BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c125548_g1_i1 len=126 path=[104:0-125]

Length=126
                                                                      Score     E

ref|XP_006853796.1|  hypothetical protein AMTR_s00056p00217790        48.1    8e-05   
ref|XP_007224771.1|  hypothetical protein PRUPE_ppa024045mg           47.4    2e-04   
ref|XP_007044432.1|  Tir-nbs-lrr resistance protein, putative iso...  47.0    2e-04   
ref|XP_010555981.1|  PREDICTED: putative disease resistance prote...  47.0    2e-04   
ref|XP_007044430.1|  Tir-nbs-lrr resistance protein, putative iso...  47.0    3e-04   
ref|XP_007044433.1|  Tir-nbs-lrr resistance protein, putative iso...  47.0    3e-04   
ref|XP_007044431.1|  Tir-nbs-lrr resistance protein, putative iso...  47.0    3e-04   
ref|XP_006357280.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  46.2    5e-04   
ref|XP_007227357.1|  hypothetical protein PRUPE_ppa000268mg           45.8    6e-04   
ref|XP_007157556.1|  hypothetical protein PHAVU_002G079200g           45.8    7e-04   
gb|AET03054.2|  disease resistance protein (TIR-NBS-LRR class), p...  45.4    8e-04   
ref|XP_003628578.1|  Leucine-rich repeat-containing protein           45.4    8e-04   



>ref|XP_006853796.1| hypothetical protein AMTR_s00056p00217790 [Amborella trichopoda]
 gb|ERN15263.1| hypothetical protein AMTR_s00056p00217790 [Amborella trichopoda]
Length=496

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -1

Query  126  PLSLEILSAKNCVSLEKIADISNLKRLEVLRIGKCKSLVELP  1
            P SL+ L A NC+SL+ IA++S+L +LE L + KCKSL E+P
Sbjct  419  PTSLKTLHASNCISLQTIANLSDLYQLEELYLTKCKSLTEIP  460



>ref|XP_007224771.1| hypothetical protein PRUPE_ppa024045mg [Prunus persica]
 gb|EMJ25970.1| hypothetical protein PRUPE_ppa024045mg [Prunus persica]
Length=1372

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -1

Query  126   PLSLEILSAKNCVSLEKIADISNLKRLEVLRIGKCKSLVELP  1
             PLSLE + A NC+SLE I+DISNL+ L +L +  C+ +V++P
Sbjct  1129  PLSLEEVDAANCISLESISDISNLENLVMLNLTSCEKVVDIP  1170



>ref|XP_007044432.1| Tir-nbs-lrr resistance protein, putative isoform 3 [Theobroma 
cacao]
 gb|EOY00264.1| Tir-nbs-lrr resistance protein, putative isoform 3 [Theobroma 
cacao]
Length=1353

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -1

Query  126   PLSLEILSAKNCVSLEKIADISNLKRLEVLRIGKCKSLVELP  1
             P SLE L+  NC+SLE I+D+SNLK LE L +  C+ LV++P
Sbjct  1086  PSSLEELNLANCISLESISDLSNLKSLEELNLTNCEKLVDIP  1127



>ref|XP_010555981.1| PREDICTED: putative disease resistance protein At4g11170 [Tarenaya 
hassleriana]
Length=714

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  SLEILSAKNCVSLEKIADISNLKRLEVLRIGKCKSLVELP  1
            +LE+L   NC  L K+ DISNLK L+ +R+ +CKSLV LP
Sbjct  441  NLEMLDLTNCAYLIKLPDISNLKNLKSMRLDRCKSLVTLP  480



>ref|XP_007044430.1| Tir-nbs-lrr resistance protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY00262.1| Tir-nbs-lrr resistance protein, putative isoform 1 [Theobroma 
cacao]
Length=1382

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -1

Query  126   PLSLEILSAKNCVSLEKIADISNLKRLEVLRIGKCKSLVELP  1
             P SLE L+  NC+SLE I+D+SNLK LE L +  C+ LV++P
Sbjct  1086  PSSLEELNLANCISLESISDLSNLKSLEELNLTNCEKLVDIP  1127



>ref|XP_007044433.1| Tir-nbs-lrr resistance protein, putative isoform 4 [Theobroma 
cacao]
 gb|EOY00265.1| Tir-nbs-lrr resistance protein, putative isoform 4 [Theobroma 
cacao]
Length=1167

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -1

Query  126   PLSLEILSAKNCVSLEKIADISNLKRLEVLRIGKCKSLVELP  1
             P SLE L+  NC+SLE I+D+SNLK LE L +  C+ LV++P
Sbjct  1086  PSSLEELNLANCISLESISDLSNLKSLEELNLTNCEKLVDIP  1127



>ref|XP_007044431.1| Tir-nbs-lrr resistance protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY00263.1| Tir-nbs-lrr resistance protein, putative isoform 2 [Theobroma 
cacao]
Length=1172

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -1

Query  126   PLSLEILSAKNCVSLEKIADISNLKRLEVLRIGKCKSLVELP  1
             P SLE L+  NC+SLE I+D+SNLK LE L +  C+ LV++P
Sbjct  1086  PSSLEELNLANCISLESISDLSNLKSLEELNLTNCEKLVDIP  1127



>ref|XP_006357280.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
[Solanum tuberosum]
Length=1375

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -1

Query  126   PLSLEILSAKNCVSLEKIADISNLKRLEVLRIGKCKSLVELP  1
             P SLE L A NC +LE+IA ++NLK L+ L+I  CK + ++P
Sbjct  1133  PSSLEWLDAANCSALEQIASVANLKYLKELQISNCKKITDIP  1174



>ref|XP_007227357.1| hypothetical protein PRUPE_ppa000268mg [Prunus persica]
 gb|EMJ28556.1| hypothetical protein PRUPE_ppa000268mg [Prunus persica]
Length=1372

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -1

Query  126   PLSLEILSAKNCVSLEKIADISNLKRLEVLRIGKCKSLVELP  1
             P SLE L A NC SLE I+DISNL+ L +L +  C+ +V++P
Sbjct  1129  PPSLEELDAANCTSLESISDISNLENLAMLNLTSCEKVVDIP  1170



>ref|XP_007157556.1| hypothetical protein PHAVU_002G079200g [Phaseolus vulgaris]
 gb|ESW29550.1| hypothetical protein PHAVU_002G079200g [Phaseolus vulgaris]
Length=1374

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -1

Query  126   PLSLEILSAKNCVSLEKIADISNLKRLEVLRIGKCKSLVELP  1
             P SLE+L+ +NC +L+ I DISNL+RLE   +  C+ +V++P
Sbjct  1135  PSSLEVLNLENCAALQYIEDISNLERLEEFNLTNCEKVVDVP  1176



>gb|AET03054.2| disease resistance protein (TIR-NBS-LRR class), putative [Medicago 
truncatula]
Length=1360

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -1

Query  126   PLSLEILSAKNCVSLEKIADISNLKRLEVLRIGKCKSLVELP  1
             P SL +L+A NC +LE I D+SNL+ LE L++  CK L+++P
Sbjct  1060  PSSLIMLNADNCYALETIHDMSNLESLEELKLTNCKKLIDIP  1101



>ref|XP_003628578.1| Leucine-rich repeat-containing protein [Medicago truncatula]
Length=1210

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -1

Query  126  PLSLEILSAKNCVSLEKIADISNLKRLEVLRIGKCKSLVELP  1
            P SL +L+A NC +LE I D+SNL+ LE L++  CK L+++P
Sbjct  910  PSSLIMLNADNCYALETIHDMSNLESLEELKLTNCKKLIDIP  951



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 515174157784