BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1255_g1_i1 len=935 path=[25:0-934]

Length=935
                                                                      Score     E

gb|KHF98939.1|  putative aquaporin PIP2-8 -like protein                 339   1e-112   
gb|AFH36336.1|  aquaporin PIP2;1                                        338   3e-112   
gb|ACB87734.1|  aquaporin                                               338   5e-112   Manihot esculenta [manioc]
gb|ACU87556.1|  PIP protein                                             338   6e-112   
ref|NP_001267957.1|  aquaporin PIP2;2                                   337   8e-112   
ref|XP_002306187.1|  membrane intrinsic family protein                  337   9e-112   Populus trichocarpa [western balsam poplar]
gb|ACU87555.1|  PIP protein                                             337   9e-112   
ref|XP_011046666.1|  PREDICTED: probable aquaporin PIP2-8               337   1e-111   
emb|CAH60721.1|  putative plasma membrane intrinsic protein             337   1e-111   Populus tremula x Populus tremuloides
ref|XP_006422584.1|  hypothetical protein CICLE_v10029003mg             337   1e-111   
gb|ABH09327.1|  putative aquaporin                                      337   1e-111   Vitis vinifera
gb|AAF71820.1|AF141900_1  putative aquaporin PIP2-2                     336   3e-111   Vitis cinerea var. helleri x Vitis rupestris
ref|XP_006412152.1|  hypothetical protein EUTSA_v10025940mg             336   4e-111   
gb|ABM54183.1|  aquaporin                                               335   4e-111   Jatropha curcas
ref|XP_008382110.1|  PREDICTED: probable aquaporin PIP2-8               335   6e-111   
ref|XP_009376943.1|  PREDICTED: probable aquaporin PIP2-8               335   6e-111   
gb|AFO63679.1|  plasma intrinsic protein 2                              335   8e-111   
gb|ACB42441.1|  aquaporin PIP2;4                                        335   8e-111   Gossypium hirsutum [American cotton]
ref|XP_007041804.1|  Plasma membrane intrinsic protein 2,8 isoform 1    334   1e-110   
emb|CDY17511.1|  BnaC03g65520D                                          334   1e-110   
ref|XP_011045923.1|  PREDICTED: probable aquaporin PIP2-8               334   2e-110   
gb|ACB42440.1|  aquaporin PIP2;3                                        334   2e-110   Gossypium hirsutum [American cotton]
gb|ACV66986.1|  plasma membrane aquaporin 2                             333   2e-110   Hevea brasiliensis [jebe]
ref|XP_004290727.1|  PREDICTED: aquaporin PIP2-7-like                   333   2e-110   
gb|AAG30607.1|AF314656_1  aquaporin                                     333   3e-110   Brassica oleracea
ref|XP_007200557.1|  hypothetical protein PRUPE_ppa009691mg             333   4e-110   
emb|CDX76314.1|  BnaA08g10860D                                          333   5e-110   
ref|XP_008236033.1|  PREDICTED: aquaporin PIP2-7                        332   7e-110   
ref|XP_010526891.1|  PREDICTED: probable aquaporin PIP2-8               332   8e-110   
tpg|DAA33864.1|  TPA: aquaporin PIP2;4                                  332   8e-110   
gb|ACB71281.1|  plasma membrane intrinsic protein                       332   1e-109   Tamarix hispida
ref|XP_002521292.1|  Aquaporin PIP2.7, putative                         332   1e-109   Ricinus communis
ref|XP_010548112.1|  PREDICTED: probable aquaporin PIP2-8               332   1e-109   
gb|ACU00102.1|  plasma membrane intrinsic protein PIP2.6                331   2e-109   Populus trichocarpa x Populus deltoides
ref|NP_195236.1|  plasma membrane intrinsic protein 3                   331   2e-109   Arabidopsis thaliana [mouse-ear cress]
gb|ACE60220.1|  plasma membrane aquaporin                               331   2e-109   Rosa hybrid cultivar
dbj|BAD90701.1|  plasma membrane intrinsic protein 2;5                  331   3e-109   Mimosa pudica [sensitive-plant]
ref|XP_006284279.1|  hypothetical protein CARUB_v10005443mg             330   4e-109   
ref|XP_010266027.1|  PREDICTED: aquaporin PIP2-7-like                   330   4e-109   
gb|ACR56615.1|  plasma intrinsic protein 2;5                            330   5e-109   Juglans regia
ref|XP_008377729.1|  PREDICTED: probable aquaporin PIP2-8               330   5e-109   
ref|XP_009105909.1|  PREDICTED: aquaporin PIP2-7                        330   7e-109   
gb|AFB83067.1|  plasma intrinsic protein PIP2.1                         329   1e-108   
emb|CDX69112.1|  BnaC01g03410D                                          329   1e-108   
gb|ADL16407.1|  aquaporin                                               329   2e-108   
gb|KFK30134.1|  hypothetical protein AALP_AA7G221400                    329   2e-108   
gb|KCW55551.1|  hypothetical protein EUGRSUZ_I01429                     329   2e-108   
ref|XP_010266854.1|  PREDICTED: probable aquaporin PIP2-8               329   2e-108   
dbj|BAF32042.1|  putative aquaporin                                     328   2e-108   Cryptomeria japonica
gb|AFB82643.1|  aquaporin                                               329   2e-108   
ref|XP_009355655.1|  PREDICTED: probable aquaporin PIP2-8               328   2e-108   
ref|XP_009138343.1|  PREDICTED: aquaporin PIP2-7-like                   328   2e-108   
ref|XP_002312952.1|  hypothetical protein POPTR_0009s13890g             328   3e-108   Populus trichocarpa [western balsam poplar]
emb|CDX72515.1|  BnaC07g45370D                                          327   3e-108   
ref|XP_006846771.1|  hypothetical protein AMTR_s00148p00023270          328   3e-108   
ref|XP_002869108.1|  hypothetical protein ARALYDRAFT_491143             328   4e-108   
ref|XP_003522619.2|  PREDICTED: aquaporin PIP2-7                        329   4e-108   
ref|XP_010432340.1|  PREDICTED: aquaporin PIP2-7                        328   5e-108   
ref|XP_006846905.1|  hypothetical protein AMTR_s00152p00041700          328   5e-108   
ref|XP_009108681.1|  PREDICTED: aquaporin PIP2-7-like                   328   5e-108   
ref|XP_011092966.1|  PREDICTED: aquaporin PIP2-7                        328   6e-108   
ref|XP_004493972.1|  PREDICTED: probable aquaporin PIP2-5-like          328   6e-108   
ref|XP_003625627.1|  Aquaporin PIP2-1                                   327   1e-107   
gb|AEY75254.1|  aquaporin                                               327   1e-107   
ref|XP_007009830.1|  Plasma membrane intrinsic protein 2A               327   1e-107   
gb|AAB67869.1|  plasma membrane major intrinsic protein 2               327   1e-107   Beta vulgaris subsp. vulgaris [field beet]
gb|ACN40330.1|  unknown                                                 327   2e-107   Picea sitchensis
gb|AAL49750.1|AF452012_1  aquaporin-like protein                        326   2e-107   Petunia x hybrida [garden petunia]
gb|ABL76066.1|  aquaporin 2                                             326   2e-107   Bruguiera gymnorhiza [Burma mangrove]
dbj|BAO18631.1|  plasmamembrane intrinsic protein 2;9                   326   3e-107   
gb|ACU00103.1|  plasma membrane intrinsic protein PIP2.1                326   3e-107   Populus trichocarpa x Populus deltoides
ref|XP_006381455.1|  hypothetical protein POPTR_0006s13000g             326   3e-107   
gb|AAC32107.1|  probable aquaporin                                      326   3e-107   Picea mariana [black spruce]
gb|ACR56614.1|  plasma intrinsic protein 2;4                            326   3e-107   Juglans regia
gb|AEY75242.1|  plasma membrane intrinsic protein                       326   4e-107   
ref|NP_179277.1|  putative aquaporin PIP2-8                             325   4e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009782764.1|  PREDICTED: aquaporin PIP2-7                        325   5e-107   
gb|ABK22173.1|  unknown                                                 325   6e-107   Picea sitchensis
gb|AAB65787.1|  plasma membrane intrinsic protein                       325   6e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007137341.1|  hypothetical protein PHAVU_009G118900g             325   6e-107   
ref|XP_007046620.1|  Plasma membrane intrinsic protein 3 isoform 1      325   6e-107   
gb|AFK33316.1|  unknown                                                 325   7e-107   
emb|CAH60720.1|  putative plasma membrane intrinsic protein             325   7e-107   Populus tremula x Populus tremuloides
gb|AAG02208.1|AF290201_1  plasma membrane intrinsic protein PIP2        325   7e-107   Solanum chacoense
ref|XP_009615212.1|  PREDICTED: aquaporin PIP2-7                        325   8e-107   
gb|AAB36949.1|  plasma membrane intrinsic protein PIP3                  324   9e-107   Arabidopsis thaliana [mouse-ear cress]
gb|ABK24156.1|  unknown                                                 325   9e-107   Picea sitchensis
gb|KHG20375.1|  putative aquaporin PIP2-5 -like protein                 325   9e-107   
gb|KDP29110.1|  hypothetical protein JCGZ_16499                         325   9e-107   
ref|XP_011048549.1|  PREDICTED: aquaporin PIP2-1-like                   325   9e-107   
gb|AAF71816.1|AF141642_1  putative aquaporin PIP2-1                     324   1e-106   Vitis cinerea var. helleri x Vitis rupestris
ref|XP_002884019.1|  PIP2_8/PIP3B                                       324   1e-106   
ref|XP_011048552.1|  PREDICTED: aquaporin PIP2-2-like                   324   1e-106   
ref|XP_004291577.1|  PREDICTED: aquaporin PIP2-2-like                   324   1e-106   
ref|XP_006381453.1|  hypothetical protein POPTR_0006s12980g             324   1e-106   
dbj|BAF32141.1|  putative aquaporin                                     324   1e-106   Taxodium distichum [bald cypress]
gb|KCW55550.1|  hypothetical protein EUGRSUZ_I01429                     324   1e-106   
ref|XP_006360898.1|  PREDICTED: aquaporin PIP2-7-like                   324   1e-106   
ref|XP_010920097.1|  PREDICTED: probable aquaporin PIP2-6               324   2e-106   
gb|AGD98708.1|  aquaporin protein 5                                     324   2e-106   
ref|XP_009412922.1|  PREDICTED: probable aquaporin PIP2-6               323   2e-106   
ref|XP_009780961.1|  PREDICTED: aquaporin PIP2-7-like                   323   2e-106   
ref|XP_011044357.1|  PREDICTED: probable aquaporin PIP2-4               323   2e-106   
ref|XP_008365039.1|  PREDICTED: probable aquaporin PIP2-5               324   2e-106   
sp|P42767.1|PIP1_ATRCA  RecName: Full=Aquaporin PIP-type                323   2e-106   Atriplex canescens [shadscale]
gb|ABK23750.1|  unknown                                                 323   2e-106   Picea sitchensis
ref|XP_003604054.1|  Aquaporin PIP22                                    323   2e-106   
gb|AAL33586.1|AF440272_1  aquaporin                                     323   3e-106   Nicotiana tabacum [American tobacco]
gb|AGD98714.1|  aquaporin protein 11                                    323   3e-106   
gb|ABC01884.1|  plasma membrane intrinsic protein PIP2-like protein     323   3e-106   Solanum tuberosum [potatoes]
ref|XP_011088776.1|  PREDICTED: uncharacterized protein LOC105169921    338   3e-106   
gb|AHZ08398.1|  phosphatidylinosital biphosphate protein                323   4e-106   
dbj|BAB40143.1|  plasma membrane intrinsic protein 2-2                  323   4e-106   Pyrus communis
gb|ABC69040.1|  aquaporin PIP2-1                                        323   4e-106   Rhododendron catawbiense [Catawba rosebay]
ref|XP_010690355.1|  PREDICTED: aquaporin PIP-type                      323   4e-106   
ref|XP_002313510.1|  hypothetical protein POPTR_0009s01940g             323   5e-106   Populus trichocarpa [western balsam poplar]
dbj|BAF63508.1|  plasma membrane intrinsic protein                      322   6e-106   Potamogeton distinctus
ref|NP_001233846.1|  putative PIP-type aquaporin                        322   6e-106   
ref|XP_011015478.1|  PREDICTED: aquaporin PIP2-2-like                   322   6e-106   
ref|XP_010516059.1|  PREDICTED: probable aquaporin PIP2-8               322   7e-106   
gb|KFK36762.1|  hypothetical protein AALP_AA4G166800                    322   7e-106   
gb|KHN33668.1|  Aquaporin PIP2-7                                        322   7e-106   
dbj|BAD90697.1|  plasma membrane intrinsic protein 2;1                  322   7e-106   Mimosa pudica [sensitive-plant]
ref|XP_010521765.1|  PREDICTED: aquaporin PIP2-7-like                   322   8e-106   
ref|XP_009803627.1|  PREDICTED: aquaporin PIP2-7-like                   322   8e-106   
gb|ABH09326.1|  putative aquaporin                                      322   8e-106   Vitis vinifera
ref|XP_009611050.1|  PREDICTED: aquaporin PIP2-7-like                   321   1e-105   
gb|AAV69744.1|  aquaporin                                               322   1e-105   Vitis vinifera
ref|XP_011089904.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    322   1e-105   
gb|AAL49751.1|AF452013_1  aquaporin-like protein                        321   1e-105   Petunia x hybrida [garden petunia]
emb|CAN75442.1|  hypothetical protein VITISV_019657                     322   1e-105   Vitis vinifera
ref|XP_010920407.1|  PREDICTED: probable aquaporin PIP2-2               322   1e-105   
dbj|BAD90700.1|  plasma membrane intrinsic protein 2;4                  322   1e-105   Mimosa pudica [sensitive-plant]
gb|ACX37450.1|  plasma membrane intrinsic protein                       322   1e-105   Hevea brasiliensis [jebe]
emb|CAH60724.1|  putative plasma membrane intrinsic protein             322   1e-105   Populus tremula x Populus tremuloides
ref|XP_006298288.1|  hypothetical protein CARUB_v10014353mg             321   1e-105   
gb|EYU37965.1|  hypothetical protein MIMGU_mgv1a011471mg                321   1e-105   
ref|XP_009345382.1|  PREDICTED: probable aquaporin PIP2-5               322   2e-105   
gb|KHG00060.1|  putative aquaporin PIP2-2                               322   2e-105   
ref|XP_007218772.1|  hypothetical protein PRUPE_ppa009540mg             321   2e-105   
ref|XP_008233329.1|  PREDICTED: probable aquaporin PIP2-5               321   2e-105   
gb|EYU36189.1|  hypothetical protein MIMGU_mgv1a011437mg                321   2e-105   
gb|AGD98705.1|  aquaporin                                               321   2e-105   
ref|NP_001267922.1|  aquaporin-like                                     321   3e-105   
ref|XP_009780213.1|  PREDICTED: aquaporin PIP2-4-like                   321   3e-105   
ref|XP_009595123.1|  PREDICTED: aquaporin PIP2-4-like                   321   3e-105   
ref|XP_010489282.1|  PREDICTED: probable aquaporin PIP2-8               320   3e-105   
gb|KHG10662.1|  Aquaporin PIP2-1 -like protein                          321   3e-105   
gb|EYU40445.1|  hypothetical protein MIMGU_mgv1a011413mg                320   3e-105   
ref|XP_002311092.1|  plasma membrane intrinsic protein 1-1              320   4e-105   Populus trichocarpa [western balsam poplar]
ref|XP_007016740.1|  Plasma membrane intrinsic protein 2,4              321   4e-105   
ref|XP_007207344.1|  hypothetical protein PRUPE_ppa009630mg             320   4e-105   
ref|XP_008243934.1|  PREDICTED: probable aquaporin PIP2-5               320   4e-105   
gb|AIG92831.1|  aquaporin PIP2                                          320   4e-105   
dbj|BAG06230.1|  plasma membrane intrinsic protein                      320   4e-105   Hordeum vulgare [barley]
gb|ABB13430.2|  plasma membrane intrinsic protein                       320   5e-105   Olea europaea
ref|NP_001268056.1|  aquaporin PIP2                                     320   5e-105   
ref|XP_010264685.1|  PREDICTED: aquaporin PIP2-1-like                   320   5e-105   
ref|XP_009600501.1|  PREDICTED: aquaporin PIP2-7-like                   320   6e-105   
ref|NP_001274376.1|  aquaporin PIP2-7-like                              319   9e-105   
ref|XP_011031744.1|  PREDICTED: probable aquaporin PIP2-5               320   1e-104   
gb|KDP44363.1|  hypothetical protein JCGZ_20043                         319   1e-104   
gb|ACU87558.1|  PIP protein                                             319   1e-104   
gb|AFN53630.1|  putative aquaporin PIP2-8                               332   1e-104   
ref|XP_010467415.1|  PREDICTED: probable aquaporin PIP2-8               319   1e-104   
gb|ABK21046.1|  unknown                                                 319   1e-104   Picea sitchensis
gb|KHN32779.1|  Aquaporin PIP2-2                                        318   1e-104   
ref|XP_002519539.1|  Aquaporin PIP2.2, putative                         319   1e-104   Ricinus communis
ref|XP_008447947.1|  PREDICTED: aquaporin PIP2-7                        319   1e-104   
gb|AIK66515.1|  putative aquaporin                                      319   1e-104   
ref|XP_009389186.1|  PREDICTED: probable aquaporin PIP2-6               319   2e-104   
ref|XP_010107654.1|  Aquaporin PIP2-7                                   319   2e-104   
ref|XP_009400343.1|  PREDICTED: probable aquaporin PIP2-6               318   2e-104   
ref|XP_008449253.1|  PREDICTED: aquaporin PIP2-2-like isoform X3        318   2e-104   
ref|XP_009344758.1|  PREDICTED: probable aquaporin PIP2-5               318   2e-104   
gb|ACU20229.1|  unknown                                                 318   2e-104   Glycine max [soybeans]
ref|XP_003518297.1|  PREDICTED: aquaporin PIP2-2-like                   318   2e-104   
gb|ABX83874.1|  plasma membrane intrinsic protein                       318   3e-104   Rhododendron catawbiense [Catawba rosebay]
ref|XP_004304427.1|  PREDICTED: aquaporin PIP2-1-like                   318   3e-104   
gb|ABI96815.1|  plasma membrane intrinsic protein                       318   3e-104   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009398603.1|  PREDICTED: probable aquaporin PIP2-2               318   3e-104   
ref|XP_010933360.1|  PREDICTED: probable aquaporin PIP2-6               318   3e-104   
ref|XP_003548071.1|  PREDICTED: aquaporin PIP2-2-like                   318   3e-104   
gb|ABK22146.1|  unknown                                                 318   3e-104   Picea sitchensis
gb|AFH36337.1|  aquaporin PIP2;2                                        318   3e-104   
ref|XP_008463943.1|  PREDICTED: aquaporin PIP2-7                        318   3e-104   
ref|XP_006436425.1|  hypothetical protein CICLE_v10032302mg             318   3e-104   
gb|KHG08488.1|  putative aquaporin PIP2-2                               318   3e-104   
gb|AFN53685.1|  putative aquaporin PIP2-8                               331   4e-104   
gb|KHN00691.1|  Aquaporin PIP2-2                                        318   4e-104   
gb|AAB18227.1|  MipC                                                    318   4e-104   Mesembryanthemum crystallinum
gb|AGG39693.1|  aquaporin protein AQU15                                 318   4e-104   
ref|XP_010483715.1|  PREDICTED: probable aquaporin PIP2-4               318   5e-104   
gb|KHG29841.1|  putative aquaporin PIP2-2                               318   5e-104   
gb|AAC17529.1|  aquaporin 2                                             317   6e-104   Samanea saman [cow-tamarind]
ref|XP_009628968.1|  PREDICTED: probable aquaporin PIP2-1               317   6e-104   
ref|XP_010443868.1|  PREDICTED: probable aquaporin PIP2-4               317   7e-104   
gb|ABK22504.1|  unknown                                                 317   7e-104   Picea sitchensis
gb|ABK24624.1|  unknown                                                 317   8e-104   Picea sitchensis
ref|XP_010031998.1|  PREDICTED: aquaporin PIP2-7-like                   317   8e-104   
ref|XP_009342865.1|  PREDICTED: probable aquaporin PIP2-5 isoform X2    317   8e-104   
ref|XP_009342858.1|  PREDICTED: probable aquaporin PIP2-5 isoform X1    317   8e-104   
emb|CDX91340.1|  BnaC04g08100D                                          317   9e-104   
ref|XP_006400824.1|  hypothetical protein EUTSA_v10014299mg             317   9e-104   
ref|XP_004500724.1|  PREDICTED: uncharacterized protein LOC101494283    330   9e-104   
ref|XP_010456647.1|  PREDICTED: probable aquaporin PIP2-4               317   1e-103   
ref|XP_008791535.1|  PREDICTED: aquaporin PIP2-4-like                   317   1e-103   
ref|NP_001240039.1|  uncharacterized protein LOC100782155               317   1e-103   
dbj|BAG06231.1|  plasma membrane intrinsic protein                      317   1e-103   Hordeum vulgare [barley]
ref|XP_007151872.1|  hypothetical protein PHAVU_004G082700g             317   1e-103   
ref|XP_010028741.1|  PREDICTED: uncharacterized protein LOC104418957    330   1e-103   
gb|KHG19287.1|  Aquaporin PIP2-7 -like protein                          317   1e-103   
ref|XP_009143524.1|  PREDICTED: aquaporin PIP2-2                        317   1e-103   
gb|KHG30776.1|  Aquaporin PIP2-2 -like protein                          317   1e-103   
gb|AAW80918.1|  putative plasma membrane intrinsic protein              316   1e-103   Astragalus penduliflorus
gb|KDO44716.1|  hypothetical protein CISIN_1g0196812mg                  318   2e-103   
gb|AGD98707.1|  aquaporin protein 4                                     317   2e-103   
ref|XP_010920405.1|  PREDICTED: aquaporin PIP2-4 isoform X1             316   2e-103   
ref|XP_008387595.1|  PREDICTED: probable aquaporin PIP2-5               316   2e-103   
ref|XP_010043748.1|  PREDICTED: probable aquaporin PIP2-4               316   2e-103   
gb|ACU14125.1|  unknown                                                 315   2e-103   Glycine max [soybeans]
ref|XP_007046621.1|  Plasma membrane intrinsic protein 3 isoform 2      316   2e-103   
ref|XP_010253676.1|  PREDICTED: aquaporin PIP2-4-like                   316   2e-103   
ref|XP_004307390.1|  PREDICTED: probable aquaporin PIP2-5-like          316   2e-103   
ref|XP_007151871.1|  hypothetical protein PHAVU_004G082600g             316   2e-103   
ref|XP_008791536.1|  PREDICTED: aquaporin PIP2-4-like                   316   2e-103   
ref|XP_010098191.1|  Aquaporin PIP2-7                                   316   2e-103   
ref|XP_006664813.1|  PREDICTED: probable aquaporin PIP2-6-like          316   2e-103   
ref|XP_011041003.1|  PREDICTED: probable aquaporin PIP2-5               316   2e-103   
ref|XP_006424576.1|  hypothetical protein CICLE_v10028975mg             316   3e-103   
ref|XP_004304428.1|  PREDICTED: aquaporin PIP2-1-like                   316   3e-103   
ref|XP_006664814.1|  PREDICTED: probable aquaporin PIP2-6-like          316   3e-103   
gb|ACU24483.1|  unknown                                                 316   3e-103   Glycine max [soybeans]
gb|ABK60195.2|  PIP2 protein                                            316   3e-103   Gossypium hirsutum [American cotton]
ref|NP_001052292.1|  Os04g0233400                                       315   3e-103   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007205689.1|  hypothetical protein PRUPE_ppa009689mg             315   3e-103   
gb|AAD31846.1|AF133530_1  water channel protein MipH                    316   3e-103   Mesembryanthemum crystallinum
gb|AGC24024.1|  plasma membrane intrinsic protein 1                     315   3e-103   
ref|XP_003521392.1|  PREDICTED: aquaporin PIP2-7-like                   315   4e-103   
tpg|DAA64677.1|  TPA: aquaporin PIP2 4a                                 315   4e-103   
ref|XP_007143702.1|  hypothetical protein PHAVU_007G094600g             315   4e-103   
ref|NP_200874.1|  putative aquaporin PIP2-4                             315   4e-103   Arabidopsis thaliana [mouse-ear cress]
gb|KDP44053.1|  hypothetical protein JCGZ_05520                         315   4e-103   
gb|AFK47442.1|  unknown                                                 315   4e-103   
gb|ACZ06859.1|  plasma membrane intrinsic protein                       315   4e-103   
dbj|BAG68661.1|  plasma membrane intrinsic protein                      315   4e-103   Tulipa gesneriana
ref|XP_003556232.1|  PREDICTED: aquaporin PIP2-1-like                   315   4e-103   
dbj|BAK20223.1|  plasma membrane intrinsic protein 2                    315   6e-103   
ref|XP_002866389.1|  hypothetical protein ARALYDRAFT_919301             315   6e-103   
emb|CDX91341.1|  BnaC04g08090D                                          315   8e-103   
ref|NP_181254.1|  aquaporin PIP2-2                                      315   8e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009345759.1|  PREDICTED: probable aquaporin PIP2-5               315   8e-103   
gb|AAO39008.1|  plasma intrinsic protein 2,2                            315   8e-103   Juglans regia
ref|XP_009615789.1|  PREDICTED: aquaporin PIP2-7-like                   315   9e-103   
gb|ABK93567.1|  unknown                                                 315   9e-103   Populus trichocarpa [western balsam poplar]
dbj|BAD90699.1|  plasma membrane intrinsic protein 2;3                  315   9e-103   Mimosa pudica [sensitive-plant]
gb|ABO69705.2|  aquaporin PIP2                                          314   1e-102   Prunus humilis
gb|ACR56613.1|  plasma intrinsic protein 2;3                            314   1e-102   Juglans regia
ref|XP_002530280.1|  Aquaporin PIP2.1, putative                         314   1e-102   Ricinus communis
gb|AIA83106.1|  putative aquaporin PIP2                                 314   1e-102   
gb|ACU87557.1|  PIP protein                                             314   1e-102   
ref|XP_009593453.1|  PREDICTED: aquaporin PIP2-2-like                   314   1e-102   
ref|XP_010684101.1|  PREDICTED: aquaporin PIP2-1-like                   314   1e-102   
ref|XP_008363507.1|  PREDICTED: aquaporin PIP2-2                        314   1e-102   
gb|AEQ29857.1|  aquaporin PIP2                                          314   2e-102   
gb|AAA68701.1|  similar to mipB gene product in Mesembryanthemum ...    313   2e-102   Mesembryanthemum crystallinum
ref|XP_002316367.1|  putative aquaporin family protein                  314   2e-102   Populus trichocarpa [western balsam poplar]
ref|XP_004304426.1|  PREDICTED: aquaporin PIP2-1-like                   314   2e-102   
ref|NP_001280185.1|  aquaporin PIP2-2                                   313   2e-102   
emb|CAA53478.1|  plasma membrane intrinsic protein 2b                   314   2e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008385311.1|  PREDICTED: probable aquaporin PIP2-2               313   2e-102   
dbj|BAA92260.1|  Plasma membrane aquaporin 2b                           313   2e-102   Raphanus sativus
ref|XP_009131906.1|  PREDICTED: probable aquaporin PIP2-4               313   2e-102   
ref|XP_004156296.1|  PREDICTED: aquaporin PIP2-2-like                   313   2e-102   
ref|XP_008809438.1|  PREDICTED: probable aquaporin PIP2-6               313   2e-102   
ref|XP_009786071.1|  PREDICTED: aquaporin PIP2-7-like                   313   2e-102   
ref|XP_002532756.1|  Aquaporin PIP2.1, putative                         313   3e-102   Ricinus communis
ref|XP_010529747.1|  PREDICTED: aquaporin PIP2-2-like                   313   3e-102   
tpg|DAA64687.1|  TPA: aquaporin PIP2 10                                 313   3e-102   
gb|AEF32110.1|  aquaporin PIP2                                          313   3e-102   
ref|XP_009624885.1|  PREDICTED: aquaporin PIP2-1-like                   313   3e-102   
ref|XP_007027328.1|  Plasma membrane intrinsic protein 2                313   3e-102   
ref|XP_006410897.1|  hypothetical protein EUTSA_v10017041mg             313   3e-102   
ref|XP_003554376.1|  PREDICTED: aquaporin PIP2-1-like                   313   3e-102   
ref|XP_009387242.1|  PREDICTED: aquaporin PIP2-5                        313   4e-102   
gb|AAB18228.1|  MipE                                                    313   4e-102   
ref|XP_009414436.1|  PREDICTED: probable aquaporin PIP2-6               313   4e-102   
ref|NP_001275065.1|  major intrinsic protein 2                          313   4e-102   
ref|XP_003536353.1|  PREDICTED: aquaporin PIP2-1-like isoform 1         313   4e-102   
ref|XP_009120600.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    313   5e-102   
ref|XP_009133124.1|  PREDICTED: aquaporin PIP2-2-like                   312   5e-102   
ref|XP_010516024.1|  PREDICTED: probable aquaporin PIP2-5               312   6e-102   
gb|AAG44947.1|AF290620_1  putative PIP2                                 312   6e-102   
ref|XP_009792249.1|  PREDICTED: aquaporin PIP2-1-like                   312   6e-102   
gb|AAO39007.1|  plasma intrinsic protein 2,1                            312   6e-102   
gb|EYU39575.1|  hypothetical protein MIMGU_mgv1a011441mg                312   6e-102   
ref|XP_006291622.1|  hypothetical protein CARUB_v10017773mg             312   6e-102   
dbj|BAB40141.1|  plasma membrane intrinsic protein 2-1                  312   6e-102   
dbj|BAF33069.1|  aquaporin                                              312   7e-102   
ref|XP_009335091.1|  PREDICTED: probable aquaporin PIP2-2               312   7e-102   
ref|XP_009614931.1|  PREDICTED: aquaporin PIP2-1-like                   312   7e-102   
tpg|DAA64674.1|  TPA: aquaporin PIP2 2                                  312   7e-102   
ref|XP_011094668.1|  PREDICTED: aquaporin PIP2-4-like                   312   7e-102   
gb|AFQ23181.1|  aquaporin PIP2;2                                        312   7e-102   
gb|AHG32324.1|  PIP2-3                                                  312   8e-102   
ref|XP_006280883.1|  hypothetical protein CARUB_v10026881mg             312   8e-102   
ref|XP_010427203.1|  PREDICTED: probable aquaporin PIP2-5               312   8e-102   
gb|EYU34445.1|  hypothetical protein MIMGU_mgv1a011350mg                312   8e-102   
gb|AHB33479.1|  plasma intrinsic protein 2-3                            312   9e-102   
ref|XP_008807132.1|  PREDICTED: probable aquaporin PIP2-6               311   9e-102   
ref|XP_003563177.1|  PREDICTED: probable aquaporin PIP2-1               312   1e-101   
gb|AAL49752.1|AF452014_1  aquaporin-like protein                        311   1e-101   
ref|XP_008785285.1|  PREDICTED: aquaporin PIP2-4                        311   1e-101   
ref|XP_009794928.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    311   1e-101   
ref|XP_006581099.1|  PREDICTED: uncharacterized protein LOC100808290    324   1e-101   
gb|ADJ67992.1|  aquaporin                                               311   1e-101   
dbj|BAE06148.1|  PIP aquaporin isoform                                  311   1e-101   
ref|NP_001237286.1|  PIP2,2                                             311   1e-101   
gb|EYU42155.1|  hypothetical protein MIMGU_mgv1a011301mg                311   1e-101   
gb|ABB88840.1|  aquaporin                                               311   1e-101   
ref|XP_006294744.1|  hypothetical protein CARUB_v10023789mg             311   2e-101   
dbj|BAA92261.1|  Plasma membrane aquaporin 2c                           311   2e-101   
ref|XP_010509371.1|  PREDICTED: aquaporin PIP2-2-like                   311   2e-101   
ref|XP_009772697.1|  PREDICTED: aquaporin PIP2-2-like                   311   2e-101   
ref|XP_009414435.1|  PREDICTED: probable aquaporin PIP2-6               311   2e-101   
ref|XP_003606383.1|  Aquaporin PIP2-7                                   311   2e-101   
ref|XP_010037961.1|  PREDICTED: probable aquaporin PIP2-2               311   2e-101   
ref|XP_010505294.1|  PREDICTED: aquaporin PIP2-2-like                   311   2e-101   
ref|XP_009760326.1|  PREDICTED: aquaporin PIP2-1-like                   311   2e-101   
ref|XP_009126591.1|  PREDICTED: probable aquaporin PIP2-4               311   2e-101   
ref|NP_001234625.1|  aquaporin                                          311   2e-101   
emb|CAB07783.1|  PaMip-2                                                311   2e-101   
emb|CDP07111.1|  unnamed protein product                                311   2e-101   
ref|XP_006359706.1|  PREDICTED: aquaporin PIP2-7-like                   310   3e-101   
ref|XP_002461930.1|  hypothetical protein SORBIDRAFT_02g010760          311   3e-101   
tpg|DAA64673.1|  TPA: aquaporin PIP2 1                                  311   3e-101   
ref|XP_011077012.1|  PREDICTED: probable aquaporin PIP2-5               310   3e-101   
gb|ABU94631.1|  putative aquaporin PIP2;3                               310   3e-101   
ref|XP_006410896.1|  hypothetical protein EUTSA_v10017874mg             310   3e-101   
ref|XP_009133125.1|  PREDICTED: aquaporin PIP2-2-like                   310   3e-101   
ref|XP_004956113.1|  PREDICTED: aquaporin PIP2-1-like                   310   4e-101   
gb|AFK47400.1|  unknown                                                 310   4e-101   
gb|ABI96814.1|  plasma membrane intrinsic protein                       310   4e-101   
ref|XP_006296058.1|  hypothetical protein CARUB_v10025207mg             310   4e-101   
emb|CAB61749.1|  putative water channel protein                         308   4e-101   
ref|XP_002881493.1|  hypothetical protein ARALYDRAFT_482707             310   4e-101   
gb|KFK34721.1|  hypothetical protein AALP_AA5G183600                    310   4e-101   
ref|XP_004505993.1|  PREDICTED: aquaporin PIP2-7-like                   310   4e-101   
gb|AEQ20672.1|  PIP2;1                                                  310   4e-101   
gb|AAY22203.1|  putative aquaporin                                      310   4e-101   
ref|XP_010032196.1|  PREDICTED: aquaporin PIP2-1                        310   5e-101   
ref|XP_010046653.1|  PREDICTED: aquaporin PIP2-1-like                   310   5e-101   
ref|XP_010505293.1|  PREDICTED: aquaporin PIP2-2                        310   5e-101   
gb|ACJ85173.1|  unknown                                                 310   5e-101   
dbj|BAO18630.1|  plasmamembrane intrinsic protein 2;8                   310   5e-101   
ref|XP_008446888.1|  PREDICTED: aquaporin PIP2-1-like                   310   5e-101   
ref|XP_007132257.1|  hypothetical protein PHAVU_011G079300g             310   5e-101   
ref|NP_001105639.1|  aquaporin PIP2-7                                   310   6e-101   
gb|AFH36338.1|  aquaporin PIP2;3                                        310   6e-101   
emb|CDY46759.1|  BnaA03g17030D                                          310   6e-101   
ref|XP_010516976.1|  PREDICTED: aquaporin PIP2-2-like                   310   6e-101   
dbj|BAE02729.1|  PIP aquaporin                                          310   6e-101   
dbj|BAD90698.1|  plasma membrane intrinsic protein 2;2                  310   6e-101   
gb|AEO13898.1|  aquaporin 7                                             310   7e-101   
ref|XP_007162747.1|  hypothetical protein PHAVU_001G177000g             310   7e-101   
ref|NP_191042.1|  putative aquaporin PIP2-5                             310   8e-101   
ref|XP_004143245.1|  PREDICTED: aquaporin PIP2-2-like                   310   8e-101   
gb|AFQ23186.1|  aquaporin PIP2;1                                        310   8e-101   
ref|XP_010316437.1|  PREDICTED: probable aquaporin PIP2-8 isoform X1    308   8e-101   
ref|NP_001289823.1|  aquaporin PIP2-1-like                              309   8e-101   
ref|XP_003538174.1|  PREDICTED: aquaporin PIP2-7                        310   8e-101   
gb|AIA83104.1|  putative aquaporin PIP2                                 310   8e-101   
gb|AAF65845.1|AF255795_1  aquaporin 1                                   310   8e-101   
ref|NP_001105638.1|  aquaporin PIP2-2                                   310   8e-101   
ref|XP_006357563.1|  PREDICTED: probable aquaporin PIP2-1-like          309   9e-101   
ref|XP_004142421.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    309   9e-101   
ref|XP_010325988.1|  PREDICTED: aquaporin PIP2-1-like                   309   9e-101   
ref|XP_010516975.1|  PREDICTED: aquaporin PIP2-2-like                   309   9e-101   
ref|NP_001274381.1|  aquaporin PIP2-7-like                              309   9e-101   
gb|AEY75244.1|  plasma membrane intrinsic protein                       309   9e-101   
ref|XP_004496281.1|  PREDICTED: aquaporin PIP2-1-like                   309   1e-100   
emb|CDY07519.1|  BnaC06g15450D                                          309   1e-100   
ref|NP_001235204.1|  Pip1 protein                                       309   1e-100   
emb|CDX67611.1|  BnaA07g16510D                                          309   1e-100   
ref|XP_008366675.1|  PREDICTED: probable aquaporin PIP2-5               309   1e-100   
ref|XP_006403531.1|  hypothetical protein EUTSA_v10010603mg             309   1e-100   
ref|XP_002461931.1|  hypothetical protein SORBIDRAFT_02g010780          309   1e-100   
emb|CAB46351.1|  major intrinsic protein 2                              309   1e-100   
gb|KHN05685.1|  Aquaporin PIP2-7                                        309   1e-100   
gb|AFW90554.1|  aquaporin                                               308   1e-100   
ref|XP_008456476.1|  PREDICTED: probable aquaporin PIP2-5               308   1e-100   
ref|XP_004157526.1|  PREDICTED: aquaporin PIP2-7-like                   309   1e-100   
ref|XP_002461936.1|  hypothetical protein SORBIDRAFT_02g010830          309   1e-100   
gb|ADJ57599.1|  plasma membrane intrinsic protein PIP2;1                309   1e-100   
emb|CAH60723.1|  putative plasma membrane intrinsic protein             309   1e-100   
gb|ADK25057.1|  plasma membrane intrinsic protein                       309   1e-100   
gb|KHN38765.1|  Aquaporin PIP2-7                                        309   1e-100   
ref|XP_007150204.1|  hypothetical protein PHAVU_005G135300g             309   1e-100   
ref|NP_001240223.1|  prolactin-inducible protein                        309   2e-100   
ref|XP_006294722.1|  hypothetical protein CARUB_v10023768mg             309   2e-100   
gb|ACF79873.1|  unknown                                                 309   2e-100   
ref|XP_002452483.1|  hypothetical protein SORBIDRAFT_04g026650          309   2e-100   
gb|KHG06004.1|  Aquaporin PIP2-2 -like protein                          308   2e-100   
gb|AAC16545.1|  aquaporin                                               309   2e-100   
ref|XP_009413714.1|  PREDICTED: aquaporin PIP2-4-like isoform X1        308   2e-100   
gb|AHA84284.1|  prolactin-inducible protein                             308   2e-100   
ref|XP_010100853.1|  Aquaporin PIP2-1                                   308   2e-100   
ref|XP_010043747.1|  PREDICTED: probable aquaporin PIP2-5               308   2e-100   
ref|XP_002322877.1|  major intrinsic protein 1                          308   2e-100   
dbj|BAA23744.1|  HvPIP2;1                                               308   2e-100   
gb|EMS51072.1|  Aquaporin PIP2-5                                        308   2e-100   
pdb|1Z98|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    308   2e-100   
ref|NP_001274397.1|  aquaporin PIP2-1-like                              308   2e-100   
gb|EAZ39662.1|  hypothetical protein OsJ_24090                          308   2e-100   
ref|XP_002461932.1|  hypothetical protein SORBIDRAFT_02g010790          308   2e-100   
ref|XP_008367680.1|  PREDICTED: probable aquaporin PIP2-5               308   2e-100   
pdb|2B5F|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    309   2e-100   
ref|NP_001059545.1|  Os07g0448800                                       308   2e-100   
ref|NP_001266257.1|  aquaporin PIP2-7-like                              308   2e-100   
ref|XP_008442677.1|  PREDICTED: probable aquaporin PIP2-4               308   2e-100   
ref|XP_010505564.1|  PREDICTED: probable aquaporin PIP2-6               308   2e-100   
ref|NP_001053335.1|  Os04g0521100                                       308   3e-100   
ref|XP_004953172.1|  PREDICTED: aquaporin PIP2-4-like                   308   3e-100   
ref|NP_001288933.1|  probable aquaporin PIP2-6                          308   3e-100   
ref|XP_002461933.1|  hypothetical protein SORBIDRAFT_02g010800          308   3e-100   
ref|XP_011043133.1|  PREDICTED: probable aquaporin PIP2-8               308   3e-100   
ref|NP_001105024.1|  aquaporin PIP2-1                                   308   3e-100   
gb|ABK60196.1|  PIP2 protein                                            308   4e-100   
ref|NP_001268058.1|  aquaporin-like                                     308   4e-100   
ref|XP_009619670.1|  PREDICTED: aquaporin PIP2-1-like                   308   4e-100   
ref|XP_008449251.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        308   4e-100   
ref|XP_006403691.1|  hypothetical protein EUTSA_v10010598mg             308   4e-100   
dbj|BAG68662.1|  plasma membrane intrinsic protein                      307   5e-100   
ref|NP_181434.1|  plasma membrane intrinsic protein 2E                  308   5e-100   
emb|CDY14415.1|  BnaC03g21800D                                          308   5e-100   
gb|ACU21481.1|  unknown                                                 307   5e-100   
ref|XP_004137971.1|  PREDICTED: probable aquaporin PIP2-4-like          308   5e-100   
ref|XP_004164389.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    308   5e-100   
gb|EAY86778.1|  hypothetical protein OsI_08158                          307   5e-100   
ref|XP_010509080.1|  PREDICTED: probable aquaporin PIP2-6               307   5e-100   
sp|Q8GRI8.1|PIP25_ORYSJ  RecName: Full=Aquaporin PIP2-5; AltName:...    307   6e-100   
ref|NP_001105616.1|  aquaporin PIP2-5                                   307   7e-100   
gb|ACG39551.1|  aquaporin PIP2.1                                        307   7e-100   
gb|AHG32323.1|  PIP2-2                                                  307   7e-100   
emb|CDP21564.1|  unnamed protein product                                306   7e-100   
gb|AAM61438.1|  aquaporin (plasma membrane intrinsic protein 2C)        307   7e-100   
ref|XP_010935141.1|  PREDICTED: aquaporin PIP2-7-like                   307   8e-100   
gb|KCW88815.1|  hypothetical protein EUGRSUZ_A01153                     310   8e-100   
gb|ABI96813.1|  plasma membrane intrinsic protein                       307   8e-100   
ref|XP_002877918.1|  hypothetical protein ARALYDRAFT_485715             307   8e-100   
ref|XP_009771075.1|  PREDICTED: aquaporin PIP2-7-like                   306   1e-99    
ref|XP_004149911.1|  PREDICTED: probable aquaporin PIP2-5-like          305   1e-99    
gb|AFB83068.1|  plasma intrinsic protein PIP2.2                         306   1e-99    
ref|XP_008449255.1|  PREDICTED: aquaporin PIP2-2-like                   306   1e-99    
ref|NP_181255.1|  aquaporin PIP2-3                                      306   1e-99    
ref|XP_006411124.1|  hypothetical protein EUTSA_v10017026mg             306   1e-99    
gb|KCW51592.1|  hypothetical protein EUGRSUZ_J01087                     310   1e-99    
emb|CAC82712.1|  major intrinsic protein 1                              306   1e-99    
ref|NP_001274386.1|  aquaporin PIP2-1-like                              306   1e-99    
ref|XP_002879778.1|  PIP2_6/PIP2E                                       306   1e-99    
ref|XP_003540176.1|  PREDICTED: aquaporin PIP2-7                        306   1e-99    
emb|CDX73446.1|  BnaC08g25570D                                          306   1e-99    
ref|XP_001779900.1|  predicted protein                                  306   2e-99    
gb|AAB67868.1|  plasma membrane major intrinsic protein 1               306   2e-99    
gb|AGD98712.1|  aquaporin protein 9                                     306   2e-99    
gb|ABN11917.1|  aquaporin                                               306   2e-99    
emb|CAB45651.1|  putative plasma membrane intrinsic protein             306   2e-99    
ref|XP_009116159.1|  PREDICTED: probable aquaporin PIP2-5               306   2e-99    
ref|XP_010426989.1|  PREDICTED: aquaporin PIP2-1                        306   2e-99    
emb|CDP06739.1|  unnamed protein product                                306   2e-99    
pdb|3CN6|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    306   2e-99    
pdb|3CLL|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    306   2e-99    
gb|AAO86707.1|  aquaporin                                               306   2e-99    
ref|NP_001047491.1|  Os02g0629200                                       306   2e-99    
ref|XP_003575410.1|  PREDICTED: aquaporin PIP2-4                        306   2e-99    
gb|AEH76326.1|  plasma membrane intrinsic protein 2A                    306   2e-99    
ref|XP_010504105.1|  PREDICTED: aquaporin PIP2-1-like                   306   2e-99    
ref|XP_004956115.1|  PREDICTED: aquaporin PIP2-6-like                   306   2e-99    
ref|XP_010554547.1|  PREDICTED: probable aquaporin PIP2-5               306   3e-99    
ref|NP_001105027.1|  aquaporin PIP2-6                                   306   3e-99    
emb|CCI55668.1|  EaPIP2,1                                               305   3e-99    
gb|AAM63463.1|  aquaporin (plasma membrane intrinsic protein 2B)        305   3e-99    
emb|CDY56697.1|  BnaCnng31040D                                          305   3e-99    
gb|KFK34592.1|  hypothetical protein AALP_AA5G165800                    305   4e-99    
gb|AAS65964.1|  aquaporin PIP 2                                         305   4e-99    
ref|XP_009116034.1|  PREDICTED: aquaporin PIP2-1                        305   4e-99    
dbj|BAA32778.1|  Plasma membrane aquaporin (PAQ2)                       305   5e-99    
pdb|3CN5|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    306   5e-99    
ref|XP_010107541.1|  Aquaporin PIP2-2                                   305   5e-99    
gb|AHA84128.1|  plasma membrane integral protein ZmPIP2-7               305   5e-99    
gb|ABH09328.1|  putative aquaporin                                      305   5e-99    
ref|XP_010555818.1|  PREDICTED: probable aquaporin PIP2-5               305   6e-99    
gb|ACU19125.1|  unknown                                                 305   6e-99    
ref|XP_004487111.1|  PREDICTED: aquaporin PIP2-7-like                   305   6e-99    
ref|XP_006652526.1|  PREDICTED: probable aquaporin PIP2-3-like          305   6e-99    
ref|NP_190910.1|  aquaporin PIP2-1                                      305   6e-99    
gb|ABU94630.1|  putative aquaporin PIP2;2                               305   6e-99    
ref|XP_001753248.1|  predicted protein                                  304   6e-99    
ref|XP_006367008.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        304   7e-99    
ref|NP_001289999.1|  aquaporin PIP2-1                                   304   8e-99    



>gb|KHF98939.1| putative aquaporin PIP2-8 -like protein [Gossypium arboreum]
Length=278

 Score =   339 bits (870),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 183/234 (78%), Positives = 205/234 (88%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV++ATVIG K   D C G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  45   TLLFLYVTIATVIGHKKQHDACDGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  104

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAVAYMVAQCLGA+ GVGLVKA  K  ++++GGGANTV  G++KG  L A
Sbjct  105  LFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKSEYNSLGGGANTVATGYNKGTALGA  164

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  165  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  224

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+NN  AWDDHWIFWVGPM+GA+A A YHQ +LRA A+KAL GSF+S P+
Sbjct  225  GAAVIYNNDKAWDDHWIFWVGPMVGALAAAAYHQYILRAAAIKAL-GSFRSNPS  277



>gb|AFH36336.1| aquaporin PIP2;1 [Quercus petraea]
Length=278

 Score =   338 bits (868),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 181/234 (77%), Positives = 203/234 (87%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY++VATVIG K T DPC G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  45   TLLFLYITVATVIGYKKTADPCGGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  104

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAV+YM+AQCLGA+ GVGLVKA  K F+D  GGGAN V  G++KG  L A
Sbjct  105  LFLARKVSLIRAVSYMIAQCLGAICGVGLVKAFMKSFYDANGGGANLVASGYNKGTALGA  164

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  165  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  224

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+NN+  WD+HWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P 
Sbjct  225  GAAVIYNNEKVWDEHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNPT  277



>gb|ACB87734.1| aquaporin [Manihot esculenta]
Length=280

 Score =   338 bits (866),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 183/234 (78%), Positives = 203/234 (87%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY++VATVIG K   DPC G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  47   TLLFLYITVATVIGYKKQTDPCGGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  106

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAVAYMVAQCLGA+ GVGLVKA  K  ++ +GGGAN+V PG+SKG  L A
Sbjct  107  LFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHSYNGLGGGANSVAPGYSKGTALGA  166

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  167  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  226

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+NN   WDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P 
Sbjct  227  GAAVIYNNDKVWDDHWIFWVGPFIGALAAAAYHQYILRAAAIKAL-GSFRSNPT  279



>gb|ACU87556.1| PIP protein [Gossypium hirsutum]
Length=278

 Score =   338 bits (866),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 182/234 (78%), Positives = 204/234 (87%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV++ATVIG K   D C G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  45   TLLFLYVTIATVIGHKKQHDACDGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  104

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAVAYMVAQCLGA+ GVGLVKA  K  ++++GGG NTV  G++KG  L A
Sbjct  105  LFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKSEYNSLGGGVNTVATGYNKGTALGA  164

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  165  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  224

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+NN  AWDDHWIFWVGPM+GA+A A YHQ +LRA A+KAL GSF+S P+
Sbjct  225  GAAVIYNNDKAWDDHWIFWVGPMVGALAAAAYHQYILRAAAIKAL-GSFRSNPS  277



>ref|NP_001267957.1| aquaporin PIP2;2 [Vitis vinifera]
 gb|AEZ35023.1| plasma membrane 2;2 aquaporin [Vitis vinifera]
Length=279

 Score =   337 bits (865),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 180/234 (77%), Positives = 204/234 (87%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY++VATVIG K   DPC G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  46   TLLFLYITVATVIGYKKQSDPCGGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  105

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRA+AYMVAQCLGA+ GVGLVKA  K F++++GGGAN+V  G++KG  L A
Sbjct  106  LFLARKVSLIRALAYMVAQCLGAICGVGLVKAFMKSFYNSLGGGANSVAAGYNKGTALGA  165

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  166  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  225

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+NN+  WDD WIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P 
Sbjct  226  GAAVIYNNEKVWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNPT  278



>ref|XP_002306187.1| membrane intrinsic family protein [Populus trichocarpa]
 gb|ABK95359.1| unknown [Populus trichocarpa]
 gb|EEE86698.1| membrane intrinsic family protein [Populus trichocarpa]
Length=279

 Score =   337 bits (864),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 183/233 (79%), Positives = 204/233 (88%), Gaps = 1/233 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K+  DPC G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  46   TLLFLYVTVATVIGHKSNKDPCDGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  105

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAVAYMVAQCLGA+ GVGLVKA  K  ++++GGGANTV  G++ G  L A
Sbjct  106  LFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKKNYNSLGGGANTVAMGYNTGTALGA  165

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  166  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  225

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            GAAVI NN+ AWDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct  226  GAAVIFNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNP  277



>gb|ACU87555.1| PIP protein [Gossypium hirsutum]
Length=278

 Score =   337 bits (864),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 182/234 (78%), Positives = 204/234 (87%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV++ATVIG K   D C G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  45   TLLFLYVTIATVIGHKKQHDACDGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  104

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAVAYMVAQCLGA+ GVGLVKA  K  ++++GGGANTV  G++KG  L A
Sbjct  105  LFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKSEYNSLGGGANTVATGYNKGTALGA  164

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  165  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  224

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+NN  AWDD WIFWVGPM+GA+A A YHQ +LRA A+KAL GSF+S P+
Sbjct  225  GAAVIYNNDKAWDDQWIFWVGPMVGALAAAAYHQYILRAAAIKAL-GSFRSNPS  277



>ref|XP_011046666.1| PREDICTED: probable aquaporin PIP2-8 [Populus euphratica]
Length=279

 Score =   337 bits (864),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 183/233 (79%), Positives = 204/233 (88%), Gaps = 1/233 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K+  DPC G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  46   TLLFLYVTVATVIGHKSNKDPCDGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  105

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAVAYMVAQCLGA+ GVGLVKA  K  ++++GGGANTV  G++ G  L A
Sbjct  106  LFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKKNYNSLGGGANTVAMGYNTGTALGA  165

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  166  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  225

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            GAAVI NN+ AWDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct  226  GAAVIFNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNP  277



>emb|CAH60721.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=279

 Score =   337 bits (864),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 183/233 (79%), Positives = 204/233 (88%), Gaps = 1/233 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K+  DPC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  46   TLLFLYVTVATVIGHKSNKDPCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  105

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAVAYMVAQCLGA+ GVGLVKA  K  ++++GGGANTV  G++ G  L A
Sbjct  106  LFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKKKYNSLGGGANTVAMGYNTGTALGA  165

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  166  EIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  225

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            GAAVI NN+ AWDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct  226  GAAVIFNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNP  277



>ref|XP_006422584.1| hypothetical protein CICLE_v10029003mg [Citrus clementina]
 ref|XP_006486723.1| PREDICTED: aquaporin PIP2-7-like [Citrus sinensis]
 gb|ESR35824.1| hypothetical protein CICLE_v10029003mg [Citrus clementina]
 gb|KDO68090.1| hypothetical protein CISIN_1g023370mg [Citrus sinensis]
Length=283

 Score =   337 bits (864),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 185/234 (79%), Positives = 204/234 (87%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYVSVATVIG K   D C G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  50   TLLFLYVSVATVIGHKKQSDACGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  109

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAVAYMVAQCLGA+ GVGLVKA  K  ++++GGGANTV  G++KG  L A
Sbjct  110  LFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGA  169

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  170  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  229

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+NN  AWDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P+
Sbjct  230  GAAVIYNNDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNPS  282



>gb|ABH09327.1| putative aquaporin [Vitis vinifera]
 gb|ABN14351.1| aquaporin PIP2;2 [Vitis vinifera]
 emb|CAN77349.1| hypothetical protein VITISV_007541 [Vitis vinifera]
Length=279

 Score =   337 bits (863),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 179/234 (76%), Positives = 204/234 (87%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY++VATVIG K   DPC G GLLG++W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  46   TLLFLYITVATVIGYKKQSDPCGGVGLLGVAWAFGGMIFILVYCTAGISGGHINPAVTFG  105

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRA+AYMVAQCLGA+ GVGLVKA  K F++++GGGAN+V  G++KG  L A
Sbjct  106  LFLARKVSLIRALAYMVAQCLGAICGVGLVKAFMKSFYNSLGGGANSVAAGYNKGTALGA  165

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  166  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  225

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+NN+  WDD WIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P 
Sbjct  226  GAAVIYNNEKVWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNPT  278



>gb|AAF71820.1|AF141900_1 putative aquaporin PIP2-2 [Vitis cinerea var. helleri x Vitis 
rupestris]
Length=279

 Score =   336 bits (861),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 179/234 (76%), Positives = 204/234 (87%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY++VATVIG K   DPC G GLLGI+W FGGMIF+LVYCTAGI+GGHINPAVTFG
Sbjct  46   TLLFLYITVATVIGYKKQSDPCGGVGLLGIAWAFGGMIFILVYCTAGIAGGHINPAVTFG  105

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRA+AYMVAQCLGA+ GVGLVKA  K F++++GGGAN+V  G++KG  L A
Sbjct  106  LFLARKVSLIRALAYMVAQCLGAICGVGLVKAFMKSFYNSLGGGANSVAAGYNKGTALGA  165

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  166  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  225

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+NN+  WDD WIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P 
Sbjct  226  GAAVIYNNEKVWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNPT  278



>ref|XP_006412152.1| hypothetical protein EUTSA_v10025940mg [Eutrema salsugineum]
 gb|ESQ53605.1| hypothetical protein EUTSA_v10025940mg [Eutrema salsugineum]
Length=281

 Score =   336 bits (861),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 182/232 (78%), Positives = 201/232 (87%), Gaps = 1/232 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  48   TLLFLYVTVATVIGHKKQTGPCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  107

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL+RAV YM+AQCLGA+ GVG VKA  K  ++T+GGGANTV  G+SKG  L A
Sbjct  108  LFLARKVSLVRAVGYMIAQCLGAICGVGFVKAFMKTPYNTLGGGANTVADGYSKGTALGA  167

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  168  EIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  227

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            GAAVI+NNK AWDDHWIFWVGP LGA+A A YHQ +LRA A+KAL GSF+S 
Sbjct  228  GAAVIYNNKKAWDDHWIFWVGPFLGALAAAAYHQYILRAAAIKAL-GSFRSN  278



>gb|ABM54183.1| aquaporin [Jatropha curcas]
 gb|KDP29674.1| hypothetical protein JCGZ_18836 [Jatropha curcas]
Length=280

 Score =   335 bits (860),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 181/234 (77%), Positives = 203/234 (87%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY++VATVIG K   DPC G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  47   TLLFLYITVATVIGYKKQTDPCGGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  106

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRA+AYMVAQCLGA+ GVGLVKA  K+ ++ +GGGAN+V  G+SKG  L A
Sbjct  107  LFLARKVSLIRALAYMVAQCLGAICGVGLVKAFMKNPYNHLGGGANSVNTGYSKGTALGA  166

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  167  EIIGTFVLVYTVFSATDPKRSARDSHVPILAPLPIGFAVFMVHLATIPITGTGINPARSF  226

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+NN   WDDHWIFWVGP +GAIA A YHQ +LRA A+KAL GSF+S P 
Sbjct  227  GAAVIYNNDKVWDDHWIFWVGPFVGAIAAAAYHQYILRAAAIKAL-GSFRSNPT  279



>ref|XP_008382110.1| PREDICTED: probable aquaporin PIP2-8 [Malus domestica]
Length=281

 Score =   335 bits (859),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 183/233 (79%), Positives = 205/233 (88%), Gaps = 1/233 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K++P  C G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  48   TLLFLYVTVATVIGHKSSPGDCGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  107

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAVAY VAQCLGA+ GVGLVKA  K  ++++GGGAN+V PG++KG  L A
Sbjct  108  LFLARKVSLIRAVAYXVAQCLGAIAGVGLVKAFQKHNYNSLGGGANSVAPGYNKGTALGA  167

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFV H+ATIPITGTGINPARSF
Sbjct  168  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFVVHLATIPITGTGINPARSF  227

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            GAAVI+NN+  WDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct  228  GAAVIYNNEKVWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNP  279



>ref|XP_009376943.1| PREDICTED: probable aquaporin PIP2-8 [Pyrus x bretschneideri]
Length=281

 Score =   335 bits (859),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 182/233 (78%), Positives = 205/233 (88%), Gaps = 1/233 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K++P  C G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  48   TLLFLYVTVATVIGHKSSPGDCGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  107

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAVAY+VAQCLGA+ GVGLVKA  K  ++++GGGAN+V PG++KG  L A
Sbjct  108  LFLARKVSLIRAVAYIVAQCLGAIAGVGLVKAFQKHNYNSLGGGANSVSPGYNKGTALGA  167

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFV H+ATIPITGTGINPARSF
Sbjct  168  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFVVHLATIPITGTGINPARSF  227

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            GAAVI+NN+  WDDHWIFWVGP +GA+  A YHQ +LRA A+KAL GSF+S P
Sbjct  228  GAAVIYNNEKVWDDHWIFWVGPFVGALGAAAYHQYILRAAAIKAL-GSFRSNP  279



>gb|AFO63679.1| plasma intrinsic protein 2 [Eriobotrya japonica]
Length=281

 Score =   335 bits (858),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 183/234 (78%), Positives = 204/234 (87%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY++VATVIG K +P  C G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  48   TLLFLYITVATVIGHKNSPGDCGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  107

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAVAYMVAQ LGA+VGVGLVKA  K  +++VGGGAN+V  G+SKG  L A
Sbjct  108  LFLARKVSLIRAVAYMVAQSLGAIVGVGLVKAFQKHKYNSVGGGANSVASGYSKGTALGA  167

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  168  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSF  227

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+NN   WDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P+
Sbjct  228  GAAVIYNNDKIWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNPS  280



>gb|ACB42441.1| aquaporin PIP2;4 [Gossypium hirsutum]
 gb|KHG19165.1| Aquaporin PIP2-7 -like protein [Gossypium arboreum]
Length=278

 Score =   335 bits (858),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 181/233 (78%), Positives = 203/233 (87%), Gaps = 1/233 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K   D C G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  45   TLLFLYVTVATVIGHKKQQDACDGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  104

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAVAYMV+QCLGA+ GVGLVKA  K  ++++GGGANTV  G++ G  L A
Sbjct  105  LFLARKVSLIRAVAYMVSQCLGAICGVGLVKAFMKHPYNSLGGGANTVASGYNNGTALGA  164

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  165  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  224

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            GAAVI+NN  AWDDHWIFWVGP +GA+A A+YHQ +LRA A+KAL GSF+S P
Sbjct  225  GAAVIYNNDKAWDDHWIFWVGPFVGALAAAIYHQYILRAAAIKAL-GSFRSNP  276



>ref|XP_007041804.1| Plasma membrane intrinsic protein 2,8 isoform 1 [Theobroma cacao]
 gb|EOX97635.1| Plasma membrane intrinsic protein 2,8 isoform 1 [Theobroma cacao]
Length=278

 Score =   334 bits (857),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 181/233 (78%), Positives = 202/233 (87%), Gaps = 1/233 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV++ATVIG K   D C G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  45   TLLFLYVTIATVIGYKKQQDACDGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  104

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAVAYMVAQCLGA+ GVGLVKA  K  +++ GGGANTV  G++KG  L A
Sbjct  105  LFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHDYNSQGGGANTVASGYNKGTALGA  164

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS 
Sbjct  165  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSI  224

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            GAAVI+NN+ AWDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct  225  GAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNP  276



>emb|CDY17511.1| BnaC03g65520D [Brassica napus]
Length=281

 Score =   334 bits (857),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 180/232 (78%), Positives = 202/232 (87%), Gaps = 1/232 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIFVLVYCTAG+SGGHINPAVTFG
Sbjct  48   TLLFLYVTVATVIGHKKQTGPCDGVGLLGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFG  107

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL+RAV YM+AQCLGA+ GVG VKA  K  ++T+GGGANTV PG+SKG  L A
Sbjct  108  LFLARKVSLVRAVGYMIAQCLGAICGVGFVKAFMKTPYNTLGGGANTVAPGYSKGTALGA  167

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  168  EIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  227

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            GAAVI+NN+ AWDDHWIFWVGP +GA+A A YHQ +LRA AVKAL  SF+S+
Sbjct  228  GAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAVKAL-ASFRSS  278



>ref|XP_011045923.1| PREDICTED: probable aquaporin PIP2-8 [Populus euphratica]
Length=279

 Score =   334 bits (856),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 183/234 (78%), Positives = 203/234 (87%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K   D C G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  46   TLLFLYVTVATVIGHKKNQDACGGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  105

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAV YMVAQCLGAV GVGLVKA  K +++++GGGANTV PG+S G  L A
Sbjct  106  LFLARKVSLIRAVGYMVAQCLGAVCGVGLVKAFMKPYYNSLGGGANTVAPGYSTGTALGA  165

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  166  EIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  225

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI N+K AWDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P 
Sbjct  226  GAAVIINDKKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSHPT  278



>gb|ACB42440.1| aquaporin PIP2;3 [Gossypium hirsutum]
 gb|AIL95755.1| aquaporin [Gossypium hirsutum]
Length=278

 Score =   334 bits (856),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 180/234 (77%), Positives = 203/234 (87%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K   D C G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  45   TLLFLYVTVATVIGHKKQQDACDGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  104

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVS IRAVAYMV+QCLGA+ GVGLVKA  K  ++++GGGANTV  G++KG  L A
Sbjct  105  LFLARKVSFIRAVAYMVSQCLGAICGVGLVKAFMKHPYNSLGGGANTVASGYNKGTALGA  164

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  165  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  224

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+NN  AWD+HWIFWVGP +GA+A A+YHQ +LRA A+KAL GSF+S P 
Sbjct  225  GAAVIYNNDKAWDEHWIFWVGPFVGALAAAIYHQYILRAAAIKAL-GSFRSNPT  277



>gb|ACV66986.1| plasma membrane aquaporin 2 [Hevea brasiliensis]
Length=278

 Score =   333 bits (855),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 182/234 (78%), Positives = 203/234 (87%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY++VATVIG K   DPC G GLLGI+W FGGMIF+LVYCTAGISGGHINPAV+FG
Sbjct  45   TLLFLYITVATVIGYKKQADPCAGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVSFG  104

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAVAYMVAQCLGA+ GVGLVKA  K  ++ +GGGANTV PG++KG  L A
Sbjct  105  LFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHPYNGLGGGANTVAPGYNKGTALGA  164

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  165  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  224

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+NN  AWDDH IFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P 
Sbjct  225  GAAVIYNNDKAWDDHRIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNPT  277



>ref|XP_004290727.1| PREDICTED: aquaporin PIP2-7-like [Fragaria vesca subsp. vesca]
Length=281

 Score =   333 bits (855),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 178/234 (76%), Positives = 201/234 (86%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY++VATVIG K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  48   TLLFLYITVATVIGHKHQTGPCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  107

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAV+YM+AQCLGA+ GV LVKA    +F T+GGG N+V  G+SKG  L A
Sbjct  108  LFLARKVSLIRAVSYMIAQCLGAIAGVALVKAFQSHYFTTLGGGTNSVADGYSKGTALGA  167

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  168  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSF  227

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+NN+  WD+HWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P+
Sbjct  228  GAAVIYNNEKVWDEHWIFWVGPFIGALAAAAYHQYILRAAAIKAL-GSFRSNPS  280



>gb|AAG30607.1|AF314656_1 aquaporin [Brassica oleracea]
Length=281

 Score =   333 bits (855),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 180/232 (78%), Positives = 201/232 (87%), Gaps = 1/232 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIFVLVYCTAG+SGGHINPAVTFG
Sbjct  48   TLLFLYVTVATVIGHKKQTGPCDGVGLLGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFG  107

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL+RAV YM+AQCLGA+ GVG VKA  K  ++T+GGGANTV PG+SKG  L A
Sbjct  108  LFLARKVSLVRAVGYMIAQCLGAICGVGFVKAFMKTPYNTLGGGANTVAPGYSKGTALGA  167

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  168  EIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  227

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            GAAVI+NN+ AWDDHWIFWVGP +GA+A A YHQ +LRA AVKAL  SF+S 
Sbjct  228  GAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAVKAL-ASFRSN  278



>ref|XP_007200557.1| hypothetical protein PRUPE_ppa009691mg [Prunus persica]
 gb|EMJ01756.1| hypothetical protein PRUPE_ppa009691mg [Prunus persica]
Length=281

 Score =   333 bits (854),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 181/233 (78%), Positives = 201/233 (86%), Gaps = 1/233 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY++V+TVIG K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  48   TLLFLYITVSTVIGNKVQSGPCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  107

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAVAY+VAQ LGA+VGVGLVKA  K  +++ GGGANTV PG+SKG  L A
Sbjct  108  LFLARKVSLIRAVAYIVAQSLGAIVGVGLVKAFQKHNYNSQGGGANTVAPGYSKGTALGA  167

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  168  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSF  227

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            G AVI NN+ AWDD WIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct  228  GPAVIFNNEKAWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNP  279



>emb|CDX76314.1| BnaA08g10860D [Brassica napus]
Length=281

 Score =   333 bits (853),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 180/232 (78%), Positives = 202/232 (87%), Gaps = 1/232 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  48   TLLFLYVTVATVIGHKKQTGPCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  107

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL+RAV YM+AQCLGA+ GVG VKA  K  ++T+GGGANTV PG+SKG  L A
Sbjct  108  LFLARKVSLVRAVGYMIAQCLGAICGVGFVKAFMKTPYNTLGGGANTVAPGYSKGTALGA  167

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  168  EIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  227

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            GAAVI+N++ AWDDHWIFWVGP +GA+A A YHQ +LRA AVKAL  SF+S+
Sbjct  228  GAAVIYNHEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAVKAL-ASFRSS  278



>ref|XP_008236033.1| PREDICTED: aquaporin PIP2-7 [Prunus mume]
Length=281

 Score =   332 bits (852),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 182/233 (78%), Positives = 202/233 (87%), Gaps = 1/233 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY++V+TVIG K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  48   TLLFLYITVSTVIGNKVQSGPCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  107

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAVAY+VAQCLGA+VGVGLVKA  K  +++ GGGANTV  G+S+G  L A
Sbjct  108  LFLARKVSLIRAVAYIVAQCLGAIVGVGLVKAFQKHNYNSQGGGANTVASGYSRGTALGA  167

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  168  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSF  227

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            GAAVI NNK AWDD WIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct  228  GAAVIFNNKKAWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNP  279



>ref|XP_010526891.1| PREDICTED: probable aquaporin PIP2-8 [Tarenaya hassleriana]
Length=281

 Score =   332 bits (852),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 180/234 (77%), Positives = 202/234 (86%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  48   TLLFLYVTVATVIGHKKQSGPCDGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  107

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL+RAVAYMVAQCLGA+ GVGLVKA  K  ++ +GGGANTV  G++ G  L A
Sbjct  108  LFLARKVSLVRAVAYMVAQCLGAICGVGLVKAFMKSPYNRLGGGANTVADGYNTGTALGA  167

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  168  EIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  227

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+NN+ AWDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P 
Sbjct  228  GAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNPT  280



>tpg|DAA33864.1| TPA_inf: aquaporin PIP2;4 [Gossypium hirsutum]
Length=270

 Score =   332 bits (851),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 179/232 (77%), Positives = 202/232 (87%), Gaps = 1/232 (0%)
 Frame = +3

Query  6    LLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFGL  185
            LLFLYV+VATVIG K   D C G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVTFGL
Sbjct  38   LLFLYVTVATVIGHKKQQDACDGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  97

Query  186  FLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVAE  365
            FLARKVS IRAVAYMV+QCLGA+ GVGLVKA  K  ++++GGGANTV  G++KG  L AE
Sbjct  98   FLARKVSFIRAVAYMVSQCLGAICGVGLVKAFMKHPYNSLGGGANTVASGYNKGTALGAE  157

Query  366  ILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSFG  545
            I+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSFG
Sbjct  158  IIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFG  217

Query  546  AAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            AAVI+NN  AWD+HWIFWVGP +GA+A A+YHQ +LRA A+KAL GSF+S P
Sbjct  218  AAVIYNNDKAWDEHWIFWVGPFVGALAAAIYHQYILRATAIKAL-GSFRSNP  268



>gb|ACB71281.1| plasma membrane intrinsic protein [Tamarix hispida]
Length=281

 Score =   332 bits (851),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 180/234 (77%), Positives = 201/234 (86%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV++ATVIG K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  48   TLLFLYVTIATVIGYKIQKGPCDGVGLLGIAWSFGGMIFVLVYCTAGISGGHINPAVTFG  107

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAV YM+AQCLGAV GVGLVKA  K F+++ GGG N V PG++KG  L A
Sbjct  108  LFLARKVSLIRAVLYMIAQCLGAVCGVGLVKAFMKPFYNSQGGGTNLVAPGYTKGTALGA  167

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  168  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  227

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+NN   WD+HWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P+
Sbjct  228  GAAVIYNNDKVWDEHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNPS  280



>ref|XP_002521292.1| Aquaporin PIP2.7, putative [Ricinus communis]
 emb|CAE53883.1| aquaporin [Ricinus communis]
 gb|EEF41148.1| Aquaporin PIP2.7, putative [Ricinus communis]
Length=280

 Score =   332 bits (850),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 180/233 (77%), Positives = 201/233 (86%), Gaps = 1/233 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY++VATVIG K   DPC G G+LGI+W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  47   TLLFLYITVATVIGYKKQTDPCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  106

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAVAYMVAQCLGA+ GVGLVKA  K+ ++ +GGGAN+V  G+S G  L A
Sbjct  107  LFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKNPYNRLGGGANSVASGYSNGTALGA  166

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  167  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  226

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            GAAVI+NN   WDDHWIFWVGP +GA+A A YHQ VLRA  +KAL GSF+S P
Sbjct  227  GAAVIYNNDKVWDDHWIFWVGPFVGALAAAAYHQYVLRAAGIKAL-GSFRSNP  278



>ref|XP_010548112.1| PREDICTED: probable aquaporin PIP2-8 [Tarenaya hassleriana]
Length=281

 Score =   332 bits (850),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 181/233 (78%), Positives = 202/233 (87%), Gaps = 1/233 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  48   TLLFLYVTVATVIGHKKQTGPCDGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  107

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL+RAVAYMVAQCLGA+ GVGLVKA  K+ ++ +GGGANTV  G++ G  L A
Sbjct  108  LFLARKVSLVRAVAYMVAQCLGAICGVGLVKAFMKNPYNRLGGGANTVADGYNTGTALGA  167

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  168  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  227

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            GAAVI+NN  AWDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct  228  GAAVIYNNDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNP  279



>gb|ACU00102.1| plasma membrane intrinsic protein PIP2.6 [Populus trichocarpa 
x Populus deltoides]
Length=279

 Score =   331 bits (849),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 179/233 (77%), Positives = 202/233 (87%), Gaps = 1/233 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K+  DPC G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  46   TLLFLYVTVATVIGHKSNKDPCDGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  105

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAVAYM+AQCLGA+ GVGLVKA  K  ++++GGGANTV  G++ G  L A
Sbjct  106  LFLARKVSLIRAVAYMMAQCLGAICGVGLVKAFMKKNYNSLGGGANTVAMGYNTGTALGA  165

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+AT+PITGTGINPARSF
Sbjct  166  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATVPITGTGINPARSF  225

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
             AAVI NN+ AWDDHWIFWVGP +GA+A A YHQ +LRA A+ AL GSF+S P
Sbjct  226  XAAVIFNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIXAL-GSFRSNP  277



>ref|NP_195236.1| plasma membrane intrinsic protein 3 [Arabidopsis thaliana]
 ref|NP_001190920.1| plasma membrane intrinsic protein 3 [Arabidopsis thaliana]
 sp|P93004.2|PIP27_ARATH RecName: Full=Aquaporin PIP2-7; AltName: Full=Plasma membrane 
intrinsic protein 2-7; Short=AtPIP2;7; AltName: Full=Plasma 
membrane intrinsic protein 3; AltName: Full=Salt stress-induced 
major intrinsic protein; Contains: RecName: Full=Aquaporin 
PIP2-7, N-terminally processed [Arabidopsis thaliana]
 gb|AAL06563.1|AF412110_1 AT4g35100/M4E13_150 [Arabidopsis thaliana]
 emb|CAA17774.1| plasma membrane intrinsic protein (SIMIP) [Arabidopsis thaliana]
 emb|CAB80227.1| plasma membrane intrinsic protein (SIMIP) [Arabidopsis thaliana]
 gb|AAL32881.1| plasma membrane intrinsic protein (SIMIP) [Arabidopsis thaliana]
 gb|AAM10142.1| plasma membrane intrinsic protein (SIMIP) [Arabidopsis thaliana]
 gb|AAM66021.1| plasma membrane intrinsic protein SIMIP [Arabidopsis thaliana]
 dbj|BAH30556.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE86464.1| plasma membrane intrinsic protein 3 [Arabidopsis thaliana]
 gb|AEE86465.1| plasma membrane intrinsic protein 3 [Arabidopsis thaliana]
Length=280

 Score =   331 bits (849),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 179/232 (77%), Positives = 200/232 (86%), Gaps = 1/232 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  47   TLLFLYVTVATVIGHKKQTGPCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  106

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL+RA+ YM+AQCLGA+ GVG VKA  K  ++T+GGGANTV  G+SKG  L A
Sbjct  107  LFLARKVSLVRALGYMIAQCLGAICGVGFVKAFMKTPYNTLGGGANTVADGYSKGTALGA  166

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  167  EIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  226

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            GAAVI+NN+ AWDD WIFWVGP LGA+A A YHQ +LRA A+KAL GSF+S 
Sbjct  227  GAAVIYNNEKAWDDQWIFWVGPFLGALAAAAYHQYILRASAIKAL-GSFRSN  277



>gb|ACE60220.1| plasma membrane aquaporin [Rosa hybrid cultivar]
Length=281

 Score =   331 bits (849),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 179/234 (76%), Positives = 197/234 (84%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  48   TLLFLYVTVATVIGHKHQTGPCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  107

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAVAYMV QCLGA+ GV LVKA    +F T+GGG N+V  G+SKG  L A
Sbjct  108  LFLARKVSLIRAVAYMVVQCLGAIAGVALVKAFQSSYFKTLGGGTNSVSVGYSKGTALGA  167

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFV H+ATIPITGTGINPARSF
Sbjct  168  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFVEHLATIPITGTGINPARSF  227

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+N +  WDD WIFWVGP +GA+  A YHQ +LRA A+KAL GSF+S P+
Sbjct  228  GAAVIYNEEKVWDDQWIFWVGPFVGALCAAAYHQYILRAAAIKAL-GSFRSNPS  280



>dbj|BAD90701.1| plasma membrane intrinsic protein 2;5 [Mimosa pudica]
Length=281

 Score =   331 bits (848),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 180/234 (77%), Positives = 200/234 (85%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY++VATVIG K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  48   TLLFLYITVATVIGHKKQSGPCDGVGLLGIAWGFGGMIFVLVYCTAGISGGHINPAVTFG  107

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRA+AYMVAQCLGA+ G GLVKA  K  ++++GGGAN V  G+SKG  L A
Sbjct  108  LFLARKVSLIRALAYMVAQCLGAICGTGLVKAFMKHSYNSLGGGANEVNSGYSKGTALGA  167

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSA DPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  168  EIIGTFVLVYTVFSAIDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  227

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+NN  AWDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P 
Sbjct  228  GAAVIYNNGKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNPT  280



>ref|XP_006284279.1| hypothetical protein CARUB_v10005443mg [Capsella rubella]
 gb|EOA17177.1| hypothetical protein CARUB_v10005443mg [Capsella rubella]
Length=280

 Score =   330 bits (847),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 177/232 (76%), Positives = 200/232 (86%), Gaps = 1/232 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  47   TLLFLYVTVATVIGHKKQTGPCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  106

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            L LARKVSL+RA+ YM++QCLGA+ GVG VKA  K  ++T+GGGANTV  G++ G  L A
Sbjct  107  LLLARKVSLVRAIGYMISQCLGAICGVGFVKAFMKTPYNTLGGGANTVADGYNNGTALGA  166

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  167  EIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  226

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            GAAVI+NN+ AWDDHWIFWVGP LGA+A A+YHQ VLRA A+KAL GSF+S 
Sbjct  227  GAAVIYNNEKAWDDHWIFWVGPFLGALAAAIYHQFVLRASAIKAL-GSFRSN  277



>ref|XP_010266027.1| PREDICTED: aquaporin PIP2-7-like [Nelumbo nucifera]
Length=280

 Score =   330 bits (847),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 182/234 (78%), Positives = 199/234 (85%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG     D C G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  47   TLLFLYVTVATVIGHSKQGDACAGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  106

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAVAYMVAQCLGA+ GVGLVKA  K  ++  GGGAN+V  G+SKG  L A
Sbjct  107  LFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHAYNANGGGANSVNAGYSKGTALGA  166

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  167  EIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  226

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI N +  WDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S PN
Sbjct  227  GAAVIFNREKIWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNPN  279



>gb|ACR56615.1| plasma intrinsic protein 2;5 [Juglans regia]
Length=281

 Score =   330 bits (847),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 179/234 (76%), Positives = 202/234 (86%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY++VATVIG K + DPC   GLLG++W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  48   TLLFLYITVATVIGYKKSADPCNSVGLLGVAWAFGGMIFVLVYCTAGISGGHINPAVTFG  107

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAVAYMVAQCLGA+ GVGLVKA  K  ++  GGGAN+V  G+SKG  L A
Sbjct  108  LFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHDYNAQGGGANSVAHGYSKGTALGA  167

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  168  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSF  227

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI++N   WD+HWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P+
Sbjct  228  GAAVIYDNDKIWDEHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNPS  280



>ref|XP_008377729.1| PREDICTED: probable aquaporin PIP2-8 [Malus domestica]
Length=281

 Score =   330 bits (846),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 183/233 (79%), Positives = 203/233 (87%), Gaps = 1/233 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY++VATVIG K +   C G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  48   TLLFLYITVATVIGHKNSLGDCGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  107

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAVAYMVAQCLGA+VGVGLVKA  K  +++VGGGAN+V  G+SKG  L A
Sbjct  108  LFLARKVSLIRAVAYMVAQCLGAIVGVGLVKAFQKHKYNSVGGGANSVASGYSKGTALGA  167

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  168  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSF  227

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            GAAVI+NN   WDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct  228  GAAVIYNNDKIWDDHWIFWVGPFVGALAAAAYHQYILRAAALKAL-GSFRSNP  279



>ref|XP_009105909.1| PREDICTED: aquaporin PIP2-7 [Brassica rapa]
 emb|CDY52648.1| BnaAnng11630D [Brassica napus]
Length=281

 Score =   330 bits (846),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 179/232 (77%), Positives = 200/232 (86%), Gaps = 1/232 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  48   TLLFLYVTVATVIGHKKQTGPCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  107

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL+RAV YM+AQCLGA+ GVG VKA  K  ++T+GGGANTV  G+S G  L A
Sbjct  108  LFLARKVSLVRAVGYMIAQCLGAICGVGFVKAFMKTPYNTLGGGANTVADGYSTGTALGA  167

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  168  EIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  227

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            GAAVI+NN+ AWDDHWIFWVGP +GA+A A YHQ +LRA AVKAL  SF+S+
Sbjct  228  GAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAVKAL-ASFRSS  278



>gb|AFB83067.1| plasma intrinsic protein PIP2.1 [Helianthemum almeriense]
Length=279

 Score =   329 bits (844),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 179/233 (77%), Positives = 200/233 (86%), Gaps = 1/233 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG       C G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  46   TLLFLYVTVATVIGDLKQTGNCNGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  105

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAVAYM+AQCLGA+ GVGLVKA  K  ++T GGGAN+V  G+SKG  L A
Sbjct  106  LFLARKVSLIRAVAYMIAQCLGAICGVGLVKAFMKHDYNTFGGGANSVNSGYSKGTALGA  165

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  166  EIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  225

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            GAAVI NN+ +WDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct  226  GAAVIFNNQKSWDDHWIFWVGPFIGALAAAAYHQYILRAAAIKAL-GSFRSNP  277



>emb|CDX69112.1| BnaC01g03410D [Brassica napus]
Length=281

 Score =   329 bits (844),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 179/232 (77%), Positives = 199/232 (86%), Gaps = 1/232 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  48   TLLFLYVTVATVIGHKKQTGPCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  107

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL+RAV YM+AQCLGA+ GVG VKA  K  ++T+GGGANTV  G+S G  L A
Sbjct  108  LFLARKVSLVRAVGYMIAQCLGAICGVGFVKAFMKTPYNTLGGGANTVADGYSTGTALGA  167

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  168  EIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  227

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            GAAVI+NN+ AWDDHWIFWVGP +GA+A A YHQ +LRA AVKAL  SF+S 
Sbjct  228  GAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAVKAL-ASFRSN  278



>gb|ADL16407.1| aquaporin [Dianthus caryophyllus]
 gb|AFC90119.1| pip2 [Dianthus caryophyllus]
Length=285

 Score =   329 bits (844),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 176/234 (75%), Positives = 201/234 (86%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY++VATVIG K    PC G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  52   TLLFLYITVATVIGHKKQTGPCDGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  111

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRA+ YM++QCLGA+ GVGLVKA  K  ++T+GGGAN+V  G++KG  L A
Sbjct  112  LFLARKVSLIRALTYMISQCLGAICGVGLVKAFMKHPYNTLGGGANSVATGYNKGTALGA  171

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  172  EIIGTFVLVYTVFSATDPKRSARDSHVPILAPLPIGFAVFMVHLATIPITGTGINPARSF  231

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+NNK  WDD WIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P 
Sbjct  232  GAAVIYNNKKIWDDQWIFWVGPFIGALAAAAYHQYILRAAAIKAL-GSFRSNPT  284



>gb|KFK30134.1| hypothetical protein AALP_AA7G221400 [Arabis alpina]
Length=282

 Score =   329 bits (843),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 178/232 (77%), Positives = 199/232 (86%), Gaps = 1/232 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  49   TLLFLYVTVATVIGHKKQTGPCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  108

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL+RAV YM++QCLGA+ GVG VKA  K  ++T+GGGAN V  G++KG  L A
Sbjct  109  LFLARKVSLVRAVGYMISQCLGAICGVGFVKAFMKTPYNTLGGGANMVADGYNKGTALGA  168

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  169  EIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  228

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            GAAVI+NN+ AWDD WIFWVGP LGA+A A YHQ +LRA AVKAL GSF+S 
Sbjct  229  GAAVIYNNEKAWDDQWIFWVGPFLGALAAAAYHQYILRAAAVKAL-GSFRSN  279



>gb|KCW55551.1| hypothetical protein EUGRSUZ_I01429 [Eucalyptus grandis]
Length=281

 Score =   329 bits (843),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 178/234 (76%), Positives = 201/234 (86%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  48   TLLFLYVTVATVIGHKKQTGPCDGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  107

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRA++YM+AQCLGA+ GVGLVKA  K F++++GGGAN+V  G+S G  L A
Sbjct  108  LFLARKVSLIRALSYMIAQCLGAICGVGLVKAFMKPFYNSLGGGANSVATGYSTGTALGA  167

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  168  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  227

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+NN   WDD WIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P 
Sbjct  228  GAAVIYNNGKVWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNPT  280



>ref|XP_010266854.1| PREDICTED: probable aquaporin PIP2-8 [Nelumbo nucifera]
Length=280

 Score =   329 bits (843),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 180/234 (77%), Positives = 198/234 (85%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG     D C G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  47   TLLFLYVTVATVIGHSKQGDACSGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  106

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAVAYMVAQCLGA+ GVGLVKA  K  ++  GGGAN+V  G+SKG  L A
Sbjct  107  LFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHSYNRYGGGANSVSAGYSKGTALGA  166

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR  RDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  167  EIIGTFLLVYTVFSATDPKRKTRDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  226

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+N   AWDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P+
Sbjct  227  GAAVIYNGDKAWDDHWIFWVGPFIGALAAAAYHQYILRAAAIKAL-GSFRSNPS  279



>dbj|BAF32042.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32043.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32044.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32045.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32046.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32047.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32048.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32049.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32050.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32051.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32052.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32053.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32054.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32055.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32056.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32057.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32058.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32059.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32060.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32061.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32062.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32063.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32064.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32065.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32066.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32067.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32068.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32069.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32070.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32071.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32072.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32073.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32074.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32075.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32076.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32077.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32078.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32079.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32080.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32081.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32082.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32083.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32084.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32085.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32086.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32087.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32088.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32089.1| putative aquaporin [Cryptomeria japonica]
Length=275

 Score =   328 bits (842),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 182/235 (77%), Positives = 199/235 (85%), Gaps = 1/235 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY++VATVIG K T   C   G+LGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  42   TLLFLYITVATVIGHKRTAANCGSVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  101

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL RAV YMVAQCLGA+ GVGLVKA  K F+D  GGGAN+V PG+SKG GL A
Sbjct  102  LFLARKVSLPRAVLYMVAQCLGAICGVGLVKAFQKSFYDMYGGGANSVAPGYSKGTGLGA  161

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  162  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  221

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  707
            GAAVI+ +   WDD WIFWVGP LGA A A YHQ +LRA A+KAL GSF+S PNV
Sbjct  222  GAAVIYGHDKIWDDQWIFWVGPFLGAFAAAFYHQYILRAAAIKAL-GSFRSNPNV  275



>gb|AFB82643.1| aquaporin [Camellia sinensis]
Length=279

 Score =   329 bits (843),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 176/233 (76%), Positives = 203/233 (87%), Gaps = 1/233 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY+++ATVIG K    PC G G+LGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  46   TLLFLYITIATVIGHKKQTGPCDGVGILGIAWSFGGMIFVLVYCTAGISGGHINPAVTFG  105

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRA+A M+AQCLGA+ GVGLVKA  K  ++++GGGAN+V  G++KG  L A
Sbjct  106  LFLARKVSLIRALACMIAQCLGAICGVGLVKAFMKSSYNSLGGGANSVAHGYNKGTALGA  165

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  166  EIIGTFVLVYTVFAATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  225

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            GAAVI+NNKH WD+HWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct  226  GAAVIYNNKHIWDEHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNP  277



>ref|XP_009355655.1| PREDICTED: probable aquaporin PIP2-8 [Pyrus x bretschneideri]
Length=281

 Score =   328 bits (842),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 180/233 (77%), Positives = 203/233 (87%), Gaps = 1/233 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY++VATVIG K +   C G GLLG++W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  48   TLLFLYITVATVIGYKNSTGDCGGVGLLGVAWAFGGMIFVLVYCTAGISGGHINPAVTFG  107

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAVAYMVAQCLGA+VGVGLVKA  K  +++VGGGAN+V  G++KG  L A
Sbjct  108  LFLARKVSLIRAVAYMVAQCLGAIVGVGLVKAFQKHKYNSVGGGANSVASGYNKGTALGA  167

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  168  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSF  227

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            GAAVI+NN   WD+HWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct  228  GAAVIYNNDKIWDEHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNP  279



>ref|XP_009138343.1| PREDICTED: aquaporin PIP2-7-like [Brassica rapa]
Length=281

 Score =   328 bits (842),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 179/232 (77%), Positives = 199/232 (86%), Gaps = 1/232 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  48   TLLFLYVTVATVIGHKKQTGPCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  107

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL+RAV YM+AQCLGAV GVG VKA  K  ++T+GGGANTV  G+S G  L A
Sbjct  108  LFLARKVSLVRAVGYMIAQCLGAVCGVGFVKAFMKTPYNTLGGGANTVADGYSNGTALGA  167

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  168  EIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  227

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            GAAVI+NN+ AWDDHWIFWVGP +GA+A A YHQ +LRA A+KAL  SF+S 
Sbjct  228  GAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-ASFRSN  278



>ref|XP_002312952.1| hypothetical protein POPTR_0009s13890g [Populus trichocarpa]
 gb|ABK94564.1| unknown [Populus trichocarpa]
 gb|EEE86907.1| hypothetical protein POPTR_0009s13890g [Populus trichocarpa]
Length=279

 Score =   328 bits (841),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 180/234 (77%), Positives = 201/234 (86%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K   D C G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  46   TLLFLYVTVATVIGHKKNQDACGGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  105

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            L LARKVSLIRAV YMVAQCLGAV GVGLVKA  K +++++GGGAN V PG+S G  + A
Sbjct  106  LLLARKVSLIRAVGYMVAQCLGAVCGVGLVKAFMKPYYNSLGGGANMVAPGYSTGTAVGA  165

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  166  EIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  225

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI N+K AWDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P 
Sbjct  226  GAAVIINDKKAWDDHWIFWVGPFVGALAAAAYHQYILRAGAIKAL-GSFRSHPT  278



>emb|CDX72515.1| BnaC07g45370D [Brassica napus]
Length=254

 Score =   327 bits (839),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 178/232 (77%), Positives = 198/232 (85%), Gaps = 1/232 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  21   TLLFLYVTVATVIGHKKQTGPCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  80

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL+RAV YM+AQCLGA+ GVG VKA  K  ++T+GGGAN V  G+S G  L A
Sbjct  81   LFLARKVSLVRAVGYMIAQCLGAICGVGFVKAFMKTPYNTLGGGANMVADGYSNGTALGA  140

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  141  EIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  200

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            GAAVI+NN+ AWDDHWIFWVGP +GA+A A YHQ +LRA AVKAL  SF+S 
Sbjct  201  GAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAVKAL-ASFRSN  251



>ref|XP_006846771.1| hypothetical protein AMTR_s00148p00023270 [Amborella trichopoda]
 gb|ERN08352.1| hypothetical protein AMTR_s00148p00023270 [Amborella trichopoda]
Length=283

 Score =   328 bits (842),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 179/237 (76%), Positives = 200/237 (84%), Gaps = 3/237 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTK--ATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLYV+VATVIG K  +  D C G G+LGI+W FGGMIF+LVYCTAGISGGHINPAVT
Sbjct  48   TLLFLYVTVATVIGYKRVSEADQCDGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVT  107

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGLFLARKVSLIRAV YMVAQCLGA+ GVGLVK     +++  GGGANT+  G+ KGVGL
Sbjct  108  FGLFLARKVSLIRAVMYMVAQCLGAICGVGLVKGFQSAYYNRYGGGANTLSNGYDKGVGL  167

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  168  GAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPAR  227

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  707
            S GAAVI+NNK AWDD WIFWVGP +GA   A YHQ +LRA A+KAL GSF+S PNV
Sbjct  228  SLGAAVIYNNKKAWDDQWIFWVGPFIGAAIAAAYHQYILRAAAIKAL-GSFRSNPNV  283



>ref|XP_002869108.1| hypothetical protein ARALYDRAFT_491143 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45367.1| hypothetical protein ARALYDRAFT_491143 [Arabidopsis lyrata subsp. 
lyrata]
Length=280

 Score =   328 bits (841),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 178/232 (77%), Positives = 199/232 (86%), Gaps = 1/232 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K     C G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  47   TLLFLYVTVATVIGHKKQTGACDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  106

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL+RA+ YM+AQCLGA+ GVG VKA  K  ++T+GGGANTV  G+SKG  L A
Sbjct  107  LFLARKVSLVRALGYMIAQCLGAICGVGFVKAFMKTPYNTLGGGANTVADGYSKGTALGA  166

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  167  EIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  226

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            GAAVI+NN+ AWDD WIFWVGP LGA+A A YHQ +LRA A+KAL GSF+S 
Sbjct  227  GAAVIYNNEKAWDDQWIFWVGPFLGALAAAAYHQYILRASAIKAL-GSFRSN  277



>ref|XP_003522619.2| PREDICTED: aquaporin PIP2-7 [Glycine max]
Length=322

 Score =   329 bits (844),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 179/233 (77%), Positives = 201/233 (86%), Gaps = 1/233 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  89   TLLFLYVTVATVIGHKKQTGPCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  148

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRA+ YMVAQCLGA+ GVGLVKA  K  ++++GGGAN+V  G++KG  L A
Sbjct  149  LFLARKVSLIRALFYMVAQCLGAICGVGLVKAFMKHSYNSLGGGANSVSAGYNKGSALGA  208

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  209  EIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  268

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            GAAVI+NN   WDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct  269  GAAVIYNNGKVWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNP  320



>ref|XP_010432340.1| PREDICTED: aquaporin PIP2-7 [Camelina sativa]
 ref|XP_010437523.1| PREDICTED: aquaporin PIP2-7 isoform X1 [Camelina sativa]
 ref|XP_010437524.1| PREDICTED: aquaporin PIP2-7 isoform X2 [Camelina sativa]
 ref|XP_010437525.1| PREDICTED: aquaporin PIP2-7 isoform X2 [Camelina sativa]
 ref|XP_010446981.1| PREDICTED: aquaporin PIP2-7 [Camelina sativa]
Length=280

 Score =   328 bits (840),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 177/232 (76%), Positives = 199/232 (86%), Gaps = 1/232 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  47   TLLFLYVTVATVIGHKKQTGPCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  106

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            L LARKVSL+RAV YM++QCLGA+ GVG VKA  K  ++T+GGGANTV  G++ G  L A
Sbjct  107  LLLARKVSLVRAVGYMISQCLGAICGVGFVKAFMKTPYNTLGGGANTVADGYNIGTALGA  166

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  167  EIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  226

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            GAAVI+NN+ AWDD WIFWVGP LGA+A A+YHQ VLRA A+KAL GSF+S 
Sbjct  227  GAAVIYNNEKAWDDQWIFWVGPFLGALAAAIYHQFVLRASAIKAL-GSFRSN  277



>ref|XP_006846905.1| hypothetical protein AMTR_s00152p00041700 [Amborella trichopoda]
 gb|ERN08486.1| hypothetical protein AMTR_s00152p00041700 [Amborella trichopoda]
Length=280

 Score =   328 bits (840),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 181/234 (77%), Positives = 203/234 (87%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K   DPC G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  47   TLLFLYVTVATVIGYKKERDPCGGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  106

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL+RAV YMVAQCLGA+ GVGLVKA  K  ++ +GGGAN V  G++KGVGL A
Sbjct  107  LFLARKVSLVRAVMYMVAQCLGAICGVGLVKAFMKPLYNNLGGGANEVVHGYTKGVGLGA  166

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  167  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  226

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+N+  AWDDHW+FWVGP +GA A A YHQ +LRA A+KAL GSF+S P+
Sbjct  227  GAAVIYNSDKAWDDHWVFWVGPFVGAAAAAAYHQYILRAAAIKAL-GSFRSNPH  279



>ref|XP_009108681.1| PREDICTED: aquaporin PIP2-7-like [Brassica rapa]
Length=281

 Score =   328 bits (840),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 179/232 (77%), Positives = 200/232 (86%), Gaps = 1/232 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPA TFG
Sbjct  48   TLLFLYVTVATVIGHKKQTGPCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAGTFG  107

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL+RAV YM+AQCLGA+ GVG VKA  K  ++T+GGGANTV PG+SKG  L A
Sbjct  108  LFLARKVSLVRAVGYMIAQCLGAICGVGFVKAFMKTPYNTLGGGANTVAPGYSKGTALGA  167

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  168  EIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  227

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            GAAVI+NN+ A DDHWIFWVGP +GA+A A YHQ +LRA AVKAL  SF+S+
Sbjct  228  GAAVIYNNEKARDDHWIFWVGPFVGALAAAAYHQYILRAAAVKAL-ASFRSS  278



>ref|XP_011092966.1| PREDICTED: aquaporin PIP2-7 [Sesamum indicum]
Length=283

 Score =   328 bits (840),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 178/235 (76%), Positives = 202/235 (86%), Gaps = 3/235 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKA--TPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLYV+VATVIG K     D C G G+LGI+W FGGMIF+LVYCTAGISGGHINPAVT
Sbjct  48   TLLFLYVTVATVIGHKKLNAADQCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT  107

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGLFLARKVSLIRA+ YM+AQCLGA+ GVGLVKA  K +++ +GGGAN+V PG++KG  L
Sbjct  108  FGLFLARKVSLIRALGYMIAQCLGAICGVGLVKAFMKSYYNGLGGGANSVAPGYNKGTAL  167

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  168  GAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  227

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            SFGAAVI+NN   WDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct  228  SFGAAVIYNNDKVWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNP  281



>ref|XP_004493972.1| PREDICTED: probable aquaporin PIP2-5-like [Cicer arietinum]
Length=287

 Score =   328 bits (840),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 180/241 (75%), Positives = 199/241 (83%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYV+VATVIG  +  DP      C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  48   TLLFLYVTVATVIGYNSQTDPAHNGTACDGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  107

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRA+ YMV QCLGA+ GVGLVK   K +++   GGAN +  G+SK
Sbjct  108  PAVTFGLFLARKVSLIRAILYMVVQCLGAICGVGLVKGFQKSYYNRYKGGANMLSNGYSK  167

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFV H+ATIPITGTGI
Sbjct  168  GTGLGAEIIGTFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVVHLATIPITGTGI  227

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARS GAAVI+NN  AWD HWIFWVGP +GA   A+YHQ VLRAQA KAL GSF+S+ N
Sbjct  228  NPARSLGAAVIYNNHKAWDHHWIFWVGPFIGAAIAAIYHQFVLRAQAAKAL-GSFKSSSN  286

Query  705  V  707
            +
Sbjct  287  L  287



>ref|XP_003625627.1| Aquaporin PIP2-1 [Medicago truncatula]
 gb|ABD32807.1| Major intrinsic protein [Medicago truncatula]
 gb|AES81845.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=287

 Score =   327 bits (838),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 182/241 (76%), Positives = 201/241 (83%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYV+V TVIG  A  DP      C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  48   TLLFLYVTVLTVIGYNAQTDPAHNGTNCDGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  107

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRAV YMVAQCLGA+ GVGLVKA  K +++   GGAN +  G+SK
Sbjct  108  PAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGLVKAFQKGYYNRYKGGANMLSAGYSK  167

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  168  GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  227

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARSFGAAVI+NN+ AWDD WIFWVGP +GA   A+YHQ VLRAQA KAL GSF+S+ N
Sbjct  228  NPARSFGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAIYHQFVLRAQAAKAL-GSFRSSSN  286

Query  705  V  707
            +
Sbjct  287  L  287



>gb|AEY75254.1| aquaporin [Atriplex canescens]
Length=282

 Score =   327 bits (838),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 176/234 (75%), Positives = 198/234 (85%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY++VATVIG K   DPC   GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  49   TLLFLYITVATVIGYKKETDPCASVGLLGIAWSFGGMIFVLVYCTAGISGGHINPAVTFG  108

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL+RA+ YM+AQC GA+ GVGLVKA  K  ++  GGGAN+V  G++KG    A
Sbjct  109  LFLARKVSLLRALVYMIAQCAGAICGVGLVKAFMKGPYNQFGGGANSVALGYNKGTAFGA  168

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            E+L TF LVYTVFSATDPKR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  169  ELLGTFVLVYTVFSATDPKRSARDSHVPILAPLPIGFAVFMVHLATIPITGTGINPARSF  228

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+NNK  WDDHWIFWVGP +GA+A A YHQ VLRA A+KAL GSF+S P 
Sbjct  229  GAAVIYNNKKVWDDHWIFWVGPFVGALAAAAYHQYVLRAAAIKAL-GSFRSNPT  281



>ref|XP_007009830.1| Plasma membrane intrinsic protein 2A [Theobroma cacao]
 gb|EOY18640.1| Plasma membrane intrinsic protein 2A [Theobroma cacao]
Length=281

 Score =   327 bits (837),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 178/239 (74%), Positives = 201/239 (84%), Gaps = 5/239 (2%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKA----TPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPA  170
            TLLFLY++V TVIG K+    + D C G G+LGI+W FGGMIF+LVYCTAGISGGHINPA
Sbjct  44   TLLFLYITVLTVIGNKSQVGTSNDSCAGVGILGIAWAFGGMIFILVYCTAGISGGHINPA  103

Query  171  VTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGV  350
            VTFGLF+ARKVSLIRA+AYMVAQ LGA+ GVGLVKA  K F++  GGGANT+  G+S G 
Sbjct  104  VTFGLFVARKVSLIRAIAYMVAQSLGAICGVGLVKAFQKSFYNRYGGGANTLSDGYSTGT  163

Query  351  GLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINP  530
            GL AEI+ TF LVYTVFSATDPKR ARDSHVPVLAPLPIGFAVF+ H+ATIP+TGTGINP
Sbjct  164  GLGAEIIGTFVLVYTVFSATDPKRKARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  223

Query  531  ARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  707
            ARSFGAAVI+NNK AWDDHWIFWVGPM+GA   A YHQ +LRA A KAL GSF+S  +V
Sbjct  224  ARSFGAAVIYNNKKAWDDHWIFWVGPMIGAAIAAFYHQFILRAGAAKAL-GSFRSQTHV  281



>gb|AAB67869.1| plasma membrane major intrinsic protein 2 [Beta vulgaris]
Length=281

 Score =   327 bits (837),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 176/234 (75%), Positives = 198/234 (85%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY++VATVIG K   DPC   GLLGI+W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  48   TLLFLYITVATVIGYKNETDPCATVGLLGIAWSFGGMIFILVYCTAGISGGHINPAVTFG  107

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL+RA  YMV QC GA+ GVGLVKA     +  +GGGAN+VQPG++KG  L A
Sbjct  108  LFLARKVSLLRAFFYMVGQCAGAICGVGLVKAFMSGAYVRLGGGANSVQPGYNKGTALGA  167

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  168  EIIGTFVLVYTVFSATDPKRSARDSHVPILAPLPIGFAVFMVHLATIPITGTGINPARSF  227

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI N+K AWDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P 
Sbjct  228  GAAVIFNDKKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNPT  280



>gb|ACN40330.1| unknown [Picea sitchensis]
Length=282

 Score =   327 bits (837),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 176/235 (75%), Positives = 199/235 (85%), Gaps = 1/235 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY+++ATVIG   T   C   G+LGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  49   TLLFLYITIATVIGHSRTSTNCGSVGVLGIAWSFGGMIFVLVYCTAGISGGHINPAVTFG  108

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL RA+ YM+AQCLGA+ G GLVKA  K F+D  GGGAN V PG++KGVGL A
Sbjct  109  LFLARKVSLPRAILYMIAQCLGAICGTGLVKAFQKSFYDQNGGGANFVHPGYTKGVGLAA  168

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  169  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  228

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  707
            GAAVI+ +K +WDDHWIFWVGP +GA   A YHQ +LRA A+KAL GSF+S P+V
Sbjct  229  GAAVIYGHKQSWDDHWIFWVGPFIGAALAAAYHQYILRAAAIKAL-GSFRSNPHV  282



>gb|AAL49750.1|AF452012_1 aquaporin-like protein [Petunia x hybrida]
Length=283

 Score =   326 bits (836),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 175/235 (74%), Positives = 200/235 (85%), Gaps = 3/235 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKAT--PDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLYV+VATVIG K     D C G G+LGI+W FGGMIFVLVYCTAGISGGHINPAVT
Sbjct  48   TLLFLYVTVATVIGHKKLNGADKCDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVT  107

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGLFLARKVSL RA+AY+++Q LGA+ GVGLVKA  K +++++GGGAN+V  G+S G  L
Sbjct  108  FGLFLARKVSLTRAIAYIISQSLGAICGVGLVKAFMKSYYNSLGGGANSVNSGYSNGTAL  167

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  168  GAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  227

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            SFGAAVI+NN   WDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct  228  SFGAAVIYNNDKVWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNP  281



>gb|ABL76066.1| aquaporin 2 [Bruguiera gymnorhiza]
Length=280

 Score =   326 bits (836),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 178/232 (77%), Positives = 199/232 (86%), Gaps = 1/232 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV++ATVIG K    PC G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  47   TLLFLYVTIATVIGHKKQTGPCDGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  106

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRA+AYMVAQCLGA+ GVGLVKA  K  ++++GGGAN V  G++KG  L A
Sbjct  107  LFLARKVSLIRALAYMVAQCLGAICGVGLVKAFMKHSYNSLGGGANFVNAGYNKGTALGA  166

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  167  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  226

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            GAAVIHNN   WDD WIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S 
Sbjct  227  GAAVIHNNDKIWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSN  277



>dbj|BAO18631.1| plasmamembrane intrinsic protein 2;9 [Solanum lycopersicum]
Length=283

 Score =   326 bits (835),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 178/234 (76%), Positives = 200/234 (85%), Gaps = 3/234 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATP--DPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLYV+VATVIG K     D C G G+LGI+W FGGMIFVLVYCTAGISGGHINPAVT
Sbjct  48   TLLFLYVTVATVIGHKKLNALDQCDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVT  107

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGLFLARKVSLIRAVAY++AQ LGA+ GVG VKA  K +++T GGGAN VQPG++ G  L
Sbjct  108  FGLFLARKVSLIRAVAYIIAQSLGAICGVGFVKAFMKHYYNTEGGGANFVQPGYNNGTAL  167

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  168  GAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  227

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            SFGAAVI+ N+  WDD WIFWVGPM+GA+A A+YHQ +LRA AVKAL GSF+S 
Sbjct  228  SFGAAVIYGNEKIWDDQWIFWVGPMVGAMAAAIYHQFILRAGAVKAL-GSFRSN  280



>gb|ACU00103.1| plasma membrane intrinsic protein PIP2.1 [Populus trichocarpa 
x Populus deltoides]
Length=285

 Score =   326 bits (835),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 180/241 (75%), Positives = 199/241 (83%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKA------TPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG K+        D C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  46   TLLFLYITVLTVIGYKSQTDTTKNSDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  105

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSL+RAV YMVAQCLGA+ G GLVKA  K ++   GGGAN +  GFSK
Sbjct  106  PAVTFGLFLARKVSLVRAVLYMVAQCLGAICGCGLVKAFQKSYYTKYGGGANELATGFSK  165

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  166  GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  225

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARSFGAAVI+N   AWDDHWIFWVGP +GA   A+YHQ VLRA AVKAL GSF+S+ N
Sbjct  226  NPARSFGAAVIYNEDKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVKAL-GSFRSSSN  284

Query  705  V  707
            +
Sbjct  285  I  285



>ref|XP_006381455.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
 gb|ABK94847.1| unknown [Populus trichocarpa]
 gb|ERP59252.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
Length=285

 Score =   326 bits (835),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 180/241 (75%), Positives = 199/241 (83%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKA------TPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG K+        D C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  46   TLLFLYITVLTVIGYKSQTDTTKNSDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  105

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSL+RAV YMVAQCLGA+ G GLVKA  K ++   GGGAN +  GFSK
Sbjct  106  PAVTFGLFLARKVSLVRAVLYMVAQCLGAICGCGLVKAFQKSYYTKYGGGANELATGFSK  165

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  166  GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  225

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARSFGAAVI+N   AWDDHWIFWVGP +GA   A+YHQ VLRA AVKAL GSF+S+ N
Sbjct  226  NPARSFGAAVIYNKDKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVKAL-GSFRSSSN  284

Query  705  V  707
            +
Sbjct  285  I  285



>gb|AAC32107.1| probable aquaporin [Picea mariana]
Length=282

 Score =   326 bits (835),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 178/235 (76%), Positives = 198/235 (84%), Gaps = 1/235 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY++VATVIG K     C   GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  49   TLLFLYITVATVIGHKRNQAACGSVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  108

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL RAV YMVAQCLGA+ G GLVKA  K ++D  GGGAN+V  G++KGVGL A
Sbjct  109  LFLARKVSLPRAVLYMVAQCLGAICGCGLVKAFQKSYYDQYGGGANSVAHGYTKGVGLSA  168

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  169  EIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  228

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  707
            GAAVI+ ++  WD+HWIFWVGP LGA   A YHQ +LRA A+KAL GSF+S P+V
Sbjct  229  GAAVIYGHQKIWDEHWIFWVGPFLGAAGAAAYHQYILRAGAIKAL-GSFRSNPHV  282



>gb|ACR56614.1| plasma intrinsic protein 2;4 [Juglans regia]
Length=280

 Score =   326 bits (835),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 179/234 (76%), Positives = 201/234 (86%), Gaps = 2/234 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY++VATVIG K +  PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  48   TLLFLYITVATVIGYKKS-GPCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  106

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAV YMVAQCLGA+ GVGLVKA  K  ++T+GGG N+V  G+SKG  L A
Sbjct  107  LFLARKVSLIRAVVYMVAQCLGAICGVGLVKAFMKHDYNTLGGGTNSVAQGYSKGTALGA  166

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  167  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSF  226

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI++N   WD+HWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P 
Sbjct  227  GAAVIYDNDKVWDEHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNPT  279



>gb|AEY75242.1| plasma membrane intrinsic protein [Malus hupehensis]
Length=287

 Score =   326 bits (835),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 178/241 (74%), Positives = 197/241 (82%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYV+V TVIG K+  DP      C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  48   TLLFLYVTVLTVIGYKSQTDPATNADACGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  107

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSL+RAV YMVAQ LGA+ GV LVKA  K ++   GGGAN++  G+S 
Sbjct  108  PAVTFGLFLARKVSLVRAVMYMVAQSLGAIAGVALVKAFQKSYYIKYGGGANSLSDGYST  167

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            GVGL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  168  GVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGI  227

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARS GAAVI+N   AWDD WIFWVGP +GA   A YHQ +LRA AVKAL GSF+S PN
Sbjct  228  NPARSLGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKAL-GSFRSNPN  286

Query  705  V  707
            V
Sbjct  287  V  287



>ref|NP_179277.1| putative aquaporin PIP2-8 [Arabidopsis thaliana]
 sp|Q9ZVX8.1|PIP28_ARATH RecName: Full=Probable aquaporin PIP2-8; AltName: Full=Plasma 
membrane intrinsic protein 2-8; Short=AtPIP2;8; AltName: Full=Plasma 
membrane intrinsic protein 3b; Short=PIP3b; Contains: 
RecName: Full=Probable aquaporin PIP2-8, N-terminally processed 
[Arabidopsis thaliana]
 gb|AAC64216.1| putative plasma membrane intrinsic protein [Arabidopsis thaliana]
 gb|AAM15086.1| putative plasma membrane intrinsic protein [Arabidopsis thaliana]
 gb|AAO63278.1| At2g16850 [Arabidopsis thaliana]
 dbj|BAF00056.1| putative aquaporin [Arabidopsis thaliana]
 gb|AEC06543.1| putative aquaporin PIP2-8 [Arabidopsis thaliana]
Length=278

 Score =   325 bits (833),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 181/234 (77%), Positives = 198/234 (85%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  45   TLLFLYVTVATVIGHKNQTGPCGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  104

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL RAVAYMVAQCLGA+ GVGLVKA     +  +GGGANTV  G+S G  L A
Sbjct  105  LFLARKVSLPRAVAYMVAQCLGAICGVGLVKAFMMTPYKRLGGGANTVADGYSTGTALGA  164

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  165  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  224

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+NN+ AWDDHWIFWVGP +GA+A A YHQ +LRA A+KAL  SF+S P 
Sbjct  225  GAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-ASFRSNPT  277



>ref|XP_009782764.1| PREDICTED: aquaporin PIP2-7 [Nicotiana sylvestris]
 tpg|DAA64682.1| TPA_exp: aquaporin PIP2 7a [Nicotiana tabacum]
Length=284

 Score =   325 bits (833),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 176/236 (75%), Positives = 199/236 (84%), Gaps = 3/236 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKAT--PDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLYV+VATVIG K     D C G G+LGISW FGGMIFVLVYCTAGISGGHINPAVT
Sbjct  49   TLLFLYVTVATVIGHKKLNGADKCDGVGILGISWAFGGMIFVLVYCTAGISGGHINPAVT  108

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGLFLARKVSL+RAV Y++AQ LGA+ GVGLVK   K +++T+GGGAN VQPG++KG  L
Sbjct  109  FGLFLARKVSLLRAVGYIIAQSLGAICGVGLVKGFMKHYYNTLGGGANFVQPGYNKGTAL  168

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  169  GAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  228

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            SFGAAVI+N +  WDD WIFWVGP +GA+  AVYHQ +LR  A+KAL GSF+S P 
Sbjct  229  SFGAAVIYNTEKVWDDQWIFWVGPFVGALVAAVYHQYILRGSAIKAL-GSFRSNPT  283



>gb|ABK22173.1| unknown [Picea sitchensis]
Length=282

 Score =   325 bits (833),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 177/235 (75%), Positives = 198/235 (84%), Gaps = 1/235 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY++VATVIG K     C   GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  49   TLLFLYITVATVIGHKRNQAACGSVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  108

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL RAV YMVAQCLGA+ G GLVKA  K ++D  GGGAN+V  G++KGVGL A
Sbjct  109  LFLARKVSLPRAVLYMVAQCLGAICGCGLVKAFQKSYYDQYGGGANSVAHGYTKGVGLSA  168

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKRNARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  169  EIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  228

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  707
            GAAVI+ ++  WD+HWIFWVGP LGA   A YHQ +LRA A+KAL GSF+S P+V
Sbjct  229  GAAVIYGHQKIWDEHWIFWVGPFLGAAGAAAYHQYILRAGAIKAL-GSFRSNPHV  282



>gb|AAB65787.1| plasma membrane intrinsic protein [Arabidopsis thaliana]
Length=280

 Score =   325 bits (833),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 177/232 (76%), Positives = 198/232 (85%), Gaps = 1/232 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTF 
Sbjct  47   TLLFLYVTVATVIGHKKQTGPCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFR  106

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLA KVSL+RA+ YM+AQCLGA+ GVG VKA  K  ++T+GGGANTV  G+SKG  L A
Sbjct  107  LFLAGKVSLVRALGYMIAQCLGAICGVGFVKAFMKTPYNTLGGGANTVADGYSKGTALGA  166

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  167  EIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  226

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            GAAVI+NN+ AWDD WIFWVGP LGA+A A YHQ +LRA A+KAL GSF+S 
Sbjct  227  GAAVIYNNEKAWDDQWIFWVGPFLGALAAAAYHQYILRASAIKAL-GSFRSN  277



>ref|XP_007137341.1| hypothetical protein PHAVU_009G118900g [Phaseolus vulgaris]
 gb|ESW09335.1| hypothetical protein PHAVU_009G118900g [Phaseolus vulgaris]
Length=278

 Score =   325 bits (832),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 177/234 (76%), Positives = 200/234 (85%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  45   TLLFLYVTVATVIGHKKQTGPCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  104

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRA+ Y+VAQCLGA+ GVGLVKA  K  ++++ GGAN+V  G+SKG  L A
Sbjct  105  LFLARKVSLIRALFYIVAQCLGAISGVGLVKAFMKHPYNSLSGGANSVNSGYSKGTALGA  164

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  165  EIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  224

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+N+   WDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P 
Sbjct  225  GAAVIYNDAKVWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNPT  277



>ref|XP_007046620.1| Plasma membrane intrinsic protein 3 isoform 1 [Theobroma cacao]
 gb|EOX90777.1| Plasma membrane intrinsic protein 3 isoform 1 [Theobroma cacao]
Length=280

 Score =   325 bits (832),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 170/234 (73%), Positives = 196/234 (84%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY+ VATVIG K    PC G G LGI+W  GGMIFVLVYCTAGISGGHINPAVT G
Sbjct  47   TLLFLYILVATVIGHKKQKGPCDGVGPLGIAWAVGGMIFVLVYCTAGISGGHINPAVTLG  106

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LF+ARKVSL+RAVAYMVAQCLG++ G  + K++ + +++T+GGGAN V  G+SKG  L A
Sbjct  107  LFVARKVSLVRAVAYMVAQCLGSICGAAIAKSIMRRYYNTLGGGANEVASGYSKGSALGA  166

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFV H+ATIPITGTGINPARS 
Sbjct  167  EIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVVHLATIPITGTGINPARSL  226

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI++N+ AWDD WIFWVGP +GA+A A YHQ +LRA A+KAL  SF+S+P 
Sbjct  227  GAAVIYDNEKAWDDQWIFWVGPFIGALAAAAYHQFILRATAIKAL-KSFRSSPT  279



>gb|AFK33316.1| unknown [Medicago truncatula]
Length=287

 Score =   325 bits (833),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 182/241 (76%), Positives = 200/241 (83%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYV+V TVIG  A  DP      C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  48   TLLFLYVTVLTVIGYNAQTDPAHNGTNCDGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  107

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRAV YMVAQCLGA+ GVGLVKA  K +++   GGAN +  G+SK
Sbjct  108  PAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGLVKAFQKGYYNRYKGGANMLSAGYSK  167

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  168  GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  227

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARSFGAAVI+NN+ AWDD WIFWVGP +GA   A+YHQ VLRAQA KAL GSF+S  N
Sbjct  228  NPARSFGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAIYHQFVLRAQAAKAL-GSFRSFSN  286

Query  705  V  707
            +
Sbjct  287  L  287



>emb|CAH60720.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=279

 Score =   325 bits (832),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 180/234 (77%), Positives = 200/234 (85%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K   D C G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  46   TLLFLYVTVATVIGHKKNQDACGGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  105

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            L LARKVSLIRAV YMVAQCLGAV GVGLVKA  K +++++GGGANTV  G+S G  L A
Sbjct  106  LLLARKVSLIRAVGYMVAQCLGAVCGVGLVKAFMKPYYNSLGGGANTVAHGYSTGTALGA  165

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LV TVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  166  EIIGTFVLVNTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  225

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI N+K AWDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P 
Sbjct  226  GAAVIINDKKAWDDHWIFWVGPFVGALAAAAYHQYILRAGAIKAL-GSFRSHPT  278



>gb|AAG02208.1|AF290201_1 plasma membrane intrinsic protein PIP2 [Solanum chacoense]
Length=283

 Score =   325 bits (832),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 178/234 (76%), Positives = 199/234 (85%), Gaps = 3/234 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATP--DPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLYV+VATVIG K     D C G G+LGI+W FGGMIFVLVYCTAGISGGHINPAVT
Sbjct  48   TLLFLYVTVATVIGHKKLNALDQCDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVT  107

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGLFLARKVSLIRAVAY++AQ LGA+ GVG VK   K +++  GGGAN VQPG+SKG  L
Sbjct  108  FGLFLARKVSLIRAVAYIIAQSLGAICGVGFVKLFMKHYYNAEGGGANFVQPGYSKGTAL  167

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  168  GAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  227

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            SFGAAVI+ ++  WDD WIFWVGPM+GA+A A+YHQ VLRA AVKAL GSF+S 
Sbjct  228  SFGAAVIYGHEKIWDDQWIFWVGPMVGAMAAAIYHQFVLRAGAVKAL-GSFRSN  280



>ref|XP_009615212.1| PREDICTED: aquaporin PIP2-7 [Nicotiana tomentosiformis]
 tpg|DAA64683.1| TPA_exp: aquaporin PIP2 7b [Nicotiana tabacum]
Length=284

 Score =   325 bits (832),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 176/236 (75%), Positives = 199/236 (84%), Gaps = 3/236 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKAT--PDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLYV+VATVIG K     D C G G+LGISW FGGMIFVLVYCTAGISGGHINPAVT
Sbjct  49   TLLFLYVTVATVIGHKKLNGADKCDGVGILGISWAFGGMIFVLVYCTAGISGGHINPAVT  108

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGLFLARKVSL+RAV Y++AQ LGA+ GVGLVK   K +++T+GGGAN VQPG++KG  L
Sbjct  109  FGLFLARKVSLLRAVGYIIAQSLGAICGVGLVKGFMKHYYNTLGGGANFVQPGYNKGTAL  168

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  169  GAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  228

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            SFGAAVI+N +  WDD WIFWVGP +GA+  AVYHQ +LR  A+KAL GSF+S P 
Sbjct  229  SFGAAVIYNTEKIWDDQWIFWVGPFVGALVAAVYHQYILRGSAIKAL-GSFRSNPT  283



>gb|AAB36949.1| plasma membrane intrinsic protein PIP3 [Arabidopsis thaliana]
Length=280

 Score =   324 bits (831),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 177/232 (76%), Positives = 198/232 (85%), Gaps = 1/232 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFL V+VATVIG K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  47   TLLFLIVTVATVIGHKKQTGPCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  106

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLA KVSL+RA+ YM+AQCLGA+ GVG VKA  K  ++T+GGGANTV  G+SKG  L A
Sbjct  107  LFLAGKVSLVRALGYMIAQCLGAICGVGFVKAFMKTPYNTLGGGANTVADGYSKGTALGA  166

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  167  EIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  226

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            GAAVI+NN+ AWDD WIFWVGP LGA+A A YHQ +LRA A+KAL GSF+S 
Sbjct  227  GAAVIYNNEKAWDDQWIFWVGPFLGALAAAAYHQYILRASAIKAL-GSFRSN  277



>gb|ABK24156.1| unknown [Picea sitchensis]
Length=282

 Score =   325 bits (832),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 177/235 (75%), Positives = 198/235 (84%), Gaps = 1/235 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY++VATVIG K     C   GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  49   TLLFLYITVATVIGHKRNQAACGSVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  108

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL RAV YMVAQCLGA+ G GLVKA  K ++D  GGGAN+V  G++KGVGL +
Sbjct  109  LFLARKVSLPRAVLYMVAQCLGAICGCGLVKAFQKSYYDQYGGGANSVAHGYTKGVGLSS  168

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  169  EIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  228

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  707
            GAAVI+ ++  WD+HWIFWVGP LGA   A YHQ +LRA A+KAL GSF+S P+V
Sbjct  229  GAAVIYGHQKIWDEHWIFWVGPFLGAAGAAAYHQYILRAGAIKAL-GSFRSNPHV  282



>gb|KHG20375.1| putative aquaporin PIP2-5 -like protein [Gossypium arboreum]
Length=282

 Score =   325 bits (832),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 178/239 (74%), Positives = 199/239 (83%), Gaps = 5/239 (2%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKA----TPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPA  170
            T+LFLY++V TVIG K+    +PD C G GLLGI+W FGGMIF+LVYCTAGISGGHINPA
Sbjct  45   TMLFLYITVLTVIGHKSQVATSPDACSGVGLLGIAWAFGGMIFILVYCTAGISGGHINPA  104

Query  171  VTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGV  350
            VTFGLFLARKVSLIRA+AYMVAQ LGA+ GVGLVKA    +++  GGGANT+  G+S G 
Sbjct  105  VTFGLFLARKVSLIRAIAYMVAQSLGAICGVGLVKAFQSAYYNRYGGGANTLADGYSTGT  164

Query  351  GLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINP  530
            GL AEI+ TF LVYTVFSATDPKR ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINP
Sbjct  165  GLGAEIIGTFVLVYTVFSATDPKRKARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  224

Query  531  ARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  707
            ARS GAAVI NNK AWDDHWIFWVGPM+GA   A YHQ +LRA A KAL GSF+S  +V
Sbjct  225  ARSIGAAVIFNNKKAWDDHWIFWVGPMIGAAIAAFYHQFILRAGAAKAL-GSFRSQTHV  282



>gb|KDP29110.1| hypothetical protein JCGZ_16499 [Jatropha curcas]
Length=284

 Score =   325 bits (832),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 177/241 (73%), Positives = 198/241 (82%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG K+  DP      C G G+LGI+W FGGMIF+LVYCTAGISGGHIN
Sbjct  45   TLLFLYITVLTVIGYKSQTDPSKNSDACGGVGILGIAWAFGGMIFILVYCTAGISGGHIN  104

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSL+RA+ YM AQCLGA+ G GLVKA  K ++   GGGAN +  G+SK
Sbjct  105  PAVTFGLFLARKVSLVRAILYMAAQCLGAICGCGLVKAFQKAYYTRYGGGANELADGYSK  164

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  165  GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  224

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARSFGAAVI+N   AWDD WIFWVGP +GA   A+YHQ +LRA AVKAL GSF+ST N
Sbjct  225  NPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAIYHQYILRAGAVKAL-GSFRSTSN  283

Query  705  V  707
            V
Sbjct  284  V  284



>ref|XP_011048549.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048550.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048551.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
Length=285

 Score =   325 bits (832),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 179/241 (74%), Positives = 199/241 (83%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKA------TPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG K+        D C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  46   TLLFLYITVLTVIGYKSQIDTTKNGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  105

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSL+RA+ YMVAQCLGA+ G GLVKA  K ++   GGGAN +  GFSK
Sbjct  106  PAVTFGLFLARKVSLVRAILYMVAQCLGAICGCGLVKAFQKSYYTNYGGGANELATGFSK  165

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  166  GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  225

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARSFGAAVI+N   AWDDHWIFWVGP +GA   A+YHQ VLRA AVKAL GSF+S+ N
Sbjct  226  NPARSFGAAVIYNKDKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVKAL-GSFRSSSN  284

Query  705  V  707
            +
Sbjct  285  I  285



>gb|AAF71816.1|AF141642_1 putative aquaporin PIP2-1 [Vitis cinerea var. helleri x Vitis 
rupestris]
Length=284

 Score =   324 bits (831),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 178/238 (75%), Positives = 200/238 (84%), Gaps = 4/238 (2%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATP---DPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAV  173
            TLLFLY++V TVIG K+     DPC G G+LGI+W FGGMIF+LVYCTAGISGGHINPAV
Sbjct  48   TLLFLYITVLTVIGYKSQTAGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAV  107

Query  174  TFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVG  353
            TFGLFLARKVSLIRA+ YMVAQCLGA+ GVGLVKA    ++D  GGGAN +  G+SKG G
Sbjct  108  TFGLFLARKVSLIRAILYMVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTG  167

Query  354  LVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPA  533
            L AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPA
Sbjct  168  LGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPA  227

Query  534  RSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  707
            RS GAAVI+NN+ AWDD WIFWVGP +GA   A YHQ +LRA A+KAL GSF+STP V
Sbjct  228  RSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAIKAL-GSFRSTPRV  284



>ref|XP_002884019.1| PIP2_8/PIP3B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60278.1| PIP2_8/PIP3B [Arabidopsis lyrata subsp. lyrata]
Length=278

 Score =   324 bits (830),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 181/234 (77%), Positives = 197/234 (84%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  45   TLLFLYVTVATVIGHKNQNGPCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  104

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL RAVAYMVAQCLGA+ GVGLVKA     +  +GGGANTV   +S G  L A
Sbjct  105  LFLARKVSLPRAVAYMVAQCLGAICGVGLVKAFMMTPYKRLGGGANTVADDYSTGTALGA  164

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  165  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  224

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+NN+ AWDDHWIFWVGP LGA+A A YHQ +LRA A+KAL  SF+S P 
Sbjct  225  GAAVIYNNEKAWDDHWIFWVGPFLGALAAAAYHQYILRAAAIKAL-ASFRSNPT  277



>ref|XP_011048552.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score =   324 bits (831),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 179/241 (74%), Positives = 199/241 (83%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKA------TPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG K+        D C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  46   TLLFLYITVLTVIGYKSQIDTTKNGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  105

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSL+RA+ YMVAQCLGA+ G GLVKA  K ++   GGGAN +  GFSK
Sbjct  106  PAVTFGLFLARKVSLVRAILYMVAQCLGAICGCGLVKAFQKSYYTNYGGGANELATGFSK  165

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  166  GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  225

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARSFGAAVI+N   AWDDHWIFWVGP +GA   A+YHQ VLRA AVKAL GSF+S+ N
Sbjct  226  NPARSFGAAVIYNKDKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVKAL-GSFRSSSN  284

Query  705  V  707
            +
Sbjct  285  I  285



>ref|XP_004291577.1| PREDICTED: aquaporin PIP2-2-like [Fragaria vesca subsp. vesca]
Length=281

 Score =   324 bits (831),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 177/234 (76%), Positives = 197/234 (84%), Gaps = 3/234 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATP--DPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLY++V TVIG K+    D C G G+LGI+W FGGMIFVLVYCTAGISGGHINPAVT
Sbjct  48   TLLFLYITVLTVIGYKSQSATDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVT  107

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGLFLARKVSL+RAV Y+VAQ LGA+ GVGLVKA  K  +D  GGGANT+ PG+SKG GL
Sbjct  108  FGLFLARKVSLLRAVLYIVAQSLGAICGVGLVKAFQKTLYDEYGGGANTLAPGYSKGTGL  167

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  168  AAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  227

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            SFGAAVI+N   AWDDHW+FW+GP +GA   A YHQ VLRA A+KAL GSF+S 
Sbjct  228  SFGAAVIYNQDKAWDDHWMFWLGPFIGAAIAAFYHQFVLRAGAIKAL-GSFRSN  280



>ref|XP_006381453.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
 gb|ABK96511.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP59250.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
Length=285

 Score =   324 bits (831),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 179/241 (74%), Positives = 198/241 (82%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKA------TPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG K+        D C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  46   TLLFLYITVLTVIGYKSQTDTTKNSDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  105

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSL+RAV YMVAQCLGA+ G GLVKA  K ++   GGG N +  GFSK
Sbjct  106  PAVTFGLFLARKVSLVRAVLYMVAQCLGAICGCGLVKAFQKSYYTKYGGGVNELATGFSK  165

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  166  GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  225

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARSFGAAVI+N   AWDDHWIFWVGP +GA   A+YHQ VLRA AVKAL GSF+S+ N
Sbjct  226  NPARSFGAAVIYNEDKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVKAL-GSFRSSSN  284

Query  705  V  707
            +
Sbjct  285  I  285



>dbj|BAF32141.1| putative aquaporin [Taxodium distichum]
Length=274

 Score =   324 bits (830),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 180/235 (77%), Positives = 198/235 (84%), Gaps = 1/235 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY+++ATVIG K T   C   G+LGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  41   TLLFLYITIATVIGHKRTAANCGSVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  100

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL RAV YMVAQCLGA+ GVGLVKA  K F+D  GGGAN+V  G+SKG GL A
Sbjct  101  LFLARKVSLPRAVLYMVAQCLGAICGVGLVKAFQKSFYDMHGGGANSVAQGYSKGTGLGA  160

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  161  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  220

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  707
            GAAVI+ +   WDD WIFWVGP LGA A A YHQ +LRA A+KAL GSF+S PNV
Sbjct  221  GAAVIYGHDKIWDDQWIFWVGPFLGAFAAAFYHQYILRAAAIKAL-GSFRSNPNV  274



>gb|KCW55550.1| hypothetical protein EUGRSUZ_I01429 [Eucalyptus grandis]
Length=282

 Score =   324 bits (830),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 178/235 (76%), Positives = 201/235 (86%), Gaps = 2/235 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  48   TLLFLYVTVATVIGHKKQTGPCDGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  107

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRA++YM+AQCLGA+ GVGLVKA  K F++++GGGAN+V  G+S G  L A
Sbjct  108  LFLARKVSLIRALSYMIAQCLGAICGVGLVKAFMKPFYNSLGGGANSVATGYSTGTALGA  167

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  168  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  227

Query  543  GAAVIHNNKHAWDD-HWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+NN   WDD  WIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P 
Sbjct  228  GAAVIYNNGKVWDDQQWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNPT  281



>ref|XP_006360898.1| PREDICTED: aquaporin PIP2-7-like [Solanum tuberosum]
Length=283

 Score =   324 bits (831),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 177/234 (76%), Positives = 199/234 (85%), Gaps = 3/234 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATP--DPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLYV+VATVIG K     + C G G+LGI+W FGGMIFVLVYCTAGISGGHINPAVT
Sbjct  48   TLLFLYVTVATVIGHKKLNKLNQCDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVT  107

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGLFLARKVSLIRAVAY++AQ LGA+ GVG VK   K +++  GGGAN VQPG++KG  L
Sbjct  108  FGLFLARKVSLIRAVAYIIAQSLGAICGVGFVKLFMKHYYNAEGGGANFVQPGYNKGTAL  167

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  168  GAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  227

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            SFGAAVI+ N+  WDD WIFWVGPM+GA+A A+YHQ VLRA AVKAL GSF+S 
Sbjct  228  SFGAAVIYGNEKIWDDQWIFWVGPMVGAMAAAIYHQFVLRAGAVKAL-GSFRSN  280



>ref|XP_010920097.1| PREDICTED: probable aquaporin PIP2-6 [Elaeis guineensis]
Length=282

 Score =   324 bits (830),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 174/236 (74%), Positives = 201/236 (85%), Gaps = 3/236 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTK--ATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLYV++ATVIG K  +  D C G G+LGI+W FGGMIF+LVYCTAGISGGHINPAVT
Sbjct  47   TLLFLYVTIATVIGYKVQSQNDQCGGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVT  106

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGLFLARKVSL+RA+ YMVAQC GA+ GVG+VK + K  ++++GGGAN V PG+SKG  L
Sbjct  107  FGLFLARKVSLVRALLYMVAQCAGAICGVGIVKGIMKHPYNSLGGGANEVAPGYSKGTAL  166

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKRNARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  167  GAEIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPAR  226

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            SFGAAVI+N   AWDD WIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P+
Sbjct  227  SFGAAVIYNQGKAWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNPH  281



>gb|AGD98708.1| aquaporin protein 5 [Camellia sinensis]
Length=285

 Score =   324 bits (830),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 175/238 (74%), Positives = 199/238 (84%), Gaps = 7/238 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY+++ TVIG K+  DP      C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  48   TLLFLYITILTVIGYKSQVDPVKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  107

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRAV Y+VAQCLGA+ GV LVKA  + ++D  GGGAN V PG++K
Sbjct  108  PAVTFGLFLARKVSLIRAVMYIVAQCLGAICGVALVKAFQRAYYDRYGGGANEVAPGYNK  167

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G  L AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIP+TGTGI
Sbjct  168  GTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGI  227

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            NPARSFGAAVI+N K AWDDHWIFWVGP +GA+  A YHQ +LRA A+KAL GSF+S 
Sbjct  228  NPARSFGAAVIYNQKKAWDDHWIFWVGPFVGAVIAAFYHQFILRAAAIKAL-GSFRSN  284



>ref|XP_009412922.1| PREDICTED: probable aquaporin PIP2-6 [Musa acuminata subsp. malaccensis]
Length=282

 Score =   323 bits (829),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 177/236 (75%), Positives = 200/236 (85%), Gaps = 3/236 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKAT--PDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLYVS+ATVIG K     D C G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVT
Sbjct  47   TLLFLYVSIATVIGHKEQNAADQCSGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVT  106

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGLFLARKVSLIRAV Y+VAQCLG +VGVG+VK + K  ++++GGGAN V  G+SKG  L
Sbjct  107  FGLFLARKVSLIRAVLYIVAQCLGGIVGVGIVKGIMKHQYNSLGGGANVVATGYSKGTAL  166

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  167  GAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  226

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            S GAAVI+N   AWDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P+
Sbjct  227  SLGAAVIYNQDKAWDDHWIFWVGPFIGALAAAAYHQYILRAAAIKAL-GSFRSNPS  281



>ref|XP_009780961.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana sylvestris]
Length=268

 Score =   323 bits (828),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 179/235 (76%), Positives = 197/235 (84%), Gaps = 1/235 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            T LFLYVSVATVIG K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  35   TFLFLYVSVATVIGHKKQVGPCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  94

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            L LARKVSL+RAV YMVAQCLGA+ GVGLVK   K  ++T GGGANTV  G+S G  L A
Sbjct  95   LLLARKVSLLRAVGYMVAQCLGAICGVGLVKGFMKHDYNTYGGGANTVAVGYSTGTALGA  154

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKRN+RDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  155  EIIGTFVLVYTVFSATDPKRNSRDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  214

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  707
            GAAVI+N+  AW+DHWIFWVGP LGA+A A+Y+Q VLRAQA K L  SF S P++
Sbjct  215  GAAVIYNDTTAWNDHWIFWVGPSLGALAAALYYQQVLRAQAAKTL-SSFHSNPSI  268



>ref|XP_011044357.1| PREDICTED: probable aquaporin PIP2-4 [Populus euphratica]
Length=284

 Score =   323 bits (829),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 179/238 (75%), Positives = 197/238 (83%), Gaps = 7/238 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYV+V TVIG K+  DP      C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  47   TLLFLYVTVLTVIGYKSQTDPDKGLDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  106

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRAV YMVAQCLGA+ G GLVKA  K F++  GGGAN +Q G++K
Sbjct  107  PAVTFGLFLARKVSLIRAVLYMVAQCLGAICGCGLVKAFQKSFYNHYGGGANELQEGYNK  166

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  167  GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  226

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            NPARSFGAAVI N   AWDDHW+FWVGP +GA   A YHQ +LRA A+KAL GSF+S 
Sbjct  227  NPARSFGAAVIFNQSKAWDDHWLFWVGPFIGAAIAAFYHQFILRAAAIKAL-GSFRSN  283



>ref|XP_008365039.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=287

 Score =   324 bits (830),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 177/241 (73%), Positives = 197/241 (82%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYV+V TVIG K+  DP      C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  48   TLLFLYVTVLTVIGYKSQTDPATNADACGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  107

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSL+RAV YMVAQ LGA+ GV LVKA  K ++   GGGAN++  G+S 
Sbjct  108  PAVTFGLFLARKVSLVRAVLYMVAQSLGAIAGVALVKAFQKSYYXKYGGGANSLSDGYST  167

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            GVGL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  168  GVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGI  227

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARS GAAVI+N   AWDD WIFWVGP +GA   A YHQ +LRA AVKAL GSF+S P+
Sbjct  228  NPARSLGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKAL-GSFRSNPH  286

Query  705  V  707
            V
Sbjct  287  V  287



>sp|P42767.1|PIP1_ATRCA RecName: Full=Aquaporin PIP-type [Atriplex canescens]
 gb|AAA86991.1| aquaporin [Atriplex canescens]
Length=282

 Score =   323 bits (829),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 174/234 (74%), Positives = 197/234 (84%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY++VATVIG K   DPC   GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  49   TLLFLYITVATVIGYKKETDPCASVGLLGIAWSFGGMIFVLVYCTAGISGGHINPAVTFG  108

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL+RA+ YM+AQC GA+ GVGLVKA  K  ++  GGGAN+V  G++KG    A
Sbjct  109  LFLARKVSLLRALVYMIAQCAGAICGVGLVKAFMKGPYNQFGGGANSVALGYNKGTAFGA  168

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            E++ TF LVYTVFSATDPKR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  169  ELIGTFVLVYTVFSATDPKRSARDSHVPILAPLPIGFAVFMVHLATIPITGTGINPARSF  228

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+N K  WDDHWIFWVGP +GA+A A YHQ VLRA A+KAL GSF+S P 
Sbjct  229  GAAVIYNKKRVWDDHWIFWVGPFVGALAAAAYHQYVLRAAAIKAL-GSFRSNPT  281



>gb|ABK23750.1| unknown [Picea sitchensis]
Length=282

 Score =   323 bits (829),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 174/235 (74%), Positives = 198/235 (84%), Gaps = 1/235 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY+++ATVIG   T   C   G+LGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  49   TLLFLYITIATVIGHSRTSADCGSVGVLGIAWSFGGMIFVLVYCTAGISGGHINPAVTFG  108

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL RA+ YM+AQCLGA+ G GLV+A  K F+D  GGGAN V PG++KGVGL A
Sbjct  109  LFLARKVSLPRAILYMIAQCLGAICGAGLVEAFQKSFYDRYGGGANFVHPGYTKGVGLAA  168

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  169  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  228

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  707
            GAAVI+ +K +WDDHWIFWVGP +GA   A YHQ +LRA AVKAL GS++S  +V
Sbjct  229  GAAVIYGHKQSWDDHWIFWVGPFVGAALAAAYHQYILRAAAVKAL-GSYRSNVDV  282



>ref|XP_003604054.1| Aquaporin PIP22 [Medicago truncatula]
 gb|AES74305.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=279

 Score =   323 bits (828),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 181/234 (77%), Positives = 198/234 (85%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  46   TLLFLYVTVATVIGHKKQTAPCDGVGLLGIAWSFGGMIFVLVYCTAGISGGHINPAVTFG  105

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAV YMVAQCLGA+ GVGLVKA  K  ++ +GGGAN V  G+SKG  L A
Sbjct  106  LFLARKVSLIRAVLYMVAQCLGAICGVGLVKAFMKHPYNHLGGGANFVASGYSKGSALGA  165

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            E++ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  166  EMIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  225

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI NN   WDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P 
Sbjct  226  GAAVIFNNAKVWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNPT  278



>gb|AAL33586.1|AF440272_1 aquaporin [Nicotiana tabacum]
Length=284

 Score =   323 bits (829),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 175/236 (74%), Positives = 199/236 (84%), Gaps = 3/236 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKAT--PDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLYV+VATVIG K     D C G G+LGISW FGGMIFVLVYCTAGISGGHINPAVT
Sbjct  49   TLLFLYVTVATVIGHKKLNGADKCDGVGILGISWAFGGMIFVLVYCTAGISGGHINPAVT  108

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGLFLARKVSL+RAV Y++AQ LGA+ GVGLVK   K +++T+GGGAN VQPG++KG  L
Sbjct  109  FGLFLARKVSLLRAVGYIIAQSLGAICGVGLVKGFMKHYYNTLGGGANFVQPGYNKGTAL  168

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  169  GAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  228

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            +FGAAVI+N +  WDD WIFWVGP +GA+  AVYHQ +LR  A+KAL GSF+S P 
Sbjct  229  TFGAAVIYNTEKIWDDQWIFWVGPFVGALVAAVYHQYILRGSAIKAL-GSFRSNPT  283



>gb|AGD98714.1| aquaporin protein 11 [Camellia sinensis]
Length=287

 Score =   323 bits (829),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 176/238 (74%), Positives = 198/238 (83%), Gaps = 7/238 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG K+  DP      C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  50   TLLFLYITVLTVIGYKSQTDPIKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  109

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRA+ YMVAQC GA+ GVGLVKA  + ++D  GGGAN V PG++K
Sbjct  110  PAVTFGLFLARKVSLIRALLYMVAQCSGAICGVGLVKAFQRAYYDRYGGGANEVAPGYNK  169

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G  L AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIP+TGTGI
Sbjct  170  GTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGI  229

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            NPARSFGAAVI+N K AWDDHWIFWVGP +GA   A YHQ +LRA A+KAL GSF+S 
Sbjct  230  NPARSFGAAVIYNQKKAWDDHWIFWVGPFVGAAIAAFYHQFILRAAAIKAL-GSFRSN  286



>gb|ABC01884.1| plasma membrane intrinsic protein PIP2-like protein [Solanum 
tuberosum]
Length=283

 Score =   323 bits (828),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 176/234 (75%), Positives = 198/234 (85%), Gaps = 3/234 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATP--DPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLYV+VATVIG K     D C G G+LGI+W FGGMIFVLVYCTAGISGGHINPAVT
Sbjct  48   TLLFLYVTVATVIGHKKLNKLDQCDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVT  107

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGLFLARKVSLIRAVAY++AQ LGA+ GVG VK   K +++  GGGAN VQPG++KG  L
Sbjct  108  FGLFLARKVSLIRAVAYIIAQSLGAICGVGFVKLFMKHYYNAEGGGANFVQPGYNKGTAL  167

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  168  GAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  227

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            SFGAAVI+ N+  WDD WIFWVGPM+GA+A A+YHQ VLRA AV+A  GSF+S 
Sbjct  228  SFGAAVIYGNEKIWDDQWIFWVGPMVGAMAAAIYHQFVLRAGAVEAF-GSFRSN  280



>ref|XP_011088776.1| PREDICTED: uncharacterized protein LOC105169921 [Sesamum indicum]
Length=754

 Score =   338 bits (867),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 182/235 (77%), Positives = 206/235 (88%), Gaps = 3/235 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKA--TPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLYV+VATVIG K     D C G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVT
Sbjct  519  TLLFLYVTVATVIGHKKLNAADQCDGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVT  578

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGLFLARKVSLIRAVAYMVAQ LGA+ GVGLVKA  K +++++GGGAN+V PG++KG  L
Sbjct  579  FGLFLARKVSLIRAVAYMVAQSLGAICGVGLVKAFMKSYYNSLGGGANSVAPGYNKGTAL  638

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  639  GAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  698

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            SFGAAVI+NN++ WDDHWIFWVGP +GA+A AVYHQ +LRA A+KAL GSF+S P
Sbjct  699  SFGAAVIYNNENVWDDHWIFWVGPFVGALAAAVYHQYILRAAAIKAL-GSFRSNP  752



>gb|AHZ08398.1| phosphatidylinosital biphosphate protein [Morus alba var. multicaulis]
Length=282

 Score =   323 bits (828),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 178/235 (76%), Positives = 200/235 (85%), Gaps = 3/235 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKAT--PDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLYV+VATVIG K     D C G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVT
Sbjct  47   TLLFLYVTVATVIGHKKQNAADQCGGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVT  106

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGLFLARKVSLIRA+ YMVAQCLGA+ GVGLVKA  K+ ++ +GGGAN+V  G+S G  L
Sbjct  107  FGLFLARKVSLIRALGYMVAQCLGAISGVGLVKAFMKNEYNRLGGGANSVAGGYSTGTAL  166

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVF+ATDPKR+ARDSH+PVLAPLPIGFAVFV H+ATIPITGTGINPAR
Sbjct  167  GAEIIGTFVLVYTVFAATDPKRSARDSHIPVLAPLPIGFAVFVVHLATIPITGTGINPAR  226

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            SFGAAVI+NN   WDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct  227  SFGAAVIYNNDKIWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNP  280



>dbj|BAB40143.1| plasma membrane intrinsic protein 2-2 [Pyrus communis]
Length=287

 Score =   323 bits (828),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 177/241 (73%), Positives = 197/241 (82%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYV+V TVIG K+  DP      C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  48   TLLFLYVTVLTVIGYKSQTDPAVNADACGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  107

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSL+RAV YMVAQ LGA+ GV LVKA  K ++   GGGAN++  G+S 
Sbjct  108  PAVTFGLFLARKVSLVRAVLYMVAQSLGAIAGVALVKAFQKSYYIKYGGGANSLSDGYST  167

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            GVGL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  168  GVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGI  227

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARS GAAVI+N   AWDD WIFWVGP +GA   A YHQ +LRA AVKAL GSF+S P+
Sbjct  228  NPARSLGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKAL-GSFRSNPH  286

Query  705  V  707
            V
Sbjct  287  V  287



>gb|ABC69040.1| aquaporin PIP2-1 [Rhododendron catawbiense]
Length=281

 Score =   323 bits (827),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 179/234 (76%), Positives = 196/234 (84%), Gaps = 3/234 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKA--TPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLY++V TVIG K+  T DPC G G+LGI+W FGGMIFVLVYCTAGISGGHINPAVT
Sbjct  48   TLLFLYITVLTVIGYKSQTTTDPCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVT  107

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGLFLARKVSL RAV YMVAQCLGA+ GVGLVKA  K +FD  GGGAN V  G++KG  L
Sbjct  108  FGLFLARKVSLFRAVLYMVAQCLGAICGVGLVKAFQKSYFDRYGGGANEVASGYNKGTAL  167

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  168  GAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  227

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            SFGAAVI+NN  AWDD WIFWVGP  GA   A YHQ +LRA A+KAL GSF+S 
Sbjct  228  SFGAAVIYNNSKAWDDQWIFWVGPFAGAAIAAFYHQFILRAAAIKAL-GSFRSN  280



>ref|XP_010690355.1| PREDICTED: aquaporin PIP-type [Beta vulgaris subsp. vulgaris]
Length=281

 Score =   323 bits (827),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 175/234 (75%), Positives = 197/234 (84%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY++VATVIG K   DPC   GLLGI+W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  48   TLLFLYITVATVIGYKNETDPCATVGLLGIAWSFGGMIFILVYCTAGISGGHINPAVTFG  107

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL+RA  YMV QC GA+ GVGLVKA     +  +GGGAN+VQ G++KG  L A
Sbjct  108  LFLARKVSLLRAFFYMVGQCAGAICGVGLVKAFMSGAYVRLGGGANSVQHGYNKGTALGA  167

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  168  EIIGTFVLVYTVFSATDPKRSARDSHVPILAPLPIGFAVFMVHLATIPITGTGINPARSF  227

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI N+K AWDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P 
Sbjct  228  GAAVIFNDKKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNPT  280



>ref|XP_002313510.1| hypothetical protein POPTR_0009s01940g [Populus trichocarpa]
 gb|EEE87465.1| hypothetical protein POPTR_0009s01940g [Populus trichocarpa]
Length=284

 Score =   323 bits (827),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 178/238 (75%), Positives = 197/238 (83%), Gaps = 7/238 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYV+V TVIG K+  DP      C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  47   TLLFLYVTVLTVIGYKSQTDPDKGLDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  106

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRAV YMVAQCLGA+ G GLVKA  K +++  GGGAN +Q G++K
Sbjct  107  PAVTFGLFLARKVSLIRAVLYMVAQCLGAICGCGLVKAFQKSYYNHYGGGANELQEGYNK  166

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  167  GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  226

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            NPARSFGAAVI N   AWDDHW+FWVGP +GA   A YHQ +LRA A+KAL GSF+S 
Sbjct  227  NPARSFGAAVIFNQSKAWDDHWLFWVGPFIGAAIAAFYHQFILRAAAIKAL-GSFRSN  283



>dbj|BAF63508.1| plasma membrane intrinsic protein [Potamogeton distinctus]
Length=280

 Score =   322 bits (826),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 173/234 (74%), Positives = 195/234 (83%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VAT IG     +PC+G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  47   TLLFLYVTVATAIGNSKQQNPCEGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  106

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL RA+ YMVAQC GA+ GVGL K   K+ +   GGGAN V PG+SKG  L A
Sbjct  107  LFLARKVSLPRALVYMVAQCAGAICGVGLAKGFMKNPYMRNGGGANFVHPGYSKGTALGA  166

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDP+R+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  167  EIIGTFVLVYTVFSATDPERSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  226

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+N    WDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P+
Sbjct  227  GAAVIYNKDKPWDDHWIFWVGPFIGALAAAAYHQYILRAAAIKAL-GSFRSNPH  279



>ref|NP_001233846.1| putative PIP-type aquaporin [Solanum lycopersicum]
 gb|ADP23920.1| putative PIP-type aquaporin [Solanum lycopersicum]
Length=283

 Score =   322 bits (826),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 177/234 (76%), Positives = 199/234 (85%), Gaps = 3/234 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATP--DPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            T LFLYV+VATVIG K     D C G G+LGI+W FGGMIFVLVYCTAGISGGHINPAVT
Sbjct  48   TPLFLYVTVATVIGHKKLNALDQCDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVT  107

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGLFLARKVSLIRAVAY++AQ LGA+ GVG VKA  K +++T GGGAN VQPG++ G  L
Sbjct  108  FGLFLARKVSLIRAVAYIIAQSLGAICGVGFVKAFMKHYYNTEGGGANFVQPGYNNGTAL  167

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  168  GAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  227

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            SFGAAVI+ N+  WDD WIFWVGPM+GA+A A+YHQ +LRA AVKAL GSF+S 
Sbjct  228  SFGAAVIYGNEKIWDDQWIFWVGPMVGAMAAAIYHQFILRAGAVKAL-GSFRSN  280



>ref|XP_011015478.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score =   322 bits (826),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 176/241 (73%), Positives = 202/241 (84%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPD------PCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG K+  D       C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  46   TLLFLYITVLTVIGYKSQTDVNKNGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  105

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSL+RA+ YMVAQCLGA+ G GLVKA  K ++ + GGGAN +  G+SK
Sbjct  106  PAVTFGLFLARKVSLVRAILYMVAQCLGAICGCGLVKAFQKSYYTSYGGGANGLAIGYSK  165

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  166  GNGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  225

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARSFGAAVI+N + AWDDHWIFWVGP +GA   A+YHQ +LRA AVK+L GSF+S+P+
Sbjct  226  NPARSFGAAVIYNKEKAWDDHWIFWVGPFIGAAIAALYHQFILRAAAVKSL-GSFRSSPS  284

Query  705  V  707
            +
Sbjct  285  I  285



>ref|XP_010516059.1| PREDICTED: probable aquaporin PIP2-8 [Camelina sativa]
Length=278

 Score =   322 bits (826),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 179/234 (76%), Positives = 197/234 (84%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  45   TLLFLYVTVATVIGHKNKTGPCNGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  104

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL+RAVAYMVAQCLGA+ GVGLVKA     +   GGGANTV  G+S G  L A
Sbjct  105  LFLARKVSLLRAVAYMVAQCLGAICGVGLVKAFMMTPYKRHGGGANTVAYGYSTGTALGA  164

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  165  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  224

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+N+K +WDDHWIFWVGP +GA+A   YHQ +LRA A+KAL  SF+S P 
Sbjct  225  GAAVIYNDKKSWDDHWIFWVGPFVGALAARAYHQYILRAAAIKAL-ASFRSNPT  277



>gb|KFK36762.1| hypothetical protein AALP_AA4G166800 [Arabis alpina]
Length=278

 Score =   322 bits (826),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 177/234 (76%), Positives = 197/234 (84%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVT G
Sbjct  45   TLLFLYVTVATVIGHKNQTGPCNGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTLG  104

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL+RAV YMVAQCLGA+ GVGLVKA     ++ +GGGAN V  G+S G  L A
Sbjct  105  LFLARKVSLLRAVGYMVAQCLGAICGVGLVKAFMMTPYNRLGGGANMVADGYSTGTALGA  164

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  165  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  224

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+NN+ AWDDHWIFWVGP +GA+A A YHQ +LRA A+KA+  SF+S P 
Sbjct  225  GAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAI-ASFRSNPT  277



>gb|KHN33668.1| Aquaporin PIP2-7 [Glycine soja]
Length=272

 Score =   322 bits (825),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 178/234 (76%), Positives = 200/234 (85%), Gaps = 4/234 (2%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  42   TLLFLYVTVATVIGHKKQTGPCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  101

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRA+ YMVAQCLGA+ GVGLVKA  K  ++++GGGAN+V  G++KG  L A
Sbjct  102  LFLARKVSLIRALFYMVAQCLGAICGVGLVKAFMKHSYNSLGGGANSVSAGYNKGSALGA  161

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  162  EIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  221

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+NN   WDDHWIFWVGP +GA+A   YHQ +LRA A+KAL GSF+S P 
Sbjct  222  GAAVIYNNGKVWDDHWIFWVGPFVGALA---YHQYILRAAAIKAL-GSFRSNPT  271



>dbj|BAD90697.1| plasma membrane intrinsic protein 2;1 [Mimosa pudica]
Length=287

 Score =   322 bits (826),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 173/240 (72%), Positives = 196/240 (82%), Gaps = 9/240 (4%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP--------CKGAGLLGISWVFGGMIFVLVYCTAGISGGH  158
            TLLFLYV++ T+IG  ++ D         C G G+LGI+W FGGMIF+LVYCTAGISGGH
Sbjct  48   TLLFLYVTILTIIGHNSSTDSKKGPGVTDCDGVGILGIAWAFGGMIFILVYCTAGISGGH  107

Query  159  INPAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGF  338
            INPAVTFGLFL RKVSLIRAV YMVAQC GA+ G GL KA  K ++D  GGG N VQPG+
Sbjct  108  INPAVTFGLFLGRKVSLIRAVLYMVAQCAGAICGTGLAKAFQKAYYDRYGGGVNFVQPGY  167

Query  339  SKGVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGT  518
            SKG  L AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIP+TGT
Sbjct  168  SKGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGT  227

Query  519  GINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            GINPARSFGAAVI+N   AWDDHWIFWVGP +GA+A A+YHQ +LRA A+KAL GSF+S 
Sbjct  228  GINPARSFGAAVIYNGSKAWDDHWIFWVGPAIGALAAAIYHQYILRAAAIKAL-GSFRSN  286



>ref|XP_010521765.1| PREDICTED: aquaporin PIP2-7-like [Tarenaya hassleriana]
Length=286

 Score =   322 bits (826),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 177/238 (74%), Positives = 200/238 (84%), Gaps = 7/238 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIG------TKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYV+V TVIG      TKA  D C G G+LGI+W FGGMIF+LVYCTAGISGGHIN
Sbjct  49   TLLFLYVTVLTVIGYKVQSDTKAGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHIN  108

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSL+RA+ YMVAQCLGA+ G GLVKA  K +++  GGGAN +  G++K
Sbjct  109  PAVTFGLFLARKVSLVRALLYMVAQCLGAICGCGLVKAFQKSYYNRYGGGANVLASGYNK  168

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  169  GTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  228

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            NPARSFGAAVI+N   AWDDHW+FWVGP +GA+A AVYHQ VLRA A+KAL GSF+S 
Sbjct  229  NPARSFGAAVIYNQDKAWDDHWLFWVGPFIGALAAAVYHQYVLRAAAIKAL-GSFRSN  285



>ref|XP_009803627.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana sylvestris]
 tpg|DAA64681.1| TPA_exp: aquaporin PIP2 6b [Nicotiana tabacum]
Length=283

 Score =   322 bits (825),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 177/236 (75%), Positives = 198/236 (84%), Gaps = 3/236 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKA--TPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLYV+VATVIG K     D C G G+LGI+W FGGMIFVLVYCTAGISGGHINPAVT
Sbjct  48   TLLFLYVTVATVIGHKKLNAADHCDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVT  107

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
             GLFLARKVSLIRAVAY++AQ LGA+ GVG VKA  K +++  GGGAN VQPG++KG  L
Sbjct  108  LGLFLARKVSLIRAVAYIIAQSLGAICGVGFVKAFMKHYYNLEGGGANFVQPGYNKGTAL  167

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  168  GAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  227

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            SFGAAVI+N +  WDD WIFWVGP +GA+  A+YHQ VLRA AVKAL GSF+S P 
Sbjct  228  SFGAAVIYNKEKIWDDQWIFWVGPFVGALIAAIYHQFVLRAGAVKAL-GSFRSNPT  282



>gb|ABH09326.1| putative aquaporin [Vitis vinifera]
Length=284

 Score =   322 bits (825),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 178/238 (75%), Positives = 200/238 (84%), Gaps = 4/238 (2%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATP---DPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAV  173
            TLLFLY++V TVIG K+     DPC G G+LGI+W FGGMIF+LVYCTAGISGGHINPAV
Sbjct  48   TLLFLYITVLTVIGYKSQTAGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAV  107

Query  174  TFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVG  353
            TFGLFLARKVSLIRA+ YMVAQCLGA+ GVGLVKA    ++D  GGGAN +  G+SKG G
Sbjct  108  TFGLFLARKVSLIRAILYMVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTG  167

Query  354  LVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPA  533
            L AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPA
Sbjct  168  LGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPA  227

Query  534  RSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  707
            RS GAAVI+NN+ AWDD WIFWVGP +GA   A YHQ +LRA AVKAL GSF+ST +V
Sbjct  228  RSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKAL-GSFRSTAHV  284



>ref|XP_009611050.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana tomentosiformis]
Length=268

 Score =   321 bits (823),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 179/235 (76%), Positives = 197/235 (84%), Gaps = 1/235 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            T LFLYVSVATVIG K    PC G GLLGISW FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  35   TFLFLYVSVATVIGHKKQVGPCDGVGLLGISWAFGGMIFVLVYCTAGISGGHINPAVTFG  94

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            L LARKVSL+RAVAYMVAQCLGA+ GVGLVK   K  ++T GGGANTV  G+S G  L A
Sbjct  95   LLLARKVSLLRAVAYMVAQCLGAICGVGLVKGFMKHDYNTHGGGANTVAVGYSTGAALGA  154

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKRN+RDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  155  EIIGTFVLVYTVFSATDPKRNSRDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  214

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  707
            GAAVI+N+  AW+DHWIFWVGP LGA+A A+Y+Q +LRAQA K L  SF S  ++
Sbjct  215  GAAVIYNHTTAWNDHWIFWVGPFLGALAAALYYQQLLRAQAAKTL-SSFHSNSSI  268



>gb|AAV69744.1| aquaporin [Vitis vinifera]
Length=284

 Score =   322 bits (825),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 178/238 (75%), Positives = 200/238 (84%), Gaps = 4/238 (2%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATP---DPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAV  173
            TLLFLY++V TVIG K+     DPC G G+LGI+W FGGMIF+LVYCTAGISGGHINPAV
Sbjct  48   TLLFLYITVLTVIGYKSQTAGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAV  107

Query  174  TFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVG  353
            TFGLFLARKVSLIRA+ YMVAQCLGA+ GVGLVKA    ++D  GGGAN +  G+SKG G
Sbjct  108  TFGLFLARKVSLIRAILYMVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTG  167

Query  354  LVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPA  533
            L AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPA
Sbjct  168  LGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPA  227

Query  534  RSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  707
            RS GAAVI+NN+ AWDD WIFWVGP +GA   A YHQ +LRA AVKAL GSF+ST +V
Sbjct  228  RSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKAL-GSFRSTTHV  284



>ref|XP_011089904.1| PREDICTED: LOW QUALITY PROTEIN: aquaporin PIP2-7-like [Sesamum 
indicum]
Length=278

 Score =   322 bits (824),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 176/238 (74%), Positives = 199/238 (84%), Gaps = 7/238 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPD------PCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG K+  D       C G G+LGI+W FGGMIF+LVYCTAGISGGHIN
Sbjct  41   TLLFLYITVLTVIGYKSQSDTAHGGDECGGVGILGIAWAFGGMIFILVYCTAGISGGHIN  100

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRA+ YMVAQCLGA+ GVGLVKA  K +++  GGGAN +  G++K
Sbjct  101  PAVTFGLFLARKVSLIRALVYMVAQCLGAICGVGLVKAFQKSYYNRYGGGANELAAGYNK  160

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            GVGL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  161  GVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  220

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            NPARSFGAAVI+N+  AWDDHWIFWVGP +GA   A YHQ +LRA A+KAL GSF+S 
Sbjct  221  NPARSFGAAVIYNDDKAWDDHWIFWVGPFIGAAIAAFYHQYILRAAAIKAL-GSFRSN  277



>gb|AAL49751.1|AF452013_1 aquaporin-like protein [Petunia x hybrida]
Length=256

 Score =   321 bits (822),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 172/236 (73%), Positives = 199/236 (84%), Gaps = 4/236 (2%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKAT--PDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLYV++ATVIG K     +PC G G+LGI+W FGGMIFVLVYCTAGISGGHINPAVT
Sbjct  20   TLLFLYVTIATVIGHKRLNGANPCDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVT  79

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgv-glvkalTKDFFDTVGGGANTVQPGFSKGVG  353
            FGLFLARKVSLIRAVAY+++QCLGA+ GV  +   + K +++++GGGAN V  G++KG  
Sbjct  80   FGLFLARKVSLIRAVAYIISQCLGAICGVGLVKAFMNKHYYNSLGGGANEVASGYNKGTA  139

Query  354  LVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPA  533
            L AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPA
Sbjct  140  LGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPA  199

Query  534  RSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            RSFGAAVI+N   AWDD WIFWVGP +GA+  A+YHQ VLRA AVKAL GSF+S P
Sbjct  200  RSFGAAVIYNQDKAWDDQWIFWVGPFIGALIAALYHQFVLRAGAVKAL-GSFRSNP  254



>emb|CAN75442.1| hypothetical protein VITISV_019657 [Vitis vinifera]
Length=284

 Score =   322 bits (825),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 178/238 (75%), Positives = 200/238 (84%), Gaps = 4/238 (2%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATP---DPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAV  173
            TLLFLY++V TVIG K+     DPC G G+LGI+W FGGMIF+LVYCTAGISGGHINPAV
Sbjct  48   TLLFLYITVLTVIGYKSQTAGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAV  107

Query  174  TFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVG  353
            TFGLFLARKVSLIRA+ YMVAQCLGA+ GVGLVKA    ++D  GGGAN +  G+SKG G
Sbjct  108  TFGLFLARKVSLIRAILYMVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTG  167

Query  354  LVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPA  533
            L AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPA
Sbjct  168  LGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPA  227

Query  534  RSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  707
            RS GAAVI+NN+ AWDD WIFWVGP +GA   A YHQ +LRA AVKAL GSF+ST +V
Sbjct  228  RSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKAL-GSFRSTXHV  284



>ref|XP_010920407.1| PREDICTED: probable aquaporin PIP2-2 [Elaeis guineensis]
Length=287

 Score =   322 bits (825),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 175/239 (73%), Positives = 196/239 (82%), Gaps = 9/239 (4%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP--------CKGAGLLGISWVFGGMIFVLVYCTAGISGGH  158
            TLLFLY++VATVIG K   DP        C G G+LGI+W FGGMIF+LVYCTAGISGGH
Sbjct  49   TLLFLYITVATVIGYKHQSDPNVGGADAACSGVGILGIAWAFGGMIFILVYCTAGISGGH  108

Query  159  INPAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGF  338
            INPAVTFGLFLARKVSL+RA+ YM+AQCLGA+ GVGLVK   + ++D  GGGAN +  G+
Sbjct  109  INPAVTFGLFLARKVSLVRALLYMIAQCLGAICGVGLVKGFQRAYYDRYGGGANELSSGY  168

Query  339  SKGVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGT  518
            SKG GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGT
Sbjct  169  SKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGT  228

Query  519  GINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQS  695
            GINPARS GAAVI+NN+ AWDD WIFWVGP +GA   A YHQ VLRA A KAL GSF+S
Sbjct  229  GINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAAYHQYVLRASAGKAL-GSFRS  286



>dbj|BAD90700.1| plasma membrane intrinsic protein 2;4 [Mimosa pudica]
Length=281

 Score =   322 bits (824),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 177/238 (74%), Positives = 201/238 (84%), Gaps = 4/238 (2%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPD---PCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAV  173
            TLLFLY++V TVIG K+  D    C G G+LGI+W FGGMIF+LVYCTAGISGGHINPAV
Sbjct  45   TLLFLYITVLTVIGYKSQIDGGHDCDGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAV  104

Query  174  TFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVG  353
            TFGLFLARKVSLIRA+AY+VAQCLGA+ G GLVKA  K F++  GGGANT+  G+S G G
Sbjct  105  TFGLFLARKVSLIRAIAYIVAQCLGAICGCGLVKAFQKAFYNRYGGGANTLSTGYSSGTG  164

Query  354  LVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPA  533
            L AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ TIPITGTGINPA
Sbjct  165  LGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLTTIPITGTGINPA  224

Query  534  RSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  707
            RSFGAAV++NN  AWDDHWIFWVGP +GA   A+YHQ VLRAQA KAL GSF+S+ ++
Sbjct  225  RSFGAAVMYNNFEAWDDHWIFWVGPFIGAAIAAIYHQYVLRAQAAKAL-GSFRSSSHL  281



>gb|ACX37450.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=288

 Score =   322 bits (825),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 174/241 (72%), Positives = 197/241 (82%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKA------TPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG K+        DPC G G+LGI+W FGGMIF+LVYCTAGISGGHIN
Sbjct  49   TLLFLYITVLTVIGYKSQTDPAKNADPCGGVGILGIAWAFGGMIFILVYCTAGISGGHIN  108

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVT GLFLARKVSL+RA+ YM AQCLGA+ G GLVKA  K +++  GGGAN +  G+SK
Sbjct  109  PAVTLGLFLARKVSLVRAILYMAAQCLGAICGCGLVKAFQKAYYNRYGGGANELADGYSK  168

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIP+TGTGI
Sbjct  169  GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGI  228

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARSFGAAVI+N   AWDD WIFWVGP +GA   A YHQ +LRA AVKAL GSF+ST N
Sbjct  229  NPARSFGAAVIYNQDKAWDDQWIFWVGPFIGAAIAAFYHQYILRAAAVKAL-GSFRSTSN  287

Query  705  V  707
            +
Sbjct  288  I  288



>emb|CAH60724.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score =   322 bits (824),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 178/241 (74%), Positives = 198/241 (82%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG K+  D       C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  46   TLLFLYITVLTVIGYKSQTDTAKNGDVCGGVGVLGIAWAFGGMIFVLVYCTAGISGGHIN  105

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSL+RA+ YMVAQCLGA+ G GLVKA  K ++   GGGAN +  GFSK
Sbjct  106  PAVTFGLFLARKVSLVRAILYMVAQCLGAICGCGLVKAFQKSYYTKYGGGANGLASGFSK  165

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G  L AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  166  GTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  225

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARSFGAAVI+N   AWDDHWIFWVGP +GA   A+YHQ VLRA AVKAL GSF+S+ N
Sbjct  226  NPARSFGAAVIYNEDKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVKAL-GSFRSSSN  284

Query  705  V  707
            +
Sbjct  285  I  285



>ref|XP_006298288.1| hypothetical protein CARUB_v10014353mg [Capsella rubella]
 gb|EOA31186.1| hypothetical protein CARUB_v10014353mg [Capsella rubella]
Length=278

 Score =   321 bits (823),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 179/234 (76%), Positives = 198/234 (85%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIFV+VYCTAGISGGHINPAVTFG
Sbjct  45   TLLFLYVTVATVIGHKNQTGPCGGVGLLGIAWSFGGMIFVVVYCTAGISGGHINPAVTFG  104

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL+RAVAYMVAQCLGA+ GVGLVKA     +   GGGANT+  G+S G  L A
Sbjct  105  LFLARKVSLLRAVAYMVAQCLGAICGVGLVKAFMMTPYKGHGGGANTIAHGYSTGTALGA  164

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  165  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  224

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+N+K AWDDHWIFWVGP +GA+A A YHQ +LRA A+KAL  SF+S P 
Sbjct  225  GAAVIYNDKKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-ASFRSNPT  277



>gb|EYU37965.1| hypothetical protein MIMGU_mgv1a011471mg [Erythranthe guttata]
Length=280

 Score =   321 bits (823),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 176/235 (75%), Positives = 200/235 (85%), Gaps = 3/235 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTK--ATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLYV+VATVIG K  +  D C G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVT
Sbjct  45   TLLFLYVTVATVIGHKKLSELDQCNGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVT  104

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGLFLARKVSLIR ++Y++AQ LGA+ GVGLVKA  K  ++  GGGAN+V  G++ G  +
Sbjct  105  FGLFLARKVSLIRGISYIIAQSLGAICGVGLVKAFMKSDYNRFGGGANSVAHGYNIGTAV  164

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  165  GAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  224

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            SFGAAVI+NN+  WDDHWIFWVGPM GAIA A+YHQ VLRA A+KAL GSF+S P
Sbjct  225  SFGAAVIYNNQKIWDDHWIFWVGPMAGAIAAAIYHQFVLRAGAIKAL-GSFRSNP  278



>ref|XP_009345382.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
Length=287

 Score =   322 bits (824),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 177/241 (73%), Positives = 197/241 (82%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYV+V TVIG K+  DP      C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  48   TLLFLYVTVLTVIGYKSQTDPAVNADACGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  107

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSL+RAV YMVAQ LGA+ GV LVKA  K ++   GGGAN++  G+S 
Sbjct  108  PAVTFGLFLARKVSLVRAVLYMVAQSLGAIAGVALVKAFQKSYYIKYGGGANSLSDGYST  167

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            GVGL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  168  GVGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGI  227

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARS GAAVI+N   AWDD WIFWVGP +GA   A YHQ +LRA AVKAL GSF+S P+
Sbjct  228  NPARSLGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKAL-GSFRSNPH  286

Query  705  V  707
            V
Sbjct  287  V  287



>gb|KHG00060.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=289

 Score =   322 bits (824),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 175/240 (73%), Positives = 198/240 (83%), Gaps = 9/240 (4%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP--------CKGAGLLGISWVFGGMIFVLVYCTAGISGGH  158
            TLLFLYV+V TVIG K   DP        C G G+LGI+W FGGMIF+LVYCTAGISGGH
Sbjct  50   TLLFLYVTVLTVIGYKVQTDPAKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGH  109

Query  159  INPAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGF  338
            INPAVTFGLF+ RKVSLIRA+ YMVAQCLGA+ G GLVKA  K +++  GGGAN +QPGF
Sbjct  110  INPAVTFGLFVGRKVSLIRALMYMVAQCLGAICGCGLVKAFQKTYYNNYGGGANELQPGF  169

Query  339  SKGVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGT  518
            +KG GL AEI+ TF LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIP+TGT
Sbjct  170  NKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGT  229

Query  519  GINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            GINPARSFGAAVI+N + AWDD WIFWVGP +GA A A YHQ +LRA A+KAL GSF+S 
Sbjct  230  GINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAAAAAFYHQYILRAAAIKAL-GSFRSN  288



>ref|XP_007218772.1| hypothetical protein PRUPE_ppa009540mg [Prunus persica]
 gb|EMJ19971.1| hypothetical protein PRUPE_ppa009540mg [Prunus persica]
Length=287

 Score =   321 bits (823),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 176/241 (73%), Positives = 197/241 (82%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKA------TPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYV+V TVIG K+        D C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  48   TLLFLYVTVLTVIGYKSQTDTTVNADACGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  107

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSL+RAV YMVAQ LGA+ GV LVKA  + ++   GGGAN +  G+SK
Sbjct  108  PAVTFGLFLARKVSLVRAVLYMVAQSLGAIAGVALVKAFQESYYTKYGGGANELSQGYSK  167

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            GVGL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  168  GVGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGI  227

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARS GAAVI+N + AWDD WIFWVGP +GA   A YHQ +LRA AVKAL GSF+S P+
Sbjct  228  NPARSLGAAVIYNKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKAL-GSFRSNPH  286

Query  705  V  707
            V
Sbjct  287  V  287



>ref|XP_008233329.1| PREDICTED: probable aquaporin PIP2-5 [Prunus mume]
Length=287

 Score =   321 bits (823),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 177/241 (73%), Positives = 196/241 (81%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKA------TPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYV+V TVIG K+        D C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  48   TLLFLYVTVLTVIGYKSQTDTAVNADACGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  107

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSL+RAV YMVAQ LGA+ GV LVKA  K ++   GGGAN +  G+S 
Sbjct  108  PAVTFGLFLARKVSLVRAVLYMVAQSLGAIAGVALVKAFQKSYYTKYGGGANELSQGYST  167

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            GVGL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  168  GVGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGI  227

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARS GAAVI+N K AWDD WIFWVGP +GA   A YHQ +LRA AVKAL GSF+S P+
Sbjct  228  NPARSLGAAVIYNKKKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKAL-GSFRSNPH  286

Query  705  V  707
            V
Sbjct  287  V  287



>gb|EYU36189.1| hypothetical protein MIMGU_mgv1a011437mg [Erythranthe guttata]
Length=282

 Score =   321 bits (823),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 178/234 (76%), Positives = 198/234 (85%), Gaps = 3/234 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATP--DPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLY++V TVIG K+    D C G G+LGI+W FGGMIFVLVYCTAGISGGHINPAVT
Sbjct  49   TLLFLYITVLTVIGYKSQSEYDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVT  108

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGLFLARKVSLIRAV YMVAQCLGA+ GVG VKA  K  ++  GGGANT+  G++KG GL
Sbjct  109  FGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQKSHYNKFGGGANTLALGYNKGTGL  168

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  169  GAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  228

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            SFGAAVI NN+ AWDDHWIFWVGP +GA   A+YHQ VLRA A+KAL GSF+S 
Sbjct  229  SFGAAVIFNNEKAWDDHWIFWVGPFIGAAIAAIYHQFVLRAGAIKAL-GSFRSN  281



>gb|AGD98705.1| aquaporin [Camellia sinensis]
Length=283

 Score =   321 bits (823),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 175/235 (74%), Positives = 201/235 (86%), Gaps = 3/235 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATP--DPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLY+++ TVIG K+    D C G G+LGI+W FGGMIFVLVYCTAGISGGHINPAVT
Sbjct  48   TLLFLYITILTVIGYKSQSATDDCGGVGILGIAWSFGGMIFVLVYCTAGISGGHINPAVT  107

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGLFLARKVSLIRAV+YM+AQCLGA+ GVGLVKA  K  ++++GGGAN + PG++KG  L
Sbjct  108  FGLFLARKVSLIRAVSYMIAQCLGAICGVGLVKAFMKHNYNSLGGGANLIAPGYNKGTAL  167

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  168  GAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  227

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            SFGAAVI+NNK  W  HWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct  228  SFGAAVIYNNKKVWGQHWIFWVGPFVGAMAAAAYHQYILRAAAIKAL-GSFRSNP  281



>ref|NP_001267922.1| aquaporin-like [Vitis vinifera]
 gb|ABN14353.1| aquaporin PIP2;4 [Vitis vinifera]
Length=284

 Score =   321 bits (822),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 177/238 (74%), Positives = 200/238 (84%), Gaps = 4/238 (2%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATP---DPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAV  173
            TLLFLY++V TVIG K+     DPC G G+LGI+W FGGMIF+LVYCTAGISGGHINPAV
Sbjct  48   TLLFLYITVLTVIGYKSQTAGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAV  107

Query  174  TFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVG  353
            TFGLFLARKVSLIRA+ YMVAQCLGA+ GVGLVKA    ++D  GGGAN +  G+SKG G
Sbjct  108  TFGLFLARKVSLIRAILYMVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTG  167

Query  354  LVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPA  533
            L AEI+ TF LVYTVFSATDPK++ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPA
Sbjct  168  LGAEIIGTFVLVYTVFSATDPKKSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPA  227

Query  534  RSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  707
            RS GAAVI+NN+ AWDD WIFWVGP +GA   A YHQ +LRA AVKAL GSF+ST +V
Sbjct  228  RSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKAL-GSFRSTAHV  284



>ref|XP_009780213.1| PREDICTED: aquaporin PIP2-4-like [Nicotiana sylvestris]
 tpg|DAA64686.1| TPA_exp: aquaporin PIP2 9b [Nicotiana tabacum]
Length=287

 Score =   321 bits (822),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 179/238 (75%), Positives = 198/238 (83%), Gaps = 7/238 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIG------TKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYV+V TVIG       KA  D C G G+LGI+W FGGMIF+LVYCTAGISGGHIN
Sbjct  50   TLLFLYVTVLTVIGYKVQSDVKADGDICGGVGILGIAWAFGGMIFILVYCTAGISGGHIN  109

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRAV YMVAQCLGA+ GVG VKA    ++   GGGAN + PG +K
Sbjct  110  PAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANVMAPGHTK  169

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            GVGL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  170  GVGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  229

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            NPARSFGAAVI+N+  AWD+HWIFWVGP +GA A AVYHQ +LRA A+KAL GSF+S 
Sbjct  230  NPARSFGAAVIYNHDKAWDEHWIFWVGPFIGAFAAAVYHQFILRAGAIKAL-GSFRSN  286



>ref|XP_009595123.1| PREDICTED: aquaporin PIP2-4-like [Nicotiana tomentosiformis]
 tpg|DAA64685.1| TPA_exp: aquaporin PIP2 9a [Nicotiana tabacum]
Length=287

 Score =   321 bits (822),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 179/238 (75%), Positives = 197/238 (83%), Gaps = 7/238 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIG------TKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYV+V TVIG       KA  D C G G+LGI+W FGGMIF+LVYCTAGISGGHIN
Sbjct  50   TLLFLYVTVLTVIGYKVQSDVKADGDICGGVGILGIAWAFGGMIFILVYCTAGISGGHIN  109

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRAV YMVAQCLGA+ GVGLVK     ++   GGGAN + PG +K
Sbjct  110  PAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGLVKGFQSAYYVRYGGGANVMAPGHTK  169

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            GVGL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  170  GVGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  229

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            NPARSFGAAVI+N   AWD+HWIFWVGP +GA A AVYHQ +LRA A+KAL GSF+S 
Sbjct  230  NPARSFGAAVIYNQDKAWDEHWIFWVGPFIGAFAAAVYHQFILRAGAIKAL-GSFRSN  286



>ref|XP_010489282.1| PREDICTED: probable aquaporin PIP2-8 [Camelina sativa]
Length=278

 Score =   320 bits (821),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 178/234 (76%), Positives = 196/234 (84%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATV+G K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  45   TLLFLYVTVATVVGHKNQTGPCNGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  104

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
             FLARKVSL+RAVAYMVAQCLGA+ GVGLVKA     +   GGGANTV  G+S G  L A
Sbjct  105  FFLARKVSLLRAVAYMVAQCLGAICGVGLVKAFMMTPYKRHGGGANTVAHGYSTGTALGA  164

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  165  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  224

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+N+  AWDDHWIFWVGP +GA+A A YHQ +LRA A+KAL  SF+S P 
Sbjct  225  GAAVIYNDDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-ASFRSNPT  277



>gb|KHG10662.1| Aquaporin PIP2-1 -like protein [Gossypium arboreum]
Length=285

 Score =   321 bits (822),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 172/238 (72%), Positives = 197/238 (83%), Gaps = 7/238 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG K+  DP      C G G+LGI+W FGGMIF+LVYCTAGISGGHIN
Sbjct  46   TLLFLYITVLTVIGYKSQVDPDKGSDECGGVGILGIAWAFGGMIFILVYCTAGISGGHIN  105

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSL+RA+ YM AQCLGA+ G GLVKA  K +++  GGGAN++  G+S 
Sbjct  106  PAVTFGLFLARKVSLVRAIFYMAAQCLGAICGCGLVKAFQKSYYNKYGGGANSLADGYST  165

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKRNARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  166  GTGLAAEIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGI  225

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            NPARSFGAAVI+N    WDDHWIFWVGP +GA   A+YHQ +LRA AVKAL GSF+S+
Sbjct  226  NPARSFGAAVIYNQDKPWDDHWIFWVGPFIGAAIAAIYHQFILRAAAVKAL-GSFRSS  282



>gb|EYU40445.1| hypothetical protein MIMGU_mgv1a011413mg [Erythranthe guttata]
Length=282

 Score =   320 bits (821),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 178/234 (76%), Positives = 200/234 (85%), Gaps = 3/234 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTK--ATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLYV+VATVIG K  +  D C G G+LGI+W FGGMIF+LVYCTAGISGGHINPAVT
Sbjct  47   TLLFLYVTVATVIGHKKLSAADQCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT  106

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGLFLARKVSL+RAVAYMVAQCLGA+ GVGLVKA  K  ++ +GGGAN+V PG++KG  L
Sbjct  107  FGLFLARKVSLVRAVAYMVAQCLGAICGVGLVKAFMKSPYNHLGGGANSVAPGYNKGTAL  166

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  167  GAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  226

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            SFGAAVI NN   WDD WIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S 
Sbjct  227  SFGAAVIFNNGKVWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSN  279



>ref|XP_002311092.1| plasma membrane intrinsic protein 1-1 [Populus trichocarpa]
 gb|ABK95655.1| unknown [Populus trichocarpa]
 gb|EEE88459.1| plasma membrane intrinsic protein 1-1 [Populus trichocarpa]
Length=285

 Score =   320 bits (821),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 176/239 (74%), Positives = 196/239 (82%), Gaps = 5/239 (2%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKA----TPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPA  170
            T+LFLY++V TVIG K+      DPC G G+LGI+W FGGMIFVLVYCTAGISGGHINPA
Sbjct  48   TMLFLYITVLTVIGYKSQIDGNADPCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPA  107

Query  171  VTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGV  350
            VTFGLFLARKVSLIRAV YMVAQC GA+ GVGLVKA  K ++    GGAN +  G+S G 
Sbjct  108  VTFGLFLARKVSLIRAVMYMVAQCAGAICGVGLVKAFQKSYYTKYNGGANVLADGYSTGT  167

Query  351  GLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINP  530
            GL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINP
Sbjct  168  GLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227

Query  531  ARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  707
            ARSFGAAVI+NNK AW D WIFW GP +GA   A YHQ +LRA A+KAL GSF+S PNV
Sbjct  228  ARSFGAAVIYNNKKAWHDQWIFWAGPFIGAAIAAFYHQFILRAGAIKAL-GSFRSNPNV  285



>ref|XP_007016740.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
 gb|EOY34359.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
Length=289

 Score =   321 bits (822),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 176/240 (73%), Positives = 197/240 (82%), Gaps = 9/240 (4%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPD--------PCKGAGLLGISWVFGGMIFVLVYCTAGISGGH  158
            TLLFLYVSV TVIG K   D         C G G+LGI+W FGGMIF+LVYCTAGISGGH
Sbjct  50   TLLFLYVSVLTVIGYKVQTDTLKNTVDADCGGVGILGIAWAFGGMIFILVYCTAGISGGH  109

Query  159  INPAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGF  338
            INPAVTFGLFL RKVSLIRA+ YMVAQCLGA+ G GLVKA  K +++T GGGAN +QPG+
Sbjct  110  INPAVTFGLFLGRKVSLIRAIMYMVAQCLGAICGCGLVKAFQKTYYNTYGGGANELQPGY  169

Query  339  SKGVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGT  518
            +KG GL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGT
Sbjct  170  NKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGT  229

Query  519  GINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            GINPARSFGAAVI+N + AWDD WIFWVGP +GA   A YHQ +LRA A+KAL GSF+S 
Sbjct  230  GINPARSFGAAVIYNREKAWDDQWIFWVGPFIGAAIAAFYHQYILRAAAIKAL-GSFRSN  288



>ref|XP_007207344.1| hypothetical protein PRUPE_ppa009630mg [Prunus persica]
 gb|EMJ08543.1| hypothetical protein PRUPE_ppa009630mg [Prunus persica]
Length=284

 Score =   320 bits (821),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 175/237 (74%), Positives = 196/237 (83%), Gaps = 3/237 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATP--DPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLY++V TVIG K+    D C G G+LGI+W FGGMIFVLVYCTAGISGGHINPAVT
Sbjct  49   TLLFLYITVLTVIGYKSQSEGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVT  108

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGLFLARKVSL+RA+ YMVAQ LGA+ GVGLVKA    +F   GGGAN +  G+S+G GL
Sbjct  109  FGLFLARKVSLVRAILYMVAQSLGAICGVGLVKAFQNAYFTKYGGGANGLADGYSQGTGL  168

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  169  AAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPAR  228

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  707
            S GAAVI+NN  AWDD WIFWVGP +GA   A YHQ +LRA AVKAL GSF+S+ N+
Sbjct  229  SLGAAVIYNNDKAWDDQWIFWVGPFIGAAIAAFYHQYILRAGAVKAL-GSFRSSSNI  284



>ref|XP_008243934.1| PREDICTED: probable aquaporin PIP2-5 [Prunus mume]
Length=284

 Score =   320 bits (821),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 175/237 (74%), Positives = 197/237 (83%), Gaps = 3/237 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPD--PCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLY++V TVIG K+  D   C G G+LGI+W FGGMIFVLVYCTAGISGGHINPAVT
Sbjct  49   TLLFLYITVLTVIGYKSQSDGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVT  108

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGLFLARKVSL+RA+ YMVAQ LGA+ GVGLVKA  K +F   GGGAN +  G+S+G GL
Sbjct  109  FGLFLARKVSLVRAILYMVAQSLGAICGVGLVKAFQKAYFTKYGGGANGLADGYSQGTGL  168

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  169  AAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPAR  228

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  707
            S GAAVI++N  AWDD WIFWVGP +GA   A YHQ +LRA AVKAL GSF+S+ N+
Sbjct  229  SLGAAVIYDNDKAWDDQWIFWVGPFIGAAIAAFYHQYILRAGAVKAL-GSFRSSSNI  284



>gb|AIG92831.1| aquaporin PIP2 [Chrysanthemum x morifolium]
Length=285

 Score =   320 bits (821),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 175/240 (73%), Positives = 198/240 (83%), Gaps = 6/240 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG K+T DP      C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  46   TLLFLYITVLTVIGYKSTTDPALNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  105

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRA+ YMVAQCLGA+ GVGLVKA  K  ++  GGGAN++  G++K
Sbjct  106  PAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGLVKAFNKSLYNRYGGGANSLADGYNK  165

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIP+TGTGI
Sbjct  166  GTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGI  225

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARSFGAAVI+N +  WDD WIFWVGP +GA   A YHQ +LRA A+KALG    STPN
Sbjct  226  NPARSFGAAVIYNKEKIWDDQWIFWVGPFIGAAIAAFYHQFILRAGAIKALGSFRSSTPN  285



>dbj|BAG06230.1| plasma membrane intrinsic protein [Hordeum vulgare]
Length=284

 Score =   320 bits (821),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 173/234 (74%), Positives = 197/234 (84%), Gaps = 3/234 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTK--ATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLY++VATVIG K  +  DPC G G+LGI+W FGGMIFVLVYCTAGISGGHINPAVT
Sbjct  49   TLLFLYITVATVIGYKVQSAADPCAGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVT  108

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGL LARKVSL+RAV Y+VAQC G +VG G+VK + KD +   GGGAN V  GFS+G  L
Sbjct  109  FGLLLARKVSLLRAVMYIVAQCAGGIVGAGIVKGIMKDAYQANGGGANMVASGFSRGTAL  168

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  169  GAEIVGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  228

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            S GAAVI+N K AWD+HWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S+
Sbjct  229  SLGAAVIYNKKAAWDNHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSS  281



>gb|ABB13430.2| plasma membrane intrinsic protein [Olea europaea]
Length=287

 Score =   320 bits (821),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 177/238 (74%), Positives = 198/238 (83%), Gaps = 7/238 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYV+V TVIG K+  DP      C G G+LGI+W FGGMIF+LVYCTAGISGGHIN
Sbjct  50   TLLFLYVTVLTVIGYKSQIDPAHGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHIN  109

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVT GLFL RKVSLIRAV YMVAQCLGA+ GVGLVKA  K ++   GGGAN + PG++K
Sbjct  110  PAVTLGLFLGRKVSLIRAVLYMVAQCLGAICGVGLVKAFQKSYYHKYGGGANELAPGYNK  169

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            GVGL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  170  GVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  229

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            NPARSFGAAVI+N    WDDHWIFWVGP +GA+  A+YHQ +LRA A+KAL GSF+S 
Sbjct  230  NPARSFGAAVIYNEDKPWDDHWIFWVGPFVGALIAAIYHQYILRAGAIKAL-GSFRSN  286



>ref|NP_001268056.1| aquaporin PIP2 [Vitis vinifera]
 gb|ABC84558.1| aquaporin PIP2 [Vitis vinifera]
Length=280

 Score =   320 bits (820),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 175/234 (75%), Positives = 198/234 (85%), Gaps = 3/234 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPD--PCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLY++V TVIG K+  D  PC G G+LGI+W FGGMIF+LVYCTAGISGGHINPAVT
Sbjct  47   TLLFLYITVLTVIGYKSQSDTDPCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT  106

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGLFLARKVSL+RA+ YM+AQCLGAV GVGLVKA     ++  GGGAN +  G++KGVGL
Sbjct  107  FGLFLARKVSLVRALMYMIAQCLGAVCGVGLVKAFQSSLYNRYGGGANELAGGYNKGVGL  166

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  167  GAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  226

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            SFGAAVI+NN  AWDDHW+FWVGP +GA   A YHQ +LRA A+KAL GSF+S 
Sbjct  227  SFGAAVIYNNDKAWDDHWMFWVGPFIGAAIAAFYHQYILRAAAIKAL-GSFRSN  279



>ref|XP_010264685.1| PREDICTED: aquaporin PIP2-1-like [Nelumbo nucifera]
Length=287

 Score =   320 bits (820),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 177/241 (73%), Positives = 200/241 (83%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG ++  D       C+G G+LGI+W FGGMIF+LVYCTAGISGGHIN
Sbjct  48   TLLFLYITVLTVIGYRSQTDQAHNGGDCEGVGILGIAWAFGGMIFILVYCTAGISGGHIN  107

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRAV YMVAQCLGA+ GVGLVK   K ++   GGGAN++  G+SK
Sbjct  108  PAVTFGLFLARKVSLIRAVMYMVAQCLGAICGVGLVKGFQKAYYMRSGGGANSLALGYSK  167

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            GVGL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  168  GVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  227

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARS GAAVI+N   AWDDHWIFWVGP  GA   A+YHQ +LRA A+KAL GSF+S P+
Sbjct  228  NPARSLGAAVIYNKDKAWDDHWIFWVGPFTGAALAALYHQYILRAAAIKAL-GSFRSNPH  286

Query  705  V  707
            V
Sbjct  287  V  287



>ref|XP_009600501.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana tomentosiformis]
 tpg|DAA64680.1| TPA_exp: aquaporin PIP2 6a [Nicotiana tabacum]
Length=283

 Score =   320 bits (820),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 176/236 (75%), Positives = 198/236 (84%), Gaps = 3/236 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKA--TPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLYV+VATVIG K     D C G G+LGI+W FGGMIFVLVYCTAGISGGHINPAVT
Sbjct  48   TLLFLYVTVATVIGHKKLNAADHCDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVT  107

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGL LARKVSLIRAVAY++AQ LGA+ GVG VKA  K +++  GGGAN VQPG++KG  L
Sbjct  108  FGLLLARKVSLIRAVAYIIAQSLGAICGVGFVKAFMKHYYNLEGGGANFVQPGYNKGTAL  167

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  168  GAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  227

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            SFGAAVI+N +  WDD WIFWVGP +GA+  A+Y+Q VLRA AVKAL GSF+S P 
Sbjct  228  SFGAAVIYNKEKIWDDQWIFWVGPFVGALIAAIYYQFVLRAGAVKAL-GSFRSNPT  282



>ref|NP_001274376.1| aquaporin PIP2-7-like [Cucumis sativus]
 gb|AHB33481.1| plasma intrinsic protein 2-5 [Cucumis sativus]
 gb|KGN43259.1| hypothetical protein Csa_7G014450 [Cucumis sativus]
Length=280

 Score =   319 bits (818),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 173/233 (74%), Positives = 195/233 (84%), Gaps = 1/233 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV++ATVIG       C G G+LGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  47   TLLFLYVTIATVIGNNKQTKACDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  106

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRA  YMVAQC GA+VGVGLVKA  K  ++  GGGAN V  G+S+G  L A
Sbjct  107  LFLARKVSLIRAFGYMVAQCAGAIVGVGLVKAFMKHDYNNNGGGANAVNSGYSRGTALGA  166

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  167  EIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  226

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            GAAVI+N +  W+DHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct  227  GAAVIYNREKPWNDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNP  278



>ref|XP_011031744.1| PREDICTED: probable aquaporin PIP2-5 [Populus euphratica]
Length=285

 Score =   320 bits (819),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 176/239 (74%), Positives = 197/239 (82%), Gaps = 5/239 (2%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKA----TPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPA  170
            T+LFLY++V TVIG K+      DPC G G+LGI+W FGGMIFVLVYCTAGISGGHINPA
Sbjct  48   TMLFLYITVLTVIGYKSQIDGNADPCNGVGILGIAWAFGGMIFVLVYCTAGISGGHINPA  107

Query  171  VTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGV  350
            VTFGLFLARKVSLIRAV YMVAQCLGA+ GVGLVKA  K ++    GGAN +  G+S G 
Sbjct  108  VTFGLFLARKVSLIRAVMYMVAQCLGAICGVGLVKAFQKSYYTKYQGGANILADGYSTGT  167

Query  351  GLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINP  530
            GL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINP
Sbjct  168  GLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227

Query  531  ARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  707
            ARS GAAVI+NN+ AWDD WIFWVGP +GA   A YHQ +LRA A+KAL GSF+S P V
Sbjct  228  ARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAIKAL-GSFRSNPTV  285



>gb|KDP44363.1| hypothetical protein JCGZ_20043 [Jatropha curcas]
Length=285

 Score =   319 bits (818),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 177/241 (73%), Positives = 197/241 (82%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG K+  DP      C G G+LGI+W FGGMIF+LVYCTAGISGGHIN
Sbjct  46   TLLFLYITVLTVIGYKSQTDPAKNADSCGGVGILGIAWAFGGMIFILVYCTAGISGGHIN  105

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSL+RAV YMVAQ LGA+ GVGLVKA    ++   GGGANT+  G+S 
Sbjct  106  PAVTFGLFLARKVSLVRAVMYMVAQSLGAICGVGLVKAFQSAYYKRYGGGANTLADGYST  165

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            GVGL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  166  GVGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  225

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARS GAAVI+N+  AWDD WIFWVGP LGA   A YHQ +LRA AVKAL GSF+S P 
Sbjct  226  NPARSLGAAVIYNHDKAWDDQWIFWVGPFLGAAIAAFYHQFILRAGAVKAL-GSFRSNPT  284

Query  705  V  707
            V
Sbjct  285  V  285



>gb|ACU87558.1| PIP protein [Gossypium hirsutum]
 gb|KHG24536.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=282

 Score =   319 bits (818),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 174/240 (73%), Positives = 196/240 (82%), Gaps = 9/240 (4%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP--------CKGAGLLGISWVFGGMIFVLVYCTAGISGGH  158
            TLLFLYV+V TVIG +   DP        C G G+LGI+W FGGMIF+LVYCTAGISGGH
Sbjct  43   TLLFLYVTVLTVIGYRVQTDPLKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGH  102

Query  159  INPAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGF  338
            INPAVTFGLFL RKVSL+RAV YMVAQCLGA+ G GLVK   K +++T GGGAN +Q GF
Sbjct  103  INPAVTFGLFLGRKVSLVRAVMYMVAQCLGAICGCGLVKGFQKSYYNTYGGGANELQDGF  162

Query  339  SKGVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGT  518
            +KG GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGT
Sbjct  163  NKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGT  222

Query  519  GINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            GINPARSFGAAVI+N   AWDD W+FWVGP +GA   A+YHQ +LRA A+KAL GSF+S 
Sbjct  223  GINPARSFGAAVIYNKDKAWDDQWMFWVGPFIGAAIAAIYHQYILRAGAMKAL-GSFRSN  281



>gb|AFN53630.1| putative aquaporin PIP2-8 [Linum usitatissimum]
Length=692

 Score =   332 bits (852),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 180/233 (77%), Positives = 202/233 (87%), Gaps = 1/233 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K   DPC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  459  TLLFLYVTVATVIGHKNQTDPCGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  518

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAV+YMVAQCLGA+ GVGLVKA+ K  ++++GGGAN V  G+S G  L A
Sbjct  519  LFLARKVSLIRAVSYMVAQCLGAICGVGLVKAIMKHPYNSLGGGANAVNAGYSTGTALGA  578

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  579  EIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  638

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            GAAVI+NN   WDDHW+FWVGP +GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct  639  GAAVIYNNDKIWDDHWVFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNP  690



>ref|XP_010467415.1| PREDICTED: probable aquaporin PIP2-8 [Camelina sativa]
Length=278

 Score =   319 bits (817),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 178/234 (76%), Positives = 196/234 (84%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  45   TLLFLYVTVATVIGHKNQTGPCNGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  104

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL+RAVAYMVAQCLGA+ GVGLVKA     +   GGGAN V  G+S G  L A
Sbjct  105  LFLARKVSLLRAVAYMVAQCLGAICGVGLVKAFMMTPYKRHGGGANAVAHGYSTGTALGA  164

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  165  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  224

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+N+  AW+DHWIFWVGP +GA+A A YHQ +LRA A+KAL  SF+S P 
Sbjct  225  GAAVIYNDDKAWNDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-ASFRSNPT  277



>gb|ABK21046.1| unknown [Picea sitchensis]
Length=284

 Score =   319 bits (818),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 176/235 (75%), Positives = 198/235 (84%), Gaps = 1/235 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY+++ATVIG       C   G+LGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  51   TLLFLYITIATVIGHSRNKADCGSVGVLGIAWSFGGMIFVLVYCTAGISGGHINPAVTFG  110

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL RAV YM+AQCLGA+ G GLVKA  K ++D  GGGAN V  G++KGVGL A
Sbjct  111  LFLARKVSLPRAVMYMIAQCLGAICGAGLVKAFQKPYYDRYGGGANVVAHGYTKGVGLAA  170

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  171  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  230

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  707
            GAAVI+ +KH+WDD WIFWVGPM+GA A A YHQ +LRA A+KAL GSF+S P V
Sbjct  231  GAAVIYGHKHSWDDQWIFWVGPMVGAAAAAAYHQHILRATAIKAL-GSFRSNPQV  284



>gb|KHN32779.1| Aquaporin PIP2-2 [Glycine soja]
Length=239

 Score =   318 bits (814),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 173/240 (72%), Positives = 197/240 (82%), Gaps = 7/240 (3%)
 Frame = +3

Query  6    LLFLYVSVATVIG------TKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINP  167
            +LFLY++V TVIG       KA  D C G G+LGI+W FGGMIF+LVYCTAGISGGHINP
Sbjct  1    MLFLYITVLTVIGYKSQSDVKAGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINP  60

Query  168  AVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKG  347
            AVTFGLFLARKVSLIRA+ YMVAQCLGA+ GVGLVKA  K +++  GGGAN +  G+S G
Sbjct  61   AVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGLVKAFQKAYYNRYGGGANELSEGYSTG  120

Query  348  VGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGIN  527
            VGL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIP+TGTGIN
Sbjct  121  VGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGIN  180

Query  528  PARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  707
            PARS GAAV++N + AWDDHWIFWVGP +GA   A YHQ +LRA A KAL GSF+S P +
Sbjct  181  PARSLGAAVMYNQQKAWDDHWIFWVGPFIGAAIAAFYHQFILRASAAKAL-GSFRSNPTI  239



>ref|XP_002519539.1| Aquaporin PIP2.2, putative [Ricinus communis]
 gb|EEF42953.1| Aquaporin PIP2.2, putative [Ricinus communis]
Length=288

 Score =   319 bits (818),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 171/241 (71%), Positives = 198/241 (82%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG K+  DP      C G G+LGI+W FGGMIF+LVYCTAGISGGHIN
Sbjct  49   TLLFLYITVLTVIGYKSQTDPAKNADACGGVGILGIAWAFGGMIFILVYCTAGISGGHIN  108

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSL+RA+ YM AQCLGA+ G GLVKA  + +++  GGGAN +  G+S 
Sbjct  109  PAVTFGLFLARKVSLVRAIMYMAAQCLGAICGCGLVKAFQRAYYNRYGGGANELADGYST  168

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIP+TGTGI
Sbjct  169  GTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGI  228

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARSFGAAVI+N + AWDD WIFWVGP +GA   A+YHQ VLRA A KAL GSF+S+ N
Sbjct  229  NPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAAIAAIYHQYVLRASAAKAL-GSFRSSSN  287

Query  705  V  707
            +
Sbjct  288  I  288



>ref|XP_008447947.1| PREDICTED: aquaporin PIP2-7 [Cucumis melo]
Length=280

 Score =   319 bits (817),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 173/233 (74%), Positives = 195/233 (84%), Gaps = 1/233 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV++ATVIG       C G G+LGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  47   TLLFLYVTIATVIGNNKQTKMCDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  106

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRA  YMVAQC GA+VGVGLVKA  K  ++  GGGAN V  G+S+G  L A
Sbjct  107  LFLARKVSLIRAFGYMVAQCAGAIVGVGLVKAFMKHDYNNNGGGANAVNSGYSRGTALGA  166

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  167  EIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  226

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            GAAVI+N +  W+DHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct  227  GAAVIYNREKPWNDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNP  278



>gb|AIK66515.1| putative aquaporin [Vitis vinifera]
Length=284

 Score =   319 bits (817),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 175/238 (74%), Positives = 200/238 (84%), Gaps = 4/238 (2%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATP---DPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAV  173
            TLLFLY++V TVIG K+     DPC G G+LGI+W FGGMIF+LVYCTAGISGGHINPAV
Sbjct  48   TLLFLYITVLTVIGYKSQTAGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAV  107

Query  174  TFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVG  353
            TFGLFLARKVSLIRA+ YMVAQCLGA+ GVGLVKA    +++  GGGAN +  G+SKG G
Sbjct  108  TFGLFLARKVSLIRAILYMVAQCLGAICGVGLVKAFQSAYYNRYGGGANELATGYSKGTG  167

Query  354  LVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPA  533
            L AEI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPA
Sbjct  168  LGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPA  227

Query  534  RSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  707
            RS GAAVI+NN+ AWDD WIFWVGP +GA   A YHQ +LRA A+KAL GSF+ST +V
Sbjct  228  RSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAIKAL-GSFRSTTHV  284



>ref|XP_009389186.1| PREDICTED: probable aquaporin PIP2-6 [Musa acuminata subsp. malaccensis]
Length=281

 Score =   319 bits (817),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 174/236 (74%), Positives = 199/236 (84%), Gaps = 3/236 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKAT--PDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLYV++ATVIG K     D C G G+LGI+W FGGMIF+LVYCTAGISGGHINPAVT
Sbjct  46   TLLFLYVTIATVIGHKEQNAADQCSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT  105

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGLFLARKVSLIRA+ Y+VAQCLGA+VGVG+VK + K  ++++GGGAN V  G+SKG  L
Sbjct  106  FGLFLARKVSLIRALLYIVAQCLGAIVGVGIVKGIMKHQYNSLGGGANEVASGYSKGTAL  165

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  166  GAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  225

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            S GAAVI+N    WDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P 
Sbjct  226  SLGAAVIYNQDKPWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNPT  280



>ref|XP_010107654.1| Aquaporin PIP2-7 [Morus notabilis]
 gb|EXC16565.1| Aquaporin PIP2-7 [Morus notabilis]
Length=282

 Score =   319 bits (817),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 177/235 (75%), Positives = 198/235 (84%), Gaps = 3/235 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKAT--PDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLYV+VATVIG K     D C G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVT
Sbjct  47   TLLFLYVTVATVIGHKKQNAADQCNGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVT  106

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGLFLARKVSLIRA+ Y+VAQCLGA+ GVGLVKA  K+ ++  GGGAN V  G+S G  L
Sbjct  107  FGLFLARKVSLIRALGYIVAQCLGAISGVGLVKAFMKNDYNRRGGGANFVVDGYSTGTAL  166

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVF+ATDPKR+ARDSH+PVLAPLPIGFAVFV H+ATIPITGTGINPAR
Sbjct  167  GAEIIGTFVLVYTVFAATDPKRSARDSHIPVLAPLPIGFAVFVVHLATIPITGTGINPAR  226

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            SFGAAVI+NN   WDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct  227  SFGAAVIYNNDKIWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNP  280



>ref|XP_009400343.1| PREDICTED: probable aquaporin PIP2-6 [Musa acuminata subsp. malaccensis]
Length=282

 Score =   318 bits (816),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 175/235 (74%), Positives = 198/235 (84%), Gaps = 3/235 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKAT--PDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLYV++ATVIG K     D C G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVT
Sbjct  47   TLLFLYVTIATVIGHKEQNAADQCSGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVT  106

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
             GLFLARKVSLIRA+ YMVAQCLGA+VGVG+VK + K  ++++GGGAN V  G+SKG  L
Sbjct  107  LGLFLARKVSLIRALLYMVAQCLGAIVGVGIVKGIMKHQYNSLGGGANMVAAGYSKGTAL  166

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  167  GAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  226

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            S GAAVI+N    WDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct  227  SLGAAVIYNQDKPWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNP  280



>ref|XP_008449253.1| PREDICTED: aquaporin PIP2-2-like isoform X3 [Cucumis melo]
Length=284

 Score =   318 bits (816),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 174/241 (72%), Positives = 195/241 (81%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYV+V TVIG  +  D       C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  45   TLLFLYVTVLTVIGYSSQSDTKSGGQICGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  104

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRA+ YM AQCLGA+ G  LVK+  K  ++  GGGAN++  G+S 
Sbjct  105  PAVTFGLFLARKVSLIRAILYMAAQCLGAICGCALVKSFQKALYNGYGGGANSLADGYST  164

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  165  GTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  224

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARSFGAAVI+N   AWDD WIFWVGP +GA   A+YHQ+VLRA AVKAL GSF+S+  
Sbjct  225  NPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAIYHQIVLRAGAVKAL-GSFRSSTA  283

Query  705  V  707
            V
Sbjct  284  V  284



>ref|XP_009344758.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
 ref|XP_009349705.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
Length=283

 Score =   318 bits (816),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 177/237 (75%), Positives = 195/237 (82%), Gaps = 3/237 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATP--DPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLYV+V TVIG K+    D C G G+LGI+W FGGMIFVLVYCTAGISGGHINPAVT
Sbjct  48   TLLFLYVTVLTVIGYKSQSELDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVT  107

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGLFLARKVSL+RAV YMVAQ LGA+ GV LVKAL K ++   GGGANT+  G+S GVGL
Sbjct  108  FGLFLARKVSLVRAVLYMVAQSLGAIAGVALVKALQKSYYIKYGGGANTLSDGYSTGVGL  167

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  168  AAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPAR  227

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  707
            S G AVI N   AWDD WIFWVGP +GA   A YHQ +LRA AVKAL GSF+S P+V
Sbjct  228  SLGPAVIFNQDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKAL-GSFRSHPSV  283



>gb|ACU20229.1| unknown [Glycine max]
Length=285

 Score =   318 bits (816),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 175/241 (73%), Positives = 198/241 (82%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIG------TKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG       KA  D C G G+LGI+W FGGMIF+LVYCTAGISGGHIN
Sbjct  46   TLLFLYITVLTVIGYKSQSDVKAGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHIN  105

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRA+ YMVAQCLGA+ GVGLVKA  K +++  GGGAN +  G+S 
Sbjct  106  PAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGLVKAFQKAYYNRYGGGANELSEGYST  165

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            GVGL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIP+TGTGI
Sbjct  166  GVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGI  225

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARS GAAV++N + AWDDHWIFWVGP +GA   A YHQ +LRA A KAL GSF+S P 
Sbjct  226  NPARSLGAAVVYNQQKAWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAKAL-GSFRSNPT  284

Query  705  V  707
            +
Sbjct  285  I  285



>ref|XP_003518297.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score =   318 bits (816),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 174/241 (72%), Positives = 198/241 (82%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG K+  D       C G G+LGI+W FGGMIF+LVYCTAGISGGHIN
Sbjct  46   TLLFLYITVLTVIGYKSQSDVKAGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHIN  105

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRA+ YMVAQCLGA+ GVGLVKA  K +++  GGGAN +  G+S 
Sbjct  106  PAVTFGLFLARKVSLIRAIMYMVAQCLGAMCGVGLVKAFQKAYYNRYGGGANELSEGYST  165

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            GVGL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIP+TGTGI
Sbjct  166  GVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGI  225

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARSFGAAV++N K AWDD WIFWVGP +GA   A YHQ +LRA A KA+ GSF+S P 
Sbjct  226  NPARSFGAAVMYNQKKAWDDQWIFWVGPFIGAAIAAFYHQFILRASAAKAV-GSFRSNPT  284

Query  705  V  707
            +
Sbjct  285  I  285



>gb|ABX83874.1| plasma membrane intrinsic protein [Rhododendron catawbiense]
Length=284

 Score =   318 bits (816),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 176/238 (74%), Positives = 198/238 (83%), Gaps = 4/238 (2%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKA---TPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAV  173
            TLLFLY++V TVIG K+     DPC G G+LGI+W FGGMIFVLVYCTAGISGGHINPAV
Sbjct  48   TLLFLYITVLTVIGYKSQTDNADPCGGVGILGIAWSFGGMIFVLVYCTAGISGGHINPAV  107

Query  174  TFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVG  353
            TFGLFLARKVSLIRA+ YMVAQCLGA+ GV LVKA  K  +D  GGGAN++  G+SKG G
Sbjct  108  TFGLFLARKVSLIRALMYMVAQCLGAICGVALVKAFQKSHYDRYGGGANSLALGYSKGTG  167

Query  354  LVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPA  533
            L AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPA
Sbjct  168  LAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPA  227

Query  534  RSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  707
            RS GAAVI+NN  AW+D W+FWVGP +GA   A YHQ +LRA AVKAL GSF+S  +V
Sbjct  228  RSLGAAVIYNNDKAWNDQWMFWVGPFIGAAIAAFYHQFILRAGAVKAL-GSFRSGSHV  284



>ref|XP_004304427.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=287

 Score =   318 bits (816),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 175/241 (73%), Positives = 197/241 (82%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPD------PCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG K+  D       C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  48   TLLFLYITVLTVIGYKSQSDTLKGGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  107

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSL RAV Y+VAQ LGA+ G GLVK+     +   GGGAN +  G+SK
Sbjct  108  PAVTFGLFLARKVSLPRAVLYIVAQSLGAICGCGLVKSFQSALYTNYGGGANGLADGYSK  167

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  168  GTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  227

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARSFGAAVI+NN+ AWDDHWIFWVGP +GA   A+YHQ +LRA AVKAL GSF+S+ N
Sbjct  228  NPARSFGAAVIYNNEKAWDDHWIFWVGPFIGAAIAALYHQYILRAGAVKAL-GSFRSSSN  286

Query  705  V  707
            +
Sbjct  287  I  287



>gb|ABI96815.1| plasma membrane intrinsic protein [Triticum aestivum]
 gb|ABW34454.1| aquaporin 2.1 [Triticum turgidum]
 gb|EMS62706.1| putative aquaporin PIP2-6 [Triticum urartu]
Length=284

 Score =   318 bits (816),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 172/234 (74%), Positives = 197/234 (84%), Gaps = 3/234 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTK--ATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLY++VATVIG K  +  DPC G G+LGI+W FGGMIFVLVYCTAGISGGHINPAVT
Sbjct  49   TLLFLYITVATVIGYKVQSAADPCGGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVT  108

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGL LARKVSL+RAV Y+VAQC G +VG G+VK + +D +   GGGAN V  GFS+G  L
Sbjct  109  FGLLLARKVSLLRAVMYIVAQCAGGIVGAGIVKGIMRDAYQANGGGANMVASGFSRGTAL  168

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  169  GAEIVGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  228

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            S GAAVI+N K AWD+HWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S+
Sbjct  229  SLGAAVIYNKKAAWDNHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSS  281



>ref|XP_009398603.1| PREDICTED: probable aquaporin PIP2-2 [Musa acuminata subsp. malaccensis]
Length=288

 Score =   318 bits (816),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 176/240 (73%), Positives = 195/240 (81%), Gaps = 9/240 (4%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP--------CKGAGLLGISWVFGGMIFVLVYCTAGISGGH  158
            T+LFLYV+VATVIG K   DP        C G G+LGI+W FGGMIF+LVYCTAGISGGH
Sbjct  49   TMLFLYVTVATVIGYKHQSDPNVNPTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGH  108

Query  159  INPAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGF  338
            INPAVTFGLFLARKVSLIRA+ YM+ QCLGA+ GVGLVK   K FF   GGGAN +  G+
Sbjct  109  INPAVTFGLFLARKVSLIRALLYMIGQCLGAICGVGLVKGFQKAFFVRYGGGANELSDGY  168

Query  339  SKGVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGT  518
            SKG GL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGT
Sbjct  169  SKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGT  228

Query  519  GINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            GINPARSFGAAVI+N   AWDD WIFWVGP++GA   A YHQ +LRA AVKAL GSF+S 
Sbjct  229  GINPARSFGAAVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYILRAGAVKAL-GSFRSN  287



>ref|XP_010933360.1| PREDICTED: probable aquaporin PIP2-6 [Elaeis guineensis]
 ref|XP_010933361.1| PREDICTED: probable aquaporin PIP2-6 [Elaeis guineensis]
Length=282

 Score =   318 bits (815),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 173/234 (74%), Positives = 198/234 (85%), Gaps = 3/234 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTK--ATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLYV++ATVIG K  +  DPC G G LGI+W FGGMIF+LVYCTAGISGGHINPAVT
Sbjct  47   TLLFLYVTIATVIGYKVQSQNDPCGGVGYLGIAWSFGGMIFILVYCTAGISGGHINPAVT  106

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGLFLARKVSL+RA+ YMVAQCLGA+ GVG+VK + K  ++++GGG N V  G+SKG  L
Sbjct  107  FGLFLARKVSLLRALLYMVAQCLGAICGVGIVKGIMKHPYNSLGGGVNEVASGYSKGTAL  166

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKR ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  167  GAEIIGTFILVYTVFSATDPKRKARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  226

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            S G AVI+NNK AWDD WIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S+
Sbjct  227  SLGPAVIYNNKKAWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSS  279



>ref|XP_003548071.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score =   318 bits (815),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 173/241 (72%), Positives = 198/241 (82%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            T+LFLY++V TVIG K+  D       C G G+LGI+W FGGMIF+LVYCTAGISGGHIN
Sbjct  46   TMLFLYITVLTVIGYKSQSDVKAGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHIN  105

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRA+ YMVAQCLGA+ GVGLVKA  K +++  GGGAN +  G+S 
Sbjct  106  PAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGLVKAFQKAYYNRYGGGANELSEGYST  165

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            GVGL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIP+TGTGI
Sbjct  166  GVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGI  225

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARS GAAV++N + AWDDHWIFWVGP +GA   A YHQ +LRA A KAL GSF+S P 
Sbjct  226  NPARSLGAAVMYNQQKAWDDHWIFWVGPFIGAAIAAFYHQFILRASAAKAL-GSFRSNPT  284

Query  705  V  707
            +
Sbjct  285  I  285



>gb|ABK22146.1| unknown [Picea sitchensis]
 gb|ABR18227.1| unknown [Picea sitchensis]
Length=280

 Score =   318 bits (815),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 174/235 (74%), Positives = 198/235 (84%), Gaps = 1/235 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY++VATVIG K T   C   G+LGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  46   TLLFLYITVATVIGHKRTQANCGSVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  105

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL RAV YM+AQCLGA+ GVGLVKA  K ++D  GGGAN V  G++KGVGL A
Sbjct  106  LFLARKVSLPRAVLYMIAQCLGAICGVGLVKAFQKSYYDKYGGGANVVAYGYTKGVGLAA  165

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ TIPITGTGINPARSF
Sbjct  166  EIIGTFILVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLGTIPITGTGINPARSF  225

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  707
            GAAVI+ ++ AWDD WIFWVGP +GA   + YHQ +LRA A+KAL GSF+S P++
Sbjct  226  GAAVIYGHQKAWDDQWIFWVGPFIGAAIASAYHQYILRAGAMKAL-GSFRSVPSM  279



>gb|AFH36337.1| aquaporin PIP2;2 [Quercus petraea]
Length=285

 Score =   318 bits (815),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 178/238 (75%), Positives = 195/238 (82%), Gaps = 7/238 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG K+  DP      C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  48   TLLFLYITVLTVIGYKSQTDPLKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  107

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRAV YMVAQCLGA+ GVGLVKA  K  +   GGGAN +  G++K
Sbjct  108  PAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGLVKAFQKSLYTRYGGGANELAAGYNK  167

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  168  GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  227

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            NPARSFGAAVI N   AWDDHWIFWVGP +GA   A YHQ +LRA A+KAL GSF+S 
Sbjct  228  NPARSFGAAVIFNQSKAWDDHWIFWVGPFVGAAIAAFYHQFILRAAAIKAL-GSFRSN  284



>ref|XP_008463943.1| PREDICTED: aquaporin PIP2-7 [Cucumis melo]
Length=283

 Score =   318 bits (815),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 173/236 (73%), Positives = 194/236 (82%), Gaps = 5/236 (2%)
 Frame = +3

Query  3    TLLFLYVSVATVIG----TKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPA  170
            TLLFLYV+V TVIG      +TPDPC G G+LGI+W FGGMIF+LVYCTAGISGGHINPA
Sbjct  48   TLLFLYVTVLTVIGYSHQRDSTPDPCSGVGILGIAWAFGGMIFILVYCTAGISGGHINPA  107

Query  171  VTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGV  350
            VTFGLFLARKVSL+RAV YM+AQC GA+ G GLVKA    ++    GGAN +  G++KG 
Sbjct  108  VTFGLFLARKVSLVRAVLYMLAQCAGAICGCGLVKAFQSAYYVRYNGGANMLSDGYNKGT  167

Query  351  GLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINP  530
            GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINP
Sbjct  168  GLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227

Query  531  ARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            ARSFGAAVI N + AWDD WIFWVGP +GA   A+YHQ VLRA A+KAL GSF+S 
Sbjct  228  ARSFGAAVIFNKEKAWDDQWIFWVGPFIGAAIAAIYHQYVLRAGAIKAL-GSFRSN  282



>ref|XP_006436425.1| hypothetical protein CICLE_v10032302mg [Citrus clementina]
 ref|XP_006485687.1| PREDICTED: probable aquaporin PIP2-5-like [Citrus sinensis]
 gb|ESR49665.1| hypothetical protein CICLE_v10032302mg [Citrus clementina]
Length=287

 Score =   318 bits (815),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 177/241 (73%), Positives = 196/241 (81%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYV+V TVIG K+  DP      C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  48   TLLFLYVTVLTVIGYKSQTDPAKNVDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  107

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSL+RAV YMVAQCLGA+ GVGLVKA  K ++   GGGAN +  G+S 
Sbjct  108  PAVTFGLFLARKVSLVRAVMYMVAQCLGAISGVGLVKAFQKSYYTRYGGGANELADGYST  167

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            GVGL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  168  GVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  227

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARS GAAVI+N   AWDD W+FWVGP +GA   A YHQ +LRA AVKAL GSF+S   
Sbjct  228  NPARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFYHQFILRAGAVKAL-GSFRSQSR  286

Query  705  V  707
            V
Sbjct  287  V  287



>gb|KHG08488.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=285

 Score =   318 bits (815),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 172/236 (73%), Positives = 192/236 (81%), Gaps = 8/236 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP--------CKGAGLLGISWVFGGMIFVLVYCTAGISGGH  158
            TLLFLYV+V TVIG K   DP        C G G+LGI+W FGGMIF+LVYCTAGISGGH
Sbjct  47   TLLFLYVTVLTVIGYKVQTDPLKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGH  106

Query  159  INPAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGF  338
            INPAVTFGLFL RKVSLIRA+ YMVAQCLGA+ G GLVKA  K +++  GGGAN +Q GF
Sbjct  107  INPAVTFGLFLGRKVSLIRAIMYMVAQCLGAICGCGLVKAFQKTYYNNYGGGANELQSGF  166

Query  339  SKGVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGT  518
            +KG GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIP+TGT
Sbjct  167  NKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGT  226

Query  519  GINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGS  686
            GINPARSFGAAVI+N + AWDD WIFWVGP +GA   A YHQ +LRA A+KA G S
Sbjct  227  GINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAAIAAFYHQYILRAAAIKAFGSS  282



>gb|AFN53685.1| putative aquaporin PIP2-8 [Linum usitatissimum]
Length=694

 Score =   331 bits (849),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 181/233 (78%), Positives = 202/233 (87%), Gaps = 1/233 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K   DPC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  461  TLLFLYVTVATVIGHKNQTDPCGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  520

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAV+YMVAQCLGA+ GVGLVKA+ K  ++++GGGAN V  G+S G  L A
Sbjct  521  LFLARKVSLIRAVSYMVAQCLGAICGVGLVKAIMKHPYNSLGGGANAVNAGYSTGTALGA  580

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  581  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  640

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            GAAVI+NN   WDDHW+FWVGP +GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct  641  GAAVIYNNDKIWDDHWVFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNP  692



>gb|KHN00691.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score =   318 bits (815),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 175/241 (73%), Positives = 198/241 (82%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIG------TKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG       KA  D C G G+LGI+W FGGMIF+LVYCTAGISGGHIN
Sbjct  46   TLLFLYITVLTVIGYKSQSDVKAGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHIN  105

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRA+ YMVAQCLGA+ GVGLVKA  K +++  GGGAN +  G+S 
Sbjct  106  PAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGLVKAFQKAYYNRYGGGANELSEGYST  165

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            GVGL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIP+TGTGI
Sbjct  166  GVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGI  225

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARS GAAV++N + AWDDHWIFWVGP +GA   A YHQ +LRA A KAL GSF+S P 
Sbjct  226  NPARSLGAAVMYNQQKAWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAKAL-GSFRSNPT  284

Query  705  V  707
            +
Sbjct  285  I  285



>gb|AAB18227.1| MipC [Mesembryanthemum crystallinum]
Length=287

 Score =   318 bits (815),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 174/238 (73%), Positives = 198/238 (83%), Gaps = 7/238 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG K+  DP      C G G+LGI+W FGGMIF+LVYCTAGISGGHIN
Sbjct  50   TLLFLYITVLTVIGYKSQTDPNTNADQCGGVGILGIAWAFGGMIFILVYCTAGISGGHIN  109

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLI+AV YMVAQCLGA+ GVG VKA  K ++   GGGAN +  G++K
Sbjct  110  PAVTFGLFLARKVSLIKAVLYMVAQCLGAICGVGFVKAFQKAYYVRYGGGANEMASGYTK  169

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  170  GTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  229

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            NPARSFGAAVI+N + AWDDHWIFWVGP +GA   A YHQ +LRA A+KAL GSF+S+
Sbjct  230  NPARSFGAAVIYNQQKAWDDHWIFWVGPFIGAAIAAFYHQYILRAAAIKAL-GSFRSS  286



>gb|AGG39693.1| aquaporin protein AQU15 [Camellia sinensis]
 gb|AGG39694.1| aquaporin protein AQU16 [Camellia sinensis]
Length=287

 Score =   318 bits (814),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 172/241 (71%), Positives = 199/241 (83%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY+++ TVIG K+  DP      C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  48   TLLFLYITILTVIGYKSQVDPVKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  107

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRAV Y+VAQCLGA+ GV LVKA    +++  GGGAN + PG+SK
Sbjct  108  PAVTFGLFLARKVSLIRAVMYIVAQCLGAICGVALVKAFQSSYYEVYGGGANELSPGYSK  167

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIP+TGTGI
Sbjct  168  GTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGI  227

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARS GAAVI+N + AW DHW+FWVGP +GA   A YHQ +LRA A+KAL GSF+S+ +
Sbjct  228  NPARSLGAAVIYNQEKAWHDHWMFWVGPFIGAAIAAFYHQFILRAGAIKAL-GSFRSSSH  286

Query  705  V  707
            V
Sbjct  287  V  287



>ref|XP_010483715.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score =   318 bits (814),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 175/238 (74%), Positives = 196/238 (82%), Gaps = 7/238 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPD------PCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYVSV TVIG KA  D       C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  49   TLLFLYVSVLTVIGYKAQTDANAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  108

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVT GLFLARKVSL+R V Y+VAQCLGA+ G GLVKA    ++   GGGAN +  G++K
Sbjct  109  PAVTMGLFLARKVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNK  168

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  169  GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  228

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            NPARSFGAAVI+N + AWDD WIFWVGPM+GA A A+YHQ +LRA A+KAL GSF+S+
Sbjct  229  NPARSFGAAVIYNQEKAWDDQWIFWVGPMIGAAAAALYHQFILRAAAIKAL-GSFRSS  285



>gb|KHG29841.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=291

 Score =   318 bits (815),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 174/240 (73%), Positives = 197/240 (82%), Gaps = 9/240 (4%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP--------CKGAGLLGISWVFGGMIFVLVYCTAGISGGH  158
            TLLFLYV+V TVIG K   DP        C G G+LGI+W FGGMIF+LVYCTAGISGGH
Sbjct  52   TLLFLYVTVLTVIGYKVQTDPVKNTNDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGH  111

Query  159  INPAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGF  338
            INPAVTFGLF+ RKVSLIRA+ YMVAQCLGA+ G GLVKA  K ++++ GGGAN +Q GF
Sbjct  112  INPAVTFGLFVGRKVSLIRALLYMVAQCLGAICGCGLVKAFQKTYYNSYGGGANELQDGF  171

Query  339  SKGVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGT  518
            +KG GL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGT
Sbjct  172  NKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGT  231

Query  519  GINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            GINPARSFGAAVI+N + AWDD WIFWVGP +GA   A YHQ +LRA A+KAL GSF+S 
Sbjct  232  GINPARSFGAAVIYNQEKAWDDQWIFWVGPFIGAFVAAFYHQYILRAAAIKAL-GSFRSN  290



>gb|AAC17529.1| aquaporin 2 [Samanea saman]
Length=287

 Score =   317 bits (813),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 177/241 (73%), Positives = 198/241 (82%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIG------TKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG      TKA  D C G G+LGI+W FGGMIF+LVYCTAGISGGHIN
Sbjct  48   TLLFLYITVLTVIGYKSQSDTKAGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHIN  107

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRA+ YMVAQCLGA+ GVGLVKA  K ++   GGGANT+  G+S 
Sbjct  108  PAVTFGLFLARKVSLIRAILYMVAQCLGAICGVGLVKAFQKAYYSRYGGGANTLSDGYST  167

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIP+TGTGI
Sbjct  168  GTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGI  227

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARS GAAVI N + AWDDHWIFWVGP +GA   A YHQ +LRA A KAL GSF+S P+
Sbjct  228  NPARSLGAAVIFNQQKAWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAKAL-GSFRSNPS  286

Query  705  V  707
            V
Sbjct  287  V  287



>ref|XP_009628968.1| PREDICTED: probable aquaporin PIP2-1 [Nicotiana tomentosiformis]
 tpg|DAA64679.1| TPA_exp: aquaporin PIP2 5 [Nicotiana tabacum]
Length=283

 Score =   317 bits (813),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 178/238 (75%), Positives = 196/238 (82%), Gaps = 7/238 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTK------ATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYV+V TVIG K      A  D C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  46   TLLFLYVTVLTVIGYKHQSDVDANGDVCGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  105

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRA+ YMVAQCLGA+ GVG VKA    ++D  GGGAN +  G +K
Sbjct  106  PAVTFGLFLARKVSLIRALVYMVAQCLGAICGVGFVKAFQSAYYDRYGGGANVMAAGHTK  165

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            GVGL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  166  GVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  225

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            NPARSFGAAVI+N   AWD+HWIFWVGP +GA A A YHQ +LRA AVKAL GSF+S 
Sbjct  226  NPARSFGAAVIYNQDKAWDEHWIFWVGPFIGAFAAAAYHQYILRAGAVKAL-GSFRSN  282



>ref|XP_010443868.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score =   317 bits (813),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 175/238 (74%), Positives = 196/238 (82%), Gaps = 7/238 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPD------PCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYVSV TVIG KA  D       C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  49   TLLFLYVSVLTVIGYKAQTDANAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  108

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVT GLFLARKVSL+R V Y+VAQCLGA+ G GLVKA    ++   GGGAN +  G++K
Sbjct  109  PAVTMGLFLARKVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNK  168

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  169  GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  228

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            NPARSFGAAVI+N + AWDD WIFWVGPM+GA A A+YHQ +LRA A+KAL GSF+S+
Sbjct  229  NPARSFGAAVIYNKEKAWDDQWIFWVGPMIGAAAAALYHQFILRAAAIKAL-GSFRSS  285



>gb|ABK22504.1| unknown [Picea sitchensis]
Length=282

 Score =   317 bits (812),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 175/235 (74%), Positives = 196/235 (83%), Gaps = 1/235 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY+++ATVIG   T   C   G+LGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  49   TLLFLYITIATVIGHSRTSTNCGSVGVLGIAWSFGGMIFVLVYCTAGISGGHINPAVTFG  108

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL RA+ YM+AQCLGA+ G GLVKA  K F+D  GGGAN V  G++KGVGL A
Sbjct  109  LFLARKVSLPRAILYMIAQCLGAICGTGLVKAFQKSFYDRYGGGANYVHHGYTKGVGLAA  168

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  169  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  228

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  707
            GAAVI+ +K +WDDHWIFWVGP  GA   A YHQ +LRA A+KAL GSF+S  NV
Sbjct  229  GAAVIYGHKQSWDDHWIFWVGPFAGAALAAAYHQYILRAAAIKAL-GSFRSNANV  282



>gb|ABK24624.1| unknown [Picea sitchensis]
 gb|ABR18055.1| unknown [Picea sitchensis]
Length=282

 Score =   317 bits (812),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 175/235 (74%), Positives = 196/235 (83%), Gaps = 1/235 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY+++ATVIG   T   C   G+LGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  49   TLLFLYITIATVIGHSRTSTNCGSVGVLGIAWSFGGMIFVLVYCTAGISGGHINPAVTFG  108

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL RA+ YM+AQCLGA+ G GLVKA  K F+D  GGGAN V  G++KGVGL A
Sbjct  109  LFLARKVSLPRAILYMIAQCLGAICGTGLVKAFQKSFYDRYGGGANYVHHGYTKGVGLAA  168

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  169  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  228

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  707
            GAAVI+ +K +WDDHWIFWVGP  GA   A YHQ +LRA A+KAL GSF+S  NV
Sbjct  229  GAAVIYGHKQSWDDHWIFWVGPFAGAALAAAYHQYILRAAAIKAL-GSFRSNANV  282



>ref|XP_010031998.1| PREDICTED: aquaporin PIP2-7-like [Eucalyptus grandis]
 gb|KCW51390.1| hypothetical protein EUGRSUZ_J00930 [Eucalyptus grandis]
Length=285

 Score =   317 bits (813),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 177/238 (74%), Positives = 198/238 (83%), Gaps = 7/238 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG K+  DP      C G G+LGI+W FGGMIF+LVYCTAGISGGHIN
Sbjct  48   TLLFLYITVLTVIGYKSQTDPALKGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHIN  107

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRAV+YMVAQCLGA+ G GLVKA  K ++   GGGAN VQPG+SK
Sbjct  108  PAVTFGLFLARKVSLIRAVSYMVAQCLGAICGCGLVKAFQKAYYTRYGGGANEVQPGYSK  167

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G  L AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIP+TGTGI
Sbjct  168  GTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGI  227

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            NPARSFGAAV++ +  AWDD WIFWVGP LGA A A Y+Q VLRA A+KAL GSF+S 
Sbjct  228  NPARSFGAAVMYGHDKAWDDQWIFWVGPFLGAAAAAFYYQFVLRAAAIKAL-GSFRSN  284



>ref|XP_009342865.1| PREDICTED: probable aquaporin PIP2-5 isoform X2 [Pyrus x bretschneideri]
Length=285

 Score =   317 bits (812),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 174/241 (72%), Positives = 196/241 (81%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPD------PCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYV+V TVIG K+  D       C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  46   TLLFLYVTVLTVIGYKSQTDAALNGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  105

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGL LARKVSL+RA+ YMVAQ LGA+ GVGLVKA    ++   GGGAN +  G+S 
Sbjct  106  PAVTFGLLLARKVSLVRAILYMVAQSLGAICGVGLVKAFQSSYYTKYGGGANELADGYST  165

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  166  GTGLGAEIVGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGI  225

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARS GAAVI+NN  AW+D WIFWVGP +GA   A+YHQ +LRA AVKAL GSF+S+PN
Sbjct  226  NPARSLGAAVIYNNDKAWNDQWIFWVGPFIGAAIAALYHQYILRAGAVKAL-GSFRSSPN  284

Query  705  V  707
            +
Sbjct  285  I  285



>ref|XP_009342858.1| PREDICTED: probable aquaporin PIP2-5 isoform X1 [Pyrus x bretschneideri]
Length=285

 Score =   317 bits (812),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 174/241 (72%), Positives = 196/241 (81%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPD------PCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYV+V TVIG K+  D       C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  46   TLLFLYVTVLTVIGYKSQTDAALNGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  105

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGL LARKVSL+RA+ YMVAQ LGA+ GVGLVKA    ++   GGGAN +  G+S 
Sbjct  106  PAVTFGLLLARKVSLVRAILYMVAQSLGAICGVGLVKAFQSSYYTKYGGGANELADGYST  165

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  166  GTGLGAEIVGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGI  225

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARS GAAVI+NN  AW+D WIFWVGP +GA   A+YHQ +LRA AVKAL GSF+S+PN
Sbjct  226  NPARSLGAAVIYNNDKAWNDQWIFWVGPFIGAAIAALYHQYILRAGAVKAL-GSFRSSPN  284

Query  705  V  707
            +
Sbjct  285  I  285



>emb|CDX91340.1| BnaC04g08100D [Brassica napus]
Length=285

 Score =   317 bits (812),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 177/241 (73%), Positives = 194/241 (80%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIG------TKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYV+V TVIG      TKA  D C G G+LGISW FGGMIF+LVYCTAGISGGHIN
Sbjct  46   TLLFLYVTVLTVIGYKISSDTKAGGDECGGVGILGISWAFGGMIFILVYCTAGISGGHIN  105

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSL+RAV YMVAQCLGA+ GVG VKA    ++   GGGAN++  G+S 
Sbjct  106  PAVTFGLFLARKVSLVRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYST  165

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  166  GTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  225

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARSFGAAVI+N    WDDHWIFWVGP +GA   A YHQ VLRA   K+L GSF+S  N
Sbjct  226  NPARSFGAAVIYNESKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSL-GSFRSAAN  284

Query  705  V  707
            V
Sbjct  285  V  285



>ref|XP_006400824.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
 gb|ESQ42277.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
Length=285

 Score =   317 bits (812),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 172/238 (72%), Positives = 196/238 (82%), Gaps = 7/238 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPD------PCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYVS+ TVIG KA  D       C G G+LGI+W FGGMIFVLVYCTAG+SGGHIN
Sbjct  48   TLLFLYVSILTVIGYKAQTDASAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGVSGGHIN  107

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSL+R V Y+VAQCLGA+ G G VKA    ++   GGGAN +  G++K
Sbjct  108  PAVTFGLFLARKVSLVRTVLYIVAQCLGAICGCGFVKAFQSSYYTRYGGGANELADGYNK  167

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  168  GTGLGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGI  227

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            NPARSFGAAVI+N + AWDD WIFWVGPM+GA A A+YHQ VLRA A+KAL GSF+S+
Sbjct  228  NPARSFGAAVIYNQEKAWDDQWIFWVGPMIGAAAAALYHQFVLRAAAIKAL-GSFRSS  284



>ref|XP_004500724.1| PREDICTED: uncharacterized protein LOC101494283 [Cicer arietinum]
Length=690

 Score =   330 bits (846),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 183/233 (79%), Positives = 200/233 (86%), Gaps = 1/233 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  457  TLLFLYVTVATVIGHKKQTGPCDGVGLLGIAWSFGGMIFVLVYCTAGISGGHINPAVTFG  516

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRAV YMVAQCLGA+ GVGLVKAL K  ++ +GGGAN+V  G+SKG  L A
Sbjct  517  LFLARKVSLIRAVLYMVAQCLGAICGVGLVKALMKQPYNNLGGGANSVASGYSKGSALGA  576

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            E++ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  577  EMIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  636

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            GAAVI NN   WDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct  637  GAAVIFNNAKVWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNP  688



>ref|XP_010456647.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=285

 Score =   317 bits (812),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 175/238 (74%), Positives = 195/238 (82%), Gaps = 7/238 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPD------PCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYVSV TVIG KA  D       C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  48   TLLFLYVSVLTVIGYKAQTDANAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  107

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVT GLFLARKVSL+R V Y+VAQCLGA+ G GLVKA    ++   GGGAN +  G++K
Sbjct  108  PAVTMGLFLARKVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNK  167

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  168  GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  227

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            NPARSFGAAVI+N + AWDD WIFWVGPM+GA A A+YHQ +LRA A+KAL GSF+S 
Sbjct  228  NPARSFGAAVIYNKEKAWDDQWIFWVGPMIGAAAAALYHQFILRAAAIKAL-GSFRSN  284



>ref|XP_008791535.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=287

 Score =   317 bits (812),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 172/239 (72%), Positives = 193/239 (81%), Gaps = 9/239 (4%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP--------CKGAGLLGISWVFGGMIFVLVYCTAGISGGH  158
            TLLFLY++VATVIG K   DP        C G G+LGI+W FGGMIF+LVYCTAGISGGH
Sbjct  49   TLLFLYITVATVIGYKHQSDPNVNGTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGH  108

Query  159  INPAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGF  338
            INPAVTFGLFLARKVSLIRA+ YM+AQCLGA+ G GLV+   K ++   GGGAN +  G+
Sbjct  109  INPAVTFGLFLARKVSLIRALLYMIAQCLGAICGAGLVRGFQKAYYVRYGGGANELSSGY  168

Query  339  SKGVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGT  518
            SKG GL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGT
Sbjct  169  SKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGT  228

Query  519  GINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQS  695
            GINPARSFGAAVI+N + AWDD WIFWVGP +GA     YHQ VLRA A KAL GSF+S
Sbjct  229  GINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAAIAEAYHQYVLRASAAKAL-GSFRS  286



>ref|NP_001240039.1| uncharacterized protein LOC100782155 [Glycine max]
 gb|ACU23140.1| unknown [Glycine max]
 gb|KHN32778.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score =   317 bits (811),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 174/241 (72%), Positives = 198/241 (82%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIG------TKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            T+LFLY++V TVIG       KA  D C G G+LGI+W FGGMIF+LVYCTAGISGGHIN
Sbjct  46   TMLFLYITVLTVIGYKSQSDVKAGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHIN  105

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRA+ YMVAQCLGA+ GVGLVKA  K +++  GGGAN +  G+S 
Sbjct  106  PAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGLVKAFQKAYYNRYGGGANELSEGYST  165

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            GVGL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIP+TGTGI
Sbjct  166  GVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGI  225

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARS GAAV++N + AWDDHWIFWVGP +GA   A YHQ +LRA A KAL GSF+S P 
Sbjct  226  NPARSLGAAVMYNQQKAWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAKAL-GSFRSNPA  284

Query  705  V  707
            +
Sbjct  285  I  285



>dbj|BAG06231.1| plasma membrane intrinsic protein [Hordeum vulgare]
 dbj|BAK01580.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01902.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=290

 Score =   317 bits (812),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 177/241 (73%), Positives = 196/241 (81%), Gaps = 10/241 (4%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP---------CKGAGLLGISWVFGGMIFVLVYCTAGISGG  155
            TLLFLY++VATVIG K   DP         C G G+LGI+W FGGMIFVLVYCTAGISGG
Sbjct  50   TLLFLYITVATVIGYKHQTDPAVNSAADAACGGVGVLGIAWAFGGMIFVLVYCTAGISGG  109

Query  156  HINPAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPG  335
            HINPAVTFGLFLARKVSL+RA+ YMVAQCLGA+ GVGLVKA    +F   GGGANT+  G
Sbjct  110  HINPAVTFGLFLARKVSLVRALLYMVAQCLGAMCGVGLVKAFQSAYFVRYGGGANTLAAG  169

Query  336  FSKGVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITG  515
            +SKG GL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITG
Sbjct  170  YSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITG  229

Query  516  TGINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQS  695
            TGINPARS GAAVI+N   AWDD WIFWVGPM+GA   A YHQ +LRA A+KAL GSF+S
Sbjct  230  TGINPARSLGAAVIYNKDKAWDDQWIFWVGPMIGAAIAAFYHQYILRAGAIKAL-GSFRS  288

Query  696  T  698
             
Sbjct  289  N  289



>ref|XP_007151872.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
 gb|ESW23866.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
Length=285

 Score =   317 bits (811),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 175/241 (73%), Positives = 197/241 (82%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG K+  D       C G G+LGI+W FGGMIF+LVYCTAGISGGHIN
Sbjct  46   TLLFLYITVLTVIGYKSQSDVKAGGDLCGGVGILGIAWAFGGMIFILVYCTAGISGGHIN  105

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRA+ YMVAQCLGA+ GVGLVKA  K +++  GGGAN +  G+S 
Sbjct  106  PAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGLVKAFQKAYYNKYGGGANELSDGYST  165

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            GVGL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIP+TGTGI
Sbjct  166  GVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGI  225

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARS GAAVI+N + AWDD WIFWVGP +GA   A YHQ +LRA A KAL GSF+S P 
Sbjct  226  NPARSLGAAVIYNKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAAKAL-GSFRSNPT  284

Query  705  V  707
            V
Sbjct  285  V  285



>ref|XP_010028741.1| PREDICTED: uncharacterized protein LOC104418957 [Eucalyptus grandis]
Length=694

 Score =   330 bits (845),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 178/233 (76%), Positives = 201/233 (86%), Gaps = 1/233 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIF+LVYCTAGISGGHINPAVTFG
Sbjct  461  TLLFLYVTVATVIGHKKQTGPCDGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  520

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRA++YM+AQCLGA+ GVGLVKA  K F++++GGGAN+V  G+S G  L A
Sbjct  521  LFLARKVSLIRALSYMIAQCLGAICGVGLVKAFMKPFYNSLGGGANSVATGYSTGTALGA  580

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  581  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  640

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  701
            GAAVI+NN   WDD WIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct  641  GAAVIYNNGKVWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNP  692



>gb|KHG19287.1| Aquaporin PIP2-7 -like protein [Gossypium arboreum]
Length=280

 Score =   317 bits (811),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 172/234 (74%), Positives = 192/234 (82%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY+ VATVIG K     C+G G LGI+W  GGMIFVLVYCTAGISGGHINPAVT G
Sbjct  47   TLLFLYILVATVIGHKKQTGLCEGVGPLGIAWAVGGMIFVLVYCTAGISGGHINPAVTLG  106

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSL RAVAYMVAQCLGA+ G GL K+  K  ++ +GGG N+V PG+SKG  L A
Sbjct  107  LFLARKVSLFRAVAYMVAQCLGAICGAGLAKSFMKHPYNRLGGGTNSVSPGYSKGTALGA  166

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFV H+ATIPITGTGINPARS 
Sbjct  167  EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFVVHLATIPITGTGINPARSL  226

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            GAAVI+NN+ AWDD WIFW GP +GA A A YHQ +LRA A+KAL  SF+S+P 
Sbjct  227  GAAVIYNNEKAWDDQWIFWAGPCIGAFAAAAYHQYILRATAIKAL-KSFRSSPT  279



>ref|XP_009143524.1| PREDICTED: aquaporin PIP2-2 [Brassica rapa]
Length=285

 Score =   317 bits (811),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 177/241 (73%), Positives = 194/241 (80%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIG------TKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYV+V TVIG      TKA  D C G G+LGISW FGGMIF+LVYCTAGISGGHIN
Sbjct  46   TLLFLYVTVLTVIGYKISSDTKAGGDECGGVGILGISWAFGGMIFILVYCTAGISGGHIN  105

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSL+RAV YMVAQCLGA+ GVG VKA    ++   GGGAN++  G+S 
Sbjct  106  PAVTFGLFLARKVSLVRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYST  165

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  166  GTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  225

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARSFGAAVI+N    WDDHWIFWVGP +GA   A YHQ VLRA   K+L GSF+S  N
Sbjct  226  NPARSFGAAVIYNESKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSL-GSFRSAAN  284

Query  705  V  707
            V
Sbjct  285  V  285



>gb|KHG30776.1| Aquaporin PIP2-2 -like protein [Gossypium arboreum]
Length=285

 Score =   317 bits (811),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 170/238 (71%), Positives = 195/238 (82%), Gaps = 7/238 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG K+  DP      C G G+LGI+W FGGMIF+LVYCTAGISGGHIN
Sbjct  46   TLLFLYITVLTVIGYKSQVDPDKGSQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHIN  105

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSL+RA+ YM AQCLGA+ G GLVKA  K +++  GGGAN++  G+S 
Sbjct  106  PAVTFGLFLARKVSLVRAILYMAAQCLGAICGCGLVKAFQKSYYNKYGGGANSLADGYST  165

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  166  GTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  225

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            NPARSFGAAV+ N    WDDHWIFWVGP +GA   A+YH+ +LRA A KAL GSF+S+
Sbjct  226  NPARSFGAAVMFNQDKPWDDHWIFWVGPFIGAAIAAIYHEYILRAGAAKAL-GSFRSS  282



>gb|AAW80918.1| putative plasma membrane intrinsic protein [Astragalus membranaceus]
Length=283

 Score =   316 bits (810),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 175/234 (75%), Positives = 194/234 (83%), Gaps = 3/234 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATP--DPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLY++V TVIG K+    D C G G+LGI+W FGGMIFVLVYCTAGISGGHINPAVT
Sbjct  48   TLLFLYITVLTVIGYKSQSATDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVT  107

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGLFLARKVSLIRAV YMVAQCLGA+ GVG VKA  K ++   GGGAN +  G++KG GL
Sbjct  108  FGLFLARKVSLIRAVMYMVAQCLGAICGVGFVKAFQKSYYVKFGGGANELADGYNKGTGL  167

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  168  AAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  227

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            SFGAAVI+N   AWDD WIFWVGP +GA   A YHQ VLRA A+KAL GSF+S 
Sbjct  228  SFGAAVIYNKDKAWDDQWIFWVGPFVGAAIAAFYHQFVLRAAAIKAL-GSFRSN  280



>gb|KDO44716.1| hypothetical protein CISIN_1g0196812mg [Citrus sinensis]
Length=337

 Score =   318 bits (815),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 177/241 (73%), Positives = 196/241 (81%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYV+V TVIG K+  DP      C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  98   TLLFLYVTVLTVIGYKSQTDPAKNVDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  157

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSL+RAV YMVAQCLGA+ GVGLVKA  K ++   GGGAN +  G+S 
Sbjct  158  PAVTFGLFLARKVSLVRAVMYMVAQCLGAISGVGLVKAFQKSYYTRYGGGANELADGYST  217

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            GVGL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  218  GVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  277

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARS GAAVI+N   AWDD W+FWVGP +GA   A YHQ +LRA AVKAL GSF+S   
Sbjct  278  NPARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFYHQFILRAGAVKAL-GSFRSQSR  336

Query  705  V  707
            V
Sbjct  337  V  337



>gb|AGD98707.1| aquaporin protein 4 [Camellia sinensis]
Length=287

 Score =   317 bits (811),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 172/241 (71%), Positives = 198/241 (82%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY+++ TVIG K+  DP      C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  48   TLLFLYITILTVIGYKSQVDPVKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  107

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRA  YMVAQCLGA+ GV LVKA    +++  GGGAN + PG+SK
Sbjct  108  PAVTFGLFLARKVSLIRAGLYMVAQCLGAICGVALVKAFQSSYYEVYGGGANELSPGYSK  167

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIP+TGTGI
Sbjct  168  GTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGI  227

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARS GAAVI+N + AW DHW+FWVGP +GA   A YHQ +LRA A+KAL GSF+S+ +
Sbjct  228  NPARSLGAAVIYNQEKAWHDHWMFWVGPFIGAAIAAFYHQFILRAGAIKAL-GSFRSSSH  286

Query  705  V  707
            V
Sbjct  287  V  287



>ref|XP_010920405.1| PREDICTED: aquaporin PIP2-4 isoform X1 [Elaeis guineensis]
Length=285

 Score =   316 bits (810),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 174/240 (73%), Positives = 195/240 (81%), Gaps = 9/240 (4%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP--------CKGAGLLGISWVFGGMIFVLVYCTAGISGGH  158
            TLLFLY++VATVIG K   DP        C G G+LGI+W FGGMIFVLVYCTAGISGGH
Sbjct  46   TLLFLYITVATVIGYKHQSDPNVSGPDAACNGVGILGIAWAFGGMIFVLVYCTAGISGGH  105

Query  159  INPAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGF  338
            INPAVTFGLFLARKVSLIRA+ YM+AQCLGA+ GVGLVKA  K +++  GGG N +  G+
Sbjct  106  INPAVTFGLFLARKVSLIRALLYMIAQCLGAICGVGLVKAFQKAYYNRYGGGVNELSSGY  165

Query  339  SKGVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGT  518
            SKG GL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGT
Sbjct  166  SKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGT  225

Query  519  GINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            GINPARS G AVI+NN  AWDD WIFWVGP +GA   A YHQ +LRA A+KAL GSF+S 
Sbjct  226  GINPARSLGPAVIYNNDKAWDDQWIFWVGPFIGAAIAAAYHQYILRAGAIKAL-GSFRSN  284



>ref|XP_008387595.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=285

 Score =   316 bits (810),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 172/241 (71%), Positives = 195/241 (81%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPD------PCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG K+  D       C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  46   TLLFLYITVLTVIGYKSQTDTALNGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  105

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGL LARKVSL+RA+ YM AQ LGA+ GVGLVKA    ++   GGGAN +  G+S 
Sbjct  106  PAVTFGLLLARKVSLVRAILYMTAQSLGAICGVGLVKAFQSSYYTKYGGGANELADGYST  165

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  166  GTGLGAEIVGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGI  225

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARS GAAVI+NN  AW+D WIFWVGP +GA   A+YHQ +LRA AVKAL GSF+S+PN
Sbjct  226  NPARSLGAAVIYNNDKAWNDQWIFWVGPFIGAAIAALYHQYILRAGAVKAL-GSFRSSPN  284

Query  705  V  707
            +
Sbjct  285  I  285



>ref|XP_010043748.1| PREDICTED: probable aquaporin PIP2-4 [Eucalyptus grandis]
 gb|KCW85737.1| hypothetical protein EUGRSUZ_B02499 [Eucalyptus grandis]
Length=284

 Score =   316 bits (810),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 175/238 (74%), Positives = 196/238 (82%), Gaps = 7/238 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            T+LFLY++V TVIG K+  DP      C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  47   TMLFLYITVLTVIGYKSQTDPTMNGSDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  106

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSL+RAV YMVAQCLGA+ G GLVKA  + ++   GGGAN +  G+SK
Sbjct  107  PAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGLVKAFQRAYYTRYGGGANELADGYSK  166

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            GVGL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  167  GVGLGAEIVGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  226

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            NPARSFGAAVI+N   AWDD W+FWVGP +GA   A YHQ +LRA AVKAL GSF+S 
Sbjct  227  NPARSFGAAVIYNKDKAWDDQWMFWVGPFIGAAIAAFYHQYILRAGAVKAL-GSFRSN  283



>gb|ACU14125.1| unknown [Glycine max]
Length=262

 Score =   315 bits (808),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 171/221 (77%), Positives = 191/221 (86%), Gaps = 0/221 (0%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLYV+VATVIG K    PC G GLLGI+W FGGMIFVLVYCTAGISGGHINPAVTFG
Sbjct  42   TLLFLYVTVATVIGHKKQTGPCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFG  101

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LFLARKVSLIRA+ YMVAQCLGA+ GVGLVKA  K  ++++GGGAN+V  G++KG  L A
Sbjct  102  LFLARKVSLIRALFYMVAQCLGAICGVGLVKAFMKHSYNSLGGGANSVSAGYNKGSALGA  161

Query  363  EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF  542
            EI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct  162  EIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  221

Query  543  GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQA  665
            GAAVI+NN   WDDHWIFWVGP +GA+A A YHQ +LRA A
Sbjct  222  GAAVIYNNGKVWDDHWIFWVGPFVGALAAAAYHQYILRAAA  262



>ref|XP_007046621.1| Plasma membrane intrinsic protein 3 isoform 2 [Theobroma cacao]
 gb|EOX90778.1| Plasma membrane intrinsic protein 3 isoform 2 [Theobroma cacao]
Length=282

 Score =   316 bits (810),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 170/236 (72%), Positives = 196/236 (83%), Gaps = 3/236 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVTFG  182
            TLLFLY+ VATVIG K    PC G G LGI+W  GGMIFVLVYCTAGISGGHINPAVT G
Sbjct  47   TLLFLYILVATVIGHKKQKGPCDGVGPLGIAWAVGGMIFVLVYCTAGISGGHINPAVTLG  106

Query  183  LFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGLVA  362
            LF+ARKVSL+RAVAYMVAQCLG++ G  + K++ + +++T+GGGAN V  G+SKG  L A
Sbjct  107  LFVARKVSLVRAVAYMVAQCLGSICGAAIAKSIMRRYYNTLGGGANEVASGYSKGSALGA  166

Query  363  EILATFFLVYTVFSATDPKRNARDSHVP-VLAPLPIGFAVFVAHVATIPITGTGINPARS  539
            EI+ TF LVYTVFSATDPKRNARDSHVP VLAPLPIGFAVFV H+ATIPITGTGINPARS
Sbjct  167  EIIGTFVLVYTVFSATDPKRNARDSHVPVVLAPLPIGFAVFVVHLATIPITGTGINPARS  226

Query  540  FGAAVIHNNKHAWDD-HWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
             GAAVI++N+ AWDD  WIFWVGP +GA+A A YHQ +LRA A+KAL  SF+S+P 
Sbjct  227  LGAAVIYDNEKAWDDQQWIFWVGPFIGALAAAAYHQFILRATAIKAL-KSFRSSPT  281



>ref|XP_010253676.1| PREDICTED: aquaporin PIP2-4-like [Nelumbo nucifera]
Length=287

 Score =   316 bits (810),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 176/241 (73%), Positives = 195/241 (81%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG K   D       C G GLLGI+W FGGMIF+LVYCTAGISGGHIN
Sbjct  48   TLLFLYITVLTVIGYKRQTDSSHNGTDCGGVGLLGIAWAFGGMIFILVYCTAGISGGHIN  107

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRAV Y++AQCLGA+ GVGLVK   K ++   GGGAN +  G+SK
Sbjct  108  PAVTFGLFLARKVSLIRAVMYIIAQCLGAICGVGLVKGFQKSYYVRYGGGANELADGYSK  167

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            GVGL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  168  GVGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  227

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARS GAAVI N   AW DHWIFWVGP +GA   A YHQ +LRA A+KAL GSF+S P+
Sbjct  228  NPARSLGAAVIFNKDKAWHDHWIFWVGPFIGAAIAAFYHQYILRAAAIKAL-GSFRSNPH  286

Query  705  V  707
            V
Sbjct  287  V  287



>ref|XP_004307390.1| PREDICTED: probable aquaporin PIP2-5-like [Fragaria vesca subsp. 
vesca]
Length=285

 Score =   316 bits (810),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 173/238 (73%), Positives = 196/238 (82%), Gaps = 5/238 (2%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKAT----PDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPA  170
            TLLFLY++V TVIG K+      D C G G+LGI+W FGGMIF+LVYCTAGISGGHINPA
Sbjct  48   TLLFLYITVLTVIGYKSQIDLGGDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPA  107

Query  171  VTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGV  350
            VTFGLFLARKVSL+RAV Y+VAQ LGA+ GVGLVKA  K ++   GGGAN +  G+S GV
Sbjct  108  VTFGLFLARKVSLVRAVMYIVAQSLGAIAGVGLVKAFQKSYYTKYGGGANELAEGYSTGV  167

Query  351  GLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINP  530
            GL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINP
Sbjct  168  GLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227

Query  531  ARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            ARS GAAVI++ K AWDD WIFWVGP +GA   A YHQ +LRA AVKAL GSF+S P+
Sbjct  228  ARSLGAAVIYDKKKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKAL-GSFRSNPH  284



>ref|XP_007151871.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
 gb|ESW23865.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
Length=285

 Score =   316 bits (810),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 174/241 (72%), Positives = 196/241 (81%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG K+  D       C G G+LGI+W FGGMIF+LVYCTAGISGGHIN
Sbjct  46   TLLFLYITVLTVIGYKSQSDAKAGGDLCGGVGILGIAWAFGGMIFILVYCTAGISGGHIN  105

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRA+ YMVAQCLGA+ GVGLVKA  K ++   GGGAN +  G+S 
Sbjct  106  PAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGLVKAFQKAYYTRYGGGANELSEGYST  165

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            GVGL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIP+TGTGI
Sbjct  166  GVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGI  225

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARS GAAVI+N + AWDD WIFWVGP +GA   A YHQ +LRA A KAL GSF+S P 
Sbjct  226  NPARSLGAAVIYNKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAAKAL-GSFRSNPT  284

Query  705  V  707
            +
Sbjct  285  I  285



>ref|XP_008791536.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=288

 Score =   316 bits (810),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 173/242 (71%), Positives = 195/242 (81%), Gaps = 9/242 (4%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP--------CKGAGLLGISWVFGGMIFVLVYCTAGISGGH  158
            TLLFLY++VATVIG K   DP        C G G+LGI+W FGGMIF+LVYCTAGISGGH
Sbjct  47   TLLFLYITVATVIGYKHQSDPNVNGTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGH  106

Query  159  INPAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGF  338
            INPAVTFGLFLARKVSLIRA+ YM+AQCLGA+ G GLVK   K ++   GGGAN +  G+
Sbjct  107  INPAVTFGLFLARKVSLIRALLYMIAQCLGAICGAGLVKGFQKAYYVRYGGGANELSSGY  166

Query  339  SKGVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGT  518
            SKG GL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGT
Sbjct  167  SKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGT  226

Query  519  GINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            GINPARSFGAAVI++ + AWDD WIFWVGP +GA     YHQ VLRA AVKAL GSF+S 
Sbjct  227  GINPARSFGAAVIYDKEKAWDDQWIFWVGPFIGAAIATAYHQFVLRAGAVKAL-GSFRSN  285

Query  699  PN  704
             +
Sbjct  286  AS  287



>ref|XP_010098191.1| Aquaporin PIP2-7 [Morus notabilis]
 gb|EXB74647.1| Aquaporin PIP2-7 [Morus notabilis]
Length=281

 Score =   316 bits (809),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 174/234 (74%), Positives = 197/234 (84%), Gaps = 3/234 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATP--DPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLYV++ TVIG K+    D C G G+LGI+W FGGMIF+LVYCTAGISGGHINPAVT
Sbjct  48   TLLFLYVTILTVIGYKSQSATDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT  107

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGLFLARKVSL+RAV Y+VAQCLGA+ G GLVKA    +++  GGGANT+   ++KGVGL
Sbjct  108  FGLFLARKVSLVRAVLYIVAQCLGAICGTGLVKAFQSSYYNRHGGGANTLADHYNKGVGL  167

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  168  GAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  227

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            SFGAAVI+NN  AWDD WIFWVGP +GA   A YHQ +LRA A+KAL GSF+ST
Sbjct  228  SFGAAVIYNNDKAWDDQWIFWVGPFIGAAIAAFYHQYILRAGAIKAL-GSFRST  280



>ref|XP_006664813.1| PREDICTED: probable aquaporin PIP2-6-like [Oryza brachyantha]
Length=276

 Score =   316 bits (809),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 173/236 (73%), Positives = 197/236 (83%), Gaps = 3/236 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTK--ATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLY++VATVIG K  ++ D C G G LGI+W FGGMIF+LVYCTAGISGGHINPAVT
Sbjct  41   TLLFLYITVATVIGYKVQSSADQCGGVGTLGIAWAFGGMIFILVYCTAGISGGHINPAVT  100

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGL LARKVS+IRAV Y+VAQCLG +VGVG+VK + K  ++  GGGAN V  G+S G  L
Sbjct  101  FGLLLARKVSVIRAVMYIVAQCLGGIVGVGIVKGIMKHQYNANGGGANVVASGYSNGTAL  160

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  161  GAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  220

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            S GAAVI+N K AWDDHWIFW GP +GA+A A YHQ +LRA A+KAL GSF+S P+
Sbjct  221  SIGAAVIYNQKKAWDDHWIFWAGPFIGALAAAAYHQYILRAAAIKAL-GSFRSNPS  275



>ref|XP_011041003.1| PREDICTED: probable aquaporin PIP2-5 [Populus euphratica]
Length=285

 Score =   316 bits (809),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 178/235 (76%), Positives = 194/235 (83%), Gaps = 5/235 (2%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKA----TPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPA  170
            TLLFLY++V TVIG K+      D C G G+LGI+W FGGMIFVLVYCTAGISGGHINPA
Sbjct  48   TLLFLYITVLTVIGYKSQIDGNADSCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPA  107

Query  171  VTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGV  350
            VTFGLFLARKVSLIRAV YMVAQCLGA+ GVGLVKA  K ++   GGGANT+  GFS G 
Sbjct  108  VTFGLFLARKVSLIRAVMYMVAQCLGAICGVGLVKAFQKSYYKRYGGGANTLADGFSTGT  167

Query  351  GLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINP  530
            GL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINP
Sbjct  168  GLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227

Query  531  ARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQS  695
            ARS GAAVI+N   AWDDHWIFWVGP  GA   A YHQ +LRA AVKAL GSF+S
Sbjct  228  ARSLGAAVIYNQDKAWDDHWIFWVGPFAGAAIAAFYHQFILRAGAVKAL-GSFRS  281



>ref|XP_006424576.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 ref|XP_006488095.1| PREDICTED: aquaporin PIP2-1-like [Citrus sinensis]
 gb|ESR37816.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 gb|KDO73274.1| hypothetical protein CISIN_1g022966mg [Citrus sinensis]
Length=289

 Score =   316 bits (809),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 172/238 (72%), Positives = 195/238 (82%), Gaps = 7/238 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYV+V TVIG K+  DP      C G G+LGI+W FGGMIF+LVYCTAGISGGHIN
Sbjct  52   TLLFLYVTVLTVIGYKSQTDPNLNTDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHIN  111

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFL RKVSLIRA+ YMVAQCLGA+ G G VKA  K +++  GGGAN +  G++K
Sbjct  112  PAVTFGLFLGRKVSLIRALLYMVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYNK  171

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  172  GTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  231

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            NPARSFGAAVI+N + AWDD WIFWVGP +GA   A YHQ +LRA A+KAL GSF+S 
Sbjct  232  NPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAFVAAFYHQYILRAAAIKAL-GSFRSN  288



>ref|XP_004304428.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=284

 Score =   316 bits (809),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 172/241 (71%), Positives = 195/241 (81%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPD------PCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG K+  D       C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  45   TLLFLYITVLTVIGYKSQSDTLKGGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  104

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSL RAV Y+VAQ LGA+ G  LVK+     +   GGGAN +  G++K
Sbjct  105  PAVTFGLFLARKVSLPRAVMYIVAQSLGAICGCALVKSFQSALYTNYGGGANGLADGYNK  164

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  165  GTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  224

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARS GAAVI+NN+ AWDDHWIFWVGP +GA   A+YHQ +LRA AVKAL GSF+S+ N
Sbjct  225  NPARSLGAAVIYNNEKAWDDHWIFWVGPFIGAAIAAMYHQYILRAGAVKAL-GSFRSSSN  283

Query  705  V  707
            +
Sbjct  284  I  284



>ref|XP_006664814.1| PREDICTED: probable aquaporin PIP2-6-like [Oryza brachyantha]
Length=282

 Score =   316 bits (809),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 173/236 (73%), Positives = 197/236 (83%), Gaps = 3/236 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTK--ATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLY++VATVIG K  ++ D C G G LGI+W FGGMIF+LVYCTAGISGGHINPAVT
Sbjct  47   TLLFLYITVATVIGYKVQSSADQCGGVGTLGIAWAFGGMIFILVYCTAGISGGHINPAVT  106

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGL LARKVS+IRAV Y+VAQCLG +VGVG+VK + K  ++  GGGAN V  G+S G  L
Sbjct  107  FGLLLARKVSVIRAVMYIVAQCLGGIVGVGIVKGIMKHQYNANGGGANVVASGYSNGTAL  166

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  167  GAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  226

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            S GAAVI+N K AWDDHWIFW GP +GA+A A YHQ +LRA A+KAL GSF+S P+
Sbjct  227  SIGAAVIYNQKKAWDDHWIFWAGPFIGALAAAAYHQYILRAAAIKAL-GSFRSNPS  281



>gb|ACU24483.1| unknown [Glycine max]
Length=284

 Score =   316 bits (809),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 173/237 (73%), Positives = 194/237 (82%), Gaps = 4/237 (2%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKAT---PDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAV  173
            TLLFLY++V TVIG K      D C G G+LGI+W FGGMIF+LVYCTAGISGGHINPAV
Sbjct  48   TLLFLYITVLTVIGYKHQTDHADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAV  107

Query  174  TFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVG  353
            TFGLFLARKVSLIRA+ YMVAQCL A+ GVGLVKA  K +F+  GGGAN++  G+S G G
Sbjct  108  TFGLFLARKVSLIRAIMYMVAQCLSAICGVGLVKAFQKSYFNKYGGGANSLADGYSTGTG  167

Query  354  LVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPA  533
            L AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIP+TGTGINPA
Sbjct  168  LGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPA  227

Query  534  RSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            RS GAAVI+N    WDDHWIFWVGP +GA   A YHQ +LRA A KAL GSF+S P+
Sbjct  228  RSLGAAVIYNQDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAKAL-GSFRSNPH  283



>gb|ABK60195.2| PIP2 protein [Gossypium hirsutum]
Length=285

 Score =   316 bits (809),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 170/237 (72%), Positives = 194/237 (82%), Gaps = 7/237 (3%)
 Frame = +3

Query  6    LLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHINP  167
            LLFLY++V TVIG K+  DP      C G G+LGI+W FGGMIF+LVYCTAGISGGHINP
Sbjct  47   LLFLYITVLTVIGYKSQVDPDKGGQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINP  106

Query  168  AVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKG  347
            AVTFGLFLARKVSL+RA+ YM AQCLGA+ G GLVKA  K +++  GGGAN++  G+S G
Sbjct  107  AVTFGLFLARKVSLVRAILYMAAQCLGAICGCGLVKAFQKSYYNKYGGGANSLADGYSTG  166

Query  348  VGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGIN  527
             GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGIN
Sbjct  167  TGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGIN  226

Query  528  PARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            PARSFGAAV+ N    WDDHWIFWVGP +GA   A+YHQ +LRA A KAL GSF+S+
Sbjct  227  PARSFGAAVMFNQDKPWDDHWIFWVGPFIGAAIAAIYHQYILRAGAAKAL-GSFRSS  282



>ref|NP_001052292.1| Os04g0233400 [Oryza sativa Japonica Group]
 sp|Q7XLR1.2|PIP26_ORYSJ RecName: Full=Probable aquaporin PIP2-6; AltName: Full=OsPIP2;6; 
AltName: Full=Plasma membrane intrinsic protein 2-6 [Oryza 
sativa Japonica Group]
 emb|CAE05002.2| OSJNBb0093G06.10 [Oryza sativa Japonica Group]
 dbj|BAF14206.1| Os04g0233400 [Oryza sativa Japonica Group]
 gb|EAY92739.1| hypothetical protein OsI_14491 [Oryza sativa Indica Group]
 dbj|BAG87850.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87963.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95414.1| unnamed protein product [Oryza sativa Japonica Group]
Length=282

 Score =   315 bits (808),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 173/236 (73%), Positives = 197/236 (83%), Gaps = 3/236 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTK--ATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLY++VATVIG K  ++ D C G G LGI+W FGGMIF+LVYCTAGISGGHINPAVT
Sbjct  47   TLLFLYITVATVIGYKVQSSADQCGGVGTLGIAWAFGGMIFILVYCTAGISGGHINPAVT  106

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGL LARKVS+IRAV Y+VAQCLG +VGVG+VK + K  ++  GGGAN V  G+S G  L
Sbjct  107  FGLLLARKVSVIRAVMYIVAQCLGGIVGVGIVKGIMKHQYNANGGGANMVASGYSTGTAL  166

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  167  GAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  226

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            S GAAVI+N K AWDDHWIFW GP +GA+A A YHQ +LRA A+KAL GSF+S P+
Sbjct  227  SIGAAVIYNQKKAWDDHWIFWAGPFIGALAAAAYHQYILRAAAIKAL-GSFRSNPS  281



>ref|XP_007205689.1| hypothetical protein PRUPE_ppa009689mg [Prunus persica]
 gb|EMJ06888.1| hypothetical protein PRUPE_ppa009689mg [Prunus persica]
Length=281

 Score =   315 bits (808),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 172/234 (74%), Positives = 195/234 (83%), Gaps = 3/234 (1%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATP--DPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAVT  176
            TLLFLY++V TVIG K+    D C G G+LGI+W FGGMIFVLVYCTAGISGGHINPAVT
Sbjct  48   TLLFLYITVLTVIGYKSQSSGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVT  107

Query  177  FGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVGL  356
            FGLFLARKVSL RAV Y+VAQ LGA+ GVGLVKA  K +++  GGGAN +  G++KG GL
Sbjct  108  FGLFLARKVSLPRAVLYIVAQSLGAICGVGLVKAFQKTYYEEYGGGANELAAGYNKGTGL  167

Query  357  VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR  536
             AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct  168  GAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPAR  227

Query  537  SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            SFGAAVI+N   AWDD WIFW+GP +GA   A+YHQ +LRA A+KAL GSF+S 
Sbjct  228  SFGAAVIYNKDKAWDDQWIFWLGPFIGAAIAALYHQYILRAGAIKAL-GSFRSN  280



>gb|AAD31846.1|AF133530_1 water channel protein MipH [Mesembryanthemum crystallinum]
Length=291

 Score =   316 bits (809),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 172/243 (71%), Positives = 194/243 (80%), Gaps = 8/243 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP--------CKGAGLLGISWVFGGMIFVLVYCTAGISGGH  158
            TLLFLY++V TVIG K   DP        C G G+LGI+W FGGMIF+LVYCTAGISGGH
Sbjct  49   TLLFLYITVLTVIGYKHQSDPLVSGADAGCGGVGILGIAWAFGGMIFILVYCTAGISGGH  108

Query  159  INPAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGF  338
            INPAVTFGLFLARK+SLIRA+ YMVAQCLGA+ GVG VKA    +++  GGGAN +  G+
Sbjct  109  INPAVTFGLFLARKLSLIRAIMYMVAQCLGAICGVGFVKAFQSAYYNKYGGGANELSVGY  168

Query  339  SKGVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGT  518
            SKG GL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGT
Sbjct  169  SKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGT  228

Query  519  GINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            GINPARS GAAVI+NN  AWDD WIFWVGP +GA   A+YHQ +LRA  +KALG    ST
Sbjct  229  GINPARSLGAAVIYNNNKAWDDQWIFWVGPFIGAAIAAIYHQYILRAGFIKALGSFRSST  288

Query  699  PNV  707
             NV
Sbjct  289  SNV  291



>gb|AGC24024.1| plasma membrane intrinsic protein 1 [Lilium hybrid cultivar]
Length=288

 Score =   315 bits (808),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 175/240 (73%), Positives = 195/240 (81%), Gaps = 9/240 (4%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPD--------PCKGAGLLGISWVFGGMIFVLVYCTAGISGGH  158
            TLLFLY++VATVIG K   D         C+G G+LGI+W FGGMIF+LVYCTAGISGGH
Sbjct  49   TLLFLYITVATVIGYKHQSDTTLGTPNADCEGVGILGIAWAFGGMIFILVYCTAGISGGH  108

Query  159  INPAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGF  338
            INPAVTFGLFLARKVSLIRAV YM+AQCLGA+ GVGLVK   K F+   GGGAN +  G+
Sbjct  109  INPAVTFGLFLARKVSLIRAVLYMIAQCLGAICGVGLVKGFQKAFYVRYGGGANELSAGY  168

Query  339  SKGVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGT  518
            SKG GL AEI+ TF LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGT
Sbjct  169  SKGTGLAAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGT  228

Query  519  GINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            GINPARSFGAAVI+N   AWDD WIFWVGP +GA   A YHQ +LRA A+KAL GSF+S 
Sbjct  229  GINPARSFGAAVIYNKSKAWDDQWIFWVGPFIGAAIAAGYHQYILRAGAIKAL-GSFRSN  287



>ref|XP_003521392.1| PREDICTED: aquaporin PIP2-7-like [Glycine max]
Length=286

 Score =   315 bits (808),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 176/240 (73%), Positives = 195/240 (81%), Gaps = 6/240 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIG-----TKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINP  167
            TLLFLYV++ TVIG        +PD C G G+LGI+W FGGMIFVLVYCTAGISGGHINP
Sbjct  48   TLLFLYVTILTVIGYNHQTATGSPDLCNGVGVLGIAWAFGGMIFVLVYCTAGISGGHINP  107

Query  168  AVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKG  347
            AVTFGLFLARKVSLIRAV YMVAQ LGA+ GVGLVKAL K +++   GG N +  G+SKG
Sbjct  108  AVTFGLFLARKVSLIRAVGYMVAQVLGAISGVGLVKALQKSYYNRYNGGVNMLADGYSKG  167

Query  348  VGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGIN  527
             GL AEI+ TF LVYTVFSATDPKR ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGIN
Sbjct  168  TGLGAEIIGTFILVYTVFSATDPKRVARDSHVPVLAPLPIGFAVFIVHLATIPITGTGIN  227

Query  528  PARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  707
            PARS G AVI NN+ AWDD WIFWVGP +GA   A YHQ VLRAQA KAL GSF+S+ N+
Sbjct  228  PARSLGPAVIFNNEKAWDDQWIFWVGPFIGAAIAAFYHQSVLRAQAAKAL-GSFRSSSNL  286



>tpg|DAA64677.1| TPA_exp: aquaporin PIP2 4a [Nicotiana tabacum]
Length=287

 Score =   315 bits (808),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 179/238 (75%), Positives = 198/238 (83%), Gaps = 7/238 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIG------TKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYV+V TVIG      TK   D C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  50   TLLFLYVTVLTVIGYKHQSDTKDGGDICGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  109

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRAV YMV+QCLGA+ GVGLVKA  K +F+  GGG N +  G +K
Sbjct  110  PAVTFGLFLARKVSLIRAVLYMVSQCLGAICGVGLVKAFQKAYFNRYGGGVNVMAGGHNK  169

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            GVGL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  170  GVGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  229

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            NPARSFGAAVI+N   AWD+HWIFWVGP +GA A AVYHQ +LRA A+KAL GSF+S 
Sbjct  230  NPARSFGAAVIYNQDKAWDEHWIFWVGPFVGAFAAAVYHQYILRAGALKAL-GSFRSN  286



>ref|XP_007143702.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
 gb|AGV54658.1| aquaporin PIP2 [Phaseolus vulgaris]
 gb|ESW15696.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
Length=287

 Score =   315 bits (808),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 175/241 (73%), Positives = 197/241 (82%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPD------PCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG K   D       C G G+LGI+W FGGMIF+LVYCTAGISGGHIN
Sbjct  48   TLLFLYITVLTVIGYKHQSDLKDHGDACGGVGILGIAWAFGGMIFILVYCTAGISGGHIN  107

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRA+ YMVAQCLGA+ GVGLVKA  K +++  GGGAN++  G+S 
Sbjct  108  PAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGLVKAFQKSYYNRYGGGANSLADGYST  167

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIP+TGTGI
Sbjct  168  GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGI  227

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARS GAAVI+N    WDDHWIFWVGP +GA   A YHQ +LRA AVKAL GSF+S P+
Sbjct  228  NPARSLGAAVIYNKDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAVKAL-GSFRSNPH  286

Query  705  V  707
            V
Sbjct  287  V  287



>ref|NP_200874.1| putative aquaporin PIP2-4 [Arabidopsis thaliana]
 sp|Q9FF53.1|PIP24_ARATH RecName: Full=Probable aquaporin PIP2-4; AltName: Full=Plasma 
membrane intrinsic protein 2.4; Short=AtPIP2;4; Contains: RecName: 
Full=Probable aquaporin PIP2-4, N-terminally processed 
[Arabidopsis thaliana]
 dbj|BAB09839.1| water channel protein [Arabidopsis thaliana]
 gb|AAM64801.1| mipC protein-like (aquaporin) [Arabidopsis thaliana]
 dbj|BAF00622.1| mipC protein - like [Arabidopsis thaliana]
 gb|AED97364.1| putative aquaporin PIP2-4 [Arabidopsis thaliana]
Length=291

 Score =   315 bits (808),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 175/242 (72%), Positives = 195/242 (81%), Gaps = 11/242 (5%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPD------PCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYVS+ TVIG KA  D       C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  48   TLLFLYVSILTVIGYKAQTDATAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  107

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVT GLFLARKVSL+R V Y+VAQCLGA+ G G VKA    ++   GGGAN +  G++K
Sbjct  108  PAVTVGLFLARKVSLVRTVLYIVAQCLGAICGCGFVKAFQSSYYTRYGGGANELADGYNK  167

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  168  GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  227

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALG-----GSF  689
            NPARSFGAAVI+NN+ AWDD WIFWVGPM+GA A A YHQ +LRA A+KALG     GSF
Sbjct  228  NPARSFGAAVIYNNEKAWDDQWIFWVGPMIGAAAAAFYHQFILRAAAIKALGSFGSFGSF  287

Query  690  QS  695
            +S
Sbjct  288  RS  289



>gb|KDP44053.1| hypothetical protein JCGZ_05520 [Jatropha curcas]
Length=286

 Score =   315 bits (808),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 172/238 (72%), Positives = 195/238 (82%), Gaps = 7/238 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLY++V TVIG K+  DP      C G G+LGI+W FGGMIF+LVYCTAGISGGHIN
Sbjct  49   TLLFLYITVLTVIGYKSQTDPNKNADACGGVGILGIAWAFGGMIFILVYCTAGISGGHIN  108

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFL RKVSLIRA+ YM+AQCLGA+ G GLVKA  K +++  GGGAN +  G++K
Sbjct  109  PAVTFGLFLGRKVSLIRALGYMIAQCLGAICGCGLVKAFQKAYYNRYGGGANELADGYNK  168

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  169  GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  228

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            NPARSFGAAVI+N   AWDD WIFWVGP +GA   A YHQ +LRA A+KAL GSF+S 
Sbjct  229  NPARSFGAAVIYNKDKAWDDQWIFWVGPFVGAAIAAFYHQYILRAAAIKAL-GSFRSN  285



>gb|AFK47442.1| unknown [Medicago truncatula]
Length=287

 Score =   315 bits (808),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 178/241 (74%), Positives = 196/241 (81%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIG------TKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYV+V TVIG       KA  D C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  48   TLLFLYVTVLTVIGYSIQTDVKAGGDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  107

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRA+ YMVAQCLGA+ GVGLVKA    +FD  GGGAN +  G+S 
Sbjct  108  PAVTFGLFLARKVSLIRAIMYMVAQCLGAIAGVGLVKAFQSAYFDRYGGGANFLHDGYST  167

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            GVGL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIP+TGTGI
Sbjct  168  GVGLGAEIVGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGI  227

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARS G+AVI+N    WDDHWIFWVGP +GA   A YHQ +LRA AVKAL GSF+S P 
Sbjct  228  NPARSLGSAVIYNKDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAVKAL-GSFRSNPT  286

Query  705  V  707
            V
Sbjct  287  V  287



>gb|ACZ06859.1| plasma membrane intrinsic protein [Glycine soja]
Length=284

 Score =   315 bits (807),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 174/237 (73%), Positives = 195/237 (82%), Gaps = 4/237 (2%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKAT---PDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAV  173
            TLLFLY++V TVIG K      D C G G+LGI+W FGGMIF+LVYCTAGISGGHINPAV
Sbjct  48   TLLFLYITVLTVIGYKHQTDHADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAV  107

Query  174  TFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVG  353
            TFGLFLARKVSLIRA+ YMVAQCLGA+ GVGLVKA  K +F+  GGGAN++  G+S G G
Sbjct  108  TFGLFLARKVSLIRAIMYMVAQCLGAICGVGLVKAFQKSYFNKYGGGANSLADGYSTGTG  167

Query  354  LVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPA  533
            L AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIP+TGTGINPA
Sbjct  168  LGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPA  227

Query  534  RSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            RS GAAVI+N    WDDHWIFWVGP +GA   A YHQ +LRA A KAL GSF+S P+
Sbjct  228  RSLGAAVIYNQDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAKAL-GSFRSNPH  283



>dbj|BAG68661.1| plasma membrane intrinsic protein [Tulipa gesneriana]
Length=288

 Score =   315 bits (808),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 176/240 (73%), Positives = 194/240 (81%), Gaps = 9/240 (4%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP--------CKGAGLLGISWVFGGMIFVLVYCTAGISGGH  158
            TLLFLY++VATVIG K   DP        C+G GLLGI+W FGGMIF+LVYCTAGISGGH
Sbjct  49   TLLFLYITVATVIGYKHQSDPNLSTPNAGCEGVGLLGIAWAFGGMIFILVYCTAGISGGH  108

Query  159  INPAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGF  338
            INPAVTFGL + RKVSLIRAV YMVAQCLGA+ GVG VKA  K F+   GGGAN +  G+
Sbjct  109  INPAVTFGLLVGRKVSLIRAVFYMVAQCLGAICGVGFVKAFQKAFYVRYGGGANELSAGY  168

Query  339  SKGVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGT  518
            SKG GL AEI+ TF LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGT
Sbjct  169  SKGTGLAAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGT  228

Query  519  GINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  698
            GINPARSFGAAVI+N   AWDD WIFWVGP +GA   A YHQ VLRA A+KAL GSF+S 
Sbjct  229  GINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAAYHQYVLRAGAIKAL-GSFRSN  287



>ref|XP_003556232.1| PREDICTED: aquaporin PIP2-1-like [Glycine max]
 gb|KHN00839.1| Putative aquaporin PIP2-5 [Glycine soja]
Length=284

 Score =   315 bits (807),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 174/237 (73%), Positives = 195/237 (82%), Gaps = 4/237 (2%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKAT---PDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHINPAV  173
            TLLFLY++V TVIG K      D C G G+LGI+W FGGMIF+LVYCTAGISGGHINPAV
Sbjct  48   TLLFLYITVLTVIGYKHQTDHADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAV  107

Query  174  TFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSKGVG  353
            TFGLFLARKVSLIRA+ YMVAQCLGA+ GVGLVKA  K +F+  GGGAN++  G+S G G
Sbjct  108  TFGLFLARKVSLIRAIMYMVAQCLGAICGVGLVKAFQKSYFNKYGGGANSLADGYSTGTG  167

Query  354  LVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPA  533
            L AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIP+TGTGINPA
Sbjct  168  LGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPA  227

Query  534  RSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            RS GAAVI+N    WDDHWIFWVGP +GA   A YHQ +LRA A KAL GSF+S P+
Sbjct  228  RSLGAAVIYNQDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAKAL-GSFRSNPH  283



>dbj|BAK20223.1| plasma membrane intrinsic protein 2 [Ziziphus jujuba]
Length=281

 Score =   315 bits (806),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 176/241 (73%), Positives = 194/241 (80%), Gaps = 8/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPDP------CKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYV++ATVIG K   D       C G G+LGI+W FGGMIF+LVYCTAGISGGHIN
Sbjct  43   TLLFLYVTIATVIGYKIQSDTKMNGEVCGGVGVLGIAWAFGGMIFILVYCTAGISGGHIN  102

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRAV YMV Q LGA+ GV LVKAL   + +T GGGAN +  G+S 
Sbjct  103  PAVTFGLFLARKVSLIRAVLYMVVQSLGAIAGVALVKALNSSY-ETYGGGANELSAGYSA  161

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            GVGL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  162  GVGLSAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGI  221

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARS GAAVI+N   AWD HWIFWVGP +GA   A YHQ +LRA A KAL GSF+S P+
Sbjct  222  NPARSLGAAVIYNQDKAWDKHWIFWVGPFIGAAIAAFYHQFILRAGAAKAL-GSFRSNPH  280

Query  705  V  707
            V
Sbjct  281  V  281



>ref|XP_002866389.1| hypothetical protein ARALYDRAFT_919301 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42648.1| hypothetical protein ARALYDRAFT_919301 [Arabidopsis lyrata subsp. 
lyrata]
Length=285

 Score =   315 bits (807),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 175/237 (74%), Positives = 195/237 (82%), Gaps = 7/237 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIGTKATPD------PCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYVSV TVIG KA  D       C G G+LGI+W FGGMIFVLVYCTAGISGGHIN
Sbjct  48   TLLFLYVSVLTVIGYKAQTDATAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHIN  107

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVT GLFLARKVSL+R V Y+VAQCLGA+ G GLVKA    ++   GGGAN +  G++K
Sbjct  108  PAVTVGLFLARKVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNK  167

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  168  GTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  227

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQS  695
            NPARSFGAAVI+NN+ AWDD WIFWVGPM+GA A A YHQ +LRA A+KAL GSF+S
Sbjct  228  NPARSFGAAVIYNNEKAWDDQWIFWVGPMIGAAAAAFYHQFILRAAAIKAL-GSFRS  283



>emb|CDX91341.1| BnaC04g08090D [Brassica napus]
Length=285

 Score =   315 bits (806),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 177/241 (73%), Positives = 193/241 (80%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TLLFLYVSVATVIG------TKATPDPCKGAGLLGISWVFGGMIFVLVYCTAGISGGHIN  164
            TLLFLYV+V TVIG      TKA  D C G G+LGISW FGGMIF+LVYCTAGISGGHIN
Sbjct  46   TLLFLYVTVLTVIGYKISSDTKAGGDECGGVGILGISWAFGGMIFILVYCTAGISGGHIN  105

Query  165  PAVTFGLFLARKVSLIRAVAYMvaqclgavvgvglvkalTKDFFDTVGGGANTVQPGFSK  344
            PAVTFGLFLARKVSLIRAV YMVAQCLGA+ GVG VKA    ++   GGGAN++  G+S 
Sbjct  106  PAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYST  165

Query  345  GVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI  524
            G GL AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGI
Sbjct  166  GTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  225

Query  525  NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  704
            NPARSFGAAVI N    W+DHWIFWVGP +GA   A YHQ VLRA   K+L GSF+S  N
Sbjct  226  NPARSFGAAVIFNESKPWNDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSL-GSFRSAAN  284

Query  705  V  707
            V
Sbjct  285  V  285



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1985022489692