]
 gb|ESR62726.1| hypothetical protein CICLE_v10018236mg [Citrus clementina]
Length=312

 Score =   125 bits (314),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGS FQFY  G++   C  +++HGVTAVGYG +DDG K+WL+KNSW
Sbjct  219  KAVANQPVSVAIDASGSDFQFYSSGVFTGQCGTELDHGVTAVGYGTADDGTKYWLVKNSW  278

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ +D   ++G CGI    S+PTA
Sbjct  279  GTTWGENGYIRMQRDIDAKEGLCGIAMQASYPTA  312



>gb|KHN33963.1| Vignain [Glycine soja]
 gb|KHN33967.1| Vignain [Glycine soja]
Length=150

 Score =   121 bits (303),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASG+ FQFYK GI+   C  +++HGVTAVGYGE+++G K+WL+KNSW
Sbjct  57   KAVANQPVSVAIDASGADFQFYKSGIFTGSCGTELDHGVTAVGYGENNEGTKYWLVKNSW  116

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+ + +     +G CGI    S+PTA
Sbjct  117  GTEWGEEGYIMMQRGVKAVEGICGIAMMASYPTA  150



>ref|XP_003540013.1| PREDICTED: vignain-like [Glycine max]
 ref|XP_003540014.1| PREDICTED: vignain-like [Glycine max]
 gb|KHN27798.1| Vignain [Glycine soja]
 gb|KHN27800.1| Vignain [Glycine soja]
Length=337

 Score =   125 bits (314),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+V IDA GSAFQFY  G++   C  +++HGVTAVGYG +DDG ++W++KNSW
Sbjct  244  KAVANQPVSVTIDAGGSAFQFYSSGVFTGQCGTQLDHGVTAVGYGSTDDGTQYWIVKNSW  303

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ + T  ++G CGI  + S+PTA
Sbjct  304  GTQWGEEGYIRMQRGTDAQEGLCGIAMDASYPTA  337



>ref|XP_006469011.1| PREDICTED: vignain-like [Citrus sinensis]
Length=341

 Score =   125 bits (315),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDA G  FQFY  G++  DC  +++HGVTAVGYG +DDG K+WL+KNSW
Sbjct  248  KAVANQPVSVAIDAGGFDFQFYSSGVFTGDCGTELDHGVTAVGYGAADDGTKYWLVKNSW  307

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+++ +D   ++G CGI    S+PTA
Sbjct  308  GTSWGEEGYIRMQRDIDAKQGLCGIAMQASYPTA  341



>ref|XP_010035848.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
 gb|KCW47319.1| hypothetical protein EUGRSUZ_K01106 [Eucalyptus grandis]
Length=336

 Score =   125 bits (314),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VA+DA G  FQFY  G++   C  +++HGVTAVGYG SDDG KFWL+KN+W
Sbjct  243  KAVANQPVSVAVDAGGFEFQFYSSGVFTGACGTELDHGVTAVGYGTSDDGTKFWLVKNTW  302

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G++WGEEGY+++ +D   ++G CGI    S+PTA
Sbjct  303  GEEWGEEGYIRMQRDVSAKEGLCGIAMKASYPTA  336



>ref|XP_006467666.1| PREDICTED: vignain-like [Citrus sinensis]
 gb|KDO77831.1| hypothetical protein CISIN_1g042468mg [Citrus sinensis]
Length=346

 Score =   125 bits (315),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGS FQFY  G++   C  +++HGVTAVGYG +DDG K+WL+KNSW
Sbjct  253  KAVANQPVSVAIDASGSDFQFYSSGVFTGQCGTELDHGVTAVGYGTADDGTKYWLVKNSW  312

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ +D   ++G CGI    S+PTA
Sbjct  313  GTTWGENGYIRMQRDIDAKEGLCGIAMQASYPTA  346



>gb|KHN27806.1| Vignain [Glycine soja]
Length=313

 Score =   125 bits (313),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+V IDA GSAFQFY  G++   C  +++HGVTAVGYG +DDG ++W++KNSW
Sbjct  220  KAVANQPVSVTIDAGGSAFQFYSSGVFTGQCGTQLDHGVTAVGYGSTDDGTQYWIVKNSW  279

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ + T  ++G CGI  + S+PTA
Sbjct  280  GTQWGEEGYIRMQRGTDAQEGLCGIAMDASYPTA  313



>ref|XP_003557016.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   125 bits (314),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGS FQFYK G++   C  +++HGVTAVGYG S+DG ++WL+KNSW
Sbjct  250  KAVANQPVSVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSNDGTEYWLVKNSW  309

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +   + +G CGI    S+PTA
Sbjct  310  GTEWGEEGYIRMQRGVNSEEGLCGIAMQASYPTA  343



>ref|XP_007132888.1| hypothetical protein PHAVU_011G133300g [Phaseolus vulgaris]
 gb|ESW04882.1| hypothetical protein PHAVU_011G133300g [Phaseolus vulgaris]
Length=343

 Score =   125 bits (314),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAV NQPV+VAIDASGS FQFYK G++   C  +++HGVTAVGYG SDDG K+WL+KNSW
Sbjct  250  KAVTNQPVSVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSDDGRKYWLVKNSW  309

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +     +G CGI    S+PTA
Sbjct  310  GTEWGEEGYIRMQRGVAAEEGLCGIAMMASYPTA  343



>gb|KHN32069.1| Vignain [Glycine soja]
Length=333

 Score =   125 bits (313),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGS FQFYK G++   C  +++HGVTAVGYG S+DG ++WL+KNSW
Sbjct  240  KAVANQPVSVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSNDGTEYWLVKNSW  299

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +   + +G CGI    S+PTA
Sbjct  300  GTEWGEEGYIRMQRGVNSEEGLCGIAMQASYPTA  333



>ref|XP_007132860.1| hypothetical protein PHAVU_011G130800g [Phaseolus vulgaris]
 gb|ESW04854.1| hypothetical protein PHAVU_011G130800g [Phaseolus vulgaris]
Length=343

 Score =   125 bits (314),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVANQPV+VAIDASGS FQFYK G++   C  +++HGVTAVGYG SDDG K+WL+KNSWG
Sbjct  251  AVANQPVSVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSDDGRKYWLVKNSWG  310

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGEEGY+++ +     +G CGI    S+PTA
Sbjct  311  TEWGEEGYIRMQRGVAAEEGLCGIAMMASYPTA  343



>ref|XP_007048792.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92949.1| Senescence-associated gene 12 [Theobroma cacao]
Length=343

 Score =   125 bits (313),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDA G  FQFY  G++  DC   ++HGVTAVGYG  DDG K+WL+KNSW
Sbjct  250  KAVANQPVSVAIDAGGYEFQFYSSGVFTGDCGTDLDHGVTAVGYGADDDGTKYWLVKNSW  309

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+++ +D   ++G CGI    S+PTA
Sbjct  310  GTSWGEEGYIRMQRDVDAKEGLCGIAMQASYPTA  343



>ref|XP_008244499.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=345

 Score =   125 bits (313),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVA+QPV+VAIDASGS FQFY  G++   C   ++HGVTAVGYG SDDG K+WL+KNSWG
Sbjct  253  AVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWG  312

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGEEGY+++ +D   ++G CGI    S+PTA
Sbjct  313  TEWGEEGYIRMQRDVDAKEGLCGIAMEASYPTA  345



>ref|XP_008244498.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=345

 Score =   125 bits (313),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVA+QPV+VAIDASGS FQFY  G++   C   ++HGVTAVGYG SDDG K+WL+KNSWG
Sbjct  253  AVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWG  312

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGEEGY+++ +D   ++G CGI    S+PTA
Sbjct  313  TEWGEEGYIRMQRDVDAKEGLCGIAMEASYPTA  345



>emb|CBI21973.3| unnamed protein product [Vitis vinifera]
Length=320

 Score =   124 bits (312),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVA+QP+AVAIDA GS FQFY  G++   C  +++HGV+AVGYG SDDG K+WL+KNSW
Sbjct  227  KAVAHQPIAVAIDAGGSEFQFYSSGVFTGQCGTELDHGVSAVGYGTSDDGMKYWLVKNSW  286

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+++ +D   ++G CGI    S+PTA
Sbjct  287  GTGWGEEGYIRMQRDVTAKEGLCGIAMQASYPTA  320



>ref|XP_007213386.1| hypothetical protein PRUPE_ppa026372mg [Prunus persica]
 gb|EMJ14585.1| hypothetical protein PRUPE_ppa026372mg [Prunus persica]
Length=345

 Score =   125 bits (313),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVA+QPV+VAIDASGS FQFY  G++   C   ++HGVTAVGYG SDDG K+WL+KNSWG
Sbjct  253  AVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWG  312

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGEEGY+++ +D   ++G CGI    S+PTA
Sbjct  313  TEWGEEGYIRMQRDVDAKEGLCGIAMEASYPTA  345



>ref|XP_008362423.1| PREDICTED: vignain-like [Malus domestica]
Length=150

 Score =   120 bits (301),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVA+QPV+VAIDASGS FQFY  G++   C   ++HGVTAVGYG S+DG K+WL+KNSWG
Sbjct  58   AVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWG  117

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGE GY+++ +D    +G CGI  + S+PTA
Sbjct  118  AEWGEAGYIRMQRDVAAAEGLCGIAMSASYPTA  150



>ref|XP_004252652.2| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=322

 Score =   124 bits (312),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGS FQFY  G++  +C  +++HGVTAVGYGE+ DG K+WL+KNSW
Sbjct  229  KAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDHGVTAVGYGEASDGTKYWLVKNSW  288

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ ++    +G CGI    S+PTA
Sbjct  289  GTSWGENGYIRMQRNVDTEEGLCGIAMEASYPTA  322



>ref|XP_004306597.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   125 bits (313),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVA+QP++VAIDASGS FQFY  G++   C   ++HGVTAVGYG SDDG K+WL+KNSW
Sbjct  247  KAVASQPISVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSDDGTKYWLVKNSW  306

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +D    +G CGI    S+PTA
Sbjct  307  GAQWGEEGYIRMQRDVDAAEGLCGIAMAASYPTA  340



>ref|XP_006446793.1| hypothetical protein CICLE_v10018274mg [Citrus clementina]
 gb|ESR60033.1| hypothetical protein CICLE_v10018274mg [Citrus clementina]
Length=341

 Score =   125 bits (313),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDA G  FQFY  G++  DC  +++HGVTAVGYG +DDG K+WL+KNSW
Sbjct  248  KAVANQPVSVAIDAGGFDFQFYSSGVFTGDCGTELDHGVTAVGYGAADDGTKYWLVKNSW  307

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+++ +D   ++G CGI    S+PTA
Sbjct  308  GATWGEEGYIRMQRDIDAKQGLCGIAMQASYPTA  341



>ref|XP_008780365.1| PREDICTED: vignain-like [Phoenix dactylifera]
Length=186

 Score =   121 bits (304),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAI+ASG  FQFY  G++   CK  ++HGVTAVGYG + DG K+WL+KNSW
Sbjct  93   KAVANQPVSVAIEASGYDFQFYSSGVFNGSCKTYLDHGVTAVGYGTAKDGTKYWLVKNSW  152

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE+GY+++ +D   ++G CGI    S+PTA
Sbjct  153  GSSWGEKGYIRMERDVAAKEGLCGIAMEASYPTA  186



>emb|CDP18637.1| unnamed protein product [Coffea canephora]
Length=243

 Score =   123 bits (308),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASG+ FQFY  G++  DC  +++HGVTAVGYG S DG K+WL+KNSW
Sbjct  150  KAVANQPVSVAIDASGNGFQFYSSGVFAGDCGTELDHGVTAVGYGTSSDGTKYWLVKNSW  209

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE+GY+ + +D   ++G CGI    S+PT+
Sbjct  210  GTGWGEKGYILMQRDIEAKEGLCGIAMQASYPTS  243



>ref|XP_006592465.1| PREDICTED: vignain-like [Glycine max]
 ref|XP_006607017.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   125 bits (313),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGS FQFYK G++   C  +++HGVTAVGYG S+DG ++WL+KNSW
Sbjct  250  KAVANQPVSVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSNDGTEYWLVKNSW  309

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +   + +G CGI    S+PTA
Sbjct  310  GTEWGEEGYIRMQRGVDSEEGLCGIAMQASYPTA  343



>ref|XP_007132275.1| hypothetical protein PHAVU_011G081100g [Phaseolus vulgaris]
 gb|ESW04269.1| hypothetical protein PHAVU_011G081100g [Phaseolus vulgaris]
Length=341

 Score =   125 bits (313),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASG  FQFY  G++   C   ++HGVTAVGYG SDDG K+WL+KNSW
Sbjct  248  KAVANQPVSVAIDASGYEFQFYAGGVFNGSCDTNLDHGVTAVGYGVSDDGSKYWLVKNSW  307

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G KWGE+GY+++ +D   ++G CGI    S+PTA
Sbjct  308  GVKWGEKGYIRMQRDVSAKEGLCGIAMLASYPTA  341



>ref|XP_011086004.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   125 bits (313),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGS FQFY  G++  DC  +++HGVTAVGYG++ DG K+WL+KNSW
Sbjct  248  KAVANQPVSVAIDASGSDFQFYSSGVFTGDCGTELDHGVTAVGYGKTSDGTKYWLVKNSW  307

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ +D    +G CGI    S+PTA
Sbjct  308  GTSWGENGYIRMQRDIDAPEGLCGIAMQASYPTA  341



>ref|XP_011038211.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score =   125 bits (313),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++V+IDA GS FQFY  G++   C  +++HGVTAVGYGE+ DG K+WL+KNSW
Sbjct  249  KAVANQPISVSIDAGGSDFQFYSSGVFTGQCGTELDHGVTAVGYGETSDGTKYWLVKNSW  308

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+++ +D    +G CGI  + S+PTA
Sbjct  309  GTSWGEEGYIRMQRDVDAEEGLCGIAMDSSYPTA  342



>gb|KHN27802.1| Vignain, partial [Glycine soja]
Length=288

 Score =   124 bits (310),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 75/94 (80%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+V+IDA GSAFQFY  G++   C  +++HGVTAVGYG +DDG ++W++KNSW
Sbjct  195  KAVANQPVSVSIDAGGSAFQFYSSGVFTGQCGTQLDHGVTAVGYGSTDDGIQYWIVKNSW  254

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++++    ++G CGI  + S+PTA
Sbjct  255  GTQWGEEGYIRMLRGIDAQEGLCGIAMDASYPTA  288



>gb|KHN08187.1| Thiol protease SEN102 [Glycine soja]
Length=326

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGS FQFYK G++   C  +++HGVTAVGYG S+DG ++WL+KNSW
Sbjct  233  KAVANQPVSVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSNDGTEYWLVKNSW  292

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +   + +G CGI    S+PTA
Sbjct  293  GTEWGEEGYIRMQRGVDSEEGLCGIAMQASYPTA  326



>ref|XP_006360708.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGS FQFY  G++  +C  +++HGVTAVGYGE+ DG K+WL+KNSW
Sbjct  247  KAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDHGVTAVGYGEASDGTKYWLVKNSW  306

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ ++    +G CGI    S+PTA
Sbjct  307  GTSWGENGYIRMQRNVDTEEGLCGIAMEASYPTA  340



>emb|CBI21972.3| unnamed protein product [Vitis vinifera]
Length=320

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVA+QP+AVAIDASGS FQFY  G++   C  +++HGV AVGYG SDDG K+WL+KNSW
Sbjct  227  KAVAHQPIAVAIDASGSEFQFYSSGVFTGQCGTELDHGVAAVGYGTSDDGMKYWLVKNSW  286

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
               WGEEGY+++ +D   ++G CGI    S+PTA
Sbjct  287  STGWGEEGYIRMQRDVTAKEGLCGIAMQASYPTA  320



>ref|XP_006360707.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGS FQFY  G++  +C  +++HGVTAVGYGE+ DG K+WL+KNSW
Sbjct  247  KAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDHGVTAVGYGEASDGTKYWLVKNSW  306

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ ++    +G CGI    S+PTA
Sbjct  307  GTSWGENGYIRMQRNVDTEEGLCGIAMEASYPTA  340



>gb|KHN13721.1| Vignain [Glycine soja]
Length=326

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGS FQFYK G++   C  +++HGVTAVGYG S+DG ++WL+KNSW
Sbjct  233  KAVANQPVSVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSNDGTEYWLVKNSW  292

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +   + +G CGI    S+PTA
Sbjct  293  GTEWGEEGYIRMQRGVDSEEGLCGIAMQASYPTA  326



>gb|KHN27804.1| KDEL-tailed cysteine endopeptidase CEP1 [Glycine soja]
Length=148

 Score =   120 bits (300),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+V ID  GSAFQF   G++   C  +++HGVTAVGYG +DDG ++W++KNSW
Sbjct  55   KAVANQPVSVTIDVGGSAFQFNSSGVFTGQCGTQLDHGVTAVGYGSTDDGTQYWIVKNSW  114

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ + T  ++G CGI  + S+PTA
Sbjct  115  GTQWGEEGYIRMQRGTDAQEGLCGIAMDASYPTA  148



>ref|XP_003607574.1| Cysteine protease [Medicago truncatula]
 gb|AES89771.1| papain family cysteine protease [Medicago truncatula]
Length=345

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDASGS FQFYK G++   C  +++HGVTAVGYG S+DG K+WL+KNSW
Sbjct  252  KAVANQPISVAIDASGSDFQFYKSGVFTGSCGTQLDHGVTAVGYGISNDGTKYWLVKNSW  311

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G+ WGEEGY+++ +     +G CGI    S+PTA
Sbjct  312  GNDWGEEGYIRMQRSVDAAQGLCGIAMMASYPTA  345



>ref|XP_002280204.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVA+QP+AVAIDA GS FQFY  G++   C  +++HGV+AVGYG SDDG K+WL+KNSW
Sbjct  248  KAVAHQPIAVAIDAGGSEFQFYSSGVFTGQCGTELDHGVSAVGYGTSDDGMKYWLVKNSW  307

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+++ +D   ++G CGI    S+PTA
Sbjct  308  GTGWGEEGYIRMQRDVTAKEGLCGIAMQASYPTA  341



>ref|XP_006592467.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGS FQFYK G++   C  +++HGVTAVGYG S+DG ++WL+KNSW
Sbjct  250  KAVANQPVSVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSNDGTEYWLVKNSW  309

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +   + +G CGI    S+PTA
Sbjct  310  GTEWGEEGYIRMQRGVDSEEGLCGIAMQASYPTA  343



>ref|XP_006376349.1| hypothetical protein POPTR_0013s12260g [Populus trichocarpa]
 gb|ERP54146.1| hypothetical protein POPTR_0013s12260g [Populus trichocarpa]
Length=342

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVA+QP++V+IDA GS FQFY  G++   C  +++HGVTAVGYGE+ DG K+WL+KNSW
Sbjct  249  KAVASQPISVSIDAGGSDFQFYSSGVFTGQCGTELDHGVTAVGYGETSDGTKYWLVKNSW  308

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+++ +DT   +G CGI  + S+PTA
Sbjct  309  GTSWGEEGYIRMQRDTEAEEGLCGIAMDSSYPTA  342



>ref|XP_002280246.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVA+QP+AVAIDASGS FQFY  G++   C  +++HGV AVGYG SDDG K+WL+KNSW
Sbjct  248  KAVAHQPIAVAIDASGSEFQFYSSGVFTGQCGTELDHGVAAVGYGTSDDGMKYWLVKNSW  307

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
               WGEEGY+++ +D   ++G CGI    S+PTA
Sbjct  308  STGWGEEGYIRMQRDVTAKEGLCGIAMQASYPTA  341



>ref|XP_008228966.1| PREDICTED: vignain-like [Prunus mume]
Length=200

 Score =   121 bits (303),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
             V++QP++VAIDASG  FQFY  G+Y + C   ++HGVTAVGYG SDDG K+WL+KNSW 
Sbjct  108  TVSHQPISVAIDASGPDFQFYSSGVYTETCGTSLDHGVTAVGYGMSDDGTKYWLVKNSWS  167

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             KWGEEGY+++ +D    +G CGI  + S+PTA
Sbjct  168  IKWGEEGYIRMQRDVDVAEGLCGIAMSASYPTA  200



>ref|XP_011078542.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGS FQFY  G++  +C  +++HGVTAVGYG++ DG K+WL+KNSW
Sbjct  248  KAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDHGVTAVGYGKTSDGTKYWLVKNSW  307

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ +D    +G CGI    S+PTA
Sbjct  308  GSSWGENGYIRMQRDIDAAEGLCGIAMQASYPTA  341



>ref|XP_009359957.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=342

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDASGS FQFY  G++   C   ++HGVTAVGYG SDDG K+WL+KNSW
Sbjct  249  KAVANQPISVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSDDGTKYWLVKNSW  308

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +    ++G CGI    S+PTA
Sbjct  309  GTEWGEEGYIRMQRGIEAKEGLCGIAMEASYPTA  342



>gb|AAA50755.1| cysteine proteinase [Alnus glutinosa]
Length=340

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 73/93 (78%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVA+QPV+VAIDA GS FQFY +G++   C  +++HGVTAVGYG SDDG K+WL+KNSWG
Sbjct  248  AVAHQPVSVAIDAGGSGFQFYSKGVFIGACGTQLDHGVTAVGYGTSDDGTKYWLVKNSWG  307

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGEEGY+++ +D   ++G CGI    S+PTA
Sbjct  308  TQWGEEGYIRMQRDVDAKEGLCGIAMKASYPTA  340



>ref|XP_011078044.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGS FQFY  G++  +C  +++HGVTAVGYG++ DG K+WL+KNSW
Sbjct  248  KAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDHGVTAVGYGKTSDGTKYWLVKNSW  307

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ +D    +G CGI    S+PTA
Sbjct  308  GSSWGENGYIRMQRDIDAAEGLCGIAMQASYPTA  341



>ref|XP_008780330.1| PREDICTED: vignain-like [Phoenix dactylifera]
Length=186

 Score =   120 bits (302),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAV NQPV+VAI+ASGS+FQFY  GI+   C   ++HGVTAVGYG + DG K+WL+KNSW
Sbjct  93   KAVTNQPVSVAIEASGSSFQFYSSGIFTGSCGTDLDHGVTAVGYGTAKDGTKYWLVKNSW  152

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPT  68
            G  WGE+GYV++ +D   ++G CGI    S+PT
Sbjct  153  GSSWGEKGYVRMERDVAAKEGLCGIAMQASYPT  185



>ref|XP_007132895.1| hypothetical protein PHAVU_011G134000g [Phaseolus vulgaris]
 gb|ESW04889.1| hypothetical protein PHAVU_011G134000g [Phaseolus vulgaris]
Length=343

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAV NQPV+VAIDASGS FQFY+ G++   C  +++HGVTAVGYG SDDG ++WL+KNSW
Sbjct  250  KAVVNQPVSVAIDASGSDFQFYESGVFTGSCGTELDHGVTAVGYGVSDDGTEYWLVKNSW  309

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +   + +G CGI    S+PTA
Sbjct  310  GTEWGEEGYIRMQRGVDSEEGLCGIAMQASYPTA  343



>ref|XP_006376351.1| hypothetical protein POPTR_0013s12280g [Populus trichocarpa]
 gb|ERP54148.1| hypothetical protein POPTR_0013s12280g [Populus trichocarpa]
Length=342

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++V+IDA GS FQFY  G +   C  +++HGVTAVGYGE+ DG K+WL+KNSW
Sbjct  249  KAVANQPISVSIDAGGSDFQFYSSGDFTGQCGTELDHGVTAVGYGETSDGTKYWLVKNSW  308

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+++ +DT   +G CGI  + S+PTA
Sbjct  309  GTSWGEEGYIRMQRDTEAEEGLCGIAMDSSYPTA  342



>ref|XP_007132861.1| hypothetical protein PHAVU_011G130900g [Phaseolus vulgaris]
 gb|ESW04855.1| hypothetical protein PHAVU_011G130900g [Phaseolus vulgaris]
Length=343

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAV NQPV+VAIDASGS FQFY+ G++   C  +++HGVTAVGYG SDDG ++WL+KNSW
Sbjct  250  KAVVNQPVSVAIDASGSDFQFYESGVFTGSCGTELDHGVTAVGYGVSDDGTEYWLVKNSW  309

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +   + +G CGI    S+PTA
Sbjct  310  GTEWGEEGYIRMQRGVDSEEGLCGIAMQASYPTA  343



>ref|XP_004506025.1| PREDICTED: vignain-like [Cicer arietinum]
Length=342

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDASGS FQFY  G++   C  +++HGVTAVGYG S+DG K+WL+KNSW
Sbjct  249  KAVANQPISVAIDASGSEFQFYSSGVFTGTCGTELDHGVTAVGYGVSEDGTKYWLVKNSW  308

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGE+GY+++ ++   ++G CGI    S+PTA
Sbjct  309  GTQWGEQGYIRMERNVVAKEGLCGIAMQASYPTA  342



>gb|AAP32195.1| cysteine protease 5 [Trifolium repens]
Length=343

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDASGS FQFYK G++   C  +++HGVTAVGYG S+DG K+WL+KNSW
Sbjct  250  KAVANQPISVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGISNDGTKYWLVKNSW  309

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+++ +     +G CGI    S+PTA
Sbjct  310  GTDWGEEGYIRMQRSIDAAEGLCGIAMQASYPTA  343



>emb|CAN70559.1| hypothetical protein VITISV_032465 [Vitis vinifera]
Length=341

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVA+QP+AVAIDASGS FQFY  G++   C  +++HGV AVGYG SDDG K+WL+KNSW
Sbjct  248  KAVAHQPIAVAIDASGSEFQFYSSGVFTGQCGTELDHGVAAVGYGTSDDGMKYWLVKNSW  307

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
               WGEEGY+++ +D   ++G CGI    S+PTA
Sbjct  308  STGWGEEGYIRMQRDVTVKEGLCGIAMQASYPTA  341



>gb|AAP32198.1| cysteine protease 12 [Trifolium repens]
Length=343

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDASGS FQFYK G++   C  +++HGVTAVGYG S+DG K+WL+KNSW
Sbjct  250  KAVANQPISVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGISNDGTKYWLVKNSW  309

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+++ +     +G CGI    S+PTA
Sbjct  310  GTDWGEEGYIRMQRSIDAAEGLCGIAMQASYPTA  343



>ref|XP_004252606.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=341

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGS FQFY  G++  +C  +++HGVTAVGYGE+ DG K+WL+KNSW
Sbjct  248  KAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDHGVTAVGYGEASDGTKYWLVKNSW  307

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ ++    +G CGI    S+PTA
Sbjct  308  GTSWGENGYIRMQRNVDAEEGLCGIAMEASYPTA  341



>ref|XP_007132887.1| hypothetical protein PHAVU_011G133200g [Phaseolus vulgaris]
 gb|ESW04881.1| hypothetical protein PHAVU_011G133200g [Phaseolus vulgaris]
Length=343

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAV NQPV+VAIDASGS FQFY+ G++   C  +++HGVTAVGYG SDDG ++WL+KNSW
Sbjct  250  KAVVNQPVSVAIDASGSDFQFYESGVFTGSCGTELDHGVTAVGYGVSDDGTEYWLVKNSW  309

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +   + +G CGI    S+PTA
Sbjct  310  GTEWGEEGYIRMQRGVDSEEGLCGIAMQASYPTA  343



>ref|XP_008362418.1| PREDICTED: vignain-like [Malus domestica]
Length=198

 Score =   120 bits (302),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVA+QPV+VAIDASGS FQFY  G++   C   ++HGVTAVGYG S+DG K+WL+KNSWG
Sbjct  106  AVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWG  165

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGE GY+++ +D    +G CGI  + S+PTA
Sbjct  166  AEWGEAGYIRMQRDVAAAEGLCGIAMSASYPTA  198



>ref|XP_006857796.1| hypothetical protein AMTR_s00061p00215230 [Amborella trichopoda]
 gb|ERN19263.1| hypothetical protein AMTR_s00061p00215230 [Amborella trichopoda]
Length=344

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDGKFWLIKNSWG  164
            KAV +QPV+VAIDASG  FQFY  GI+  +C  +++HGVTAVGYG S   K+WL+KNSWG
Sbjct  252  KAVTSQPVSVAIDASGYEFQFYSGGIFTGNCGTELDHGVTAVGYGTSGGTKYWLVKNSWG  311

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            ++WGE GY+++ +D  +++G CGI   PS+PTA
Sbjct  312  EQWGEAGYIRMQRDVASKEGLCGIAMQPSYPTA  344



>dbj|BAF56427.1| cysteine proteinase [Lotus japonicus]
Length=342

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            +AVANQP++VAIDASGS FQ Y+ G++   C  +++HGV  VGYG SDDG K+WL+KNSW
Sbjct  249  QAVANQPISVAIDASGSDFQNYQSGVFTGSCGTQLDHGVAVVGYGVSDDGTKYWLVKNSW  308

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G+ WGEEGY+++ +D    +G CGI   PS+PTA
Sbjct  309  GEDWGEEGYIRMQRDVEAPEGLCGIAMQPSYPTA  342



>ref|XP_007050065.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX94222.1| Senescence-associated gene 12 [Theobroma cacao]
Length=342

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDGK-FWLIKNSW  167
            KAVANQPV+V+IDA G AFQFY  GI+  DC  +++HGVTAVGYG S+DG  +WL+KNSW
Sbjct  249  KAVANQPVSVSIDAGGYAFQFYSSGIFTGDCGTELDHGVTAVGYGTSEDGTMYWLVKNSW  308

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE+GY+++ +D   ++G CGI  + S+PTA
Sbjct  309  GTGWGEKGYIRMQRDIKAKEGLCGIAMDSSYPTA  342



>ref|XP_004297572.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDASGS FQ Y  G++   C   ++HGVTAVGYG SDDG K+WL+KNSW
Sbjct  248  KAVANQPISVAIDASGSDFQLYSSGVFTGTCGTSLDHGVTAVGYGISDDGTKYWLVKNSW  307

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +D    +G CGI    S+PTA
Sbjct  308  GAQWGEEGYIRMQRDVDAPEGLCGIAMAASYPTA  341



>gb|KDP23983.1| hypothetical protein JCGZ_25371 [Jatropha curcas]
Length=340

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDGKFWLIKNSWG  164
            KAV NQPV+VAIDA G AFQFY  GI+  DC  +++HGV AVGYG S+  K+WL+KNSWG
Sbjct  248  KAVTNQPVSVAIDAGGFAFQFYSSGIFTGDCGTELDHGVAAVGYGVSNGTKYWLVKNSWG  307

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGEEGY+++ +D   ++G CGI    S+PTA
Sbjct  308  TQWGEEGYIRMQRDIDAKEGLCGIAMQASYPTA  340



>ref|XP_007025398.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOY28020.1| Senescence-associated gene 12 [Theobroma cacao]
Length=338

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDA GS FQ YK GI+  +C   ++HGVTAVGYG +DDG K+WL+KNSW
Sbjct  245  KAVANQPVSVAIDAGGSDFQHYKSGIFTGECSTFLDHGVTAVGYGTADDGTKYWLVKNSW  304

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE+GY+++ +D    +G CGI    S+PTA
Sbjct  305  GTSWGEDGYIRMQRDIDAEEGLCGIAMEASYPTA  338



>emb|CAN62459.1| hypothetical protein VITISV_015168 [Vitis vinifera]
Length=246

 Score =   121 bits (304),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVA+QP+AVAIDA G  FQFY  G++   C  +++HGV AVGYG SDDG K+WL+KNSW
Sbjct  153  KAVAHQPIAVAIDAGGXEFQFYSSGVFTGQCGTELDHGVXAVGYGTSDDGMKYWLVKNSW  212

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+++ +D   ++G CGI    S+PTA
Sbjct  213  GTGWGEEGYIRMQRDVTAKEGLCGIAMQASYPTA  246



>ref|XP_008225269.1| PREDICTED: uncharacterized protein LOC103324934 [Prunus mume]
Length=768

 Score =   127 bits (318),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 57/94 (61%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDA G  FQFY  GI   DC   +NHGVT VGYG   DG K+WL+KNSW
Sbjct  675  KAVANQPVSVAIDAGGYEFQFYSRGILTGDCGTHLNHGVTVVGYGTGADGTKYWLVKNSW  734

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGE GYV++ +D   R+G CGI    S+PTA
Sbjct  735  GAEWGEGGYVRIQRDVHTRQGLCGIAIKASYPTA  768



>ref|XP_011009172.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=340

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDGKFWLIKNSWG  164
            KAVA QPV+VAIDA G  FQFY  GI+   C  +++HGVTAVGYG SD  K+WL+KNSWG
Sbjct  248  KAVAKQPVSVAIDAGGYDFQFYSSGIFTGSCGTQLDHGVTAVGYGVSDGSKYWLVKNSWG  307

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGEEGY+++ KD   ++G CGI    S+PTA
Sbjct  308  AQWGEEGYIRMQKDVSAKEGLCGIAMQASYPTA  340



>ref|XP_011014442.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=360

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDGKFWLIKNSWG  164
            KAVA QPV+VAIDA G  FQFY  GI+   C  +++HGVTAVGYG SD  K+WL+KNSWG
Sbjct  268  KAVAEQPVSVAIDAGGYDFQFYSSGIFTGSCDTQLDHGVTAVGYGVSDGSKYWLVKNSWG  327

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGEEGY+++ KD   ++G CGI    S+PTA
Sbjct  328  AQWGEEGYIRMQKDIPAKEGLCGIAMQASYPTA  360



>ref|XP_007132875.1| hypothetical protein PHAVU_011G132100g [Phaseolus vulgaris]
 gb|ESW04869.1| hypothetical protein PHAVU_011G132100g [Phaseolus vulgaris]
Length=343

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAV NQPV+VAIDASGS F+FYK G++   C  +++HGVTAVGYG SDDG ++WL+KNSW
Sbjct  250  KAVTNQPVSVAIDASGSDFKFYKSGVFTGSCGTELDHGVTAVGYGVSDDGTEYWLVKNSW  309

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +   + +G CGI    S+PTA
Sbjct  310  GTEWGEEGYIRMQRGVDSEEGLCGIAMQASYPTA  343



>ref|XP_009354319.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=228

 Score =   120 bits (302),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVA+QPV+VAIDASGS FQFY  G++   C   ++HGVTAVGYG S+DG K+WL+KNSWG
Sbjct  136  AVAHQPVSVAIDASGSDFQFYSSGVFSGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWG  195

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGE GY+++ +D    +G CGI  + S+PTA
Sbjct  196  AEWGEAGYIRMQRDVAAPEGLCGIAMSASYPTA  228



>ref|XP_002531152.1| cysteine protease, putative [Ricinus communis]
 gb|EEF31237.1| cysteine protease, putative [Ricinus communis]
Length=340

 Score =   123 bits (308),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDGKFWLIKNSWG  164
            KAVA QPV+VAIDA G  FQFY  GI+  DC  +++HGV AVGYGES+   +WL+KNSWG
Sbjct  248  KAVAKQPVSVAIDAGGFEFQFYSSGIFTGDCGTELDHGVAAVGYGESNGMNYWLVKNSWG  307

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGEEGY+++ KD   ++G CGI    S+PTA
Sbjct  308  TQWGEEGYIRMQKDIDAKEGLCGIAMQASYPTA  340



>ref|XP_002531151.1| cysteine protease, putative [Ricinus communis]
 gb|EEF31236.1| cysteine protease, putative [Ricinus communis]
Length=340

 Score =   123 bits (308),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDGKFWLIKNSWG  164
            KAVA QPV+VAIDA G  FQFY  GI+  DC  +++HGV AVGYGES+   +WL+KNSWG
Sbjct  248  KAVAKQPVSVAIDAGGFGFQFYSSGIFTGDCGTELDHGVAAVGYGESNGMNYWLVKNSWG  307

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGEEGY+++ KD   ++G CGI    S+PTA
Sbjct  308  TQWGEEGYIRMQKDIDAKEGLCGIAMQASYPTA  340



>ref|XP_004297571.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   123 bits (308),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDASGS FQ Y  G++   C   ++HGVTAVGYG SDDG ++WL+KNSW
Sbjct  248  KAVANQPISVAIDASGSDFQLYSSGVFTGTCGTSLDHGVTAVGYGVSDDGTQYWLVKNSW  307

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +D    +G CGI    S+PTA
Sbjct  308  GAQWGEEGYIRMQRDVTAPEGLCGIAMAASYPTA  341



>ref|XP_011037399.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score =   123 bits (308),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++V+IDA GS FQFY  G++  +C  +++HGVTAVGYG++ DG K+WL+KNSW
Sbjct  249  KAVANQPISVSIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGKTSDGTKYWLVKNSW  308

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+++ +D    +G CGI  + S+PTA
Sbjct  309  GTSWGEEGYIRMQRDIDAEEGLCGIAMDSSYPTA  342



>ref|XP_002307151.2| hypothetical protein POPTR_0005s09140g, partial [Populus trichocarpa]
 gb|EEE94147.2| hypothetical protein POPTR_0005s09140g, partial [Populus trichocarpa]
Length=309

 Score =   122 bits (306),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDGKFWLIKNSWG  164
            KAVA QPV+VAIDA G  FQFY  GI+   C  +++HGVTAVGYG SD  K+WL+KNSWG
Sbjct  217  KAVAKQPVSVAIDAGGFEFQFYSSGIFTGSCGTELDHGVTAVGYGGSDGTKYWLVKNSWG  276

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGEEGY+++ KD   ++G CGI    S+PTA
Sbjct  277  AQWGEEGYIRMQKDISAKEGLCGIAMQASYPTA  309



>ref|XP_003605890.1| Cysteine proteinase [Medicago truncatula]
 gb|AES88087.1| papain family cysteine protease [Medicago truncatula]
Length=343

 Score =   123 bits (308),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDASGS FQFYK G++   C  +++HGVTAVGYG S+DG K+WL+KNSW
Sbjct  250  KAVANQPISVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSNDGTKYWLVKNSW  309

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+ + +     +G CGI    S+PTA
Sbjct  310  GTEWGEEGYIMMQRGVDAAEGLCGIAMQASYPTA  343



>ref|XP_006376431.1| hypothetical protein POPTR_0013s12980g [Populus trichocarpa]
 gb|ERP54228.1| hypothetical protein POPTR_0013s12980g [Populus trichocarpa]
Length=342

 Score =   123 bits (308),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            K VANQP++V+IDA GS FQFY  G++   C  +++HGVTAVGYGE+ DG K+WL+KNSW
Sbjct  249  KVVANQPISVSIDAGGSDFQFYSSGVFTGKCGTELDHGVTAVGYGETSDGTKYWLVKNSW  308

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+++ +D    +G CGI  + S+PTA
Sbjct  309  GTSWGEEGYIRMQRDIDTEEGLCGIAMDSSYPTA  342



>ref|XP_010045986.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW84688.1| hypothetical protein EUGRSUZ_B01505 [Eucalyptus grandis]
Length=342

 Score =   123 bits (308),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVA+QPV+VAIDA  SAFQFY  GI+  +C   ++HGVTAVGYG S+DG K+WL+KNSW
Sbjct  249  KAVAHQPVSVAIDAGESAFQFYSSGIFTGECGTNLDHGVTAVGYGTSEDGTKYWLVKNSW  308

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+++ +D   ++G CGI    S+PTA
Sbjct  309  GTGWGEEGYIRMKRDIDAKEGLCGIAMEASYPTA  342



>ref|XP_009354265.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   123 bits (308),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVA+QPV+VAIDASGS FQFY  G++   C   ++HGVTAVGYG SDDG K+WL+KNSWG
Sbjct  252  AVAHQPVSVAIDASGSNFQFYSSGVFNGTCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWG  311

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             KWGE GY+++ +D    +G CGI  + S+PTA
Sbjct  312  AKWGEAGYIRMQRDVSAPEGLCGIAMSASYPTA  344



>ref|XP_010045988.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=342

 Score =   122 bits (307),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVA+QPV+VAIDA  SAFQFY  GI+  +C   ++HGVTAVGYG S+DG K+WL+KNSW
Sbjct  249  KAVAHQPVSVAIDAGESAFQFYSSGIFTGECGTNLDHGVTAVGYGTSEDGTKYWLVKNSW  308

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+++ +D   ++G CGI    S+PTA
Sbjct  309  GTGWGEEGYIRMKRDIDAKEGLCGIAMEASYPTA  342



>ref|XP_007214432.1| hypothetical protein PRUPE_ppa025658mg [Prunus persica]
 gb|EMJ15631.1| hypothetical protein PRUPE_ppa025658mg [Prunus persica]
Length=339

 Score =   122 bits (307),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVA+QPV+VAIDA GS FQFY  G++   C   ++HGVTAVGYG SDDG KFWL+KNSWG
Sbjct  247  AVAHQPVSVAIDAGGSDFQFYSSGVFTGACGTSLDHGVTAVGYGVSDDGTKFWLVKNSWG  306

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGEEGY+++ +D   ++G CGI    S+PTA
Sbjct  307  TEWGEEGYIRMQRDVEAKEGLCGIAMEASYPTA  339



>ref|XP_008353753.1| PREDICTED: vignain-like [Malus domestica]
 ref|XP_008362420.1| PREDICTED: vignain-like [Malus domestica]
Length=155

 Score =   118 bits (296),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVA+QPV+VAIDASGS FQFY  G++   C   ++HGVTAVGYG S+DG K+WL+KNSWG
Sbjct  63   AVAHQPVSVAIDASGSDFQFYSRGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWG  122

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGE GY+++ ++    +G CGI  + S+PTA
Sbjct  123  AEWGEAGYIRMQREVAAAEGLCGIAMSASYPTA  155



>emb|CAN64655.1| hypothetical protein VITISV_005140 [Vitis vinifera]
Length=341

 Score =   122 bits (307),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVA+QP+AVAIDA G  FQFY  G++   C  +++HGV+AVGYG SDDG K+WL+KNSW
Sbjct  248  KAVAHQPIAVAIDAGGFEFQFYSSGVFTGQCGTELDHGVSAVGYGTSDDGMKYWLVKNSW  307

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+++ +D   ++G CGI    S+PTA
Sbjct  308  GTGWGEEGYIRMQRDVTEKEGLCGIAMQASYPTA  341



>gb|KHN33968.1| Vignain [Glycine soja]
Length=237

 Score =   120 bits (302),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASG+ FQFYK GI+   C  +++HGVTAVGYGE+++G K+WL+KNSW
Sbjct  144  KAVANQPVSVAIDASGADFQFYKSGIFTGSCGTELDHGVTAVGYGENNEGTKYWLVKNSW  203

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+ + +     +G CGI    S+PTA
Sbjct  204  GTEWGEEGYIMMQRGVKAVEGICGIAMMASYPTA  237



>dbj|BAF56430.1| cysteine proteinase [Lotus japonicus]
Length=341

 Score =   122 bits (307),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDGKFWLIKNSWG  164
            KAVANQP++VAIDASGS FQFY  G++   C  +++HGVTAVGYG     K+WL+KNSWG
Sbjct  249  KAVANQPISVAIDASGSEFQFYSSGVFTGSCGTELDHGVTAVGYGSDGGTKYWLVKNSWG  308

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            ++WGE+GY+++ +D    +G CG     S+PTA
Sbjct  309  EQWGEQGYIRMQRDVAAEEGLCGFAMQASYPTA  341



>ref|XP_008780633.1| PREDICTED: vignain-like [Phoenix dactylifera]
Length=186

 Score =   119 bits (298),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDA G AFQ Y  G++  DC   ++HGVTAVGY ++ DG K+WL+KNSW
Sbjct  93   KAVANQPVSVAIDAGGFAFQLYSSGVFTGDCGTDLDHGVTAVGYDKTSDGTKYWLVKNSW  152

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ +D   ++G CGI    S+PTA
Sbjct  153  GSSWGENGYIRMQRDVDAKEGLCGIAMEASYPTA  186



>ref|XP_007212667.1| hypothetical protein PRUPE_ppa018342mg [Prunus persica]
 gb|EMJ13866.1| hypothetical protein PRUPE_ppa018342mg [Prunus persica]
Length=326

 Score =   122 bits (306),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVA+QPV+VAIDA GS FQFY  G++   C   ++HGVTAVGYG SDDG K+WL+KNSWG
Sbjct  234  AVAHQPVSVAIDAGGSDFQFYSSGVFTGSCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWG  293

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGEEGY+++ +D   ++G CGI    S+PTA
Sbjct  294  TEWGEEGYIRMQRDVEAKEGLCGIAMEASYPTA  326



>ref|XP_008228922.1| PREDICTED: vignain-like [Prunus mume]
Length=326

 Score =   122 bits (306),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVA+QPV+VAIDA GS FQFY  G++   C   ++HGVTAVGYG SDDG K+WL+KNSWG
Sbjct  234  AVAHQPVSVAIDAGGSDFQFYSSGVFTGSCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWG  293

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGEEGY+++ +D   ++G CGI    S+PTA
Sbjct  294  TEWGEEGYIRMQRDVEAKEGLCGIAMEASYPTA  326



>ref|XP_009629965.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=343

 Score =   122 bits (307),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDASGS FQFY  G++  +C  +++HGVTA+GYG++ DG ++WL+KNSW
Sbjct  249  KAVANQPISVAIDASGSDFQFYSTGVFTGECGTELDHGVTAIGYGKTSDGTQYWLVKNSW  308

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ +D    +G CGI    S+PTA
Sbjct  309  GTSWGENGYIRMQRDVDAEEGLCGIAMQASYPTA  342



>ref|XP_011086001.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   122 bits (307),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGS FQFY  G++   C  +++HGVTAVGYG++ DG K+WL+KNSW
Sbjct  248  KAVANQPVSVAIDASGSDFQFYTSGVFTGQCGTELDHGVTAVGYGKTSDGTKYWLVKNSW  307

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ +D    +G CGI    S+PTA
Sbjct  308  GTSWGENGYIRMQRDIDAAEGLCGIAMQASYPTA  341



>ref|XP_011022002.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=365

 Score =   122 bits (307),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDGKFWLIKNSWG  164
            KAVA QPV+VAIDA G  FQFY  GI+   C  +++HGVTAVGYG SD  K+WL+KNSWG
Sbjct  273  KAVAKQPVSVAIDAGGFEFQFYSSGIFTGSCGTELDHGVTAVGYGGSDGTKYWLVKNSWG  332

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGEEGY+++ KD   ++G CGI    S+PTA
Sbjct  333  AQWGEEGYIRMQKDISAKEGLCGIAMQASYPTA  365



>gb|AAP32196.1| cysteine protease 8 [Trifolium repens]
Length=343

 Score =   122 bits (306),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDASGS FQFYK G++   C  +++HGVTAVGYG S+DG K+WL+KNSW
Sbjct  250  KAVANQPISVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSNDGTKYWLVKNSW  309

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+ + +     +G CGI    S+PTA
Sbjct  310  GTDWGEEGYIMMQRGVEAAEGLCGIAMQASYPTA  343



>ref|XP_004290089.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   122 bits (306),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDASGS FQFY  G++   C   ++HGVTAVGYG  DDG K+WL+KNSW
Sbjct  247  KAVANQPISVAIDASGSDFQFYSSGVFTGACGTSLDHGVTAVGYGVGDDGTKYWLVKNSW  306

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGE+GY+++ +D    +G CGI    S+PTA
Sbjct  307  GAEWGEQGYIRMQRDVDAPEGLCGIAMEASYPTA  340



>gb|KHN07749.1| Vignain [Glycine soja]
Length=301

 Score =   121 bits (304),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGS FQFYK G++   C  +++HGVTAVGYG SDDG ++WL+KNS 
Sbjct  208  KAVANQPVSVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSDDGTEYWLVKNSR  267

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +   + +G CGI    S+PTA
Sbjct  268  GTEWGEEGYIRMQRGVDSEEGLCGIAMQASYPTA  301



>ref|XP_010038688.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW47321.1| hypothetical protein EUGRSUZ_K01109 [Eucalyptus grandis]
Length=340

 Score =   122 bits (306),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVA QPV+VAIDA G  FQFY  G++   C  +++HGVTAVGYG SDDG KFWL+KNSW
Sbjct  247  KAVAKQPVSVAIDAGGFDFQFYSSGVFTGACGTELDHGVTAVGYGTSDDGTKFWLVKNSW  306

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G++WGE+GY+++ +D   ++G CGI    S+PTA
Sbjct  307  GEEWGEKGYIRMQRDVSAKEGLCGIAMKASYPTA  340



>ref|XP_004505502.1| PREDICTED: vignain-like [Cicer arietinum]
Length=345

 Score =   122 bits (306),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDASGS FQFYK G++   C  +++HGVTAVGYG S+DG K+WL+KNSW
Sbjct  252  KAVANQPISVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSNDGTKYWLVKNSW  311

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE+GY+++ +     +G CGI    S+PTA
Sbjct  312  GTDWGEQGYIRMQRGVDAAEGLCGIAMQASYPTA  345



>ref|XP_008342800.1| PREDICTED: thiol protease SEN102-like [Malus domestica]
Length=243

 Score =   120 bits (301),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVA+QPV+VAIDASGS FQFY  G++   C   ++HGVTAVGYG S+DG K+WL+KNSWG
Sbjct  151  AVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWG  210

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGE GY+++ +D    +G CGI  + S+PTA
Sbjct  211  AEWGEAGYIRMQRDVAAAEGLCGIAMSASYPTA  243



>ref|XP_008244476.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=339

 Score =   122 bits (306),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVA+QPV+VAIDA GS FQFY  G++   C   ++HGVTAVGYG SDDG K+WL+KNSWG
Sbjct  247  AVAHQPVSVAIDAGGSDFQFYSSGVFTGSCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWG  306

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGEEGY+++ +D   ++G CGI    S+PTA
Sbjct  307  TEWGEEGYIRMQRDVEAKEGLCGIAMEASYPTA  339



>ref|XP_007212585.1| hypothetical protein PRUPE_ppa015944mg [Prunus persica]
 gb|EMJ13784.1| hypothetical protein PRUPE_ppa015944mg [Prunus persica]
Length=339

 Score =   122 bits (306),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVA+QPV+VAIDA GS FQFY  G++   C   ++HGVTAVGYG SDDG K+WL+KNSWG
Sbjct  247  AVAHQPVSVAIDAGGSDFQFYSSGVFTGSCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWG  306

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGEEGY+++ +D   ++G CGI    S+PTA
Sbjct  307  TEWGEEGYIRMQRDVEAKEGLCGIAMEASYPTA  339



>gb|KHN07750.1| KDEL-tailed cysteine endopeptidase CEP1 [Glycine soja]
Length=309

 Score =   121 bits (304),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGS FQFYK G++   C  +++HGVTAVGYG S DG ++WL+KNSW
Sbjct  216  KAVANQPVSVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSADGTEYWLVKNSW  275

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +    ++G CGI    S+PTA
Sbjct  276  GTEWGEEGYIRMQRGVKAKEGLCGIAMMASYPTA  309



>ref|XP_003609015.1| Cysteine proteinase [Medicago truncatula]
 gb|AES91212.1| papain family cysteine protease [Medicago truncatula]
Length=345

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDASGS FQFYK G++   C  +++HGVTAVGYG  +DG K+WL+KNSW
Sbjct  252  KAVANQPISVAIDASGSDFQFYKSGVFSGSCGTELDHGVTAVGYGVGNDGTKYWLVKNSW  311

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+++ +     +G CGI    S+PTA
Sbjct  312  GTDWGEEGYIRMQRGVDAAEGLCGIAMQASYPTA  345



>ref|XP_003607571.1| Cysteine proteinase EP-B [Medicago truncatula]
 gb|AAQ63885.1| putative cysteine proteinase [Medicago truncatula]
 gb|AES89768.1| papain family cysteine protease [Medicago truncatula]
Length=345

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDASGS FQFYK G++   C  +++HGVTAVGYG  +DG K+WL+KNSW
Sbjct  252  KAVANQPISVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVGNDGTKYWLVKNSW  311

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+K+ +     +G CGI    S+PTA
Sbjct  312  GTDWGEEGYIKMQRGVDAAEGLCGIAMEASYPTA  345



>ref|XP_006857795.1| hypothetical protein AMTR_s00061p00215070 [Amborella trichopoda]
 gb|ERN19262.1| hypothetical protein AMTR_s00061p00215070 [Amborella trichopoda]
Length=342

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDGKFWLIKNSWG  164
            KAV +QPV+VAIDASG  FQFY  G++  +C  +++HGVTAVGYG S   K+WL+KNSWG
Sbjct  250  KAVTSQPVSVAIDASGYEFQFYSGGVFTGNCGTELDHGVTAVGYGTSGGTKYWLVKNSWG  309

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGE GY+++ +D  +++G CGI   PS+PTA
Sbjct  310  KQWGEAGYIRMQRDVASKEGLCGIAMQPSYPTA  342



>ref|XP_003612210.1| Cysteine proteinase [Medicago truncatula]
 gb|AES95168.1| papain family cysteine protease [Medicago truncatula]
Length=344

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDASGS FQFYK G++   C  +++HGVTAVGYG S+DG K+WL+KNSW
Sbjct  251  KAVANQPISVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSNDGTKYWLVKNSW  310

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+ + +     +G CGI    S+PTA
Sbjct  311  GTDWGEEGYIMMQRGVEAAEGLCGIAMQASYPTA  344



>ref|XP_006852525.1| hypothetical protein AMTR_s00021p00178750 [Amborella trichopoda]
 gb|ERN13992.1| hypothetical protein AMTR_s00021p00178750 [Amborella trichopoda]
Length=227

 Score =   119 bits (299),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDGKFWLIKNSWG  164
            KAV  QPV+VAIDASG AFQFYK GI+   C  ++NHGVTAVGYG  D    WL+KNSWG
Sbjct  135  KAVVQQPVSVAIDASGYAFQFYKGGIFSGACGTELNHGVTAVGYGAQDGKLHWLVKNSWG  194

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFP  71
             +WGE GYV++ ++ GN++G CGI+   S+P
Sbjct  195  SRWGEGGYVRMERNIGNKEGICGISMMASYP  225



>ref|XP_008800071.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDA GSAFQ Y  G++  DC  +++HGVTAVGY ++ DG K+WL+KNSW
Sbjct  249  KAVANQPVSVAIDAGGSAFQLYSSGVFTGDCGTELDHGVTAVGYDKTSDGTKYWLVKNSW  308

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ +D   ++G CGI    S+PTA
Sbjct  309  GSSWGENGYIRMERDVDAKEGLCGIAMEASYPTA  342



>ref|XP_004303175.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDASGS FQFY  G++   C   ++HGVTAVGYG SD+G K+WL+KNSW
Sbjct  247  KAVANQPISVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSDNGTKYWLVKNSW  306

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGE GY+++ +D   ++G CGI    S+PTA
Sbjct  307  GAEWGEGGYIRMQRDVDAQEGLCGIAMAASYPTA  340



>ref|XP_009775915.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=340

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVANQPV+VAIDASGS FQFY  G++  +C  +++HGVTA+GYG++ DG K+WL+KNSWG
Sbjct  248  AVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDHGVTAIGYGKTSDGTKYWLVKNSWG  307

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
              WGE GY+++ +D    +G CGI    S+PTA
Sbjct  308  TSWGENGYIRMQRDIDAAEGTCGIAMQASYPTA  340



>ref|XP_003607548.1| Cysteine protease [Medicago truncatula]
 ref|XP_003637653.1| Cysteine protease [Medicago truncatula]
 gb|AES89745.1| papain family cysteine protease [Medicago truncatula]
Length=345

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDASGS FQFYK G++   C  +++HGVTAVGYG  +DG K+WL+KNSW
Sbjct  252  KAVANQPISVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVGNDGTKYWLVKNSW  311

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+K+ +     +G CGI    S+PTA
Sbjct  312  GTDWGEEGYIKMQRGVDAAEGLCGIAMEASYPTA  345



>ref|XP_011086005.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGS FQFY  G++   C  +++HGVTAVGYG++ DG K+WL+KNSW
Sbjct  248  KAVANQPVSVAIDASGSDFQFYTSGVFTGQCGTELDHGVTAVGYGKTSDGTKYWLVKNSW  307

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ +D    +G CGI    S+P+A
Sbjct  308  GTSWGENGYIRMQRDVDAAEGLCGIAMQASYPSA  341



>dbj|BAF46311.1| cysteine proteinase precursor [Ipomoea nil]
Length=339

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDA GS FQFY  G++  +C  +++HGVTAVGYG ++DG K+WL+KNSW
Sbjct  246  KAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGSKYWLVKNSW  305

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE+GY+++ KD   ++G CGI    S+P+A
Sbjct  306  GTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  339



>ref|XP_002306369.1| hypothetical protein POPTR_0005s09080g [Populus trichocarpa]
 gb|EEE93365.1| hypothetical protein POPTR_0005s09080g [Populus trichocarpa]
Length=340

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDGKFWLIKNSWG  164
            KAVA QPV+VAIDA G  FQFY  GI+   C  +++HGVTAVGYG SD  K+WL+KNSWG
Sbjct  248  KAVAKQPVSVAIDAGGFEFQFYSSGIFTGSCGTQLDHGVTAVGYGISDGTKYWLVKNSWG  307

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGEEGY+++ KD   ++G CGI    S+P+A
Sbjct  308  AQWGEEGYIRMQKDISAKEGLCGIAMQASYPSA  340



>gb|AAK27968.1|AF242372_1 cysteine protease [Ipomoea batatas]
Length=339

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDA GS FQFY  G++  +C  +++HGVTAVGYG ++DG K+WL+KNSW
Sbjct  246  KAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGSKYWLVKNSW  305

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE+GY+++ KD   ++G CGI    S+P+A
Sbjct  306  GTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  339



>ref|XP_003527388.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGS FQFYK G++   C  +++HGVTAVGYG S DG ++WL+KNSW
Sbjct  250  KAVANQPVSVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSADGTEYWLVKNSW  309

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +     +G CGI    S+PTA
Sbjct  310  GTEWGEEGYIRMQRGVKAEEGLCGIAMMASYPTA  343



>ref|XP_007213554.1| hypothetical protein PRUPE_ppa018048mg [Prunus persica]
 gb|EMJ14753.1| hypothetical protein PRUPE_ppa018048mg [Prunus persica]
Length=343

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDA G  FQFY  GI   DC   +NHGVT VGYG   DG K+WL+KNSW
Sbjct  250  KAVANQPVSVAIDAGGYEFQFYSRGILTGDCGTHLNHGVTVVGYGTGADGTKYWLVKNSW  309

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGE GYV++ +D   R+G CGI    S+PTA
Sbjct  310  GAEWGEGGYVRIQRDVHTRQGLCGIAMKASYPTA  343



>ref|XP_010091034.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 ref|XP_010091036.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36678.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36680.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=343

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDA GS FQ Y  G++  +C  +++HGVTAVGYG+++DG K+WL+KNSW
Sbjct  250  KAVANQPVSVAIDAGGSDFQLYSSGVFTGECGTELDHGVTAVGYGKTEDGTKYWLVKNSW  309

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+++ +D    +G CGI    S+P+A
Sbjct  310  GSSWGEEGYIRMERDVDAEEGLCGIAMEASYPSA  343



>ref|XP_004505500.1| PREDICTED: vignain-like [Cicer arietinum]
Length=345

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KA+ANQP++VAIDASGS FQFYK G++   C  +++HGVTAVGYG S+DG K+WL+KNSW
Sbjct  252  KALANQPISVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSNDGTKYWLVKNSW  311

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE+GY+++ +     +G CGI    S+PTA
Sbjct  312  GTDWGEQGYIRMQRGVDAAEGLCGIAMQASYPTA  345



>gb|AAL14199.1| cysteine proteinase precursor [Ipomoea batatas]
 gb|AAK15148.2| cysteine proteinase-like protein [Ipomoea batatas]
Length=341

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDA GS FQFY  G++  +C  +++HGVTAVGYG ++DG K+WL+KNSW
Sbjct  248  KAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGSKYWLVKNSW  307

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE+GY+++ KD   ++G CGI    S+P+A
Sbjct  308  GTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  341



>gb|AAT34987.1| putative cysteine protease [Gossypium hirsutum]
Length=344

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVA+QPV+VAI+A GS FQFY  G++  +C  +++H VTAVGYGES+DG K+W++KNSW
Sbjct  251  KAVAHQPVSVAIEAGGSDFQFYSSGVFTGECGTELDHAVTAVGYGESEDGSKYWIVKNSW  310

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G KWGE GY+++ KD   ++G CGI    S+PTA
Sbjct  311  GTKWGESGYIEMQKDIKVKQGLCGIAMQASYPTA  344



>ref|XP_007048796.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92953.1| Senescence-associated gene 12 [Theobroma cacao]
Length=343

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 69/93 (74%), Gaps = 1/93 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDA G  FQFY  G++  DC   ++HGVTAVGYG  DDG K+WL+KNSW
Sbjct  250  KAVANQPVSVAIDAGGFKFQFYSGGVFTGDCGTALDHGVTAVGYGVDDDGTKYWLVKNSW  309

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPT  68
            G  WGEEGY+++ +D   ++G CGI    S+PT
Sbjct  310  GTSWGEEGYIRMQRDVDAKEGLCGIAMQASYPT  342



>dbj|BAB13759.1| cysteine proteinase [Astragalus sinicus]
Length=343

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDASGS FQFY  G++   C  +++HGVTAVGYG SDDG K+WL+KNSW
Sbjct  250  KAVANQPISVAIDASGSDFQFYTSGVFTGSCGTELDHGVTAVGYGVSDDGTKYWLVKNSW  309

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+++ +     +G CGI    S+P A
Sbjct  310  GTSWGEEGYIRMQRGVDAVEGLCGIAMQASYPIA  343



>gb|KCW47322.1| hypothetical protein EUGRSUZ_K01110 [Eucalyptus grandis]
Length=305

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDA G  FQFY  G++   C   ++HGV AVGYG SDD  K+WL+KNSW
Sbjct  212  KAVANQPVSVAIDAGGFEFQFYSSGVFTGACGTDLDHGVAAVGYGTSDDSTKYWLVKNSW  271

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G KWGEEGY+++ +D   ++G CGI    S+PTA
Sbjct  272  GAKWGEEGYIRMQRDVTAKEGLCGIAMKASYPTA  305



>emb|CAL64936.1| putative cysteine protease 8 [Trifolium pratense]
Length=344

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDASGS FQFYK G++   C  +++HGVTAVGYG S+DG K+WL+KNSW
Sbjct  251  KAVANQPISVAIDASGSDFQFYKSGVFTGACGTELDHGVTAVGYGVSNDGTKYWLVKNSW  310

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+ + +     +G CGI    S+PTA
Sbjct  311  GTDWGEEGYIMMQRGIEAAEGICGIAMQASYPTA  344



>ref|XP_004505461.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP1-like [Cicer 
arietinum]
Length=343

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+V +D  GS FQFY  GI+   C    +H VT VGYG S DG K+W++KNSW
Sbjct  250  KAVANQPVSVYVDGGGSGFQFYSGGIFTGKCGTDTDHAVTVVGYGVSHDGMKYWIVKNSW  309

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G+ WGE+GY++L +D G++KG CGI TNPS+P A
Sbjct  310  GNDWGEKGYMRLKRDIGSKKGLCGIATNPSYPVA  343



>ref|XP_008800073.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDA GSAFQ Y  G++  DC   ++HGVTAVGY ++ DG K+WL+KNSW
Sbjct  249  KAVANQPVSVAIDAGGSAFQLYSSGVFTGDCGTDLDHGVTAVGYDKTSDGTKYWLVKNSW  308

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ +D   ++G CGI    S+PTA
Sbjct  309  GSSWGENGYIRMERDVDAKEGLCGIAMEASYPTA  342



>emb|CDP18645.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+V+IDASG AFQFY  G++  DC   ++HGVTAVGYG++ +G K+WL+KNSW
Sbjct  244  KAVANQPVSVSIDASGMAFQFYTSGVFTGDCGTDLDHGVTAVGYGKASNGTKYWLVKNSW  303

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ +    ++G CGI  + S+PTA
Sbjct  304  GTSWGESGYIRMQRGISAKEGLCGIAMDSSYPTA  337



>ref|XP_010103045.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXB94643.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=359

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDA GS FQ Y  G++  +C  +++HGVTAVGYG+++DG K+WL+KNSW
Sbjct  266  KAVANQPVSVAIDAGGSDFQLYSSGVFTGECGTELDHGVTAVGYGKTEDGTKYWLVKNSW  325

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+++ +D    +G CGI    S+P+A
Sbjct  326  GSSWGEEGYIRMERDVDAEEGLCGIAMEASYPSA  359



>dbj|BAD29955.1| cysteine protease [Daucus carota]
Length=365

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDASGS FQFY  G++  +C  +++HGVTAVGYG + DG K+WL+KNSW
Sbjct  248  KAVANQPISVAIDASGSDFQFYSSGVFTGECGTELDHGVTAVGYGTAADGTKYWLVKNSW  307

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+++ +     +G CGI    S+PTA
Sbjct  308  GTSWGEEGYIQMQRGVAAAEGLCGIAMQASYPTA  341



>ref|XP_010038689.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=340

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDA G  FQFY  G++   C   ++HGV AVGYG SDD  K+WL+KNSW
Sbjct  247  KAVANQPVSVAIDAGGFEFQFYSSGVFTGACGTDLDHGVAAVGYGTSDDSTKYWLVKNSW  306

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G KWGEEGY+++ +D   ++G CGI    S+PTA
Sbjct  307  GAKWGEEGYIRMQRDVTAKEGLCGIAMKASYPTA  340



>gb|AFV30165.1| cysteine proteinase [Lotus japonicus]
Length=342

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            +AVANQP+++AIDASGS FQ Y+ G++   C  +++HGV  VGYG SDDG K+WL+KNSW
Sbjct  249  QAVANQPISIAIDASGSDFQNYQSGVFTGSCGTQLDHGVAVVGYGVSDDGTKYWLVKNSW  308

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+++ +D    +G CG+   PS+PTA
Sbjct  309  GADWGEEGYIRMQRDVDAPEGLCGLAMQPSYPTA  342



>gb|EYU19040.1| hypothetical protein MIMGU_mgv1a026538mg [Erythranthe guttata]
Length=325

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDASGS FQFY  G++   C  +++HGVTAVGYG + DG K+WL+KNSW
Sbjct  232  KAVANQPISVAIDASGSDFQFYSGGVFSGQCGTELDHGVTAVGYGVTSDGTKYWLVKNSW  291

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ +D    +G CGI    S+PTA
Sbjct  292  GSSWGENGYIRMQRDIDAAEGLCGIAMQASYPTA  325



>ref|XP_003527350.1| PREDICTED: vignain-like [Glycine max]
 ref|XP_003556993.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASG+ FQFYK GI+   C  +++HGVTAVGYGE+++G K+WL+KNSW
Sbjct  250  KAVANQPVSVAIDASGADFQFYKSGIFTGSCGTELDHGVTAVGYGENNEGTKYWLVKNSW  309

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+ + +     +G CGI    S+PTA
Sbjct  310  GTEWGEEGYIMMQRGVKAVEGICGIAMMASYPTA  343



>gb|EYU19037.1| hypothetical protein MIMGU_mgv1a018631mg [Erythranthe guttata]
Length=325

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDASGS FQFY  G++   C  +++HGVTAVGYG + DG K+WL+KNSW
Sbjct  232  KAVANQPISVAIDASGSDFQFYSGGVFSGQCGTELDHGVTAVGYGVTSDGTKYWLVKNSW  291

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ +D    +G CGI    S+PTA
Sbjct  292  GSSWGENGYIRMQRDIDAAEGLCGIAMQASYPTA  325



>ref|XP_004252607.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=340

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDAS S FQFY  G++  +C  +++HGVTAVGYG++ DG K+WL+KNSW
Sbjct  247  KAVANQPVSVAIDASASDFQFYSSGVFTGECGTELDHGVTAVGYGKASDGTKYWLVKNSW  306

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ ++    +G CGI    S+PTA
Sbjct  307  GTSWGENGYIRMQRNVDTEEGLCGIAMEASYPTA  340



>ref|XP_008340724.1| PREDICTED: vignain-like [Malus domestica]
Length=338

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDA GS FQFY  G++   C   ++HGVTAVG+G S DG K+WL+KNSW
Sbjct  245  KAVANQPISVAIDAGGSDFQFYSSGVFTGTCGTSLDHGVTAVGFGVSADGTKYWLVKNSW  304

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +D   ++G CGI    S+PTA
Sbjct  305  GAEWGEEGYIRMQRDVEAKEGLCGIAMEASYPTA  338



>gb|AAU81592.1| cysteine proteinase, partial [Petunia x hybrida]
Length=196

 Score =   117 bits (294),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 70/92 (76%), Gaps = 1/92 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAI+ASGS FQFY EG++  DC  +++HGV  VGYG + DG K+W ++NSW
Sbjct  85   KAVANQPVSVAIEASGSDFQFYSEGVFTGDCGTELDHGVAIVGYGTTLDGTKYWTVRNSW  144

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFP  71
            G +WGE+GY+++ +D    +G CGI   PS+P
Sbjct  145  GPEWGEKGYIRMQRDIDAEEGLCGIAMQPSYP  176



>gb|KHN32068.1| Vignain [Glycine soja]
Length=309

 Score =   120 bits (301),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGS FQFYK G++   C  +++HGVTAVGYG S DG ++WL+KNSW
Sbjct  216  KAVANQPVSVAIDASGSDFQFYKTGVFTGSCGTQLDHGVTAVGYGVSADGTQYWLVKNSW  275

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+ + +    ++G CGI    S+PTA
Sbjct  276  GTEWGEEGYIMMQRGVKAQEGLCGIAMMASYPTA  309



>gb|KHN13720.1| Vignain [Glycine soja]
Length=309

 Score =   120 bits (301),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGS FQFYK G++   C  +++HGVTAVGYG S DG ++WL+KNSW
Sbjct  216  KAVANQPVSVAIDASGSDFQFYKTGVFTGSCGTQLDHGVTAVGYGVSADGTQYWLVKNSW  275

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+ + +    ++G CGI    S+PTA
Sbjct  276  GTEWGEEGYIMMQRGVKAQEGLCGIAMMASYPTA  309



>ref|XP_003539970.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGS FQFYK G++   C  +++HGVTAVGYG S DG ++WL+KNSW
Sbjct  250  KAVANQPVSVAIDASGSDFQFYKTGVFTGSCGTQLDHGVTAVGYGVSADGTQYWLVKNSW  309

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+ + +    ++G CGI    S+PTA
Sbjct  310  GTEWGEEGYIMMQRGVKAQEGLCGIAMMASYPTA  343



>emb|CCI46913.1| unnamed protein product [Albugo candida]
Length=514

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDGKFWLIKNSWGD  161
            AVA QPV++AIDA   +FQFYK G+Y K C  +++HGV AVGYG  D  KFW +KNSWG 
Sbjct  245  AVAQQPVSIAIDAGDRSFQFYKSGVYNKTCGTQLDHGVLAVGYGVEDGQKFWKVKNSWGT  304

Query  160  KWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             WGEEGY++L +D     G CGI   PSFPTA
Sbjct  305  TWGEEGYIRLSRDQNGPTGQCGIAMVPSFPTA  336



>ref|XP_004505498.1| PREDICTED: vignain-like [Cicer arietinum]
Length=344

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDASGS FQFYK G++   C  +++HGVTAVGYG S+DG K+WL+KNSW
Sbjct  251  KAVANQPISVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSNDGTKYWLVKNSW  310

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPT  68
            G  WGE+GY+++ +     +G CGI    S+PT
Sbjct  311  GTDWGEQGYIRMQRGVDAAEGLCGIAMQASYPT  343



>ref|XP_011038210.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++V+IDA GS FQFY  G++   C  +++HGVTAVGYGE+ DG K+WL KNSW
Sbjct  249  KAVANQPISVSIDAGGSDFQFYSSGVFTGQCGTELDHGVTAVGYGETSDGTKYWLFKNSW  308

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ +D    +G CGI  + S+PTA
Sbjct  309  GTSWGEAGYIRMQRDIDAEEGLCGIAMDSSYPTA  342



>ref|XP_003539989.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGS FQFYK G++   C  +++HGVTAVGYG S DG ++WL+KNSW
Sbjct  250  KAVANQPVSVAIDASGSDFQFYKTGVFTGSCGTQLDHGVTAVGYGVSADGTQYWLVKNSW  309

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+ + +    ++G CGI    S+PTA
Sbjct  310  GTEWGEEGYIMMQRGVKAQEGLCGIAMMASYPTA  343



>ref|XP_010442505.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP1-like [Camelina 
sativa]
Length=362

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 71/92 (77%), Gaps = 1/92 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDA GS FQFY EG++   C  ++NHGV  VGYG + DG K+W++KNSW
Sbjct  251  KAVANQPVSVAIDAGGSDFQFYSEGVFTGRCGTELNHGVAVVGYGTTIDGTKYWIVKNSW  310

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFP  71
            G++WGE+GY+++ +   N+KG CGIT   S+P
Sbjct  311  GEEWGEKGYIRMQRGIRNKKGLCGITMEASYP  342



>ref|XP_006857794.1| hypothetical protein AMTR_s00061p00214890 [Amborella trichopoda]
 gb|ERN19261.1| hypothetical protein AMTR_s00061p00214890 [Amborella trichopoda]
Length=342

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDGKFWLIKNSWG  164
            KAVA+QPV+VAIDASG  FQFY  G++  +C  +++HGVTAVGYG S   K+WL+KNSWG
Sbjct  250  KAVASQPVSVAIDASGYEFQFYSRGVFTGNCGTELDHGVTAVGYGTSGGTKYWLVKNSWG  309

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGE GY+ + +D  +++G CGI    S+PTA
Sbjct  310  KQWGEAGYIMMQRDVASKEGLCGIAMQASYPTA  342



>gb|AAP32194.1| cysteine protease 1 [Trifolium repens]
Length=292

 Score =   120 bits (300),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDASGS FQFY  G++   C  +++HGVTAVGYG  +DG K+WL+KNSW
Sbjct  199  KAVANQPISVAIDASGSDFQFYNSGVFTGSCGTELDHGVTAVGYGVGNDGTKYWLVKNSW  258

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+++ +     +G CGI    S+PTA
Sbjct  259  GADWGEEGYIRMQRGIAAAEGLCGIAMQASYPTA  292



>ref|XP_008223852.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=342

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDA GS FQFY  G++   C   ++HGVTAVGYG SDDG K+WL+KNSW
Sbjct  249  KAVANQPVSVAIDAGGSDFQFYSSGVFTGACGTSLDHGVTAVGYGVSDDGTKYWLVKNSW  308

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGE+GY+++ +    ++G CGI    S+PTA
Sbjct  309  GTEWGEKGYIRMQRGVEAKEGLCGIAMEASYPTA  342



>ref|XP_003529366.1| PREDICTED: thiol protease SEN102-like [Glycine max]
Length=340

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDGKFWLIKNSWGD  161
            AVA+QPV+V ++A G  FQFY  G++  +C  ++NH VT VGYGE  +GK+WLI+NSWG 
Sbjct  249  AVASQPVSVLLEAKGQGFQFYSGGVFSGECGTELNHAVTIVGYGEEAEGKYWLIRNSWGK  308

Query  160  KWGEEGYVKLMKDTGNRKGACGITTNPSFP  71
             WGE GY+KLM+DTGN +G CGI    S+P
Sbjct  309  SWGEGGYMKLMRDTGNPQGLCGINMQASYP  338



>ref|XP_002525124.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37251.1| cysteine protease, putative [Ricinus communis]
Length=342

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVA+QPV+V+IDA   +FQFY+ GIY   C + +NHGV AVGYG S  G K+W++KNSW
Sbjct  249  KAVAHQPVSVSIDAGSMSFQFYQSGIYAGSCGSDLNHGVAAVGYGTSSSGSKYWIVKNSW  308

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGE GYV++ +D  +RKG CGI  + S+PTA
Sbjct  309  GPEWGERGYVRMKRDITSRKGLCGIAMDCSYPTA  342



>gb|KDP40484.1| hypothetical protein JCGZ_24483 [Jatropha curcas]
Length=339

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDGKFWLIKNSWGD  161
            AVANQPV+VAIDASG  FQFY  GI+   C  +++HGV AVGYG +D  KFWL+KNSWG 
Sbjct  248  AVANQPVSVAIDASGFEFQFYSSGIFTGSCGTELDHGVAAVGYGVNDGNKFWLVKNSWGT  307

Query  160  KWGEEGYVKLMKDTGNRKGACGITTNPSFPT  68
            +WGE+GY+++ +D   ++G CGI    S+PT
Sbjct  308  QWGEKGYIRMQRDIAAKEGLCGIAMQASYPT  338



>gb|KHN33962.1| Vignain [Glycine soja]
Length=309

 Score =   120 bits (300),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGS FQFY+ G++   C  +++HGVTAVGYG S DG ++WL+KNSW
Sbjct  216  KAVANQPVSVAIDASGSDFQFYQSGVFTGSCGTELDHGVTAVGYGVSADGTEYWLVKNSW  275

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +     +G CGI    S+PTA
Sbjct  276  GTEWGEEGYIRMQRGVKAEEGLCGIAMMASYPTA  309



>ref|XP_003527349.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGS FQFY+ G++   C  +++HGVTAVGYG S DG ++WL+KNSW
Sbjct  250  KAVANQPVSVAIDASGSDFQFYQSGVFTGSCGTELDHGVTAVGYGVSADGTEYWLVKNSW  309

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +     +G CGI    S+PTA
Sbjct  310  GTEWGEEGYIRMQRGVKAEEGLCGIAMMASYPTA  343



>ref|XP_003556992.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDASGS FQFY+ G++   C  +++HGVTAVGYG S DG ++WL+KNSW
Sbjct  250  KAVANQPVSVAIDASGSDFQFYQSGVFTGSCGTELDHGVTAVGYGVSADGTEYWLVKNSW  309

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +     +G CGI    S+PTA
Sbjct  310  GTEWGEEGYIRMQRGVKAEEGLCGIAMMASYPTA  343



>gb|AAP32197.1| cysteine protease 10 [Trifolium repens]
Length=272

 Score =   119 bits (298),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDASGS FQFY  G++   C  +++HGVTAVGYG  +DG K+WL+KNSW
Sbjct  179  KAVANQPISVAIDASGSDFQFYNSGVFTGSCGTELDHGVTAVGYGVGNDGTKYWLVKNSW  238

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+++ +     +G CGI    S+PTA
Sbjct  239  GADWGEEGYIRMQRGIDAAEGLCGIAMQASYPTA  272



>gb|EYU25672.1| hypothetical protein MIMGU_mgv1a018700mg [Erythranthe guttata]
Length=343

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDASGS FQFY  G++   C  +++HGVTAVGYG + DG K+WL+KNSW
Sbjct  250  KAVANQPISVAIDASGSDFQFYSGGVFTGQCGTELDHGVTAVGYGVTSDGTKYWLVKNSW  309

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ +D    +G CGI    S+PTA
Sbjct  310  GTSWGENGYIRMQRDIDAAEGLCGIAMQASYPTA  343



>ref|XP_008353750.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVA+QPV+VAIDASGS FQFY  G++   C   ++HGVTAVGYG S+DG K+WL+KNSWG
Sbjct  252  AVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWG  311

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGE GY+++ +D    +G CGI  + S+PTA
Sbjct  312  XEWGEXGYIRMQRDVAAAEGLCGIAMSASYPTA  344



>ref|XP_008368631.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVA+QPV+VAIDASGS FQFY  G++   C   ++HGVTAVGYG S+DG K+WL+KNSWG
Sbjct  252  AVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWG  311

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGE GY+++ +D    +G CGI  + S+PTA
Sbjct  312  AEWGEAGYIRMQRDVAAXEGLCGIAMSASYPTA  344



>ref|XP_007048674.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92831.1| Senescence-associated gene 12 [Theobroma cacao]
Length=344

 Score =   120 bits (301),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDA G  FQFY  GI+   C+ +++HGVTAVGYG  DDG K+WL+KNSW
Sbjct  251  KAVANQPVSVAIDAGGFEFQFYSGGIFTGACETQLDHGVTAVGYGVGDDGTKYWLVKNSW  310

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE+GY+++ +D   ++G CGI    S+PTA
Sbjct  311  GTSWGEKGYIRMQRDVDAKEGLCGIAMAASYPTA  344



>gb|KDP31767.1| hypothetical protein JCGZ_12228 [Jatropha curcas]
Length=315

 Score =   119 bits (299),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDGKFWLIKNSWGD  161
            AVA QPV+VAIDA G +FQFY +GI+   C  ++NHGVTAVGYGE+D  K+WL+KNSWG 
Sbjct  221  AVAKQPVSVAIDAGGFSFQFYSKGIFSGFCGTQLNHGVTAVGYGETDGKKYWLVKNSWGT  280

Query  160  KWGEEGYVKLMKDTGNRKGACGITTNPSFPT  68
            +WG+ GY+KL + +  +KG CGI   PS+P 
Sbjct  281  EWGDSGYIKLRRGSKGKKGICGIAMEPSYPV  311



>ref|XP_004515849.1| PREDICTED: vignain-like [Cicer arietinum]
Length=360

 Score =   120 bits (301),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 70/92 (76%), Gaps = 1/92 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KA ANQP++VAIDA GS FQ Y EG++   C  ++NHGV  VGYGE++DG K+W++KNSW
Sbjct  251  KAAANQPISVAIDAGGSDFQLYSEGVFSGYCGTRLNHGVAIVGYGETEDGTKYWIVKNSW  310

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFP  71
            G +WGEEGY+++ +D   ++G CGI  + S+P
Sbjct  311  GSQWGEEGYIRIQRDVSQKQGLCGIAMDASYP  342



>emb|CBI21975.3| unnamed protein product [Vitis vinifera]
Length=286

 Score =   119 bits (298),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVA+QP+AVAIDA G  FQFY  G++   C  +++HGV AVGYG SDDG K+WL+KNSW
Sbjct  193  KAVAHQPIAVAIDAGGFEFQFYSSGVFTGQCGTELDHGVAAVGYGTSDDGMKYWLVKNSW  252

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ +D   ++G CGI    S+PTA
Sbjct  253  GTGWGEVGYIRMQRDVTAKEGLCGIAMQASYPTA  286



>emb|CBI21976.3| unnamed protein product [Vitis vinifera]
Length=322

 Score =   119 bits (299),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAV +QP+AVAIDA G  FQFY  G++   C  +++HGV AVGYG SDDG K+WL+KNSW
Sbjct  229  KAVVHQPIAVAIDAGGFEFQFYSSGVFTGQCGTELDHGVAAVGYGTSDDGMKYWLVKNSW  288

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+++ +D   ++G CGI    S+PTA
Sbjct  289  GTGWGEEGYIRMQRDVTAKEGLCGIAMQASYPTA  322



>ref|XP_008342781.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   120 bits (300),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVA+QPV+VAIDASGS FQFY  G++   C   ++HGVTAVGYG S+DG K+WL+KNSWG
Sbjct  241  AVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWG  300

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGE GY+++ +D    +G CGI  + S+PTA
Sbjct  301  AEWGEXGYIRMQRDVAAPEGLCGIAMSASYPTA  333



>ref|XP_008223851.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=342

 Score =   120 bits (300),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDA GS FQFY  G++   C   ++HGVTAVGYG SDDG K+WL+KNSW
Sbjct  249  KAVANQPISVAIDAGGSDFQFYSSGVFTGACGTSLDHGVTAVGYGVSDDGTKYWLVKNSW  308

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGE+GY+++ +    ++G CGI    S+PTA
Sbjct  309  GTEWGEKGYIRMQRGVEAKEGLCGIAMEASYPTA  342



>ref|XP_009354269.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=333

 Score =   120 bits (300),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVA+QPV+VAIDASGS FQFY  G++   C   ++HGVTAVGYG S+DG K+WL+KNSWG
Sbjct  241  AVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWG  300

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGE GY+++ +D    +G CGI  + S+PTA
Sbjct  301  AEWGEAGYIRMQRDVAAPEGLCGIAMSASYPTA  333



>ref|XP_008342782.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   120 bits (300),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVA+QPV+VAIDASGS FQFY  G++   C   ++HGVTAVGYG S+DG K+WL+KNSWG
Sbjct  241  AVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWG  300

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGE GY+++ +D    +G CGI  + S+PTA
Sbjct  301  AEWGEAGYIRMQRDVAAAEGLCGIAMSASYPTA  333



>ref|XP_008342777.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   120 bits (300),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVA+QPV+VAIDASGS FQFY  G++   C   ++HGVTAVGYG S+DG K+WL+KNSWG
Sbjct  241  AVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWG  300

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGE GY+++ +D    +G CGI  + S+PTA
Sbjct  301  AEWGEAGYIRMQRDVAAAEGLCGIAMSASYPTA  333



>ref|XP_010052206.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=342

 Score =   120 bits (300),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            +AVANQPV+VAIDA GS FQFY  G++  DC+  ++HGVT VGYG SDDG K+WL+KNSW
Sbjct  249  QAVANQPVSVAIDADGSHFQFYSGGVFTGDCQTDLDHGVTVVGYGTSDDGTKYWLVKNSW  308

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ +D    +G CGI    ++PTA
Sbjct  309  GAGWGENGYIRMKRDIDAVEGLCGIAIRAAYPTA  342



>ref|XP_008362421.1| PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-like [Malus domestica]
Length=344

 Score =   120 bits (300),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVA+QPV+VAIDASGS FQFY  G++   C   ++HGVTAVGYG S+DG K+WL+KNSWG
Sbjct  252  AVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWG  311

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGE GY+++ +D    +G CGI  + S+PTA
Sbjct  312  AEWGEAGYIRMQRDVAAAEGLCGIAMSASYPTA  344



>gb|KHN05669.1| Vignain [Glycine soja]
Length=315

 Score =   119 bits (299),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAI+ASG  FQFY  G++   C   ++HGVT+VGYG SDDG K+WL+KNSW
Sbjct  222  KAVANQPVSVAIEASGFKFQFYSGGVFTGSCGTNLDHGVTSVGYGVSDDGTKYWLVKNSW  281

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G KWGE+GY+++ +D   ++G CGI    S+P+A
Sbjct  282  GVKWGEKGYIRMQRDVAAKEGLCGIAMLASYPSA  315



>ref|XP_002280230.2| PREDICTED: LOW QUALITY PROTEIN: senescence-specific cysteine 
protease SAG39 [Vitis vinifera]
Length=341

 Score =   120 bits (300),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAV +QP+AVAIDA G  FQFY  G++   C  +++HGV AVGYG SDDG K+WL+KNSW
Sbjct  248  KAVVHQPIAVAIDAGGFEFQFYSSGVFTGQCGTELDHGVAAVGYGTSDDGMKYWLVKNSW  307

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+++ +D   ++G CGI    S+PTA
Sbjct  308  GTGWGEEGYIRMQRDVTAKEGLCGIAMQASYPTA  341



>gb|KCW76137.1| hypothetical protein EUGRSUZ_D00513 [Eucalyptus grandis]
Length=328

 Score =   119 bits (299),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            +AVANQPV+VAIDA GS FQFY  G++  DC+  ++HGVT VGYG SDDG K+WL+KNSW
Sbjct  235  QAVANQPVSVAIDADGSHFQFYSGGVFTGDCQTDLDHGVTVVGYGTSDDGTKYWLVKNSW  294

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ +D    +G CGI    ++PTA
Sbjct  295  GAGWGENGYIRMKRDIDAVEGLCGIAIRAAYPTA  328



>emb|CDP18644.1| unnamed protein product [Coffea canephora]
Length=336

 Score =   119 bits (299),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+V+IDA G AFQFY  G++  DC   ++HGVTAVGYG++ +G K+WL+KNSW
Sbjct  243  KAVANQPVSVSIDAGGMAFQFYSSGVFTGDCGTDLDHGVTAVGYGKTSNGTKYWLVKNSW  302

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+K+ +    ++G CGI  + S+PTA
Sbjct  303  GTSWGESGYIKMKRGIAAKEGLCGIAMDSSYPTA  336



>ref|XP_009354268.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   119 bits (299),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVA+QPV+VAIDASGS FQFY  G++   C   ++HGVTAVGYG S+DG K+WL+KNSWG
Sbjct  252  AVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWG  311

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGE GY+++ +D    +G CGI  + S+PTA
Sbjct  312  AEWGEAGYIRMQRDVAAPEGLCGIAMSASYPTA  344



>ref|XP_004294729.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   119 bits (299),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP+AVAIDASG  FQ Y  G++   C  +++HGVTAVGYG   DG K+WL+KNSW
Sbjct  247  KAVANQPIAVAIDASGFDFQLYSSGVFTGTCGTELDHGVTAVGYGVDADGTKYWLVKNSW  306

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +D    +G CGI  + S+PTA
Sbjct  307  GAQWGEEGYIRMQRDVAAPEGLCGIAMDASYPTA  340



>ref|XP_010317330.1| PREDICTED: uncharacterized protein LOC101251741 [Solanum lycopersicum]
Length=802

 Score =   123 bits (308),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 53/93 (57%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVANQPV+VAIDASGS FQFY  G++  +C  +++HGVTAVGYG + DG K+WL+KNSWG
Sbjct  710  AVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDHGVTAVGYGITSDGTKYWLVKNSWG  769

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
              WGE GY+++ +    ++G CGI    S+PTA
Sbjct  770  TSWGENGYIRMQRGIDAKEGICGIAMQASYPTA  802



>ref|XP_009359967.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=342

 Score =   119 bits (299),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDA GS FQFY  G++   C   ++HGVTAVGYG S DG K+WL+KNSW
Sbjct  249  KAVANQPISVAIDAGGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSADGTKYWLVKNSW  308

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +    ++G CGI    S+PTA
Sbjct  309  GTEWGEEGYIRMQRGIKAKEGLCGIAMEASYPTA  342



>ref|XP_009361500.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=342

 Score =   119 bits (299),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDA GS FQFY  G++   C   ++HGVTAVGYG S DG K+WL+KNSW
Sbjct  249  KAVANQPISVAIDAGGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSADGTKYWLVKNSW  308

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +    ++G CGI    S+PTA
Sbjct  309  GTEWGEEGYIRMQRGIKAKEGLCGIAMEASYPTA  342



>ref|XP_009359979.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=342

 Score =   119 bits (299),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDA GS FQFY  G++   C   ++HGVTAVGYG S DG K+WL+KNSW
Sbjct  249  KAVANQPISVAIDAGGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGISADGTKYWLVKNSW  308

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +    ++G CGI    S+PTA
Sbjct  309  GTQWGEEGYIRMQRGVEAKEGLCGIAMEASYPTA  342



>ref|XP_004979206.1| PREDICTED: vignain-like [Setaria italica]
Length=362

 Score =   120 bits (300),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 69/93 (74%), Gaps = 1/93 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPVAVAIDASG  FQFY EG++   C   ++HGV AVGYG + DG K+W++KNSW
Sbjct  254  KAVANQPVAVAIDASGQDFQFYSEGVFTGSCGTDLDHGVAAVGYGITRDGTKYWIVKNSW  313

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPT  68
            G+ WG+ GY+++ +   + +G CGI   PS+PT
Sbjct  314  GEDWGQRGYIRMQRGVSDSQGLCGIAMEPSYPT  346



>ref|XP_009357171.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   119 bits (299),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVA+QPV+VAIDASGS FQFY  G++   C   ++HGVTAVGYG S+DG K+WL+KNSWG
Sbjct  252  AVAHQPVSVAIDASGSDFQFYSSGVFSGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWG  311

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGE GY+++ +D    +G CGI    S+PTA
Sbjct  312  AEWGEAGYIRMQRDVAAAEGLCGIAMAASYPTA  344



>dbj|BAB70668.1| cysteine proteinase [Daucus carota]
Length=150

 Score =   115 bits (287),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 69/93 (74%), Gaps = 1/93 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            +AVANQPV+VAIDA GS  QFY+EG+Y  +C  +++HGV  VGYG ++DG K+W++KNSW
Sbjct  42   QAVANQPVSVAIDAGGSDMQFYREGVYTGECGTELDHGVAVVGYGATNDGTKYWIVKNSW  101

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPT  68
            G  WGE GY+++++D    +G CGI    S+P 
Sbjct  102  GTDWGERGYIRMVRDINAAEGICGIAMEASYPV  134



>ref|XP_009344439.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
 ref|XP_009344444.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=333

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVA+QPV+VAIDASGS FQFY  G++   C   ++HGVTAVGYG S+DG K+WL+KNSWG
Sbjct  241  AVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWG  300

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGE GY+++ +D    +G CGI    S+PTA
Sbjct  301  AEWGEAGYIRMQRDVAAAEGLCGIAMAASYPTA  333



>ref|XP_009623244.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=341

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDASGS FQFY  G++   C  +++HGVTAVGYG+  DG K+WL+KNSW
Sbjct  248  KAVANQPISVAIDASGSDFQFYSSGVFTGKCGTELDHGVTAVGYGKIGDGTKYWLVKNSW  307

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ +D    +G CGI    S+P+A
Sbjct  308  GTSWGENGYIRMQRDVDAEEGLCGIAMQASYPSA  341



>ref|XP_010277773.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Nelumbo 
nucifera]
Length=345

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAV+NQPV+VAIDA G  FQFY  GI+  +C   ++HGVTAVGYG S DG K+WL+KNSW
Sbjct  252  KAVSNQPVSVAIDAGGFDFQFYSSGIFTGECGTNLDHGVTAVGYGTSSDGTKYWLVKNSW  311

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE+GY+++ +D  +++G CGI    S+P A
Sbjct  312  GTTWGEKGYIRMKRDVASKEGLCGIAMQASYPIA  345



>gb|EYU25679.1| hypothetical protein MIMGU_mgv1a023356mg, partial [Erythranthe 
guttata]
Length=347

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 68/94 (72%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYG-ESDDGKFWLIKNSW  167
            KAV NQP++VAIDASGS FQFY  G++   C  +++HGVT VGYG  SD+ K+WL+KNSW
Sbjct  254  KAVVNQPISVAIDASGSDFQFYSSGVFTGQCGTELDHGVTVVGYGVTSDETKYWLVKNSW  313

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ +D    +G CGI    S+PTA
Sbjct  314  GTSWGENGYIRMQRDIDTVEGLCGIAMQASYPTA  347



>ref|XP_009357173.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVA+QPV+VAIDASGS FQFY  G++   C   ++HGVTAVGYG S+DG K+WL+KNSWG
Sbjct  252  AVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWG  311

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGE GY+++ +D    +G CGI    S+PTA
Sbjct  312  AEWGEAGYIRMQRDVAAAEGLCGIAMAASYPTA  344



>ref|XP_006582264.1| PREDICTED: vignain-like [Glycine max]
 gb|KHN33267.1| Vignain [Glycine soja]
Length=338

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 72/95 (76%), Gaps = 2/95 (2%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG--KFWLIKNS  170
            +AVANQPV+V+IDA GS FQFY  G++   C  +++HGVT VGYG +DDG  ++W++KNS
Sbjct  244  QAVANQPVSVSIDAGGSGFQFYSSGVFTGQCGTQLDHGVTVVGYGTTDDGTHEYWIVKNS  303

Query  169  WGDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            WG +WGEEGY+++ +    ++G CGI  + S+PTA
Sbjct  304  WGTQWGEEGYIRMQRGIDAQEGLCGIAMDASYPTA  338



>ref|XP_008348586.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVA+QPV+VAIDASGS FQFY  G++   C   ++HGVTAVGYG S+DG K+WL+KNSWG
Sbjct  252  AVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWG  311

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGE GY+++ +D    +G CGI    S+PTA
Sbjct  312  AEWGEAGYIRMQRDVAAAEGLCGIAMAASYPTA  344



>ref|XP_009354321.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=393

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVA+QPV+VAIDASGS FQFY  G++   C   ++HGVTAVGYG S+DG K+WL+KNSWG
Sbjct  301  AVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWG  360

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGE GY+++ +D    +G CGI  + S+PTA
Sbjct  361  AEWGEAGYIRMQRDVAAPEGLCGIAMSASYPTA  393



>ref|XP_009357172.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=343

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVA+QPV+VAIDASGS FQFY  G++   C   ++HGVTAVGYG S+DG K+WL+KNSWG
Sbjct  251  AVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWG  310

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGE GY+++ +D    +G CGI    S+PTA
Sbjct  311  AEWGEAGYIRMQRDVAAAEGLCGIAMAASYPTA  343



>gb|KHN08873.1| Vignain [Glycine soja]
Length=335

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 72/95 (76%), Gaps = 2/95 (2%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG--KFWLIKNS  170
            +AVANQPV+V+IDA GS FQFY  G++   C  +++HGVT VGYG +DDG  ++W++KNS
Sbjct  241  QAVANQPVSVSIDAGGSGFQFYSSGVFTGQCGTQLDHGVTVVGYGTTDDGTHEYWIVKNS  300

Query  169  WGDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            WG +WGEEGY+++ +    ++G CGI  + S+PTA
Sbjct  301  WGTQWGEEGYIRMQRGIDAQEGLCGIAMDASYPTA  335



>ref|NP_001130571.1| uncharacterized protein LOC100191670 [Zea mays]
 gb|ACF78842.1| unknown [Zea mays]
Length=171

 Score =   115 bits (288),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 67/92 (73%), Gaps = 2/92 (2%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVA+QPV+VAIDA G A QFY EG++  DC   ++HGV AVGYG SDDG  +W++KNSW
Sbjct  58   KAVAHQPVSVAIDAGGQALQFYSEGVFTGDCGTDLDHGVAAVGYGVSDDGTPYWIVKNSW  117

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFP  71
            G  WGE GY+++ + TGN  G CGI    SFP
Sbjct  118  GPSWGEGGYIRMQRGTGN-GGLCGIAMEASFP  148



>ref|XP_008382007.1| PREDICTED: ervatamin-B-like [Malus domestica]
 ref|XP_008365747.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=343

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVA+QPV+VAIDASGS FQFY  G++   C   ++HGVTAVGYG S+DG K+WL+KNSWG
Sbjct  251  AVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWG  310

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGE GY+++ +D    +G CGI    S+PTA
Sbjct  311  TEWGEAGYIRMQRDVAAGEGLCGIAMAASYPTA  343



>ref|XP_004148072.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP1-like [Cucumis 
sativus]
Length=317

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDGKFWLIKNSWGD  161
            AVANQPV+VAIDA G+ FQFY  GI+  +C  ++NHGV  VGYGE+ +  +WL+KNSWG 
Sbjct  225  AVANQPVSVAIDAEGNNFQFYSGGIFSGNCGNQLNHGVAIVGYGETSNQAYWLVKNSWGT  284

Query  160  KWGEEGYVKLMKDTGNRKGACGITTNPSFPT  68
             WGE GY+++ +D+ +R+G CGI    S+PT
Sbjct  285  DWGESGYIRMKRDSTDRQGTCGIAMMASYPT  315



>ref|XP_004487576.1| PREDICTED: vignain-like [Cicer arietinum]
Length=338

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP+ V I+A+  AFQFY  GI+   C    +H VT +GYG SDDG K+WL+KNSW
Sbjct  245  KAVANQPIIVYIEATQRAFQFYSSGIFTGKCGTDFDHAVTIIGYGISDDGVKYWLVKNSW  304

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G KWGE+GY+K+ +D  ++KG CG+  NP++P A
Sbjct  305  GTKWGEKGYIKMKRDIHSKKGLCGLALNPTYPLA  338



>gb|KHN38752.1| Vignain [Glycine soja]
Length=308

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAI+ASG  FQFY  G++   C   ++HGVTAVGYG SDDG K+WL+KNSW
Sbjct  215  KAVANQPVSVAIEASGFEFQFYSGGVFTGSCGTNLDHGVTAVGYGVSDDGTKYWLVKNSW  274

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G KWG++GY+++ +D   ++G CGI    S+P A
Sbjct  275  GVKWGDKGYIRMQRDVAAKEGLCGIAMLASYPNA  308



>ref|XP_002280215.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVA+QP+AVAIDA G  FQFY  G++   C  +++HGV AVGYG SDDG K+WL+KNSW
Sbjct  248  KAVAHQPIAVAIDAGGFEFQFYSSGVFTGQCGTELDHGVAAVGYGTSDDGMKYWLVKNSW  307

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ +D   ++G CGI    S+PTA
Sbjct  308  GTGWGEVGYIRMQRDVTAKEGLCGIAMQASYPTA  341



>gb|KDP23984.1| hypothetical protein JCGZ_25372 [Jatropha curcas]
Length=340

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDGKFWLIKNSWG  164
            KAVA QPV+VAIDA G  FQFY  GI+  DC  +++HGV AVGYG S    +WL+KNSWG
Sbjct  248  KAVAKQPVSVAIDAGGYEFQFYSSGIFTGDCGTELDHGVAAVGYGVSQGTNYWLVKNSWG  307

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGEEGY+++ +D   ++G CGI    S+PTA
Sbjct  308  TQWGEEGYIRMQRDIDAKEGLCGIAMQASYPTA  340



>ref|NP_001151278.1| LOC100284911 precursor [Zea mays]
 gb|ACG42212.1| vignain precursor [Zea mays]
Length=376

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVA+QPV+VAI+ASGS FQFY EG++   C  +++HGVTAVGYG + DG K+WL+KNSW
Sbjct  262  KAVAHQPVSVAIEASGSHFQFYSEGVFSGRCGTELDHGVTAVGYGVTADGTKYWLVKNSW  321

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPT  68
            G +WGE+GY+++ +D   ++G CGI    S+P 
Sbjct  322  GPEWGEKGYIRMARDVAAKEGHCGIAMEASYPV  354



>ref|XP_003526229.1| PREDICTED: vignain-like [Glycine max]
Length=284

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDA G+ FQFYK GI+   C  +++HGVTAVGYGE+++G K+WL+KNSW
Sbjct  191  KAVANQPVSVAIDARGADFQFYKSGIFTGSCGTELDHGVTAVGYGENNEGTKYWLVKNSW  250

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY  + +     +G CGI    S+PTA
Sbjct  251  GTEWGEEGYTMMQRGVKAVEGICGIAMLASYPTA  284



>ref|XP_007048673.1| Senescence-associated gene 12, putative [Theobroma cacao]
 gb|EOX92830.1| Senescence-associated gene 12, putative [Theobroma cacao]
Length=304

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDA G  FQFY  GI+   C  +++HGVTA+GYG  DDG K WL+KNSW
Sbjct  211  KAVANQPVSVAIDAGGFGFQFYSGGIFSGACGTQLDHGVTAIGYGVGDDGTKHWLVKNSW  270

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE+GY+++ +D   ++G CGI    S+PTA
Sbjct  271  GTSWGEKGYIRMQRDVDAKEGLCGIAMQASYPTA  304



>ref|XP_008805390.1| PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAI+AS  +FQFY  GI+   C   ++HGVT VGYG + DG K+WL+KNSW
Sbjct  249  KAVANQPVSVAIEASSGSFQFYSSGIFTGSCGTDLDHGVTTVGYGTTKDGTKYWLVKNSW  308

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE+GY+++ +D   ++G CGI    S+PTA
Sbjct  309  GSSWGEKGYIRMERDVAAKEGLCGIAMEASYPTA  342



>gb|KGN62053.1| hypothetical protein Csa_2G292830 [Cucumis sativus]
Length=340

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDGKFWLIKNSWGD  161
            AVANQPV+VAIDA G+ FQFY  GI+  +C  ++NHGV  VGYGE+ +  +WL+KNSWG 
Sbjct  248  AVANQPVSVAIDAEGNNFQFYSGGIFSGNCGNQLNHGVAIVGYGETSNQAYWLVKNSWGT  307

Query  160  KWGEEGYVKLMKDTGNRKGACGITTNPSFPT  68
             WGE GY+++ +D+ +R+G CGI    S+PT
Sbjct  308  DWGESGYIRMKRDSTDRQGTCGIAMMASYPT  338



>gb|EYU43350.1| hypothetical protein MIMGU_mgv1a021555mg [Erythranthe guttata]
Length=325

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVA QP++VAIDASGS FQFY  G++   C  +++HGVTAVGYG + DG K+WL+KNSW
Sbjct  232  KAVAKQPISVAIDASGSDFQFYSGGVFTGQCGTELDHGVTAVGYGVTSDGTKYWLVKNSW  291

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ +D    +G CGI    S+PTA
Sbjct  292  GSSWGENGYIRMQRDIDAEEGLCGIAMQASYPTA  325



>ref|XP_004306836.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDASG  FQ Y  G++   C  +++HGVTAVGYG   DG K+WL+KNSW
Sbjct  248  KAVANQPISVAIDASGYDFQLYSSGVFTGTCGTELDHGVTAVGYGVDADGTKYWLVKNSW  307

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +D    +G CGI    S+PTA
Sbjct  308  GAQWGEEGYIRMQRDVAAPEGLCGIAMEASYPTA  341



>ref|XP_003538185.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAI+ASG  FQFY  G++   C   ++HGVTAVGYG SDDG K+WL+KNSW
Sbjct  250  KAVANQPVSVAIEASGFEFQFYSGGVFTGSCGTNLDHGVTAVGYGVSDDGTKYWLVKNSW  309

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G KWG++GY+++ +D   ++G CGI    S+P A
Sbjct  310  GVKWGDKGYIRMQRDVAAKEGLCGIAMLASYPNA  343



>ref|XP_009349242.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=484

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDA GS FQFY  G++   C   ++HGVTAVGYG S DG K+WL+KNSW
Sbjct  391  KAVANQPISVAIDAGGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGISADGTKYWLVKNSW  450

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G +WGEEGY+++ +    ++G CGI    S+PTA
Sbjct  451  GTQWGEEGYIRMQRGVKAKEGLCGIAMEASYPTA  484



>ref|XP_011078435.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=340

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVA QPV+V+IDA G  FQFY  G++  DC   ++HGVTAVGYG++ DG K+WL+KNSW
Sbjct  247  KAVAKQPVSVSIDAGGMEFQFYSSGVFTGDCGTDLDHGVTAVGYGKTSDGTKYWLVKNSW  306

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGEEGY+ + +D   ++G CGI  + S+P A
Sbjct  307  GTSWGEEGYIMMERDVAAKEGLCGIAMDSSYPIA  340



>ref|XP_008221945.1| PREDICTED: vignain-like [Prunus mume]
Length=361

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 70/92 (76%), Gaps = 1/92 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+VAIDA G  FQFY EG++  DC  ++NHGV  VGYG + DG K+W++KNSW
Sbjct  250  KAVANQPVSVAIDAGGRDFQFYSEGVFNGDCGTELNHGVAVVGYGATLDGTKYWIVKNSW  309

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFP  71
            G++WGE+GY+++ +     +G CGI  +PS+P
Sbjct  310  GEEWGEKGYIRIQRGVDAEQGLCGIAKDPSYP  341



>ref|XP_011021998.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=339

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDGKFWLIKNSWG  164
            KAVA QPV+VAIDA G  FQFY  GI+   C  +++HGVTAVGYG SD  K+WL+KNSWG
Sbjct  247  KAVAKQPVSVAIDAGGFEFQFYSSGIFTGSCGTQLDHGVTAVGYGISDGTKYWLVKNSWG  306

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGE GY+++ KD   ++G CGI    S+P+A
Sbjct  307  AQWGEGGYIRMQKDISAKEGLCGIAMQASYPSA  339



>emb|CBI30671.3| unnamed protein product [Vitis vinifera]
Length=320

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVA  PV+VAIDA GS FQFY  G++   C  +++HGVTAVGYG++DDG K+WL+KNSW
Sbjct  227  KAVAQHPVSVAIDAGGSDFQFYSSGVFTGQCGTELDHGVTAVGYGKTDDGTKYWLVKNSW  286

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE+GY+ + +D G  +G CGI    S+PTA
Sbjct  287  GTGWGEDGYIWMERDIGADEGLCGIAMEASYPTA  320



>gb|EYU25680.1| hypothetical protein MIMGU_mgv1a019612mg [Erythranthe guttata]
Length=328

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQP++VAIDASG   QFY  G++   C  +++HGVTAVGYG ++DG K+WL+KNSW
Sbjct  235  KAVANQPISVAIDASGPDIQFYSTGVFTGQCGTELDHGVTAVGYGATNDGTKYWLVKNSW  294

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE GY+++ +D    +G CGI    S+PTA
Sbjct  295  GTSWGENGYIRMQRDIHAAEGLCGIAMQASYPTA  328



>tpg|DAA48694.1| TPA: vignain [Zea mays]
Length=484

 Score =   119 bits (298),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 51/92 (55%), Positives = 71/92 (77%), Gaps = 1/92 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVA+QPV+VAI+ASGS FQFY EG++   C  +++HGV AVGYG + DG K+WL+KNSW
Sbjct  370  KAVAHQPVSVAIEASGSHFQFYSEGVFSGRCGTELDHGVAAVGYGVTADGTKYWLVKNSW  429

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFP  71
            G +WGE+GY+++ +D   ++G CGI    S+P
Sbjct  430  GPEWGEKGYIRMARDVAAKEGHCGIAMEASYP  461



>ref|XP_003624039.1| Cysteine protease [Medicago truncatula]
 gb|AES80257.1| papain family cysteine protease [Medicago truncatula]
Length=127

 Score =   113 bits (283),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 73/110 (66%), Gaps = 10/110 (9%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVANQPV+V+ID  G  F+FY  GI+  +C+ K NH VT VGYG S DG K+WL+KNSW
Sbjct  10   KAVANQPVSVSIDMRG-MFKFYSSGIFTGECRTKPNHAVTIVGYGTSKDGIKYWLVKNSW  68

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA*N*RRSVTYHNYRL*L  17
              +WGE+GY+++ +D   ++G CGI   PS+P        + Y  +R+ L
Sbjct  69   SKRWGEKGYIRIKRDIDAKEGLCGIAMKPSYP--------INYQQHRIKL  110



>ref|XP_002274223.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Vitis 
vinifera]
Length=340

 Score =   118 bits (295),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVA  PV+VAIDA GS FQFY  G++   C  +++HGVTAVGYG++DDG K+WL+KNSW
Sbjct  247  KAVAQHPVSVAIDAGGSDFQFYSSGVFTGQCGTELDHGVTAVGYGKTDDGTKYWLVKNSW  306

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
            G  WGE+GY+ + +D G  +G CGI    S+PTA
Sbjct  307  GTGWGEDGYIWMERDIGADEGLCGIAMEASYPTA  340



>ref|XP_010906196.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=342

 Score =   118 bits (295),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 69/93 (74%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AV+NQPV+VAI+ASG +FQFY  G++   C   ++HGVTAVGYG + DG K+WL+KNSWG
Sbjct  250  AVSNQPVSVAIEASGYSFQFYSSGVFTGSCGTDLDHGVTAVGYGTARDGTKYWLVKNSWG  309

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
              WGE GYV++ +D   ++G CGI    S+PTA
Sbjct  310  SSWGESGYVRMERDVAAKEGLCGIAMKASYPTA  342



>ref|XP_008342776.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   118 bits (295),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = -1

Query  340  AVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSWG  164
            AVA+QPV+VAIDASGS FQFY  G++   C   ++HGVTAVGYG S+DG K+WL+ NSWG
Sbjct  241  AVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVXNSWG  300

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGE GY+++ +D    +G CGI  + S+PTA
Sbjct  301  AEWGEXGYIRMQRDVAAPEGLCGIAMSASYPTA  333



>gb|ACN27279.1| unknown [Zea mays]
Length=279

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVA+QPV+VAI+ASGS FQFY EG++   C  +++HGV AVGYG + DG K+WL+KNSW
Sbjct  165  KAVAHQPVSVAIEASGSHFQFYSEGVFSGRCGTELDHGVAAVGYGVTADGTKYWLVKNSW  224

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPT  68
            G +WGE+GY+++ +D   ++G CGI    S+P 
Sbjct  225  GPEWGEKGYIRMARDVAAKEGHCGIAMEASYPV  257



>tpg|DAA42119.1| TPA: hypothetical protein ZEAMMB73_388689, partial [Zea mays]
Length=229

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 68/93 (73%), Gaps = 1/93 (1%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDG-KFWLIKNSW  167
            KAVA+QPVAVAI+ASG  FQFY EG++   C   ++HGV AVGYG + DG K+W +KNSW
Sbjct  115  KAVASQPVAVAIEASGQDFQFYSEGVFTGSCGTDLDHGVAAVGYGTTGDGTKYWTVKNSW  174

Query  166  GDKWGEEGYVKLMKDTGNRKGACGITTNPSFPT  68
            G+ WGE GY+++ +   + +G CGI   PS+PT
Sbjct  175  GEDWGERGYIRMQRGVPDSRGLCGIAMEPSYPT  207



>gb|KDP45578.1| hypothetical protein JCGZ_17185 [Jatropha curcas]
Length=340

 Score =   118 bits (295),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = -1

Query  343  KAVANQPVAVAIDASGSAFQFYKEGIYGKDCKAKVNHGVTAVGYGESDDGKFWLIKNSWG  164
            KAVA QPV+VAIDA G  FQFY  GI+  DC  +++HGV AVGYG S+  K+WL+KNSWG
Sbjct  248  KAVAQQPVSVAIDAGGFQFQFYSSGIFTGDCGTELDHGVAAVGYGVSNGMKYWLVKNSWG  307

Query  163  DKWGEEGYVKLMKDTGNRKGACGITTNPSFPTA  65
             +WGE GY+++ +D   ++G CGI    S+PTA
Sbjct  308  TQWGEVGYIRMQRDIEAKEGLCGIAMQASYPTA  340



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 511879084288