BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1255_g2_i1 len=253 path=[1873:0-252]

Length=253
                                                                      Score     E

ref|XP_009376943.1|  PREDICTED: probable aquaporin PIP2-8             79.7    6e-16   
ref|NP_001289999.1|  aquaporin PIP2-1                                 79.0    1e-15   
gb|AAB67868.1|  plasma membrane major intrinsic protein 1             78.6    1e-15   Beta vulgaris subsp. vulgaris [field beet]
gb|ABC01884.1|  plasma membrane intrinsic protein PIP2-like protein   77.4    3e-15   Solanum tuberosum [potatoes]
ref|XP_009803627.1|  PREDICTED: aquaporin PIP2-7-like                 77.0    5e-15   
ref|XP_008382110.1|  PREDICTED: probable aquaporin PIP2-8             76.6    6e-15   
ref|XP_006360898.1|  PREDICTED: aquaporin PIP2-7-like                 76.6    6e-15   
ref|XP_009600501.1|  PREDICTED: aquaporin PIP2-7-like                 76.3    7e-15   
gb|AAG02208.1|AF290201_1  plasma membrane intrinsic protein PIP2      76.3    8e-15   Solanum chacoense
dbj|BAO18631.1|  plasmamembrane intrinsic protein 2;9                 75.5    2e-14   
ref|XP_007009830.1|  Plasma membrane intrinsic protein 2A             75.5    2e-14   
gb|ACE60220.1|  plasma membrane aquaporin                             75.1    2e-14   Rosa hybrid cultivar
dbj|BAO18630.1|  plasmamembrane intrinsic protein 2;8                 74.7    3e-14   
emb|CAB45651.1|  putative plasma membrane intrinsic protein           74.7    3e-14   Pisum sativum [garden pea]
ref|NP_001266257.1|  aquaporin PIP2-7-like                            74.7    3e-14   
gb|KEH39328.1|  major intrinsic protein (MIP) family transporter      74.3    3e-14   
ref|XP_008236033.1|  PREDICTED: aquaporin PIP2-7                      74.7    3e-14   
ref|XP_006412151.1|  hypothetical protein EUTSA_v10025940mg           74.3    3e-14   
gb|KHG19287.1|  Aquaporin PIP2-7 -like protein                        74.3    4e-14   
gb|ACU87557.1|  PIP protein                                           74.3    4e-14   
gb|KDO68091.1|  hypothetical protein CISIN_1g023370mg                 74.3    4e-14   
gb|ADL16407.1|  aquaporin                                             74.3    5e-14   
ref|XP_004505993.1|  PREDICTED: aquaporin PIP2-7-like                 74.3    5e-14   
ref|XP_007200557.1|  hypothetical protein PRUPE_ppa009691mg           73.9    5e-14   
gb|AAL49750.1|AF452012_1  aquaporin-like protein                      73.9    6e-14   Petunia x hybrida [garden petunia]
gb|AAB65787.1|  plasma membrane intrinsic protein                     73.9    7e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195236.1|  plasma membrane intrinsic protein 3                 73.9    7e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004290727.1|  PREDICTED: aquaporin PIP2-7-like                 73.6    7e-14   
gb|AAL32127.1|  aquaporin                                             73.6    7e-14   Medicago truncatula
ref|XP_009138343.1|  PREDICTED: aquaporin PIP2-7-like                 73.6    8e-14   
emb|CDX69112.1|  BnaC01g03410D                                        73.6    8e-14   
gb|AAD31846.1|AF133530_1  water channel protein MipH                  73.6    8e-14   Mesembryanthemum crystallinum
ref|XP_006284279.1|  hypothetical protein CARUB_v10005443mg           73.6    8e-14   
ref|XP_011045923.1|  PREDICTED: probable aquaporin PIP2-8             73.6    9e-14   
gb|KDO73275.1|  hypothetical protein CISIN_1g022966mg                 73.2    9e-14   
ref|XP_006846771.1|  hypothetical protein AMTR_s00148p00023270        73.6    9e-14   
ref|XP_010483715.1|  PREDICTED: probable aquaporin PIP2-4             73.6    9e-14   
ref|XP_009105909.1|  PREDICTED: aquaporin PIP2-7                      73.6    9e-14   
ref|XP_003597235.1|  Aquaporin PIP2-7                                 73.6    9e-14   
ref|XP_006424577.1|  hypothetical protein CICLE_v10028975mg           73.2    1e-13   
ref|XP_006412152.1|  hypothetical protein EUTSA_v10025940mg           73.2    1e-13   
ref|XP_010432340.1|  PREDICTED: aquaporin PIP2-7                      73.2    1e-13   
ref|XP_006298288.1|  hypothetical protein CARUB_v10014353mg           73.2    1e-13   
ref|XP_010253676.1|  PREDICTED: aquaporin PIP2-4-like                 73.2    1e-13   
ref|XP_007207344.1|  hypothetical protein PRUPE_ppa009630mg           73.2    1e-13   
gb|KFK30134.1|  hypothetical protein AALP_AA7G221400                  73.2    1e-13   
ref|XP_006359706.1|  PREDICTED: aquaporin PIP2-7-like                 73.2    1e-13   
ref|XP_008377729.1|  PREDICTED: probable aquaporin PIP2-8             72.8    1e-13   
gb|KDP44053.1|  hypothetical protein JCGZ_05520                       72.8    1e-13   
ref|XP_006422584.1|  hypothetical protein CICLE_v10029003mg           72.8    1e-13   
ref|XP_010443868.1|  PREDICTED: probable aquaporin PIP2-4             72.8    2e-13   
ref|XP_007046621.1|  Plasma membrane intrinsic protein 3 isoform 2    72.8    2e-13   
ref|XP_009355655.1|  PREDICTED: probable aquaporin PIP2-8             72.8    2e-13   
gb|KCW55550.1|  hypothetical protein EUGRSUZ_I01429                   72.8    2e-13   
gb|KFK36762.1|  hypothetical protein AALP_AA4G166800                  72.8    2e-13   
ref|XP_010526891.1|  PREDICTED: probable aquaporin PIP2-8             72.8    2e-13   
ref|XP_008807132.1|  PREDICTED: probable aquaporin PIP2-6             72.8    2e-13   
ref|XP_006400824.1|  hypothetical protein EUTSA_v10014299mg           72.8    2e-13   
ref|XP_007046620.1|  Plasma membrane intrinsic protein 3 isoform 1    72.4    2e-13   
ref|XP_006424576.1|  hypothetical protein CICLE_v10028975mg           72.8    2e-13   
ref|XP_002530280.1|  Aquaporin PIP2.1, putative                       72.8    2e-13   Ricinus communis
gb|KCW55551.1|  hypothetical protein EUGRSUZ_I01429                   72.4    2e-13   
gb|ACB42441.1|  aquaporin PIP2;4                                      72.4    2e-13   Gossypium hirsutum [American cotton]
gb|AAF61464.1|AF139815_1  plasma membrane intrinsic protein 2         72.4    2e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010467415.1|  PREDICTED: probable aquaporin PIP2-8             72.4    2e-13   
ref|NP_179277.1|  putative aquaporin PIP2-8                           72.4    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009131906.1|  PREDICTED: probable aquaporin PIP2-4             72.4    2e-13   
ref|XP_007041804.1|  Plasma membrane intrinsic protein 2,8 isoform 1  72.4    2e-13   
gb|AHZ08398.1|  phosphatidylinosital biphosphate protein              72.4    2e-13   
gb|ACB42440.1|  aquaporin PIP2;3                                      72.4    2e-13   Gossypium hirsutum [American cotton]
gb|KHN33668.1|  Aquaporin PIP2-7                                      72.0    2e-13   
emb|CDP07111.1|  unnamed protein product                              72.4    2e-13   
ref|XP_009794928.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...  72.4    2e-13   
ref|XP_010548112.1|  PREDICTED: probable aquaporin PIP2-8             72.4    2e-13   
ref|XP_009108681.1|  PREDICTED: aquaporin PIP2-7-like                 72.4    2e-13   
ref|XP_010456647.1|  PREDICTED: probable aquaporin PIP2-4             72.4    2e-13   
gb|KHG08488.1|  putative aquaporin PIP2-2                             72.4    2e-13   
ref|XP_007041805.1|  Plasma membrane intrinsic protein 3 isoform 2    71.6    3e-13   
gb|AFB82643.1|  aquaporin                                             72.0    3e-13   
ref|XP_004956115.1|  PREDICTED: aquaporin PIP2-6-like                 72.4    3e-13   
ref|XP_006357563.1|  PREDICTED: probable aquaporin PIP2-1-like        72.0    3e-13   
gb|AAB18227.1|  MipC                                                  72.0    3e-13   Mesembryanthemum crystallinum
ref|XP_010920097.1|  PREDICTED: probable aquaporin PIP2-6             72.0    3e-13   
gb|AFK47400.1|  unknown                                               72.0    3e-13   
gb|AAG30607.1|AF314656_1  aquaporin                                   72.0    3e-13   Brassica oleracea
gb|EYU40445.1|  hypothetical protein MIMGU_mgv1a011413mg              72.0    3e-13   
ref|XP_009628968.1|  PREDICTED: probable aquaporin PIP2-1             72.0    3e-13   
gb|ACU14125.1|  unknown                                               71.6    3e-13   Glycine max [soybeans]
gb|ACU87555.1|  PIP protein                                           72.0    3e-13   
gb|AAZ83350.1|  aquaporin                                             70.5    3e-13   Gossypium hirsutum [American cotton]
gb|ACB71281.1|  plasma membrane intrinsic protein                     72.0    3e-13   Tamarix hispida
ref|NP_001234625.1|  aquaporin                                        72.0    3e-13   
ref|XP_002461932.1|  hypothetical protein SORBIDRAFT_02g010790        72.0    3e-13   Sorghum bicolor [broomcorn]
ref|XP_010934344.1|  PREDICTED: aquaporin PIP2-4-like                 71.6    3e-13   
emb|CDX76314.1|  BnaA08g10860D                                        71.6    4e-13   
emb|CDY17511.1|  BnaC03g65520D                                        71.6    4e-13   
ref|XP_008243934.1|  PREDICTED: probable aquaporin PIP2-5             71.6    4e-13   
gb|AAF65845.1|AF255795_1  aquaporin 1                                 72.0    4e-13   Allium cepa
ref|XP_006383054.1|  plasma membrane intrinsic protein 1-1            71.6    4e-13   
gb|KHG00060.1|  putative aquaporin PIP2-2                             71.6    4e-13   
gb|AFQ23186.1|  aquaporin PIP2;1                                      71.6    4e-13   
ref|NP_001105025.1|  aquaporin PIP2-3                                 71.6    4e-13   Zea mays [maize]
gb|ACV66986.1|  plasma membrane aquaporin 2                           71.6    4e-13   Hevea brasiliensis [jebe]
gb|AAB18228.1|  MipE                                                  71.6    4e-13   Mesembryanthemum crystallinum
emb|CAC82712.1|  major intrinsic protein 1                            71.6    5e-13   Populus tremula x Populus tremuloides
ref|XP_003522619.2|  PREDICTED: aquaporin PIP2-7                      72.0    5e-13   
gb|AFB83067.1|  plasma intrinsic protein PIP2.1                       71.2    5e-13   
gb|KHG29841.1|  putative aquaporin PIP2-2                             71.6    5e-13   
gb|AAB36949.1|  plasma membrane intrinsic protein PIP3                71.2    5e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003606383.1|  Aquaporin PIP2-7                                 71.2    5e-13   
gb|ACR56615.1|  plasma intrinsic protein 2;5                          71.2    5e-13   Juglans regia
ref|XP_011043133.1|  PREDICTED: probable aquaporin PIP2-8             71.2    6e-13   
gb|EAZ23886.1|  hypothetical protein OsJ_07605                        71.2    6e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002306187.1|  membrane intrinsic family protein                71.2    6e-13   Populus trichocarpa [western balsam poplar]
gb|KCW49751.1|  hypothetical protein EUGRSUZ_K03244                   70.9    6e-13   
gb|AFO63679.1|  plasma intrinsic protein 2                            71.2    6e-13   
ref|NP_001047491.1|  Os02g0629200                                     71.2    6e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002521292.1|  Aquaporin PIP2.7, putative                       71.2    6e-13   Ricinus communis
gb|EAZ39657.1|  hypothetical protein OsJ_24085                        71.6    6e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002884019.1|  PIP2_8/PIP3B                                     71.2    6e-13   
gb|ACA35273.1|  aquaporin                                             69.3    6e-13   Cucumis sativus [cucumbers]
ref|XP_008791536.1|  PREDICTED: aquaporin PIP2-4-like                 71.2    6e-13   
gb|EAY86778.1|  hypothetical protein OsI_08158                        71.2    6e-13   Oryza sativa Indica Group [Indian rice]
gb|AAW80918.1|  putative plasma membrane intrinsic protein            71.2    7e-13   Astragalus penduliflorus
ref|XP_008363507.1|  PREDICTED: aquaporin PIP2-2                      70.9    7e-13   
ref|XP_010529747.1|  PREDICTED: aquaporin PIP2-2-like                 71.2    7e-13   
tpg|DAA33865.1|  TPA: aquaporin PIP2;10                               70.9    7e-13   
ref|XP_002869108.1|  hypothetical protein ARALYDRAFT_491143           70.9    7e-13   
ref|XP_008449250.1|  PREDICTED: aquaporin PIP2-1-like                 70.9    7e-13   
gb|AEO13898.1|  aquaporin 7                                           70.9    7e-13   
gb|ACM50914.1|  aquaporin                                             70.9    7e-13   Medicago falcata [sickle alfalfa]
gb|ACU00102.1|  plasma membrane intrinsic protein PIP2.6              70.9    7e-13   Populus trichocarpa x Populus deltoides
ref|XP_002866389.1|  hypothetical protein ARALYDRAFT_919301           70.9    8e-13   
ref|XP_010266854.1|  PREDICTED: probable aquaporin PIP2-8             70.9    8e-13   
ref|XP_010516059.1|  PREDICTED: probable aquaporin PIP2-8             70.9    8e-13   
dbj|BAD90697.1|  plasma membrane intrinsic protein 2;1                70.9    8e-13   Mimosa pudica [sensitive-plant]
dbj|BAD90701.1|  plasma membrane intrinsic protein 2;5                70.9    8e-13   Mimosa pudica [sensitive-plant]
ref|NP_001233846.1|  putative PIP-type aquaporin                      70.9    8e-13   
ref|NP_181434.1|  plasma membrane intrinsic protein 2E                70.9    8e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004137971.1|  PREDICTED: probable aquaporin PIP2-4-like        70.9    8e-13   
gb|ABC69040.1|  aquaporin PIP2-1                                      70.9    8e-13   Rhododendron catawbiense [Catawba rosebay]
ref|XP_004289073.1|  PREDICTED: aquaporin PIP2-7-like                 71.2    8e-13   
emb|CAH60720.1|  putative plasma membrane intrinsic protein           70.5    9e-13   Populus tremula x Populus tremuloides
ref|XP_004956116.1|  PREDICTED: aquaporin PIP2-6-like                 70.9    9e-13   
ref|XP_004164389.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...  70.9    9e-13   
emb|CDP21564.1|  unnamed protein product                              70.5    9e-13   
gb|KHG20375.1|  putative aquaporin PIP2-5 -like protein               70.5    9e-13   
ref|XP_009782764.1|  PREDICTED: aquaporin PIP2-7                      70.5    1e-12   
ref|XP_002461936.1|  hypothetical protein SORBIDRAFT_02g010830        70.5    1e-12   Sorghum bicolor [broomcorn]
ref|NP_001105027.1|  aquaporin PIP2-6                                 70.9    1e-12   Zea mays [maize]
gb|EYU36189.1|  hypothetical protein MIMGU_mgv1a011437mg              70.5    1e-12   
ref|XP_006422583.1|  hypothetical protein CICLE_v10029003mg           70.1    1e-12   
ref|XP_011015478.1|  PREDICTED: aquaporin PIP2-2-like                 70.5    1e-12   
ref|XP_010920407.1|  PREDICTED: probable aquaporin PIP2-2             70.5    1e-12   
gb|EMT09900.1|  Putative aquaporin PIP2-2                             70.9    1e-12   
ref|XP_009120600.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...  70.5    1e-12   
ref|XP_006428786.1|  hypothetical protein CICLE_v10012379mg           70.5    1e-12   
tpg|DAA64687.1|  TPA: aquaporin PIP2 10                               70.5    1e-12   
ref|XP_008670063.1|  PREDICTED: aquaporin PIP2-6-like                 70.5    1e-12   
ref|XP_009780961.1|  PREDICTED: aquaporin PIP2-7-like                 70.1    1e-12   
ref|XP_008442677.1|  PREDICTED: probable aquaporin PIP2-4             70.5    1e-12   
ref|XP_009593453.1|  PREDICTED: aquaporin PIP2-2-like                 70.5    1e-12   
ref|XP_010689549.1|  PREDICTED: aquaporin PIP2-1-like                 70.1    1e-12   
gb|ACU87556.1|  PIP protein                                           70.1    1e-12   
ref|XP_006648854.1|  PREDICTED: probable aquaporin PIP2-2-like        70.1    1e-12   
ref|XP_006384579.1|  hypothetical protein POPTR_0004s18240g           69.7    1e-12   
gb|KHF98939.1|  putative aquaporin PIP2-8 -like protein               70.1    1e-12   
ref|XP_006846905.1|  hypothetical protein AMTR_s00152p00041700        70.1    1e-12   
ref|XP_009772697.1|  PREDICTED: aquaporin PIP2-2-like                 70.1    1e-12   
ref|NP_001059542.1|  Os07g0448100                                     70.1    1e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ03711.1|  hypothetical protein OsI_25843                        70.1    1e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_006280883.1|  hypothetical protein CARUB_v10026881mg           70.5    1e-12   
gb|EPS67285.1|  hypothetical protein M569_07488                       70.1    1e-12   
ref|XP_006846005.1|  hypothetical protein AMTR_s00155p00061840        70.1    1e-12   
gb|AIA83106.1|  putative aquaporin PIP2                               70.1    1e-12   
gb|AAO39007.1|  plasma intrinsic protein 2,1                          70.1    1e-12   Juglans regia
ref|XP_002312952.1|  hypothetical protein POPTR_0009s13890g           70.1    2e-12   Populus trichocarpa [western balsam poplar]
ref|XP_010690355.1|  PREDICTED: aquaporin PIP-type                    70.1    2e-12   
ref|XP_006657662.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...  70.1    2e-12   
gb|ABM54183.1|  aquaporin                                             70.1    2e-12   Jatropha curcas
gb|ABB13430.2|  plasma membrane intrinsic protein                     70.1    2e-12   Olea europaea
ref|XP_009367074.1|  PREDICTED: aquaporin PIP2-2                      70.1    2e-12   
gb|KCW88816.1|  hypothetical protein EUGRSUZ_A01153                   70.5    2e-12   
ref|XP_010046653.1|  PREDICTED: aquaporin PIP2-1-like                 70.1    2e-12   
ref|XP_003606384.1|  Aquaporin PIP2-7                                 69.3    2e-12   
gb|AHG32324.1|  PIP2-3                                                70.1    2e-12   
ref|XP_006367007.1|  PREDICTED: aquaporin PIP2-1-like isoform X1      70.1    2e-12   
ref|XP_003536353.1|  PREDICTED: aquaporin PIP2-1-like isoform 1       70.1    2e-12   
ref|XP_003563179.1|  PREDICTED: aquaporin PIP2-6                      69.7    2e-12   
gb|ACB87734.1|  aquaporin                                             69.7    2e-12   Manihot esculenta [manioc]
ref|XP_010028741.1|  PREDICTED: uncharacterized protein LOC104418957  72.0    2e-12   
gb|AAB67869.1|  plasma membrane major intrinsic protein 2             69.7    2e-12   Beta vulgaris subsp. vulgaris [field beet]
gb|ACR56614.1|  plasma intrinsic protein 2;4                          69.7    2e-12   Juglans regia
gb|AEQ29857.1|  aquaporin PIP2                                        69.7    2e-12   
gb|ABK60196.1|  PIP2 protein                                          69.7    2e-12   Gossypium hirsutum [American cotton]
ref|XP_007027328.1|  Plasma membrane intrinsic protein 2              69.7    2e-12   
ref|NP_001268058.1|  aquaporin-like                                   69.7    2e-12   
ref|NP_001235204.1|  Pip1 protein                                     69.7    2e-12   
ref|NP_001275065.1|  major intrinsic protein 2                        69.7    2e-12   
gb|AAO39008.1|  plasma intrinsic protein 2,2                          69.7    2e-12   Juglans regia
gb|AGD98714.1|  aquaporin protein 11                                  69.7    2e-12   
gb|KDP23969.1|  hypothetical protein JCGZ_25357                       69.7    2e-12   
ref|XP_006294722.1|  hypothetical protein CARUB_v10023768mg           69.7    2e-12   
ref|XP_010489282.1|  PREDICTED: probable aquaporin PIP2-8             69.7    2e-12   
dbj|BAE02729.1|  PIP aquaporin                                        69.7    2e-12   Hordeum vulgare [barley]
dbj|BAA23744.1|  HvPIP2;1                                             69.7    2e-12   Hordeum vulgare [barley]
gb|EMT03221.1|  hypothetical protein F775_43871                       69.7    2e-12   
gb|EYU39575.1|  hypothetical protein MIMGU_mgv1a011441mg              69.7    2e-12   
gb|ACU00104.1|  plasma membrane intrinsic protein PIP2.2              69.7    2e-12   Populus trichocarpa x Populus deltoides
gb|AHB33482.1|  plasma intrinsic protein 2-6                          69.3    2e-12   
gb|ACZ06859.1|  plasma membrane intrinsic protein                     69.7    2e-12   
ref|XP_003556232.1|  PREDICTED: aquaporin PIP2-1-like                 69.7    2e-12   
ref|XP_006367014.1|  PREDICTED: aquaporin PIP2-1-like                 69.3    2e-12   
ref|NP_001267957.1|  aquaporin PIP2;2                                 69.3    2e-12   
gb|KFK36804.1|  hypothetical protein AALP_AA4G173500                  69.7    2e-12   
gb|ABH09327.1|  putative aquaporin                                    69.3    2e-12   Vitis vinifera
gb|AFB83068.1|  plasma intrinsic protein PIP2.2                       69.3    2e-12   
emb|CDY56697.1|  BnaCnng31040D                                        69.7    3e-12   
ref|XP_007016740.1|  Plasma membrane intrinsic protein 2,4            69.7    3e-12   
gb|AGD98707.1|  aquaporin protein 4                                   69.7    3e-12   
ref|XP_011046666.1|  PREDICTED: probable aquaporin PIP2-8             69.3    3e-12   
ref|NP_001274308.1|  aquaporin PIP2-1-like                            69.3    3e-12   
gb|AAF71820.1|AF141900_1  putative aquaporin PIP2-2                   69.3    3e-12   Vitis cinerea var. helleri x Vitis rupestris
ref|XP_006403691.1|  hypothetical protein EUTSA_v10010598mg           69.3    3e-12   
ref|XP_002322877.1|  major intrinsic protein 1                        69.3    3e-12   Populus trichocarpa [western balsam poplar]
gb|ABK22546.1|  unknown                                               69.3    3e-12   Picea sitchensis
ref|XP_009126591.1|  PREDICTED: probable aquaporin PIP2-4             69.3    3e-12   
ref|XP_007143702.1|  hypothetical protein PHAVU_007G094600g           69.3    3e-12   
gb|AHG32323.1|  PIP2-2                                                69.3    3e-12   
ref|XP_010107654.1|  Aquaporin PIP2-7                                 69.3    3e-12   
gb|ACU24483.1|  unknown                                               69.3    3e-12   Glycine max [soybeans]
gb|EPS61960.1|  hypothetical protein M569_12834                       69.3    3e-12   
ref|XP_010521765.1|  PREDICTED: aquaporin PIP2-7-like                 69.3    3e-12   
ref|XP_004156296.1|  PREDICTED: aquaporin PIP2-2-like                 69.3    3e-12   
ref|XP_010037961.1|  PREDICTED: probable aquaporin PIP2-2             69.3    3e-12   
gb|AHB33479.1|  plasma intrinsic protein 2-3                          69.3    3e-12   
ref|XP_004291577.1|  PREDICTED: aquaporin PIP2-2-like                 69.3    3e-12   
sp|P42767.1|PIP1_ATRCA  RecName: Full=Aquaporin PIP-type              69.3    3e-12   Atriplex canescens [shadscale]
gb|AGG39693.1|  aquaporin protein AQU15                               69.3    3e-12   
ref|XP_002879778.1|  PIP2_6/PIP2E                                     69.3    3e-12   
gb|AEY75254.1|  aquaporin                                             69.3    3e-12   
dbj|BAA32778.1|  Plasma membrane aquaporin (PAQ2)                     69.3    3e-12   Raphanus sativus
ref|XP_002519539.1|  Aquaporin PIP2.2, putative                       69.3    3e-12   Ricinus communis
ref|XP_008387595.1|  PREDICTED: probable aquaporin PIP2-5             69.3    3e-12   
gb|AAC17529.1|  aquaporin 2                                           69.3    3e-12   Samanea saman [cow-tamarind]
ref|XP_006339071.1|  PREDICTED: aquaporin PIP2-1-like                 69.3    3e-12   
dbj|BAD90699.1|  plasma membrane intrinsic protein 2;3                69.3    3e-12   Mimosa pudica [sensitive-plant]
gb|ACU23034.1|  unknown                                               68.2    3e-12   Glycine max [soybeans]
ref|XP_008785285.1|  PREDICTED: aquaporin PIP2-4                      69.3    3e-12   
ref|XP_009614931.1|  PREDICTED: aquaporin PIP2-1-like                 69.3    3e-12   
emb|CDY13298.1|  BnaC06g14590D                                        69.3    3e-12   
ref|XP_010684101.1|  PREDICTED: aquaporin PIP2-1-like                 69.3    3e-12   
ref|XP_008449253.1|  PREDICTED: aquaporin PIP2-2-like isoform X3      69.3    3e-12   
ref|XP_008449251.1|  PREDICTED: aquaporin PIP2-1-like isoform X1      69.3    3e-12   
ref|XP_002461933.1|  hypothetical protein SORBIDRAFT_02g010800        69.3    3e-12   Sorghum bicolor [broomcorn]
ref|NP_190910.1|  aquaporin PIP2-1                                    69.3    3e-12   Arabidopsis thaliana [mouse-ear cress]
gb|KHG01329.1|  Aquaporin PIP2-7 -like protein                        68.6    3e-12   
ref|XP_004143246.1|  PREDICTED: aquaporin PIP2-2-like                 68.9    3e-12   
ref|XP_004143245.1|  PREDICTED: aquaporin PIP2-2-like                 68.9    4e-12   
ref|XP_008366675.1|  PREDICTED: probable aquaporin PIP2-5             68.9    4e-12   
gb|AAL33586.1|AF440272_1  aquaporin                                   68.9    4e-12   Nicotiana tabacum [American tobacco]
ref|XP_009595123.1|  PREDICTED: aquaporin PIP2-4-like                 68.9    4e-12   
ref|NP_001289846.1|  probable aquaporin PIP2-1                        68.9    4e-12   
gb|AFK47442.1|  unknown                                               68.9    4e-12   
gb|AEC45513.1|  plasma membrane intrinsic protein                     68.9    4e-12   
gb|ABU94631.1|  putative aquaporin PIP2;3                             68.9    4e-12   Phaseolus vulgaris [French bean]
ref|XP_006367008.1|  PREDICTED: aquaporin PIP2-1-like isoform X2      68.9    4e-12   
ref|XP_009615212.1|  PREDICTED: aquaporin PIP2-7                      68.9    4e-12   
gb|KCW88815.1|  hypothetical protein EUGRSUZ_A01153                   70.1    4e-12   
ref|XP_008449252.1|  PREDICTED: aquaporin PIP2-1-like isoform X2      68.9    4e-12   
ref|NP_001268056.1|  aquaporin PIP2                                   68.9    4e-12   
ref|XP_002877918.1|  hypothetical protein ARALYDRAFT_485715           68.9    4e-12   
gb|ABL76066.1|  aquaporin 2                                           68.9    4e-12   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_008385311.1|  PREDICTED: probable aquaporin PIP2-2             68.9    4e-12   
gb|ABB88840.1|  aquaporin                                             68.9    4e-12   Stevia rebaudiana
dbj|BAD90700.1|  plasma membrane intrinsic protein 2;4                68.9    4e-12   Mimosa pudica [sensitive-plant]
ref|XP_009345759.1|  PREDICTED: probable aquaporin PIP2-5             68.9    4e-12   
emb|CCI55668.1|  EaPIP2,1                                             68.9    4e-12   
gb|ACV70048.1|  aquaporin PIP2;1                                      68.6    4e-12   Quercus macrocarpa [burr oak]
ref|XP_003591905.1|  Aquaporin PIP                                    68.9    4e-12   
gb|KHG06004.1|  Aquaporin PIP2-2 -like protein                        68.9    4e-12   
gb|AFK35635.1|  unknown                                               67.8    4e-12   
gb|ACR56613.1|  plasma intrinsic protein 2;3                          68.9    4e-12   
gb|ACJ85173.1|  unknown                                               68.9    4e-12   
gb|AAK83979.1|AF393807_1  aquaporine PIP3-like protein                66.6    4e-12   
gb|KHN00691.1|  Aquaporin PIP2-2                                      68.9    4e-12   
ref|XP_011092966.1|  PREDICTED: aquaporin PIP2-7                      68.9    5e-12   
gb|KHG10662.1|  Aquaporin PIP2-1 -like protein                        68.9    5e-12   
gb|AGD98708.1|  aquaporin protein 5                                   68.9    5e-12   
ref|XP_002311092.1|  plasma membrane intrinsic protein 1-1            68.9    5e-12   
gb|EMS60960.1|  Aquaporin PIP2-4                                      68.2    5e-12   
gb|AAG44947.1|AF290620_1  putative PIP2                               68.9    5e-12   
gb|AHW81492.1|  ECFP-tagged plasma membrane intrinsic protein 2a      70.5    5e-12   
ref|XP_010504105.1|  PREDICTED: aquaporin PIP2-1-like                 68.9    5e-12   
ref|NP_001105026.1|  aquaporin PIP2-4                                 68.9    5e-12   
gb|AEY75244.1|  plasma membrane intrinsic protein                     68.6    5e-12   
ref|XP_009780213.1|  PREDICTED: aquaporin PIP2-4-like                 68.6    5e-12   
ref|XP_010426989.1|  PREDICTED: aquaporin PIP2-1                      68.6    5e-12   
dbj|BAF32141.1|  putative aquaporin                                   68.6    5e-12   
ref|XP_008344248.1|  PREDICTED: aquaporin PIP2-7-like                 66.6    5e-12   
ref|XP_011077012.1|  PREDICTED: probable aquaporin PIP2-5             68.6    5e-12   
ref|XP_010920405.1|  PREDICTED: aquaporin PIP2-4 isoform X1           68.6    5e-12   
ref|XP_009792249.1|  PREDICTED: aquaporin PIP2-1-like                 68.6    5e-12   
gb|KDP44363.1|  hypothetical protein JCGZ_20043                       68.6    5e-12   
ref|XP_011048549.1|  PREDICTED: aquaporin PIP2-1-like                 68.6    6e-12   
gb|AIA83104.1|  putative aquaporin PIP2                               68.6    6e-12   
gb|AEH76326.1|  plasma membrane intrinsic protein 2A                  68.6    6e-12   
gb|AGD98705.1|  aquaporin                                             68.6    6e-12   
gb|ABI96815.1|  plasma membrane intrinsic protein                     68.6    6e-12   
ref|XP_006428787.1|  hypothetical protein CICLE_v10012633mg           67.8    6e-12   
gb|AEQ20672.1|  PIP2;1                                                68.6    6e-12   
gb|ACG33001.1|  aquaporin PIP2.2                                      68.6    7e-12   
gb|ABK24156.1|  unknown                                               68.2    7e-12   
ref|XP_003518297.1|  PREDICTED: aquaporin PIP2-2-like                 68.6    7e-12   
gb|ABK22173.1|  unknown                                               68.2    7e-12   
sp|Q8GRI8.1|PIP25_ORYSJ  RecName: Full=Aquaporin PIP2-5; AltName:...  68.2    7e-12   
ref|XP_008809438.1|  PREDICTED: probable aquaporin PIP2-6             68.2    7e-12   
ref|XP_007162747.1|  hypothetical protein PHAVU_001G177000g           68.6    7e-12   
gb|EAZ03714.1|  hypothetical protein OsI_25847                        68.2    7e-12   
ref|NP_001105639.1|  aquaporin PIP2-7                                 68.2    7e-12   
ref|XP_007137341.1|  hypothetical protein PHAVU_009G118900g           68.2    7e-12   
ref|XP_011031744.1|  PREDICTED: probable aquaporin PIP2-5             68.2    7e-12   
gb|AAL49752.1|AF452014_1  aquaporin-like protein                      68.2    7e-12   
ref|NP_001237286.1|  PIP2,2                                           68.2    7e-12   
ref|XP_009619670.1|  PREDICTED: aquaporin PIP2-1-like                 68.2    7e-12   
ref|XP_010266027.1|  PREDICTED: aquaporin PIP2-7-like                 68.2    7e-12   
ref|XP_002461931.1|  hypothetical protein SORBIDRAFT_02g010780        68.2    8e-12   
ref|XP_006481459.1|  PREDICTED: aquaporin PIP2-2-like                 68.2    8e-12   
ref|XP_003604054.1|  Aquaporin PIP22                                  68.2    8e-12   
gb|AEF32110.1|  aquaporin PIP2                                        68.2    8e-12   
ref|XP_006481455.1|  PREDICTED: aquaporin PIP2-2-like                 68.2    8e-12   
ref|XP_004953172.1|  PREDICTED: aquaporin PIP2-4-like                 68.2    8e-12   
ref|XP_010100853.1|  Aquaporin PIP2-1                                 68.2    8e-12   
ref|NP_001289823.1|  aquaporin PIP2-1-like                            68.2    8e-12   
ref|XP_009116034.1|  PREDICTED: aquaporin PIP2-1                      68.2    8e-12   
dbj|BAG06230.1|  plasma membrane intrinsic protein                    68.2    8e-12   
gb|AAC32107.1|  probable aquaporin                                    68.2    8e-12   
ref|XP_009760326.1|  PREDICTED: aquaporin PIP2-1-like                 68.2    8e-12   
ref|XP_004304427.1|  PREDICTED: aquaporin PIP2-1-like                 68.2    8e-12   
ref|XP_009413716.1|  PREDICTED: probable aquaporin PIP2-3 isoform X2  67.8    8e-12   
ref|NP_001240039.1|  uncharacterized protein LOC100782155             68.2    8e-12   
gb|EYU37965.1|  hypothetical protein MIMGU_mgv1a011471mg              68.2    8e-12   
emb|CAB07783.1|  PaMip-2                                              68.6    9e-12   
tpg|DAA64674.1|  TPA: aquaporin PIP2 2                                68.2    9e-12   
ref|XP_008447947.1|  PREDICTED: aquaporin PIP2-7                      67.8    9e-12   
ref|XP_006481457.1|  PREDICTED: aquaporin PIP2-1-like isoform X1      68.2    9e-12   
ref|XP_006381453.1|  hypothetical protein POPTR_0006s12980g           68.2    9e-12   
ref|NP_001274376.1|  aquaporin PIP2-7-like                            67.8    9e-12   
gb|AGD98712.1|  aquaporin protein 9                                   67.8    9e-12   
gb|ACR38689.1|  unknown                                               67.4    9e-12   
gb|ABK93567.1|  unknown                                               68.2    9e-12   
ref|XP_010325988.1|  PREDICTED: aquaporin PIP2-1-like                 67.8    9e-12   
ref|XP_008791535.1|  PREDICTED: aquaporin PIP2-4-like                 68.2    9e-12   
gb|KCW51593.1|  hypothetical protein EUGRSUZ_J01087                   68.6    1e-11   
ref|XP_010043747.1|  PREDICTED: probable aquaporin PIP2-5             67.8    1e-11   
gb|EMS56715.1|  putative aquaporin PIP2-2                             68.6    1e-11   
ref|XP_004142421.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...  67.8    1e-11   
gb|AGC24024.1|  plasma membrane intrinsic protein 1                   67.8    1e-11   
emb|CAH60723.1|  putative plasma membrane intrinsic protein           67.8    1e-11   
ref|XP_002452483.1|  hypothetical protein SORBIDRAFT_04g026650        67.8    1e-11   
ref|XP_002316367.1|  putative aquaporin family protein                67.8    1e-11   
ref|XP_007151872.1|  hypothetical protein PHAVU_004G082700g           67.8    1e-11   
gb|EMT02787.1|  Putative aquaporin PIP2-6                             67.0    1e-11   
ref|XP_010107541.1|  Aquaporin PIP2-2                                 67.8    1e-11   
ref|XP_001753248.1|  predicted protein                                67.8    1e-11   
ref|XP_007151871.1|  hypothetical protein PHAVU_004G082600g           67.8    1e-11   
ref|XP_010098191.1|  Aquaporin PIP2-7                                 67.8    1e-11   
tpg|DAA39707.1|  TPA: plasma membrane intrinsic protein2              67.4    1e-11   
ref|XP_011041003.1|  PREDICTED: probable aquaporin PIP2-5             67.8    1e-11   
tpg|DAA64673.1|  TPA: aquaporin PIP2 1                                67.8    1e-11   
ref|XP_003540176.1|  PREDICTED: aquaporin PIP2-7                      67.8    1e-11   
tpg|DAA60471.1|  TPA: plasma membrane intrinsic protein2              67.0    1e-11   
emb|CDP06739.1|  unnamed protein product                              67.8    1e-11   
ref|XP_008446888.1|  PREDICTED: aquaporin PIP2-1-like                 67.8    1e-11   
ref|XP_009413714.1|  PREDICTED: aquaporin PIP2-4-like isoform X1      67.8    1e-11   
ref|XP_004157526.1|  PREDICTED: aquaporin PIP2-7-like                 67.8    1e-11   
ref|XP_002313510.1|  hypothetical protein POPTR_0009s01940g           67.8    1e-11   
ref|XP_004976254.1|  PREDICTED: aquaporin PIP2-5-like                 67.8    1e-11   
gb|ACU19125.1|  unknown                                               67.8    1e-11   
ref|XP_002532756.1|  Aquaporin PIP2.1, putative                       67.4    1e-11   
ref|XP_004493972.1|  PREDICTED: probable aquaporin PIP2-5-like        67.8    1e-11   
ref|XP_010262516.1|  PREDICTED: aquaporin PIP2-7-like                 65.9    1e-11   
gb|AEC45512.1|  plasma membrane intrinsic protein                     67.4    1e-11   
ref|XP_010555818.1|  PREDICTED: probable aquaporin PIP2-5             67.4    1e-11   
gb|AFH36336.1|  aquaporin PIP2;1                                      67.4    1e-11   
ref|NP_001053335.1|  Os04g0521100                                     67.8    1e-11   
gb|ABK22847.1|  unknown                                               67.4    1e-11   
gb|KDO69067.1|  hypothetical protein CISIN_1g018895mg                 67.4    1e-11   
gb|ABK24624.1|  unknown                                               67.4    1e-11   
gb|ABK22504.1|  unknown                                               67.4    1e-11   
ref|XP_009624885.1|  PREDICTED: aquaporin PIP2-1-like                 67.4    1e-11   
ref|XP_010920406.1|  PREDICTED: aquaporin PIP2-4 isoform X2           67.0    1e-11   
ref|XP_006664814.1|  PREDICTED: probable aquaporin PIP2-6-like        67.4    1e-11   
dbj|BAF32042.1|  putative aquaporin                                   67.4    1e-11   
ref|XP_004307390.1|  PREDICTED: probable aquaporin PIP2-5-like        67.4    1e-11   
ref|XP_010554547.1|  PREDICTED: probable aquaporin PIP2-5             67.4    1e-11   
gb|AEY75242.1|  plasma membrane intrinsic protein                     67.4    1e-11   
ref|XP_010031998.1|  PREDICTED: aquaporin PIP2-7-like                 67.4    1e-11   
ref|XP_008345410.1|  PREDICTED: aquaporin PIP2-1-like                 66.6    1e-11   
ref|XP_003575410.1|  PREDICTED: aquaporin PIP2-4                      67.4    1e-11   
gb|KCW51391.1|  hypothetical protein EUGRSUZ_J00930                   66.6    2e-11   
ref|NP_001105024.1|  aquaporin PIP2-1                                 67.4    2e-11   
ref|XP_004956113.1|  PREDICTED: aquaporin PIP2-1-like                 67.4    2e-11   
gb|KHN05685.1|  Aquaporin PIP2-7                                      67.4    2e-11   
ref|NP_001240223.1|  prolactin-inducible protein                      67.4    2e-11   
dbj|BAD90698.1|  plasma membrane intrinsic protein 2;2                67.4    2e-11   
gb|AAO86707.1|  aquaporin                                             67.4    2e-11   
emb|CAB46351.1|  major intrinsic protein 2                            67.4    2e-11   
gb|AFQ23567.1|  aquaporin PIP2;2                                      67.4    2e-11   
gb|AIG92831.1|  aquaporin PIP2                                        67.4    2e-11   
ref|XP_003538174.1|  PREDICTED: aquaporin PIP2-7                      67.4    2e-11   
ref|XP_004304426.1|  PREDICTED: aquaporin PIP2-1-like                 67.4    2e-11   
gb|AFN53630.1|  putative aquaporin PIP2-8                             69.3    2e-11   
ref|NP_001052292.1|  Os04g0233400                                     67.4    2e-11   
ref|XP_009414436.1|  PREDICTED: probable aquaporin PIP2-6             67.4    2e-11   
gb|KHN38765.1|  Aquaporin PIP2-7                                      67.4    2e-11   
gb|EMT25472.1|  hypothetical protein F775_43073                       67.0    2e-11   
gb|ADK25057.1|  plasma membrane intrinsic protein                     67.4    2e-11   
ref|XP_002461930.1|  hypothetical protein SORBIDRAFT_02g010760        67.4    2e-11   
dbj|BAJ86750.1|  predicted protein                                    67.4    2e-11   
ref|XP_011048552.1|  PREDICTED: aquaporin PIP2-2-like                 67.4    2e-11   
ref|XP_009398603.1|  PREDICTED: probable aquaporin PIP2-2             67.4    2e-11   
ref|XP_008345040.1|  PREDICTED: aquaporin PIP2-1-like                 66.2    2e-11   
gb|ACX37450.1|  plasma membrane intrinsic protein                     67.4    2e-11   
ref|XP_006367009.1|  PREDICTED: probable aquaporin PIP2-2-like        66.2    2e-11   
gb|ABK21046.1|  unknown                                               67.0    2e-11   
tpg|DAA64677.1|  TPA: aquaporin PIP2 4a                               67.0    2e-11   
ref|NP_001105616.1|  aquaporin PIP2-5                                 67.0    2e-11   
ref|XP_009335091.1|  PREDICTED: probable aquaporin PIP2-2             67.0    2e-11   
tpg|DAA60472.1|  TPA: plasma membrane intrinsic protein2              67.4    2e-11   
gb|AIK66515.1|  putative aquaporin                                    67.0    2e-11   
ref|XP_010325989.1|  PREDICTED: aquaporin PIP2-1-like                 66.6    2e-11   
ref|XP_009345382.1|  PREDICTED: probable aquaporin PIP2-5             67.0    2e-11   
gb|ABX83874.1|  plasma membrane intrinsic protein                     67.0    2e-11   
ref|XP_009615789.1|  PREDICTED: aquaporin PIP2-7-like                 67.0    2e-11   
gb|ADJ57599.1|  plasma membrane intrinsic protein PIP2;1              67.0    2e-11   
gb|AAC16545.1|  aquaporin                                             67.0    2e-11   
gb|EYU42155.1|  hypothetical protein MIMGU_mgv1a011301mg              67.0    2e-11   
ref|XP_009786071.1|  PREDICTED: aquaporin PIP2-7-like                 67.0    2e-11   
ref|XP_001769800.1|  predicted protein                                67.0    2e-11   
gb|AFH36337.1|  aquaporin PIP2;2                                      67.0    2e-11   
ref|XP_011094668.1|  PREDICTED: aquaporin PIP2-4-like                 67.0    2e-11   
gb|KDO69063.1|  hypothetical protein CISIN_1g018895mg                 67.4    2e-11   
gb|EAZ39662.1|  hypothetical protein OsJ_24090                        67.0    2e-11   
ref|XP_001762521.1|  predicted protein                                67.0    2e-11   
emb|CAN75442.1|  hypothetical protein VITISV_019657                   67.0    2e-11   
gb|AAV80229.1|  aquaporin 2                                           67.0    2e-11   
gb|AAV69744.1|  aquaporin                                             67.0    2e-11   
gb|ABH09326.1|  putative aquaporin                                    67.0    2e-11   
ref|XP_008359252.1|  PREDICTED: aquaporin PIP2-2-like                 65.1    2e-11   
gb|AAS65964.1|  aquaporin PIP 2                                       67.0    2e-11   
gb|ADJ67992.1|  aquaporin                                             67.0    2e-11   
ref|XP_009389186.1|  PREDICTED: probable aquaporin PIP2-6             67.0    2e-11   
ref|XP_004496281.1|  PREDICTED: aquaporin PIP2-1-like                 67.0    2e-11   
emb|CAA53478.1|  plasma membrane intrinsic protein 2b                 67.0    2e-11   
ref|NP_001059545.1|  Os07g0448800                                     67.0    2e-11   
ref|NP_001267922.1|  aquaporin-like                                   67.0    2e-11   
dbj|BAB40141.1|  plasma membrane intrinsic protein 2-1                66.6    2e-11   
gb|ACG32567.1|  aquaporin PIP2.1                                      67.0    2e-11   
gb|ABN11917.1|  aquaporin                                             67.0    2e-11   
gb|KDO44717.1|  hypothetical protein CISIN_1g0196812mg                66.6    2e-11   
ref|XP_010264685.1|  PREDICTED: aquaporin PIP2-1-like                 67.0    2e-11   
gb|ABK24173.1|  unknown                                               66.2    2e-11   
gb|ABI96814.1|  plasma membrane intrinsic protein                     67.0    2e-11   
dbj|BAB40143.1|  plasma membrane intrinsic protein 2-2                67.0    3e-11   
ref|NP_001105638.1|  aquaporin PIP2-2                                 67.0    3e-11   
ref|XP_002446796.1|  hypothetical protein SORBIDRAFT_06g022840        67.0    3e-11   
gb|ABK25921.1|  unknown                                               66.6    3e-11   
gb|KHG30776.1|  Aquaporin PIP2-2 -like protein                        66.6    3e-11   
ref|XP_010505564.1|  PREDICTED: probable aquaporin PIP2-6             67.0    3e-11   
gb|AAY22203.1|  putative aquaporin                                    66.6    3e-11   
ref|XP_010509080.1|  PREDICTED: probable aquaporin PIP2-6             67.0    3e-11   
gb|AFQ23181.1|  aquaporin PIP2;2                                      66.6    3e-11   
ref|XP_006291609.1|  hypothetical protein CARUB_v10017763mg           66.6    3e-11   
ref|XP_011044357.1|  PREDICTED: probable aquaporin PIP2-4             66.6    3e-11   
ref|XP_006294744.1|  hypothetical protein CARUB_v10023789mg           66.6    3e-11   
gb|AAF71816.1|AF141642_1  putative aquaporin PIP2-1                   66.6    3e-11   
ref|XP_003548071.1|  PREDICTED: aquaporin PIP2-2-like                 66.6    3e-11   
ref|XP_006435690.1|  hypothetical protein CICLE_v10032308mg           66.6    3e-11   
ref|XP_003563177.1|  PREDICTED: probable aquaporin PIP2-1             66.6    3e-11   
ref|NP_200874.1|  putative aquaporin PIP2-4                           66.6    3e-11   
ref|XP_004500724.1|  PREDICTED: uncharacterized protein LOC101494283  68.6    3e-11   
ref|XP_008365039.1|  PREDICTED: probable aquaporin PIP2-5             66.6    3e-11   
gb|ABI96813.1|  plasma membrane intrinsic protein                     66.6    3e-11   
gb|EPS68613.1|  hypothetical protein M569_06155                       66.6    3e-11   
gb|ACF79873.1|  unknown                                               66.6    3e-11   
gb|ABU94630.1|  putative aquaporin PIP2;2                             66.6    3e-11   
ref|NP_001274381.1|  aquaporin PIP2-7-like                            66.6    3e-11   
gb|KCW51592.1|  hypothetical protein EUGRSUZ_J01087                   67.8    3e-11   
gb|ACU20229.1|  unknown                                               66.6    3e-11   
ref|XP_006652526.1|  PREDICTED: probable aquaporin PIP2-3-like        66.6    3e-11   
ref|NP_181254.1|  aquaporin PIP2-2                                    66.6    3e-11   
gb|AHA84128.1|  plasma membrane integral protein ZmPIP2-7             66.6    3e-11   
ref|XP_009611050.1|  PREDICTED: aquaporin PIP2-7-like                 66.2    3e-11   
ref|XP_007150204.1|  hypothetical protein PHAVU_005G135300g           66.6    3e-11   
gb|ABK26611.1|  unknown                                               66.2    3e-11   
dbj|BAF33069.1|  aquaporin                                            66.6    3e-11   
dbj|BAE06148.1|  PIP aquaporin isoform                                66.6    4e-11   
ref|XP_010032196.1|  PREDICTED: aquaporin PIP2-1                      66.2    4e-11   
ref|XP_009412922.1|  PREDICTED: probable aquaporin PIP2-6             66.2    4e-11   



>ref|XP_009376943.1| PREDICTED: probable aquaporin PIP2-8 [Pyrus x bretschneideri]
Length=281

 Score = 79.7 bits (195),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 34/52 (65%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S  ++  G+ +   KDYV+PPPA L DMDELK+WSFYRA+IAEF+ATLLFLY
Sbjct  2    SKEVIEEGQARHHGKDYVDPPPAPLFDMDELKRWSFYRALIAEFIATLLFLY  53



>ref|NP_001289999.1| aquaporin PIP2-1 [Beta vulgaris subsp. vulgaris]
 gb|ACT22630.1| plasma membrane intrinsic protein PIP2;2 [Beta vulgaris subsp. 
vulgaris]
Length=288

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + STKDY +PPPA L+DM+ELKKWSFYRA+IAEFVATLLFLY
Sbjct  15   EFSTKDYHDPPPAPLIDMEELKKWSFYRAIIAEFVATLLFLY  56



>gb|AAB67868.1| plasma membrane major intrinsic protein 1 [Beta vulgaris]
Length=288

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + STKDY +PPPA L+DM+ELKKWSFYRA+IAEFVATLLFLY
Sbjct  15   EFSTKDYHDPPPAPLIDMEELKKWSFYRAIIAEFVATLLFLY  56



>gb|ABC01884.1| plasma membrane intrinsic protein PIP2-like protein [Solanum 
tuberosum]
Length=283

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S  ++  G++    KDYV+PPPA LLDM EL KWSFYRAVIAEF+ATLLFLY
Sbjct  2    SKDVIEEGQVHHRGKDYVDPPPAPLLDMAELTKWSFYRAVIAEFIATLLFLY  53



>ref|XP_009803627.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana sylvestris]
 tpg|DAA64681.1| TPA_exp: aquaporin PIP2 6b [Nicotiana tabacum]
Length=283

 Score = 77.0 bits (188),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S  ++  G+     KDYV+PPPA LLDM EL KWSFYRAVIAEF+ATLLFLY
Sbjct  2    SKDVIEEGQTHQHGKDYVDPPPAPLLDMAELTKWSFYRAVIAEFIATLLFLY  53



>ref|XP_008382110.1| PREDICTED: probable aquaporin PIP2-8 [Malus domestica]
Length=281

 Score = 76.6 bits (187),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S  ++  G+ +   KDYV+PPPA L D DELK+WSFYRA+IAEF+ATLLFLY
Sbjct  2    SKEVIEEGQARHHGKDYVDPPPAPLFDTDELKRWSFYRALIAEFIATLLFLY  53



>ref|XP_006360898.1| PREDICTED: aquaporin PIP2-7-like [Solanum tuberosum]
Length=283

 Score = 76.6 bits (187),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S  ++  G+     KDYV+PPPA LLDM EL KWSFYRAVIAEF+ATLLFLY
Sbjct  2    SKDVIEEGQAHHHGKDYVDPPPAPLLDMAELTKWSFYRAVIAEFIATLLFLY  53



>ref|XP_009600501.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana tomentosiformis]
 tpg|DAA64680.1| TPA_exp: aquaporin PIP2 6a [Nicotiana tabacum]
Length=283

 Score = 76.3 bits (186),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S  ++  G+     KDYV+PPPA LLDM EL KWSFYRAVIAEF+ATLLFLY
Sbjct  2    SKDVIEEGQTHQHGKDYVDPPPAPLLDMAELTKWSFYRAVIAEFIATLLFLY  53



>gb|AAG02208.1|AF290201_1 plasma membrane intrinsic protein PIP2 [Solanum chacoense]
Length=283

 Score = 76.3 bits (186),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S  ++  G+     KDYV+PPPA LLDM EL KWSFYRAVIAEF+ATLLFLY
Sbjct  2    SKDVIEEGQAHHHGKDYVDPPPAPLLDMAELTKWSFYRAVIAEFIATLLFLY  53



>dbj|BAO18631.1| plasmamembrane intrinsic protein 2;9 [Solanum lycopersicum]
Length=283

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/52 (65%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S  ++  G+     KDYV+PPPA LLDM EL KWSFYRA+IAEF+ATLLFLY
Sbjct  2    SKDVIEEGQAHHHGKDYVDPPPAPLLDMAELTKWSFYRALIAEFIATLLFLY  53



>ref|XP_007009830.1| Plasma membrane intrinsic protein 2A [Theobroma cacao]
 gb|EOY18640.1| Plasma membrane intrinsic protein 2A [Theobroma cacao]
Length=281

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +1

Query  118  GELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            GE     KDYV+PPPA L+D  ELKKWSFYRA+IAEF+ATLLFLY
Sbjct  5    GEHGFHAKDYVDPPPAPLIDAAELKKWSFYRALIAEFIATLLFLY  49



>gb|ACE60220.1| plasma membrane aquaporin [Rosa hybrid cultivar]
Length=281

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA L DMDELK+WSFYRA+IAEF+ATLLFLY
Sbjct  16   KDYVDPPPAPLFDMDELKRWSFYRALIAEFIATLLFLY  53



>dbj|BAO18630.1| plasmamembrane intrinsic protein 2;8 [Solanum lycopersicum]
Length=283

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S  ++  G+++   KDYV+PPPA LLD  ELK WSFYRA+IAEF+ATLLFLY
Sbjct  2    SKEVIEEGQVQQHGKDYVDPPPAPLLDFAELKLWSFYRALIAEFIATLLFLY  53



>emb|CAB45651.1| putative plasma membrane intrinsic protein [Pisum sativum]
Length=285

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S KDY +PPPA L+D+DEL KWSFYRA+IAEFVATLLFLY
Sbjct  14   SAKDYQDPPPAPLIDLDELTKWSFYRALIAEFVATLLFLY  53



>ref|NP_001266257.1| aquaporin PIP2-7-like [Solanum lycopersicum]
 gb|ADV58935.1| aquaporin [Solanum lycopersicum]
Length=283

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S  ++  G+++   KDYV+PPPA LLD  ELK WSFYRA+IAEF+ATLLFLY
Sbjct  2    SKEVIEEGQVQQHGKDYVDPPPAPLLDFAELKLWSFYRALIAEFIATLLFLY  53



>gb|KEH39328.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=268

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + S KDY +PPPA L D+DEL KWS YRAVIAEFVATLLFLY
Sbjct  13   EFSAKDYQDPPPAPLFDLDELTKWSLYRAVIAEFVATLLFLY  54



>ref|XP_008236033.1| PREDICTED: aquaporin PIP2-7 [Prunus mume]
Length=281

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S  +   G+     KDYV+PPPA L+D DELK+WSFYRA+IAEF+ATLLFLY
Sbjct  2    SKEVSEEGQAHHHGKDYVDPPPAPLIDSDELKRWSFYRALIAEFIATLLFLY  53



>ref|XP_006412151.1| hypothetical protein EUTSA_v10025940mg [Eutrema salsugineum]
 gb|ESQ53604.1| hypothetical protein EUTSA_v10025940mg [Eutrema salsugineum]
Length=246

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +1

Query  118  GELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            G+     KDYV+PPPA LLDM ELK WSFYRA+IAEF+ATLLFLY
Sbjct  9    GQTHSHGKDYVDPPPAPLLDMAELKSWSFYRALIAEFIATLLFLY  53



>gb|KHG19287.1| Aquaporin PIP2-7 -like protein [Gossypium arboreum]
Length=280

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            ++  KDYV+PPPA LLDM+ELK WSFYRA++AEFVATLLFLY
Sbjct  11   QLHGKDYVDPPPARLLDMEELKSWSFYRALLAEFVATLLFLY  52



>gb|ACU87557.1| PIP protein [Gossypium hirsutum]
Length=280

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            ++  KDYV+PPPA LLDM+ELK WSFYRA++AEFVATLLFLY
Sbjct  11   QLHGKDYVDPPPARLLDMEELKTWSFYRALLAEFVATLLFLY  52



>gb|KDO68091.1| hypothetical protein CISIN_1g023370mg [Citrus sinensis]
Length=267

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA L+DM ELK WSFYRA+IAEFVATLLFLY
Sbjct  18   KDYVDPPPAPLIDMAELKLWSFYRALIAEFVATLLFLY  55



>gb|ADL16407.1| aquaporin [Dianthus caryophyllus]
 gb|AFC90119.1| pip2 [Dianthus caryophyllus]
Length=285

 Score = 74.3 bits (181),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA LLDM ELK+WSFYRA+IAEF+ATLLFLY
Sbjct  20   KDYVDPPPAPLLDMGELKQWSFYRALIAEFIATLLFLY  57



>ref|XP_004505993.1| PREDICTED: aquaporin PIP2-7-like [Cicer arietinum]
Length=285

 Score = 74.3 bits (181),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + S KDY +PPPA L+D DEL KWSFYRA+IAEFVATLLFLY
Sbjct  12   EFSAKDYQDPPPAPLIDFDELTKWSFYRALIAEFVATLLFLY  53



>ref|XP_007200557.1| hypothetical protein PRUPE_ppa009691mg [Prunus persica]
 gb|EMJ01756.1| hypothetical protein PRUPE_ppa009691mg [Prunus persica]
Length=281

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S  +   G+     KDYV+PPPA L+D DELK+WSFYRA+IAEF+ATLLFLY
Sbjct  2    SKEVSEEGQAHHHGKDYVDPPPAPLIDSDELKRWSFYRALIAEFIATLLFLY  53



>gb|AAL49750.1|AF452012_1 aquaporin-like protein [Petunia x hybrida]
Length=283

 Score = 73.9 bits (180),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S  ++  G+++   KDYV+PPPA LLD  ELK WSFYRA+IAEF+ATLLFLY
Sbjct  2    SKEVIEEGQVQQHGKDYVDPPPAPLLDFAELKLWSFYRALIAEFIATLLFLY  53



>gb|AAB65787.1| plasma membrane intrinsic protein [Arabidopsis thaliana]
Length=280

 Score = 73.9 bits (180),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA LLDM ELK WSFYRA+IAEF+ATLLFLY
Sbjct  15   KDYVDPPPAPLLDMGELKSWSFYRALIAEFIATLLFLY  52



>ref|NP_195236.1| plasma membrane intrinsic protein 3 [Arabidopsis thaliana]
 ref|NP_001190920.1| plasma membrane intrinsic protein 3 [Arabidopsis thaliana]
 sp|P93004.2|PIP27_ARATH RecName: Full=Aquaporin PIP2-7; AltName: Full=Plasma membrane 
intrinsic protein 2-7; Short=AtPIP2;7; AltName: Full=Plasma 
membrane intrinsic protein 3; AltName: Full=Salt stress-induced 
major intrinsic protein; Contains: RecName: Full=Aquaporin 
PIP2-7, N-terminally processed [Arabidopsis thaliana]
 gb|AAL06563.1|AF412110_1 AT4g35100/M4E13_150 [Arabidopsis thaliana]
 emb|CAA17774.1| plasma membrane intrinsic protein (SIMIP) [Arabidopsis thaliana]
 emb|CAB80227.1| plasma membrane intrinsic protein (SIMIP) [Arabidopsis thaliana]
 gb|AAL32881.1| plasma membrane intrinsic protein (SIMIP) [Arabidopsis thaliana]
 gb|AAM10142.1| plasma membrane intrinsic protein (SIMIP) [Arabidopsis thaliana]
 gb|AAM66021.1| plasma membrane intrinsic protein SIMIP [Arabidopsis thaliana]
 dbj|BAH30556.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE86464.1| plasma membrane intrinsic protein 3 [Arabidopsis thaliana]
 gb|AEE86465.1| plasma membrane intrinsic protein 3 [Arabidopsis thaliana]
Length=280

 Score = 73.9 bits (180),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA LLDM ELK WSFYRA+IAEF+ATLLFLY
Sbjct  15   KDYVDPPPAPLLDMGELKSWSFYRALIAEFIATLLFLY  52



>ref|XP_004290727.1| PREDICTED: aquaporin PIP2-7-like [Fragaria vesca subsp. vesca]
Length=281

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA L D DELK+WSFYRA+IAEFVATLLFLY
Sbjct  16   KDYVDPPPAPLFDTDELKRWSFYRALIAEFVATLLFLY  53



>gb|AAL32127.1| aquaporin [Medicago truncatula]
Length=287

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + S KDY +PPPA L D+DEL KWS YRAVIAEFVATLLFLY
Sbjct  13   EFSAKDYQDPPPAPLFDLDELTKWSLYRAVIAEFVATLLFLY  54



>ref|XP_009138343.1| PREDICTED: aquaporin PIP2-7-like [Brassica rapa]
Length=281

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S  +   G+     KDYV+PPPA LLDM EL KWSFYRA+IAEFVATLLFLY
Sbjct  2    SKEVSEEGQTHHHGKDYVDPPPAPLLDMAELGKWSFYRALIAEFVATLLFLY  53



>emb|CDX69112.1| BnaC01g03410D [Brassica napus]
Length=281

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 34/52 (65%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S  +   G+     KDYV+PPPA LLDM ELK WSFYRA+IAEF+ATLLFLY
Sbjct  2    SKEVSEEGQTHSHGKDYVDPPPAPLLDMGELKSWSFYRALIAEFIATLLFLY  53



>gb|AAD31846.1|AF133530_1 water channel protein MipH [Mesembryanthemum crystallinum]
Length=291

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +1

Query  115  AGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
             GE++   KDY +PPP+ L DM+EL KWSFYRA+IAEF+ATLLFLY
Sbjct  9    GGEVRDVAKDYQDPPPSPLFDMEELTKWSFYRALIAEFIATLLFLY  54



>ref|XP_006284279.1| hypothetical protein CARUB_v10005443mg [Capsella rubella]
 gb|EOA17177.1| hypothetical protein CARUB_v10005443mg [Capsella rubella]
Length=280

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA L DM ELK WSFYRA+IAEFVATLLFLY
Sbjct  15   KDYVDPPPAPLFDMGELKSWSFYRALIAEFVATLLFLY  52



>ref|XP_011045923.1| PREDICTED: probable aquaporin PIP2-8 [Populus euphratica]
Length=279

 Score = 73.6 bits (179),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  121  ELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            E K   KDYV+PPPA   D+DELK+WSF+RA+IAEF+ATLLFLY
Sbjct  8    EGKSHAKDYVDPPPAPFFDVDELKRWSFFRALIAEFIATLLFLY  51



>gb|KDO73275.1| hypothetical protein CISIN_1g022966mg [Citrus sinensis]
Length=264

 Score = 73.2 bits (178),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +1

Query  115  AGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
             G  + S KDY +PPPA L+D +EL KWSFYRAVIAEF+ATLLFLY
Sbjct  12   GGGGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLLFLY  57



>ref|XP_006846771.1| hypothetical protein AMTR_s00148p00023270 [Amborella trichopoda]
 gb|ERN08352.1| hypothetical protein AMTR_s00148p00023270 [Amborella trichopoda]
Length=283

 Score = 73.6 bits (179),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + + KDY +PPPAAL+D++EL KWSFYRA+IAEF+ATLLFLY
Sbjct  12   EFTAKDYTDPPPAALIDLEELTKWSFYRALIAEFIATLLFLY  53



>ref|XP_010483715.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score = 73.6 bits (179),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 32/45 (71%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +1

Query  118  GELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            G    + +DY +PPPA LLDM+EL+KWS YRAVIAEFVATLLFLY
Sbjct  10   GGAPAAARDYADPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLY  54



>ref|XP_009105909.1| PREDICTED: aquaporin PIP2-7 [Brassica rapa]
 emb|CDY52648.1| BnaAnng11630D [Brassica napus]
Length=281

 Score = 73.6 bits (179),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 34/52 (65%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S  +   G+     KDYV+PPPA LLDM ELK WSFYRA+IAEF+ATLLFLY
Sbjct  2    SKEVSEEGQTHSHGKDYVDPPPAPLLDMGELKSWSFYRALIAEFIATLLFLY  53



>ref|XP_003597235.1| Aquaporin PIP2-7 [Medicago truncatula]
 gb|AES67486.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=287

 Score = 73.6 bits (179),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + S KDY +PPPA L D+DEL KWS YRAVIAEFVATLLFLY
Sbjct  13   EFSAKDYQDPPPAPLFDLDELTKWSLYRAVIAEFVATLLFLY  54



>ref|XP_006424577.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 gb|ESR37817.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
Length=264

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + S KDY +PPPA L+D +EL KWSFYRAVIAEF+ATLLFLY
Sbjct  16   EFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLLFLY  57



>ref|XP_006412152.1| hypothetical protein EUTSA_v10025940mg [Eutrema salsugineum]
 gb|ESQ53605.1| hypothetical protein EUTSA_v10025940mg [Eutrema salsugineum]
Length=281

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/52 (65%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S  +   G+     KDYV+PPPA LLDM ELK WSFYRA+IAEF+ATLLFLY
Sbjct  2    SKEVSEEGQTHSHGKDYVDPPPAPLLDMAELKSWSFYRALIAEFIATLLFLY  53



>ref|XP_010432340.1| PREDICTED: aquaporin PIP2-7 [Camelina sativa]
 ref|XP_010437523.1| PREDICTED: aquaporin PIP2-7 isoform X1 [Camelina sativa]
 ref|XP_010437524.1| PREDICTED: aquaporin PIP2-7 isoform X2 [Camelina sativa]
 ref|XP_010437525.1| PREDICTED: aquaporin PIP2-7 isoform X2 [Camelina sativa]
 ref|XP_010446981.1| PREDICTED: aquaporin PIP2-7 [Camelina sativa]
Length=280

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA L DM ELK WSFYRA+IAEFVATLLFLY
Sbjct  15   KDYVDPPPAPLFDMGELKSWSFYRALIAEFVATLLFLY  52



>ref|XP_006298288.1| hypothetical protein CARUB_v10014353mg [Capsella rubella]
 gb|EOA31186.1| hypothetical protein CARUB_v10014353mg [Capsella rubella]
Length=278

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA LLDM ELK WSFYRA+IAEF+ATLLFLY
Sbjct  13   KDYVDPPPAPLLDMAELKLWSFYRAIIAEFIATLLFLY  50



>ref|XP_010253676.1| PREDICTED: aquaporin PIP2-4-like [Nelumbo nucifera]
Length=287

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + S KDY +PPPA+L+D DEL KWSFYRA+IAEF+ATLLFLY
Sbjct  12   QFSAKDYHDPPPASLIDPDELSKWSFYRALIAEFIATLLFLY  53



>ref|XP_007207344.1| hypothetical protein PRUPE_ppa009630mg [Prunus persica]
 gb|EMJ08543.1| hypothetical protein PRUPE_ppa009630mg [Prunus persica]
Length=284

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +1

Query  115  AGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
             G+ + S KDY +PPPA L+D +EL +WSFYRA+IAEF+ATLLFLY
Sbjct  9    GGQHRFSGKDYQDPPPAPLIDAEELGQWSFYRAIIAEFIATLLFLY  54



>gb|KFK30134.1| hypothetical protein AALP_AA7G221400 [Arabis alpina]
Length=282

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA L DM ELK WSFYRA+IAEFVATLLFLY
Sbjct  17   KDYVDPPPAPLFDMTELKSWSFYRALIAEFVATLLFLY  54



>ref|XP_006359706.1| PREDICTED: aquaporin PIP2-7-like [Solanum tuberosum]
Length=283

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S  ++  G+++   KDYV+PPPA LLD  ELK WSF+RA+IAEF+ATLLFLY
Sbjct  2    SKEVIEEGQVQQHGKDYVDPPPAPLLDFAELKLWSFHRALIAEFIATLLFLY  53



>ref|XP_008377729.1| PREDICTED: probable aquaporin PIP2-8 [Malus domestica]
Length=281

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDY +PPPA L+D DEL++WSFYRA+IAEFVATLLFLY
Sbjct  16   KDYTDPPPAPLIDFDELRRWSFYRALIAEFVATLLFLY  53



>gb|KDP44053.1| hypothetical protein JCGZ_05520 [Jatropha curcas]
Length=286

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + S KDY +PPPA L+DMDEL +WSFYRA+IAEF+ATLLFLY
Sbjct  13   EFSGKDYHDPPPAPLIDMDELGQWSFYRALIAEFIATLLFLY  54



>ref|XP_006422584.1| hypothetical protein CICLE_v10029003mg [Citrus clementina]
 ref|XP_006486723.1| PREDICTED: aquaporin PIP2-7-like [Citrus sinensis]
 gb|ESR35824.1| hypothetical protein CICLE_v10029003mg [Citrus clementina]
 gb|KDO68090.1| hypothetical protein CISIN_1g023370mg [Citrus sinensis]
Length=283

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA L+DM ELK WSFYRA+IAEFVATLLFLY
Sbjct  18   KDYVDPPPAPLIDMAELKLWSFYRALIAEFVATLLFLY  55



>ref|XP_010443868.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +1

Query  136  TKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            ++DY +PPPA LLDM+EL+KWS YRAVIAEFVATLLFLY
Sbjct  16   SRDYADPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLY  54



>ref|XP_007046621.1| Plasma membrane intrinsic protein 3 isoform 2 [Theobroma cacao]
 gb|EOX90778.1| Plasma membrane intrinsic protein 3 isoform 2 [Theobroma cacao]
Length=282

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            ++  KDYV+PPPA LLDM+E++ WSFYRA++AEFVATLLFLY
Sbjct  11   QLHGKDYVDPPPARLLDMEEIRSWSFYRALLAEFVATLLFLY  52



>ref|XP_009355655.1| PREDICTED: probable aquaporin PIP2-8 [Pyrus x bretschneideri]
Length=281

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDY +PPPA L+D DEL++WSFYRA+IAEFVATLLFLY
Sbjct  16   KDYADPPPAPLIDFDELRRWSFYRALIAEFVATLLFLY  53



>gb|KCW55550.1| hypothetical protein EUGRSUZ_I01429 [Eucalyptus grandis]
Length=282

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA LLDM ELK WSFYRA+IAEF+ATLLFLY
Sbjct  16   KDYVDPPPAPLLDMGELKLWSFYRALIAEFIATLLFLY  53



>gb|KFK36762.1| hypothetical protein AALP_AA4G166800 [Arabis alpina]
Length=278

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA LLDM ELK WSFYRA+IAEF+ATLLFLY
Sbjct  13   KDYVDPPPAPLLDMGELKLWSFYRALIAEFIATLLFLY  50



>ref|XP_010526891.1| PREDICTED: probable aquaporin PIP2-8 [Tarenaya hassleriana]
Length=281

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/52 (65%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S  +   G+ +   KDYV+PPPA LLDM ELK WSFYRA+IAEF+ATLLFLY
Sbjct  2    SKEVSEEGQSQHHGKDYVDPPPAPLLDMAELKLWSFYRALIAEFIATLLFLY  53



>ref|XP_008807132.1| PREDICTED: probable aquaporin PIP2-6 [Phoenix dactylifera]
Length=282

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S KDY +PPPA LLDM EL+ WSFYRA+IAEFVATLLFLY
Sbjct  13   SAKDYTDPPPAPLLDMGELRLWSFYRALIAEFVATLLFLY  52



>ref|XP_006400824.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
 gb|ESQ42277.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
Length=285

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + +DY +PPPA LLDM+EL+KWS YRAVIAEFVATLLFLY
Sbjct  14   AARDYADPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLY  53



>ref|XP_007046620.1| Plasma membrane intrinsic protein 3 isoform 1 [Theobroma cacao]
 gb|EOX90777.1| Plasma membrane intrinsic protein 3 isoform 1 [Theobroma cacao]
Length=280

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            ++  KDYV+PPPA LLDM+E++ WSFYRA++AEFVATLLFLY
Sbjct  11   QLHGKDYVDPPPARLLDMEEIRSWSFYRALLAEFVATLLFLY  52



>ref|XP_006424576.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 ref|XP_006488095.1| PREDICTED: aquaporin PIP2-1-like [Citrus sinensis]
 gb|ESR37816.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 gb|KDO73274.1| hypothetical protein CISIN_1g022966mg [Citrus sinensis]
Length=289

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + S KDY +PPPA L+D +EL KWSFYRAVIAEF+ATLLFLY
Sbjct  16   EFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLLFLY  57



>ref|XP_002530280.1| Aquaporin PIP2.1, putative [Ricinus communis]
 gb|EEF32087.1| Aquaporin PIP2.1, putative [Ricinus communis]
Length=287

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + S KDY +PPPA L+D+DEL KWSFYRA+IAEF+ATLLFLY
Sbjct  14   EFSAKDYHDPPPAPLIDVDELGKWSFYRALIAEFIATLLFLY  55



>gb|KCW55551.1| hypothetical protein EUGRSUZ_I01429 [Eucalyptus grandis]
Length=281

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA LLDM ELK WSFYRA+IAEF+ATLLFLY
Sbjct  16   KDYVDPPPAPLLDMGELKLWSFYRALIAEFIATLLFLY  53



>gb|ACB42441.1| aquaporin PIP2;4 [Gossypium hirsutum]
 gb|KHG19165.1| Aquaporin PIP2-7 -like protein [Gossypium arboreum]
Length=278

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA L+DM ELK WSFYRA+IAEF+ATLLFLY
Sbjct  13   KDYVDPPPAPLIDMAELKSWSFYRALIAEFIATLLFLY  50



>gb|AAF61464.1|AF139815_1 plasma membrane intrinsic protein 2 [Triticum aestivum]
Length=257

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + STKDY +PPPA ++D +EL KWS YRAVIAEFVATLLFLY
Sbjct  13   EFSTKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLY  54



>ref|XP_010467415.1| PREDICTED: probable aquaporin PIP2-8 [Camelina sativa]
Length=278

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA LLDM ELK WSFYRA+IAEF+ATLLFLY
Sbjct  13   KDYVDPPPAPLLDMAELKFWSFYRAIIAEFIATLLFLY  50



>ref|NP_179277.1| putative aquaporin PIP2-8 [Arabidopsis thaliana]
 sp|Q9ZVX8.1|PIP28_ARATH RecName: Full=Probable aquaporin PIP2-8; AltName: Full=Plasma 
membrane intrinsic protein 2-8; Short=AtPIP2;8; AltName: Full=Plasma 
membrane intrinsic protein 3b; Short=PIP3b; Contains: 
RecName: Full=Probable aquaporin PIP2-8, N-terminally processed 
[Arabidopsis thaliana]
 gb|AAC64216.1| putative plasma membrane intrinsic protein [Arabidopsis thaliana]
 gb|AAM15086.1| putative plasma membrane intrinsic protein [Arabidopsis thaliana]
 gb|AAO63278.1| At2g16850 [Arabidopsis thaliana]
 dbj|BAF00056.1| putative aquaporin [Arabidopsis thaliana]
 gb|AEC06543.1| putative aquaporin PIP2-8 [Arabidopsis thaliana]
Length=278

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA LLDM ELK WSFYRA+IAEF+ATLLFLY
Sbjct  13   KDYVDPPPAPLLDMAELKLWSFYRAIIAEFIATLLFLY  50



>ref|XP_009131906.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=285

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  130  MSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            M+ +DY +PPPA L DM+EL KWS YRAVIAEFVATLLFLY
Sbjct  13   MAARDYQDPPPAPLFDMEELGKWSLYRAVIAEFVATLLFLY  53



>ref|XP_007041804.1| Plasma membrane intrinsic protein 2,8 isoform 1 [Theobroma cacao]
 gb|EOX97635.1| Plasma membrane intrinsic protein 2,8 isoform 1 [Theobroma cacao]
Length=278

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  121  ELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            E   S KDYV+PPPA L+DM ELK WSFYRA+IAEF+ATLLFLY
Sbjct  7    EEGQSRKDYVDPPPAPLIDMAELKLWSFYRALIAEFIATLLFLY  50



>gb|AHZ08398.1| phosphatidylinosital biphosphate protein [Morus alba var. multicaulis]
Length=282

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA L+DM ELK WSFYRA+IAEF+ATLLFLY
Sbjct  15   KDYVDPPPAPLIDMAELKLWSFYRALIAEFIATLLFLY  52



>gb|ACB42440.1| aquaporin PIP2;3 [Gossypium hirsutum]
 gb|AIL95755.1| aquaporin [Gossypium hirsutum]
Length=278

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA L+DM ELK WSFYRA+IAEF+ATLLFLY
Sbjct  13   KDYVDPPPAPLIDMAELKSWSFYRALIAEFIATLLFLY  50



>gb|KHN33668.1| Aquaporin PIP2-7 [Glycine soja]
Length=272

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  121  ELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            E+    KDYV+PPPA L+D+ E+K WSFYRA+IAEF+ATLLFLY
Sbjct  4    EVSQQRKDYVDPPPAPLIDLAEIKLWSFYRALIAEFIATLLFLY  47



>emb|CDP07111.1| unnamed protein product [Coffea canephora]
Length=288

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +1

Query  106  ILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            ++ A + + S KDY +PPPAA  D+DEL KWSF+RA+IAEFVATLLFLY
Sbjct  8    VVAAEQGEFSAKDYHDPPPAAFFDLDELTKWSFHRALIAEFVATLLFLY  56



>ref|XP_009794928.1| PREDICTED: LOW QUALITY PROTEIN: probable aquaporin PIP2-1 [Nicotiana 
sylvestris]
Length=282

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + S KDY +PPPA L+D +ELK+WSFYRA IAEF+ATLLFLY
Sbjct  10   EFSAKDYTDPPPAPLIDFEELKQWSFYRAAIAEFIATLLFLY  51



>ref|XP_010548112.1| PREDICTED: probable aquaporin PIP2-8 [Tarenaya hassleriana]
Length=281

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA LLDM ELK WSFYRA+IAEF+ATLLFLY
Sbjct  16   KDYVDPPPAPLLDMAELKLWSFYRALIAEFIATLLFLY  53



>ref|XP_009108681.1| PREDICTED: aquaporin PIP2-7-like [Brassica rapa]
Length=281

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S  +   G  +   KDYV+PPPA  LDM ELK WSFYRA+IAEF+ATLLFLY
Sbjct  2    SKEVSEEGHTQSHGKDYVDPPPAPFLDMGELKSWSFYRALIAEFIATLLFLY  53



>ref|XP_010456647.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=285

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + +DY +PPPA LLDM+EL+KWS YRAVIAEFVATLLFLY
Sbjct  14   AARDYKDPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLY  53



>gb|KHG08488.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=285

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            ++S KDY +PPPA L+D +EL KWSFYRAVIAEF+ATLLFLY
Sbjct  11   QVSGKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLY  52



>ref|XP_007041805.1| Plasma membrane intrinsic protein 3 isoform 2, partial [Theobroma 
cacao]
 gb|EOX97636.1| Plasma membrane intrinsic protein 3 isoform 2, partial [Theobroma 
cacao]
Length=192

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  121  ELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            E   S KDYV+PPPA L+DM ELK WSFYRA+IAEF+ATLLFLY
Sbjct  7    EEGQSRKDYVDPPPAPLIDMAELKLWSFYRALIAEFIATLLFLY  50



>gb|AFB82643.1| aquaporin [Camellia sinensis]
Length=279

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA L+DM EL+ WSFYRA+IAEF+ATLLFLY
Sbjct  14   KDYVDPPPAPLIDMAELQLWSFYRAIIAEFIATLLFLY  51



>ref|XP_004956115.1| PREDICTED: aquaporin PIP2-6-like [Setaria italica]
Length=286

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            +DYV+PPPA L+D+DEL KWS YRAVIAEFVATLLFLY
Sbjct  16   RDYVDPPPAPLVDIDELGKWSLYRAVIAEFVATLLFLY  53



>ref|XP_006357563.1| PREDICTED: probable aquaporin PIP2-1-like [Solanum tuberosum]
Length=286

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + S KDY +PPPA L+D +EL +WSFYRA+IAEF+ATLLFLY
Sbjct  13   EFSAKDYTDPPPAPLVDFEELTQWSFYRAIIAEFIATLLFLY  54



>gb|AAB18227.1| MipC [Mesembryanthemum crystallinum]
Length=287

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + S KDY +PPPA L+D +EL+KWSFYRAVIAEF+ATLLFLY
Sbjct  14   EFSAKDYHDPPPAPLIDFEELRKWSFYRAVIAEFIATLLFLY  55



>ref|XP_010920097.1| PREDICTED: probable aquaporin PIP2-6 [Elaeis guineensis]
Length=282

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S KDY +PPPA LLDM EL+ WSFYRA+IAEFVATLLFLY
Sbjct  13   SAKDYTDPPPAPLLDMGELRLWSFYRALIAEFVATLLFLY  52



>gb|AFK47400.1| unknown [Lotus japonicus]
Length=287

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S+KDY +PPPA L+D +EL KWSFYRAVIAEF+ATLLFLY
Sbjct  14   SSKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLY  53



>gb|AAG30607.1|AF314656_1 aquaporin [Brassica oleracea]
Length=281

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S  +   G  +   KDYV+PPPA  LDM ELK WSFYRA+IAEF+ATLLFLY
Sbjct  2    SKEVSEEGHTQSHGKDYVDPPPAPFLDMGELKSWSFYRALIAEFIATLLFLY  53



>gb|EYU40445.1| hypothetical protein MIMGU_mgv1a011413mg [Erythranthe guttata]
Length=282

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA LLDM ELK WSFYRA+IAEF+ATLLFLY
Sbjct  15   KDYVDPPPAPLLDMGELKLWSFYRALIAEFIATLLFLY  52



>ref|XP_009628968.1| PREDICTED: probable aquaporin PIP2-1 [Nicotiana tomentosiformis]
 tpg|DAA64679.1| TPA_exp: aquaporin PIP2 5 [Nicotiana tabacum]
Length=283

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + S KDY +PPPA L+D +ELK+WSFYRA IAEF+ATLLFLY
Sbjct  10   EFSAKDYTDPPPAPLIDFEELKQWSFYRAAIAEFIATLLFLY  51



>gb|ACU14125.1| unknown [Glycine max]
Length=262

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  121  ELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            E+    KDYV+PPPA L+D+ E+K WSFYRA+IAEF+ATLLFLY
Sbjct  4    EVSQQGKDYVDPPPAPLIDLAEIKLWSFYRALIAEFIATLLFLY  47



>gb|ACU87555.1| PIP protein [Gossypium hirsutum]
Length=278

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +1

Query  121  ELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            E  MS KDYV+PPPA L+D+ E+K WSFYRA+IAEF+ATLLFLY
Sbjct  7    EEGMSRKDYVDPPPAPLIDVAEIKLWSFYRALIAEFIATLLFLY  50



>gb|AAZ83350.1| aquaporin [Gossypium hirsutum]
Length=130

 Score = 70.5 bits (171),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +1

Query  121  ELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            E  MS KDYV+PPPA L+D+ E+K WSFYRA+IAEF+ATLLFLY
Sbjct  7    EEGMSRKDYVDPPPAPLIDVAEIKLWSFYRALIAEFIATLLFLY  50



>gb|ACB71281.1| plasma membrane intrinsic protein [Tamarix hispida]
Length=281

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S  +   G+ ++  KDYV+PPPA LLDM EL  WSFYRA IAEF+ATLLFLY
Sbjct  2    SKEVSEEGQSQLHRKDYVDPPPAPLLDMAELTTWSFYRACIAEFIATLLFLY  53



>ref|NP_001234625.1| aquaporin [Solanum lycopersicum]
 gb|ADU34070.1| aquaporin [Solanum lycopersicum]
 dbj|BAO18627.1| plasmamembrane intrinsic protein 2;4 [Solanum lycopersicum]
Length=280

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S KDY +PPPA L+D +EL++WSFYRA+IAEF+ATLLFLY
Sbjct  9    SAKDYTDPPPAPLVDFEELRQWSFYRAIIAEFIATLLFLY  48



>ref|XP_002461932.1| hypothetical protein SORBIDRAFT_02g010790 [Sorghum bicolor]
 gb|EER98453.1| hypothetical protein SORBIDRAFT_02g010790 [Sorghum bicolor]
Length=286

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 6/52 (12%)
 Frame = +1

Query  115  AGELKMST------KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            A E+ +ST      +DY++PPPA L+D+DEL KWS YRAVIAEFVATLLFLY
Sbjct  2    AKEVDVSTLEAGGARDYIDPPPAPLVDIDELGKWSLYRAVIAEFVATLLFLY  53



>ref|XP_010934344.1| PREDICTED: aquaporin PIP2-4-like [Elaeis guineensis]
Length=282

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  121  ELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            E + + KDY +PPPA L+D +EL KWS YRAVIAEF+ATLLFLY
Sbjct  6    EAEFTAKDYTDPPPAPLIDAEELAKWSLYRAVIAEFIATLLFLY  49



>emb|CDX76314.1| BnaA08g10860D [Brassica napus]
Length=281

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S  +   G  +   KDYV+PPPA  LDM ELK WSFYRA+IAEF+ATLLFLY
Sbjct  2    SKEVSEEGHTQSHGKDYVDPPPAPFLDMGELKSWSFYRALIAEFIATLLFLY  53



>emb|CDY17511.1| BnaC03g65520D [Brassica napus]
Length=281

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S  +   G  +   KDYV+PPPA  LDM ELK WSFYRA+IAEF+ATLLFLY
Sbjct  2    SKEVSEEGHTQSHGKDYVDPPPAPFLDMGELKSWSFYRALIAEFIATLLFLY  53



>ref|XP_008243934.1| PREDICTED: probable aquaporin PIP2-5 [Prunus mume]
Length=284

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +1

Query  115  AGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
             G  + S KDY +PPPA L+D +EL +WSFYRA+IAEF+ATLLFLY
Sbjct  9    GGHNRFSGKDYQDPPPAPLIDAEELGQWSFYRAIIAEFIATLLFLY  54



>gb|AAF65845.1|AF255795_1 aquaporin 1 [Allium cepa]
Length=291

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  121  ELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + + + KDY +PPPA L DM EL KWS YRAVIAEFVATLLFLY
Sbjct  13   DTQFTAKDYTDPPPAPLFDMGELTKWSLYRAVIAEFVATLLFLY  56



>ref|XP_006383054.1| plasma membrane intrinsic protein 1-1 [Populus trichocarpa]
 gb|ERP60851.1| plasma membrane intrinsic protein 1-1 [Populus trichocarpa]
Length=272

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 34/43 (79%), Positives = 38/43 (88%), Gaps = 2/43 (5%)
 Frame = +1

Query  130  MST--KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            MST  KDY +PPPA LLDM+ELK+WSFYRA+IAEFVAT LFLY
Sbjct  1    MSTGGKDYRDPPPAPLLDMEELKQWSFYRALIAEFVATFLFLY  43



>gb|KHG00060.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=289

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + S KDY +PPPA L+D +EL KWSFYRAVIAEF+ATLLFLY
Sbjct  14   EFSAKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLY  55



>gb|AFQ23186.1| aquaporin PIP2;1 [Eustoma exaltatum subsp. russellianum]
Length=286

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S KDY +PPPAA  D+DEL KWSFYRA+IAEFVATLLFLY
Sbjct  15   SAKDYHDPPPAAFFDLDELTKWSFYRALIAEFVATLLFLY  54



>ref|NP_001105025.1| aquaporin PIP2-3 [Zea mays]
 sp|Q9ATM7.1|PIP23_MAIZE RecName: Full=Aquaporin PIP2-3; AltName: Full=Plasma membrane 
intrinsic protein 2-3; AltName: Full=ZmPIP2-3; AltName: Full=ZmPIP2;3 
[Zea mays]
 gb|AAK26760.1| plasma membrane integral protein ZmPIP2-3 [Zea mays]
 gb|ACR38296.1| unknown [Zea mays]
 gb|AFW63074.1| plasma membrane intrinsic protein2 [Zea mays]
Length=289

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 37/46 (80%), Gaps = 2/46 (4%)
 Frame = +1

Query  115  AGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            AGE   S KDY +PPPA L+D DEL KWS YRAVIAEF+ATLLFLY
Sbjct  13   AGEF--SAKDYTDPPPAPLIDADELTKWSLYRAVIAEFIATLLFLY  56



>gb|ACV66986.1| plasma membrane aquaporin 2 [Hevea brasiliensis]
Length=278

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  121  ELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            E +   KDYV+PPPA L+DM E+K WSFYRA+IAEF+ATLLFLY
Sbjct  7    EERQPGKDYVDPPPAPLIDMAEIKLWSFYRALIAEFIATLLFLY  50



>gb|AAB18228.1| MipE [Mesembryanthemum crystallinum]
Length=284

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA L DM ELK WSFYRA+IAEF+ATLLFLY
Sbjct  18   KDYVDPPPAPLFDMGELKLWSFYRALIAEFIATLLFLY  55



>emb|CAC82712.1| major intrinsic protein 1 [Populus tremula x Populus tremuloides]
 emb|CAH60722.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  112  YAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + G  ++S KDY +PPPA L+D +E+ +WSFYRA+IAEFVATLLFLY
Sbjct  5    FEGGGELSAKDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLY  51



>ref|XP_003522619.2| PREDICTED: aquaporin PIP2-7 [Glycine max]
Length=322

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 38/75 (51%), Positives = 50/75 (67%), Gaps = 1/75 (1%)
 Frame = +1

Query  28   LIFPLYIPSHLLQFTHSIILFV*SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFY  207
            L+ P    S L     S + F  S+S + + E+    KDYV+PPPA L+D+ E+K WSFY
Sbjct  21   LLIPNLPLSELWHKKASTLEFSRSSSRM-SKEVSQQRKDYVDPPPAPLIDLAEIKLWSFY  79

Query  208  RAVIAEFVATLLFLY  252
            RA+IAEF+ATLLFLY
Sbjct  80   RALIAEFIATLLFLY  94



>gb|AFB83067.1| plasma intrinsic protein PIP2.1 [Helianthemum almeriense]
Length=279

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA ++DM ELK WSFYRA+IAEF+ATLLFLY
Sbjct  14   KDYVDPPPAPIIDMAELKLWSFYRALIAEFIATLLFLY  51



>gb|KHG29841.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=291

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +1

Query  115  AGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
             G  + S KDY +PPPA L+DM+EL KWS YRA IAEF+ATLLFLY
Sbjct  12   GGGAEFSAKDYHDPPPAPLIDMEELTKWSLYRAAIAEFIATLLFLY  57



>gb|AAB36949.1| plasma membrane intrinsic protein PIP3 [Arabidopsis thaliana]
Length=280

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFL  249
            KDYV+PPPA LLDM ELK WSFYRA+IAEF+ATLLFL
Sbjct  15   KDYVDPPPAPLLDMGELKSWSFYRALIAEFIATLLFL  51



>ref|XP_003606383.1| Aquaporin PIP2-7 [Medicago truncatula]
 gb|AES88580.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
 gb|AFK45158.1| unknown [Medicago truncatula]
Length=285

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S KDY +PPPA L+D++EL KWSFYRA+IAEFVATLLFLY
Sbjct  14   SAKDYQDPPPAPLIDVEELTKWSFYRALIAEFVATLLFLY  53



>gb|ACR56615.1| plasma intrinsic protein 2;5 [Juglans regia]
Length=281

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA L+DM ELK WSFYRA+IAEF+ATLLFLY
Sbjct  16   KDYVDPPPAPLIDMAELKLWSFYRALIAEFIATLLFLY  53



>ref|XP_011043133.1| PREDICTED: probable aquaporin PIP2-8 [Populus euphratica]
Length=276

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 2/44 (5%)
 Frame = +1

Query  127  KMST--KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KMST  KDY +PPPA LLDM+ELK+WSFYRA+IAE VAT LFLY
Sbjct  4    KMSTEGKDYRDPPPAPLLDMEELKQWSFYRALIAELVATFLFLY  47



>gb|EAZ23886.1| hypothetical protein OsJ_07605 [Oryza sativa Japonica Group]
Length=280

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + S KDY +PPPA L+D++EL KWS YRAVIAEF+ATLLFLY
Sbjct  14   EFSAKDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLY  55



>ref|XP_002306187.1| membrane intrinsic family protein [Populus trichocarpa]
 gb|ABK95359.1| unknown [Populus trichocarpa]
 gb|EEE86698.1| membrane intrinsic family protein [Populus trichocarpa]
Length=279

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA LLD+ ELK WSFYRA+IAEF+ATLLFLY
Sbjct  14   KDYVDPPPAPLLDLGELKLWSFYRALIAEFIATLLFLY  51



>gb|KCW49751.1| hypothetical protein EUGRSUZ_K03244 [Eucalyptus grandis]
Length=258

 Score = 70.9 bits (172),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDY +PPPA L+D +EL KWSFYRAVIAEFVATLLFLY
Sbjct  18   KDYRDPPPAPLVDAEELVKWSFYRAVIAEFVATLLFLY  55



>gb|AFO63679.1| plasma intrinsic protein 2 [Eriobotrya japonica]
Length=281

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S  +   G+     KDY +PPPA L+D DEL++WSFYRA IAEFVATLLFLY
Sbjct  2    SKEVSEEGQAHHHGKDYADPPPAPLIDFDELRRWSFYRAPIAEFVATLLFLY  53



>ref|NP_001047491.1| Os02g0629200 [Oryza sativa Japonica Group]
 sp|Q6K215.1|PIP22_ORYSJ RecName: Full=Probable aquaporin PIP2-2; AltName: Full=OsPIP2;2; 
AltName: Full=Plasma membrane intrinsic protein 2-2 [Oryza 
sativa Japonica Group]
 dbj|BAD23735.1| putative plasma membrane integral protein [Oryza sativa Japonica 
Group]
 dbj|BAF09405.1| Os02g0629200 [Oryza sativa Japonica Group]
 dbj|BAG88109.1| unnamed protein product [Oryza sativa Japonica Group]
Length=288

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + S KDY +PPPA L+D++EL KWS YRAVIAEF+ATLLFLY
Sbjct  14   EFSAKDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLY  55



>ref|XP_002521292.1| Aquaporin PIP2.7, putative [Ricinus communis]
 emb|CAE53883.1| aquaporin [Ricinus communis]
 gb|EEF41148.1| Aquaporin PIP2.7, putative [Ricinus communis]
Length=280

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA L+DM ELK WSFYRA+IAEF+ATLLFLY
Sbjct  15   KDYVDPPPAPLVDMAELKLWSFYRALIAEFIATLLFLY  52



>gb|EAZ39657.1| hypothetical protein OsJ_24085 [Oryza sativa Japonica Group]
Length=321

 Score = 71.6 bits (174),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 4/50 (8%)
 Frame = +1

Query  103  SILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S L AG      +DY++PPPA L+D+DEL KWS YRA+IAEFVATLLFLY
Sbjct  8    STLEAG----GARDYIDPPPAPLVDVDELGKWSLYRALIAEFVATLLFLY  53



>ref|XP_002884019.1| PIP2_8/PIP3B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60278.1| PIP2_8/PIP3B [Arabidopsis lyrata subsp. lyrata]
Length=278

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA LLDM E+K WSFYRA+IAEF+ATLLFLY
Sbjct  13   KDYVDPPPAPLLDMAEIKLWSFYRAIIAEFIATLLFLY  50



>gb|ACA35273.1| aquaporin [Cucumis sativus]
Length=124

 Score = 69.3 bits (168),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            ++ I   G    S KDY +P PA ++DM+EL KWSFYRA+IAEFVATLLFLY
Sbjct  3    TSDIEIGGRGAASRKDYFDPLPAPMIDMEELGKWSFYRAIIAEFVATLLFLY  54



>ref|XP_008791536.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=288

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +1

Query  115  AGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            AG    + KDY +PPPA L+D +EL KWS YRAVIAEFVATLLFLY
Sbjct  7    AGAAGFTAKDYTDPPPAPLIDAEELTKWSLYRAVIAEFVATLLFLY  52



>gb|EAY86778.1| hypothetical protein OsI_08158 [Oryza sativa Indica Group]
Length=288

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + S KDY +PPPA L+D++EL KWS YRAVIAEF+ATLLFLY
Sbjct  14   EFSAKDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLY  55



>gb|AAW80918.1| putative plasma membrane intrinsic protein [Astragalus membranaceus]
Length=283

 Score = 71.2 bits (173),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + S KDY +PPPA L+DM EL  WSFYRA+IAEF+ATLLFLY
Sbjct  12   EFSAKDYTDPPPAPLIDMAELASWSFYRAIIAEFIATLLFLY  53



>ref|XP_008363507.1| PREDICTED: aquaporin PIP2-2 [Malus domestica]
Length=281

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + +TKDY +PPP  L D +EL KWSFYRAVIAEFVATLLFLY
Sbjct  12   EFATKDYQDPPPTPLFDAEELTKWSFYRAVIAEFVATLLFLY  53



>ref|XP_010529747.1| PREDICTED: aquaporin PIP2-2-like [Tarenaya hassleriana]
Length=288

 Score = 71.2 bits (173),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 38/46 (83%), Gaps = 1/46 (2%)
 Frame = +1

Query  115  AGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            AGE     +DY +PPPAAL+D +EL +WSFYRAVIAEF+ATLLFLY
Sbjct  10   AGE-GFPARDYTDPPPAALVDAEELTRWSFYRAVIAEFIATLLFLY  54



>tpg|DAA33865.1| TPA_inf: aquaporin PIP2;10 [Gossypium hirsutum]
Length=271

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +1

Query  115  AGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
             G  + S KDY +PPPA L+D++EL KWS YRA IAEF+ATLLFLY
Sbjct  12   GGGAEFSAKDYQDPPPAPLIDLEELTKWSLYRAAIAEFIATLLFLY  57



>ref|XP_002869108.1| hypothetical protein ARALYDRAFT_491143 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45367.1| hypothetical protein ARALYDRAFT_491143 [Arabidopsis lyrata subsp. 
lyrata]
Length=280

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA   DM ELK WSFYRA+IAEF+ATLLFLY
Sbjct  15   KDYVDPPPAPFFDMGELKSWSFYRALIAEFIATLLFLY  52



>ref|XP_008449250.1| PREDICTED: aquaporin PIP2-1-like [Cucumis melo]
Length=279

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + + KDY +PPPA L+D DE  +WSFYRA+IAEFVATLLFLY
Sbjct  8    RSNVKDYQDPPPAPLIDSDEFSQWSFYRAIIAEFVATLLFLY  49



>gb|AEO13898.1| aquaporin 7 [Triticum aestivum]
Length=286

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + STKDY +PPPA ++D +EL KWS YRAVIAEFVATLLFLY
Sbjct  13   EFSTKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLY  54



>gb|ACM50914.1| aquaporin [Medicago falcata]
Length=287

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + + KDY +PPPA L D DEL KWS YRAVIAEFVATLLFLY
Sbjct  13   EFTAKDYQDPPPAPLFDTDELTKWSLYRAVIAEFVATLLFLY  54



>gb|ACU00102.1| plasma membrane intrinsic protein PIP2.6 [Populus trichocarpa 
x Populus deltoides]
Length=279

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA LLD+ ELK WSFYRA+IAEF+ATLLFLY
Sbjct  14   KDYVDPPPAPLLDLGELKLWSFYRALIAEFIATLLFLY  51



>ref|XP_002866389.1| hypothetical protein ARALYDRAFT_919301 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42648.1| hypothetical protein ARALYDRAFT_919301 [Arabidopsis lyrata subsp. 
lyrata]
Length=285

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + +DY +PPPA LLDM+E++KWS YRAVIAEFVATLLFLY
Sbjct  14   AARDYRDPPPAPLLDMEEIRKWSLYRAVIAEFVATLLFLY  53



>ref|XP_010266854.1| PREDICTED: probable aquaporin PIP2-8 [Nelumbo nucifera]
Length=280

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA LLD  ELK WSFYRA+IAEFVATLLFLY
Sbjct  15   KDYVDPPPAPLLDFGELKLWSFYRALIAEFVATLLFLY  52



>ref|XP_010516059.1| PREDICTED: probable aquaporin PIP2-8 [Camelina sativa]
Length=278

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA LLD+ ELK WSFYRA+IAEF+ATLLFLY
Sbjct  13   KDYVDPPPAPLLDIAELKLWSFYRAIIAEFIATLLFLY  50



>dbj|BAD90697.1| plasma membrane intrinsic protein 2;1 [Mimosa pudica]
Length=287

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S KDY EPPPA L+D +EL KW+FYRAVIAEFVATLLFLY
Sbjct  14   SAKDYHEPPPAPLIDPEELGKWAFYRAVIAEFVATLLFLY  53



>dbj|BAD90701.1| plasma membrane intrinsic protein 2;5 [Mimosa pudica]
Length=281

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S  +   G+ +   KDYV+PPPA L+DM EL+ W+FYRA+IAEF+ATLLFLY
Sbjct  2    SKEVSEEGQTQHHGKDYVDPPPAPLIDMAELRLWAFYRALIAEFIATLLFLY  53



>ref|NP_001233846.1| putative PIP-type aquaporin [Solanum lycopersicum]
 gb|ADP23920.1| putative PIP-type aquaporin [Solanum lycopersicum]
Length=283

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S  ++  G+      DYV+PPPA LLDM EL KWSFYRA+IAEF+AT LFLY
Sbjct  2    SKDVIEEGQAHHHGSDYVDPPPAPLLDMAELTKWSFYRALIAEFIATPLFLY  53



>ref|NP_181434.1| plasma membrane intrinsic protein 2E [Arabidopsis thaliana]
 sp|Q9ZV07.1|PIP26_ARATH RecName: Full=Probable aquaporin PIP2-6; AltName: Full=Plasma 
membrane intrinsic protein 2-6; Short=AtPIP2;6; AltName: Full=Plasma 
membrane intrinsic protein 2e; Short=PIP2e; Contains: 
RecName: Full=Probable aquaporin PIP2-6, N-terminally processed 
[Arabidopsis thaliana]
 gb|AAC79629.1| putative aquaporin (water channel protein) [Arabidopsis thaliana]
 gb|AAK74048.1| At2g39010/T7F6.18 [Arabidopsis thaliana]
 gb|AAL06803.1| At2g39010/T7F6.18 [Arabidopsis thaliana]
 gb|AAL09798.1| At2g39010/T7F6.18 [Arabidopsis thaliana]
 gb|AEC09626.1| plasma membrane intrinsic protein 2E [Arabidopsis thaliana]
Length=289

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  121  ELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            E  +S KDY++PPP    ++ ELKKWSFYRAVIAEF+ATLLFLY
Sbjct  9    EESLSGKDYLDPPPVKTFEVRELKKWSFYRAVIAEFIATLLFLY  52



>ref|XP_004137971.1| PREDICTED: probable aquaporin PIP2-4-like [Cucumis sativus]
 gb|KGN58957.1| hypothetical protein Csa_3G739030 [Cucumis sativus]
Length=290

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            ++ I   G    S KDY +P PA ++DM+EL KWSFYRA+IAEFVATLLFLY
Sbjct  3    TSDIEIGGRGAASRKDYFDPLPAPMIDMEELGKWSFYRAIIAEFVATLLFLY  54



>gb|ABC69040.1| aquaporin PIP2-1 [Rhododendron catawbiense]
Length=281

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 34/52 (65%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S  +  A +   S KDY +PPPA L+DM+EL KWSFYRAVIAEF+ATLLFLY
Sbjct  2    SKDVEVAEQPAYSAKDYHDPPPARLIDMEELIKWSFYRAVIAEFIATLLFLY  53



>ref|XP_004289073.1| PREDICTED: aquaporin PIP2-7-like [Fragaria vesca subsp. vesca]
Length=315

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYVEPPP  LL++ EL++WSFYRAVIAEFVATLLFLY
Sbjct  19   KDYVEPPPVPLLELGELQRWSFYRAVIAEFVATLLFLY  56



>emb|CAH60720.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=279

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA L DM ELK WSF+RA+IAEF+ATLLFLY
Sbjct  14   KDYVDPPPAPLFDMGELKLWSFFRALIAEFIATLLFLY  51



>ref|XP_004956116.1| PREDICTED: aquaporin PIP2-6-like [Setaria italica]
Length=286

 Score = 70.9 bits (172),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 4/50 (8%)
 Frame = +1

Query  103  SILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S L AG      +DY +PPPA L+D+DEL KWS YRAVIAEFVATLLFLY
Sbjct  8    STLEAG----GARDYADPPPAPLVDIDELGKWSLYRAVIAEFVATLLFLY  53



>ref|XP_004164389.1| PREDICTED: LOW QUALITY PROTEIN: probable aquaporin PIP2-4-like 
[Cucumis sativus]
Length=290

 Score = 70.9 bits (172),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            ++ I   G    S KDY +P PA ++DM+EL KWSFYRA+IAEFVATLLFLY
Sbjct  3    TSDIEIGGRGXASRKDYFDPLPAPMIDMEELGKWSFYRAIIAEFVATLLFLY  54



>emb|CDP21564.1| unnamed protein product [Coffea canephora]
Length=277

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA LLD  ELK WSFYRA+IAEFVATLLFLY
Sbjct  15   KDYVDPPPAPLLDFAELKLWSFYRALIAEFVATLLFLY  52



>gb|KHG20375.1| putative aquaporin PIP2-5 -like protein [Gossypium arboreum]
Length=282

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            +DYV+PPPA L+D  ELKKWSFYRA+IAEF+AT+LFLY
Sbjct  13   RDYVDPPPAPLIDASELKKWSFYRALIAEFIATMLFLY  50



>ref|XP_009782764.1| PREDICTED: aquaporin PIP2-7 [Nicotiana sylvestris]
 tpg|DAA64682.1| TPA_exp: aquaporin PIP2 7a [Nicotiana tabacum]
Length=284

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA LLD  ELK WSFYRA+IAEF+ATLLFLY
Sbjct  17   KDYVDPPPAPLLDFAELKLWSFYRALIAEFIATLLFLY  54



>ref|XP_002461936.1| hypothetical protein SORBIDRAFT_02g010830 [Sorghum bicolor]
 gb|EER98457.1| hypothetical protein SORBIDRAFT_02g010830 [Sorghum bicolor]
Length=286

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 4/50 (8%)
 Frame = +1

Query  103  SILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S L AG      +DY +PPPA L+D+DEL KWS YRAVIAEFVATLLFLY
Sbjct  8    STLEAG----GVRDYADPPPAPLIDIDELGKWSLYRAVIAEFVATLLFLY  53



>ref|NP_001105027.1| aquaporin PIP2-6 [Zea mays]
 sp|Q9ATM5.1|PIP26_MAIZE RecName: Full=Aquaporin PIP2-6; AltName: Full=Plasma membrane 
intrinsic protein 2-6; AltName: Full=ZmPIP2-6; AltName: Full=ZmPIP2;6 
[Zea mays]
 gb|AAK26762.1| plasma membrane integral protein ZmPIP2-6 [Zea mays]
 gb|ACF84935.1| unknown [Zea mays]
 gb|ACG36207.1| aquaporin PIP2.4 [Zea mays]
 tpg|DAA60477.1| TPA: LOW QUALITY PROTEIN: plasma membrane intrinsic protein2 
[Zea mays]
Length=288

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 2/50 (4%)
 Frame = +1

Query  103  SILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S L AG ++   +DY +PPPA L+D+DEL KWS YRAVIAEFVATLLFLY
Sbjct  8    STLEAGGVR--DRDYADPPPAPLIDIDELGKWSLYRAVIAEFVATLLFLY  55



>gb|EYU36189.1| hypothetical protein MIMGU_mgv1a011437mg [Erythranthe guttata]
Length=282

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + + KDY +PPPA L+D DEL KWSFYRA+IAEF+ATLLFLY
Sbjct  13   EFAAKDYHDPPPAPLIDYDELTKWSFYRALIAEFIATLLFLY  54



>ref|XP_006422583.1| hypothetical protein CICLE_v10029003mg [Citrus clementina]
 gb|ESR35823.1| hypothetical protein CICLE_v10029003mg [Citrus clementina]
 gb|KDO68092.1| hypothetical protein CISIN_1g023370mg [Citrus sinensis]
Length=204

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA L+DM ELK WSFYRA+IAEFVATLLFLY
Sbjct  18   KDYVDPPPAPLIDMAELKLWSFYRALIAEFVATLLFLY  55



>ref|XP_011015478.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + S KDY +PPPA L+D +E+ +WSFYRA+IAEFVATLLFLY
Sbjct  10   EFSAKDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLY  51



>ref|XP_010920407.1| PREDICTED: probable aquaporin PIP2-2 [Elaeis guineensis]
Length=287

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + + KDY +PPPAAL+D +E+ KWS YRAVIAEF+ATLLFLY
Sbjct  13   EFTAKDYTDPPPAALIDAEEMIKWSLYRAVIAEFIATLLFLY  54



>gb|EMT09900.1| Putative aquaporin PIP2-2 [Aegilops tauschii]
Length=315

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + STKDY +PPPA ++D +EL KWS YRAVIAEFVATLLFLY
Sbjct  13   EFSTKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLY  54



>ref|XP_009120600.1| PREDICTED: LOW QUALITY PROTEIN: probable aquaporin PIP2-4 [Brassica 
rapa]
Length=285

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + +DYV+PPPA LLDM+E  KWS YRAVIAEFV TLLFLY
Sbjct  14   AARDYVDPPPAPLLDMEEFGKWSLYRAVIAEFVXTLLFLY  53



>ref|XP_006428786.1| hypothetical protein CICLE_v10012379mg [Citrus clementina]
 gb|ESR42026.1| hypothetical protein CICLE_v10012379mg [Citrus clementina]
Length=287

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            +  I   G+ +   KDY +PPPA L+D +EL KWSFYRA+IAEF+ATLLFLY
Sbjct  2    AKDIEVGGQGEFHAKDYHDPPPAPLIDAEELTKWSFYRAIIAEFIATLLFLY  53



>tpg|DAA64687.1| TPA_exp: aquaporin PIP2 10 [Nicotiana tabacum]
Length=283

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  121  ELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            E   +TKDY +PPPA L+D +EL +WSFYRA+IAEF+ATLLFLY
Sbjct  8    EGSFTTKDYQDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLY  51



>ref|XP_008670063.1| PREDICTED: aquaporin PIP2-6-like [Zea mays]
 tpg|DAA39701.1| TPA: hypothetical protein ZEAMMB73_098286 [Zea mays]
Length=286

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 4/50 (8%)
 Frame = +1

Query  103  SILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S L AG      +DY +PPPA L+D+DEL KWS YRAVIAEFVATLLFLY
Sbjct  8    STLEAG----GVRDYADPPPAPLIDVDELGKWSLYRAVIAEFVATLLFLY  53



>ref|XP_009780961.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana sylvestris]
Length=268

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  136  TKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            T+DYV+PP A L DM ELKKWSFYRA+IAEFVAT LFLY
Sbjct  2    TRDYVDPPAAPLFDMAELKKWSFYRALIAEFVATFLFLY  40



>ref|XP_008442677.1| PREDICTED: probable aquaporin PIP2-4 [Cucumis melo]
Length=289

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S+ I   G    S KDY +P PA ++DM+E  KWSFYRA+IAEFVATLLFLY
Sbjct  3    SSDIEIGGRGAASRKDYFDPLPAPMIDMEEFAKWSFYRAIIAEFVATLLFLY  54



>ref|XP_009593453.1| PREDICTED: aquaporin PIP2-2-like [Nicotiana tomentosiformis]
Length=283

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  121  ELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            E   +TKDY +PPPA L+D +EL +WSFYRA+IAEF+ATLLFLY
Sbjct  8    EGSFTTKDYQDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLY  51



>ref|XP_010689549.1| PREDICTED: aquaporin PIP2-1-like [Beta vulgaris subsp. vulgaris]
Length=274

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  142  DYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            DY +PPPA L+DM+ELKKW FYRA+IAEFVATLLFLY
Sbjct  20   DYHDPPPAPLIDMEELKKWPFYRAIIAEFVATLLFLY  56



>gb|ACU87556.1| PIP protein [Gossypium hirsutum]
Length=278

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +1

Query  121  ELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            E  +S KDYV+PPPA L+D+ E+K WSFYRA+IAEF+ATLLFLY
Sbjct  7    EEGVSRKDYVDPPPAPLIDVAEIKLWSFYRALIAEFIATLLFLY  50



>ref|XP_006648854.1| PREDICTED: probable aquaporin PIP2-2-like [Oryza brachyantha]
Length=262

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + S KDY +PPPA L+D++EL KWS YRAVIAEF+ATLLFLY
Sbjct  14   EFSAKDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLY  55



>ref|XP_006384579.1| hypothetical protein POPTR_0004s18240g [Populus trichocarpa]
 gb|ERP62376.1| hypothetical protein POPTR_0004s18240g [Populus trichocarpa]
Length=201

 Score = 69.7 bits (169),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA LLD+ ELK WSFYRA+IAEF+ATLLFLY
Sbjct  14   KDYVDPPPAPLLDLGELKLWSFYRALIAEFIATLLFLY  51



>gb|KHF98939.1| putative aquaporin PIP2-8 -like protein [Gossypium arboreum]
Length=278

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +1

Query  121  ELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            E  +S KDYV+PPPA L+D+ E+K WSFYRA+IAEF+ATLLFLY
Sbjct  7    EEGVSRKDYVDPPPAPLIDVAEIKLWSFYRALIAEFIATLLFLY  50



>ref|XP_006846905.1| hypothetical protein AMTR_s00152p00041700 [Amborella trichopoda]
 gb|ERN08486.1| hypothetical protein AMTR_s00152p00041700 [Amborella trichopoda]
Length=280

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDY +PPPA LLDM ELK WSFYRA+IAEF+ATLLFLY
Sbjct  15   KDYQDPPPAPLLDMGELKLWSFYRALIAEFIATLLFLY  52



>ref|XP_009772697.1| PREDICTED: aquaporin PIP2-2-like [Nicotiana sylvestris]
Length=283

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  121  ELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            E   +TKDY +PPPA L+D +EL +WSFYRA+IAEF+ATLLFLY
Sbjct  8    EGSFTTKDYQDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLY  51



>ref|NP_001059542.1| Os07g0448100 [Oryza sativa Japonica Group]
 sp|Q8GRT8.1|PIP24_ORYSJ RecName: Full=Aquaporin PIP2-4; AltName: Full=OsPIP2;4; AltName: 
Full=Plasma membrane intrinsic protein 2-4 [Oryza sativa 
Japonica Group]
 dbj|BAC15860.1| putative plasma membrane integral protein [Oryza sativa Japonica 
Group]
 dbj|BAC16113.1| putative plasma membrane integral protein [Oryza sativa Japonica 
Group]
 dbj|BAF21456.1| Os07g0448100 [Oryza sativa Japonica Group]
 dbj|BAG93070.1| unnamed protein product [Oryza sativa Japonica Group]
Length=286

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 4/50 (8%)
 Frame = +1

Query  103  SILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S L AG      +DY++PPPA L+D+DEL KWS YRA+IAEFVATLLFLY
Sbjct  8    STLEAG----GARDYIDPPPAPLVDVDELGKWSLYRALIAEFVATLLFLY  53



>gb|EAZ03711.1| hypothetical protein OsI_25843 [Oryza sativa Indica Group]
Length=286

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 4/50 (8%)
 Frame = +1

Query  103  SILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S L AG      +DY++PPPA L+D+DEL KWS YRA+IAEFVATLLFLY
Sbjct  8    STLEAG----GARDYIDPPPAPLVDVDELGKWSLYRALIAEFVATLLFLY  53



>ref|XP_006280883.1| hypothetical protein CARUB_v10026881mg, partial [Capsella rubella]
 gb|EOA13781.1| hypothetical protein CARUB_v10026881mg, partial [Capsella rubella]
Length=297

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + +DY +PPPA LLDM+EL KWS YRAVIAEFVATLLFLY
Sbjct  26   AARDYKDPPPAPLLDMEELGKWSLYRAVIAEFVATLLFLY  65



>gb|EPS67285.1| hypothetical protein M569_07488, partial [Genlisea aurea]
Length=279

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA L D++EL++WSFYRAVIAEF ATL+FLY
Sbjct  15   KDYVDPPPAPLYDVEELRRWSFYRAVIAEFFATLIFLY  52



>ref|XP_006846005.1| hypothetical protein AMTR_s00155p00061840 [Amborella trichopoda]
 gb|ERN07680.1| hypothetical protein AMTR_s00155p00061840 [Amborella trichopoda]
Length=285

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  130  MSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            ++ KDY EPPPA L+D++EL KWS YRA+IAEFVATLLFLY
Sbjct  15   VAAKDYTEPPPAPLIDIEELGKWSLYRALIAEFVATLLFLY  55



>gb|AIA83106.1| putative aquaporin PIP2 [Citrus trifoliata]
Length=292

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + S KDY + PPA L+D DEL KWSFYRAVIAEF+ATLLFLY
Sbjct  19   EFSAKDYHDSPPAPLIDFDELGKWSFYRAVIAEFIATLLFLY  60



>gb|AAO39007.1| plasma intrinsic protein 2,1 [Juglans regia]
Length=287

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +1

Query  115  AGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            AG+   S KDY +PPPA L+D +E  +WSFYRA+IAEF+ATLLFLY
Sbjct  8    AGQGGFSAKDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLY  53



>ref|XP_002312952.1| hypothetical protein POPTR_0009s13890g [Populus trichocarpa]
 gb|ABK94564.1| unknown [Populus trichocarpa]
 gb|EEE86907.1| hypothetical protein POPTR_0009s13890g [Populus trichocarpa]
Length=279

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  121  ELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            E +  TKDYV+PPPA L D+ ELK WSF+RA+IAEF+ATLLFLY
Sbjct  8    EGQTHTKDYVDPPPAPLFDVGELKLWSFFRALIAEFIATLLFLY  51



>ref|XP_010690355.1| PREDICTED: aquaporin PIP-type [Beta vulgaris subsp. vulgaris]
Length=281

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA L DM ELK WSF+RAVIAEF+ATLLFLY
Sbjct  16   KDYVDPPPAPLFDMGELKLWSFWRAVIAEFIATLLFLY  53



>ref|XP_006657662.1| PREDICTED: LOW QUALITY PROTEIN: aquaporin PIP2-4-like [Oryza 
brachyantha]
Length=284

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 4/50 (8%)
 Frame = +1

Query  103  SILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S L AG      +DY++PPPA L+D+DEL KWS YRA+IAEFVATLLFLY
Sbjct  8    STLEAG----GARDYIDPPPAPLVDVDELGKWSLYRALIAEFVATLLFLY  53



>gb|ABM54183.1| aquaporin [Jatropha curcas]
 gb|KDP29674.1| hypothetical protein JCGZ_18836 [Jatropha curcas]
Length=280

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA L+DM E+K WSFYRA+IAEF+ATLLFLY
Sbjct  15   KDYVDPPPAPLIDMAEIKLWSFYRALIAEFIATLLFLY  52



>gb|ABB13430.2| plasma membrane intrinsic protein [Olea europaea]
Length=287

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S KDY +PPPA L+D DEL  WSFYRA+IAEFVATLLFLY
Sbjct  16   SAKDYHDPPPAPLIDFDELSSWSFYRALIAEFVATLLFLY  55



>ref|XP_009367074.1| PREDICTED: aquaporin PIP2-2 [Pyrus x bretschneideri]
Length=288

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + +TKDY +PPP  L D +EL KWSFYRAVIAEF+ATLLFLY
Sbjct  12   EFATKDYQDPPPTPLFDAEELTKWSFYRAVIAEFIATLLFLY  53



>gb|KCW88816.1| hypothetical protein EUGRSUZ_A01153 [Eucalyptus grandis]
Length=325

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +1

Query  115  AGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
             G     +KDY +PPPA L+D +EL +WSFYRA+IAEF+ATLLFLY
Sbjct  79   GGHGSFQSKDYQDPPPAPLVDAEELGQWSFYRAIIAEFIATLLFLY  124



>ref|XP_010046653.1| PREDICTED: aquaporin PIP2-1-like [Eucalyptus grandis]
Length=286

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +1

Query  115  AGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
             G     +KDY +PPPA L+D +EL +WSFYRA+IAEF+ATLLFLY
Sbjct  9    GGHGSFQSKDYQDPPPAPLVDAEELGQWSFYRAIIAEFIATLLFLY  54



>ref|XP_003606384.1| Aquaporin PIP2-7 [Medicago truncatula]
 gb|AES88581.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=204

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S KDY +PPPA L+D++EL KWSFYRA+IAEFVATLLFLY
Sbjct  14   SAKDYQDPPPAPLIDVEELTKWSFYRALIAEFVATLLFLY  53



>gb|AHG32324.1| PIP2-3 [Pisum sativum]
Length=287

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S KDY +PPPA L+D +EL KWSFYRA+IAEF+ATLLFLY
Sbjct  14   SNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLY  53



>ref|XP_006367007.1| PREDICTED: aquaporin PIP2-1-like isoform X1 [Solanum tuberosum]
Length=287

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + KDY +PPPA L+D +EL KWSFYRA+IAEF+ATLLFLY
Sbjct  12   APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY  51



>ref|XP_003536353.1| PREDICTED: aquaporin PIP2-1-like isoform 1 [Glycine max]
 gb|KHN17135.1| Aquaporin PIP2-2 [Glycine soja]
Length=287

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S KDY +PPPA L+D +EL KWSFYRA+IAEF+ATLLFLY
Sbjct  14   SGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLY  53



>ref|XP_003563179.1| PREDICTED: aquaporin PIP2-6 [Brachypodium distachyon]
Length=289

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            +DY +PPPA L+D+DEL KWS YRAVIAEFVATLLFLY
Sbjct  17   RDYSDPPPAPLIDIDELGKWSLYRAVIAEFVATLLFLY  54



>gb|ACB87734.1| aquaporin [Manihot esculenta]
Length=280

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA L+DM E+K WSFYRA+IAEF+ATLLFLY
Sbjct  15   KDYVDPPPAPLIDMAEIKLWSFYRALIAEFIATLLFLY  52



>ref|XP_010028741.1| PREDICTED: uncharacterized protein LOC104418957 [Eucalyptus grandis]
Length=694

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA LLDM ELK WSFYRA+IAEF+ATLLFLY
Sbjct  429  KDYVDPPPAPLLDMGELKLWSFYRALIAEFIATLLFLY  466



>gb|AAB67869.1| plasma membrane major intrinsic protein 2 [Beta vulgaris]
Length=281

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA L DM ELK WSF+RAVIAEF+ATLLFLY
Sbjct  16   KDYVDPPPAPLFDMGELKLWSFWRAVIAEFIATLLFLY  53



>gb|ACR56614.1| plasma intrinsic protein 2;4 [Juglans regia]
Length=280

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S  +   G      KDYV+PPPA L+D+ ELK WSFYRA+IAEF+ATLLFLY
Sbjct  2    SKEVTEEGHSHQHGKDYVDPPPAPLIDLAELKLWSFYRALIAEFIATLLFLY  53



>gb|AEQ29857.1| aquaporin PIP2 [Malus prunifolia]
Length=281

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + ++KDY +PPP  L D +EL KWSFYRAVIAEFVATLLFLY
Sbjct  12   EFASKDYQDPPPTPLFDAEELTKWSFYRAVIAEFVATLLFLY  53



>gb|ABK60196.1| PIP2 protein [Gossypium hirsutum]
Length=286

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            +   KDY +PPPA L+D  EL KWSFYRAVIAEF+ATLLFLY
Sbjct  10   EFQAKDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLLFLY  51



>ref|XP_007027328.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
 gb|EOY07830.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
Length=283

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            +   KDY +PPPA L+D +EL KWSFYRA+IAEF+ATLLFLY
Sbjct  10   QFQAKDYHDPPPAPLVDAEELTKWSFYRAIIAEFIATLLFLY  51



>ref|NP_001268058.1| aquaporin-like [Vitis vinifera]
 gb|ABN14352.1| aquaporin PIP2;3 [Vitis vinifera]
 emb|CAN77241.1| hypothetical protein VITISV_029527 [Vitis vinifera]
 gb|AIK66516.1| putative aquaporin [Vitis vinifera]
Length=287

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            +  I  AG   ++ KDY +PPPA L+D +EL  WSFYRA+IAEFVATLLFLY
Sbjct  2    AKDIEVAGHGDLTLKDYHDPPPAPLVDPEELGSWSFYRAIIAEFVATLLFLY  53



>ref|NP_001235204.1| Pip1 protein [Glycine max]
 gb|AAA69490.1| putative water channel protein; plasmalemma intrinsic protein; 
similar to Arabidopsis Pip2a gene product, PIR Accession Number 
S44084 [Glycine max]
Length=285

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S KDY +PPPA L+D +EL +WSFYRA+IAEF+ATLLFLY
Sbjct  12   SAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATLLFLY  51



>ref|NP_001275065.1| major intrinsic protein 2 [Solanum tuberosum]
 gb|ABB29939.1| major intrinsic protein 2-like [Solanum tuberosum]
 emb|CBI99236.1| major intrinsic protein 2 [Solanum tuberosum]
Length=287

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S KDY +PPPA L+D +EL KWS YRAVIAEF+ATLLFLY
Sbjct  16   SAKDYTDPPPAPLIDFEELTKWSLYRAVIAEFIATLLFLY  55



>gb|AAO39008.1| plasma intrinsic protein 2,2 [Juglans regia]
Length=287

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +1

Query  115  AGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            AG+   S KDY +PPPA L+D +E  +WSFYRA+IAEF+ATLLFLY
Sbjct  8    AGQGGFSAKDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLY  53



>gb|AGD98714.1| aquaporin protein 11 [Camellia sinensis]
Length=287

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  121  ELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            E + S KDY +PPPA L+D  EL KWSFYRA+IAEF+ATLLFLY
Sbjct  12   EQEFSAKDYHDPPPAPLVDAVELTKWSFYRAIIAEFIATLLFLY  55



>gb|KDP23969.1| hypothetical protein JCGZ_25357 [Jatropha curcas]
Length=283

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA LLD++EL KWSFYRAVIAE VATL+FL+
Sbjct  16   KDYVDPPPAPLLDIEELTKWSFYRAVIAELVATLIFLF  53



>ref|XP_006294722.1| hypothetical protein CARUB_v10023768mg [Capsella rubella]
 gb|EOA27620.1| hypothetical protein CARUB_v10023768mg [Capsella rubella]
Length=290

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S KDY++PPP    +M ELKKWSFYRAVIAEF+ATLLFLY
Sbjct  14   SGKDYLDPPPVKTFEMRELKKWSFYRAVIAEFIATLLFLY  53



>ref|XP_010489282.1| PREDICTED: probable aquaporin PIP2-8 [Camelina sativa]
Length=278

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA LLDM ELK WSFYRA+IA F+ATLLFLY
Sbjct  13   KDYVDPPPAPLLDMAELKLWSFYRAIIAVFIATLLFLY  50



>dbj|BAE02729.1| PIP aquaporin [Hordeum vulgare]
Length=286

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + S+KDY +PPPA ++D +EL KWS YRAVIAEFVATLLFLY
Sbjct  13   EFSSKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLY  54



>dbj|BAA23744.1| HvPIP2;1 [Hordeum vulgare subsp. vulgare]
Length=286

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + S+KDY +PPPA ++D +EL KWS YRAVIAEFVATLLFLY
Sbjct  13   EFSSKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLY  54



>gb|EMT03221.1| hypothetical protein F775_43871 [Aegilops tauschii]
Length=286

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            +DY +PPPA L+D+DEL KWS YRAVIAEFVATLLFLY
Sbjct  16   RDYSDPPPAPLVDVDELGKWSLYRAVIAEFVATLLFLY  53



>gb|EYU39575.1| hypothetical protein MIMGU_mgv1a011441mg [Erythranthe guttata]
Length=281

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDY +PPPA L+D +EL KWSFYRAVIAEF+ATLLFLY
Sbjct  14   KDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLY  51



>gb|ACU00104.1| plasma membrane intrinsic protein PIP2.2 [Populus trichocarpa 
x Populus deltoides]
Length=285

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + S KDY +PPPA L+D +E+ +WSFYRA+IAEFVATLLFLY
Sbjct  10   EFSAKDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLY  51



>gb|AHB33482.1| plasma intrinsic protein 2-6 [Cucumis sativus]
Length=279

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + + KDY +PPPA  +D DE  +WSFYRA+IAEFVATLLFLY
Sbjct  8    RSNVKDYQDPPPAPFIDSDEFTQWSFYRAIIAEFVATLLFLY  49



>gb|ACZ06859.1| plasma membrane intrinsic protein [Glycine soja]
Length=284

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S KDY +PPPA L+D +EL KWSFYRA+IAEF+ATLLFLY
Sbjct  14   SGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLY  53



>ref|XP_003556232.1| PREDICTED: aquaporin PIP2-1-like [Glycine max]
 gb|KHN00839.1| Putative aquaporin PIP2-5 [Glycine soja]
Length=284

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S KDY +PPPA L+D +EL KWSFYRA+IAEF+ATLLFLY
Sbjct  14   SGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLY  53



>ref|XP_006367014.1| PREDICTED: aquaporin PIP2-1-like, partial [Solanum tuberosum]
Length=279

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + KDY +PPPA L+D +EL KWSFYRA+IAEF+ATLLFLY
Sbjct  4    APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY  43



>ref|NP_001267957.1| aquaporin PIP2;2 [Vitis vinifera]
 gb|AEZ35023.1| plasma membrane 2;2 aquaporin [Vitis vinifera]
Length=279

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA L+D+ E+K WSFYRAVIAEF+ATLLFLY
Sbjct  14   KDYVDPPPAPLIDIAEIKLWSFYRAVIAEFIATLLFLY  51



>gb|KFK36804.1| hypothetical protein AALP_AA4G173500 [Arabis alpina]
Length=295

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +1

Query  121  ELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            E  +S KDY EPPP  + +  EL KWSFYRAVIAEF+ATLLFLY
Sbjct  15   EESLSGKDYKEPPPVKIFEASELGKWSFYRAVIAEFIATLLFLY  58



>gb|ABH09327.1| putative aquaporin [Vitis vinifera]
 gb|ABN14351.1| aquaporin PIP2;2 [Vitis vinifera]
 emb|CAN77349.1| hypothetical protein VITISV_007541 [Vitis vinifera]
Length=279

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA L+D+ E+K WSFYRAVIAEF+ATLLFLY
Sbjct  14   KDYVDPPPAPLIDIAEIKLWSFYRAVIAEFIATLLFLY  51



>gb|AFB83068.1| plasma intrinsic protein PIP2.2 [Helianthemum almeriense]
Length=281

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 37/46 (80%), Gaps = 2/46 (4%)
 Frame = +1

Query  115  AGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            AGE +   KDY +PPPA L D +EL KWSFYRA+IAEF+ATLLFLY
Sbjct  8    AGEFR--AKDYHDPPPAPLFDAEELGKWSFYRAIIAEFIATLLFLY  51



>emb|CDY56697.1| BnaCnng31040D [Brassica napus]
Length=287

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  136  TKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            T+DY +PPPA L D +EL KWSFYRAVIAEFVATLLFLY
Sbjct  15   TRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLY  53



>ref|XP_007016740.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
 gb|EOY34359.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
Length=289

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + S KDY +PPPA L+D +EL KWSFYRA+IAEF+ATLLFLY
Sbjct  14   EFSAKDYHDPPPAPLIDAEELFKWSFYRALIAEFIATLLFLY  55



>gb|AGD98707.1| aquaporin protein 4 [Camellia sinensis]
Length=287

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S KDY +PPPA L+D +EL KWSFYRA+IAEF+ATLLFLY
Sbjct  14   SAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLY  53



>ref|XP_011046666.1| PREDICTED: probable aquaporin PIP2-8 [Populus euphratica]
Length=279

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA LLD  E+K WSFYRA+IAEF+ATLLFLY
Sbjct  14   KDYVDPPPAPLLDFGEIKLWSFYRALIAEFIATLLFLY  51



>ref|NP_001274308.1| aquaporin PIP2-1-like [Solanum lycopersicum]
 dbj|BAO18628.1| plasmamembrane intrinsic protein 2;5 [Solanum lycopersicum]
Length=281

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +1

Query  112  YAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            Y  +    +KDY +PPPA L+D +EL KWSFYRA+IAEF+ATLLFLY
Sbjct  7    YGNDQYAPSKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY  53



>gb|AAF71820.1|AF141900_1 putative aquaporin PIP2-2 [Vitis cinerea var. helleri x Vitis 
rupestris]
Length=279

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA L+D+ E+K WSFYRAVIAEF+ATLLFLY
Sbjct  14   KDYVDPPPAPLIDIAEIKLWSFYRAVIAEFIATLLFLY  51



>ref|XP_006403691.1| hypothetical protein EUTSA_v10010598mg [Eutrema salsugineum]
 gb|ESQ45144.1| hypothetical protein EUTSA_v10010598mg [Eutrema salsugineum]
Length=287

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  136  TKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            T+DY +PPPA L D +EL KWSFYRAVIAEFVATLLFLY
Sbjct  15   TRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLY  53



>ref|XP_002322877.1| major intrinsic protein 1 [Populus trichocarpa]
 gb|ABK93143.1| unknown [Populus trichocarpa]
 gb|ABK94547.1| unknown [Populus trichocarpa]
 gb|EEF04638.1| major intrinsic protein 1 [Populus trichocarpa]
Length=285

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + S KDY +PPPA L+D +E+ +WSFYRA+IAEFVATLLFLY
Sbjct  10   EFSAKDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLY  51



>gb|ABK22546.1| unknown [Picea sitchensis]
Length=283

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  118  GELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            GE     KDY +PPPA LLD  ELK+WSFYRA IAEFVATLLFLY
Sbjct  6    GEGIEQAKDYRDPPPAPLLDSLELKRWSFYRAAIAEFVATLLFLY  50



>ref|XP_009126591.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=283

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + +DY +PPPA L DM+EL KWS YRAVIAEFVATLLFLY
Sbjct  12   AARDYQDPPPAPLFDMEELGKWSLYRAVIAEFVATLLFLY  51



>ref|XP_007143702.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
 gb|AGV54658.1| aquaporin PIP2 [Phaseolus vulgaris]
 gb|ESW15696.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
Length=287

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S KDY +PPPA L+D +EL KWSFYRA+IAEF+ATLLFLY
Sbjct  14   SGKDYHDPPPAPLIDTEELTKWSFYRALIAEFIATLLFLY  53



>gb|AHG32323.1| PIP2-2 [Pisum sativum]
Length=287

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + S KDY +PPPA L D  E KKWS YRAVIAEFVATLLFLY
Sbjct  13   EFSAKDYQDPPPAPLFDSAEFKKWSLYRAVIAEFVATLLFLY  54



>ref|XP_010107654.1| Aquaporin PIP2-7 [Morus notabilis]
 gb|EXC16565.1| Aquaporin PIP2-7 [Morus notabilis]
Length=282

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDYV+PPPA L+D  ELK WSFYRA+IAEF+ATLLFLY
Sbjct  15   KDYVDPPPAPLIDTAELKLWSFYRALIAEFIATLLFLY  52



>gb|ACU24483.1| unknown [Glycine max]
Length=284

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S KDY +PPPA L+D +EL KWSFYRA+IAEF+ATLLFLY
Sbjct  14   SGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLY  53



>gb|EPS61960.1| hypothetical protein M569_12834, partial [Genlisea aurea]
Length=285

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/45 (71%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  118  GELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            G    + KDY EPPPAAL D DEL  WSFYRA IAEFVAT LFLY
Sbjct  21   GTAAQTDKDYREPPPAALFDPDELASWSFYRAGIAEFVATFLFLY  65



>ref|XP_010521765.1| PREDICTED: aquaporin PIP2-7-like [Tarenaya hassleriana]
Length=286

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + + KDY +PPPA L+D +EL KWSFYRA+IAEF+ATLLFLY
Sbjct  13   EFTAKDYTDPPPAPLIDPEELTKWSFYRALIAEFIATLLFLY  54



>ref|XP_004156296.1| PREDICTED: aquaporin PIP2-2-like [Cucumis sativus]
Length=284

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + KDY +PPPA L+D +EL +WSFYRA+IAEFVATLLFLY
Sbjct  11   AVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLY  50



>ref|XP_010037961.1| PREDICTED: probable aquaporin PIP2-2 [Eucalyptus grandis]
 gb|KCW49750.1| hypothetical protein EUGRSUZ_K03244 [Eucalyptus grandis]
Length=289

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDY +PPPA L+D +EL KWSFYRAVIAEFVATLLFLY
Sbjct  18   KDYRDPPPAPLVDAEELVKWSFYRAVIAEFVATLLFLY  55



>gb|AHB33479.1| plasma intrinsic protein 2-3 [Cucumis sativus]
 gb|KGN48149.1| hypothetical protein Csa_6G445140 [Cucumis sativus]
Length=284

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + KDY +PPPA L+D +EL +WSFYRA+IAEFVATLLFLY
Sbjct  11   AVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLY  50



>ref|XP_004291577.1| PREDICTED: aquaporin PIP2-2-like [Fragaria vesca subsp. vesca]
Length=281

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  127  KMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            + + KDY +PPP  L D DEL KWSFYRAVIAEF+ATLLFLY
Sbjct  12   EFAAKDYHDPPPTPLFDADELTKWSFYRAVIAEFIATLLFLY  53



>sp|P42767.1|PIP1_ATRCA RecName: Full=Aquaporin PIP-type [Atriplex canescens]
 gb|AAA86991.1| aquaporin [Atriplex canescens]
Length=282

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  118  GELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            G++    KDYV+PPPA   DM ELK WSF+RA IAEF+ATLLFLY
Sbjct  10   GQVHQHGKDYVDPPPAPFFDMGELKLWSFWRAAIAEFIATLLFLY  54



>gb|AGG39693.1| aquaporin protein AQU15 [Camellia sinensis]
 gb|AGG39694.1| aquaporin protein AQU16 [Camellia sinensis]
Length=287

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S KDY +PPPA L+D +EL KWSFYRA+IAEF+ATLLFLY
Sbjct  14   SAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLY  53



>ref|XP_002879778.1| PIP2_6/PIP2E [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56037.1| PIP2_6/PIP2E [Arabidopsis lyrata subsp. lyrata]
Length=289

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  121  ELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            E  +S KDY++PPP    ++ ELKKWSFYRAVIAEF+AT LFLY
Sbjct  9    EESLSGKDYLDPPPVKTFEVRELKKWSFYRAVIAEFIATFLFLY  52



>gb|AEY75254.1| aquaporin [Atriplex canescens]
Length=282

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  118  GELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            G++    KDYV+PPPA   DM ELK WSF+RA IAEF+ATLLFLY
Sbjct  10   GQVHQHGKDYVDPPPAPFFDMGELKLWSFWRAAIAEFIATLLFLY  54



>dbj|BAA32778.1| Plasma membrane aquaporin (PAQ2) [Raphanus sativus]
Length=287

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  136  TKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            T+DY +PPPA L D +EL KWSFYRAVIAEFVATLLFLY
Sbjct  15   TRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLY  53



>ref|XP_002519539.1| Aquaporin PIP2.2, putative [Ricinus communis]
 gb|EEF42953.1| Aquaporin PIP2.2, putative [Ricinus communis]
Length=288

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  139  KDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            KDY +PPPA L+D +EL KWSFYRA+IAEF+ATLLFLY
Sbjct  17   KDYHDPPPAPLIDAEELTKWSFYRAIIAEFIATLLFLY  54



>ref|XP_008387595.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=285

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S KDY +PPP  L+D +EL KWSFYRA+IAEF+ATLLFLY
Sbjct  12   SAKDYQDPPPEPLIDAEELGKWSFYRAIIAEFIATLLFLY  51



>gb|AAC17529.1| aquaporin 2 [Samanea saman]
Length=287

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S KDY +PPPA L+D +EL KWSFYRA+IAEF+ATLLFLY
Sbjct  14   SAKDYHDPPPAPLIDAEELGKWSFYRALIAEFIATLLFLY  53



>ref|XP_006339071.1| PREDICTED: aquaporin PIP2-1-like [Solanum tuberosum]
Length=281

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +1

Query  112  YAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            Y  +    +KDY +PPPA L+D +EL KWSFYRA+IAEF+ATLLFLY
Sbjct  7    YGNDQYAPSKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY  53



>dbj|BAD90699.1| plasma membrane intrinsic protein 2;3 [Mimosa pudica]
Length=288

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S KDY +PPPA L+D +EL KWSFYRA+IAEF+ATLLFLY
Sbjct  14   SAKDYHDPPPAPLIDAEELGKWSFYRALIAEFIATLLFLY  53



>gb|ACU23034.1| unknown [Glycine max]
Length=158

 Score = 68.2 bits (165),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  133  STKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            S KDY +PPPA L+D +EL KWSFYRA+IAEF+ATLLFLY
Sbjct  14   SGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLY  53



>ref|XP_008785285.1| PREDICTED: aquaporin PIP2-4 [Phoenix dactylifera]
Length=287

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 37/46 (80%), Gaps = 2/46 (4%)
 Frame = +1

Query  115  AGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            AGE   + KDY +PPPA L+D +EL KWS YRAVIAEF+ATLLFLY
Sbjct  11   AGEF--TAKDYTDPPPAPLIDAEELTKWSLYRAVIAEFIATLLFLY  54



>ref|XP_009614931.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
 tpg|DAA64676.1| TPA_exp: aquaporin PIP2 3b [Nicotiana tabacum]
Length=285

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +1

Query  97   SASILYAGELKMSTKDYVEPPPAALLDMDELKKWSFYRAVIAEFVATLLFLY  252
            +  I Y  +     KDY +PPPA L+D +EL KWSFYRA+IAEF+ATLLFLY
Sbjct  2    AKDIEYGTDQYAPNKDYQDPPPAPLIDAEELGKWSFYRAIIAEFIATLLFLY  53



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 509187792286