BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1247_g1_i1 len=833 path=[811:0-226 1038:227-832]

Length=833
                                                                      Score     E

ref|XP_009768885.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    175   1e-47   
ref|XP_009768886.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    174   1e-47   
ref|XP_009586572.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    174   2e-47   
ref|XP_009586574.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    174   3e-47   
ref|XP_010325920.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    169   2e-45   
ref|XP_010325918.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    169   2e-45   
ref|XP_006341248.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    169   2e-45   
ref|XP_004167581.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    163   6e-43   
ref|XP_011019902.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5     160   1e-42   
ref|XP_009374729.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5     162   1e-42   
ref|XP_011077930.1|  PREDICTED: LOW QUALITY PROTEIN: cell divisio...    165   3e-42   
gb|ACA35280.1|  abscisic acid insensitive                               162   9e-42   Cucumis sativus [cucumbers]
ref|XP_009366660.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    159   9e-42   
ref|XP_002528738.1|  DNA binding protein, putative                      157   2e-41   Ricinus communis
ref|XP_002308147.1|  ABA insensitive 5 family protein                   156   4e-41   Populus trichocarpa [western balsam poplar]
ref|XP_011094355.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5     155   1e-40   
ref|XP_008386997.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    156   1e-40   
ref|XP_008386994.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    156   2e-40   
ref|XP_010101577.1|  Protein ABSCISIC ACID-INSENSITIVE 5                155   2e-40   
ref|XP_006594214.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    155   4e-40   
ref|XP_004149224.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    154   5e-40   
emb|CAN71955.1|  hypothetical protein VITISV_009883                     154   5e-40   Vitis vinifera
ref|XP_004305345.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    154   5e-40   
ref|XP_010654080.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5     154   6e-40   
ref|XP_003541461.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    154   1e-39   
ref|XP_006481876.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    155   1e-39   
ref|XP_010049460.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    152   4e-39   
gb|KDO61128.1|  hypothetical protein CISIN_1g043882mg                   152   5e-39   
ref|XP_006430223.1|  hypothetical protein CICLE_v10013385mg             152   5e-39   
gb|KDP42738.1|  hypothetical protein JCGZ_23678                         151   6e-39   
gb|KCW89189.1|  hypothetical protein EUGRSUZ_A01499                     150   6e-39   
ref|XP_010049452.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    151   7e-39   
gb|KHN13511.1|  Protein ABSCISIC ACID-INSENSITIVE 5                     150   2e-38   
gb|KHG26140.1|  abscisic acid-insensitive 5 -like protein               149   3e-38   
ref|XP_007027726.1|  Basic-leucine zipper transcription factor fa...    148   4e-38   
ref|XP_007027724.1|  Basic-leucine zipper transcription factor fa...    149   4e-38   
ref|XP_007027725.1|  Basic-leucine zipper transcription factor fa...    148   4e-38   
ref|XP_007027722.1|  Basic-leucine zipper transcription factor fa...    149   4e-38   
ref|XP_010271676.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    147   3e-37   
ref|XP_006589850.1|  PREDICTED: cell division protein FtsZ homolo...    150   4e-37   
ref|XP_010271672.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    146   7e-37   
emb|CBI30287.3|  unnamed protein product                                142   6e-36   
ref|XP_007145326.1|  hypothetical protein PHAVU_007G229600g             142   1e-35   
gb|AFO63293.1|  bZIP14                                                  143   1e-35   
ref|XP_007203311.1|  hypothetical protein PRUPE_ppa019833mg             142   1e-35   
ref|XP_010244710.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    142   3e-35   
gb|KHG21602.1|  abscisic acid-insensitive 5 -like protein               141   3e-35   
emb|CDP15406.1|  unnamed protein product                                141   4e-35   
ref|XP_010683741.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    141   5e-35   
ref|XP_007162892.1|  hypothetical protein PHAVU_001G189400g             139   1e-34   
gb|EYU38630.1|  hypothetical protein MIMGU_mgv1a006763mg                139   3e-34   
ref|XP_008241247.1|  PREDICTED: LOW QUALITY PROTEIN: protein ABSC...    137   1e-33   
gb|ADL62859.1|  abscisic acid insensitive                               137   1e-33   
ref|XP_010554860.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5     135   5e-33   
ref|XP_010509494.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5     135   6e-33   
ref|XP_003553595.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    133   1e-32   
emb|CDX75056.1|  BnaA05g08020D                                          134   1e-32   
gb|AGG35953.1|  ABA insensitive PP2C protein 5                          134   2e-32   
ref|XP_006296104.1|  hypothetical protein CARUB_v10025255mg             132   5e-32   
gb|EPS62571.1|  hypothetical protein M569_12220                         127   5e-31   
emb|CDY43738.1|  BnaAnng07530D                                          129   5e-31   
ref|XP_009141571.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    129   5e-31   
ref|XP_006410797.1|  hypothetical protein EUTSA_v10016668mg             129   1e-30   
ref|XP_010516839.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    128   2e-30   
ref|NP_565840.1|  protein abscisic acid-insensitive 5                   128   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881435.1|  hypothetical protein ARALYDRAFT_321332             127   3e-30   
emb|CDX84141.1|  BnaC04g09030D                                          127   3e-30   
gb|EYU35478.1|  hypothetical protein MIMGU_mgv1a023701mg                127   3e-30   
ref|XP_010505159.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    126   1e-29   
ref|XP_009143603.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5     124   6e-29   
gb|KHN02230.1|  Protein ABSCISIC ACID-INSENSITIVE 5                     122   6e-29   
ref|XP_004494169.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    121   4e-28   
ref|XP_004494170.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    119   2e-27   
ref|XP_003625810.1|  Abscisic acid insensitive                          117   2e-26   
gb|AFZ45968.1|  ABA insensitve 5-like protein                           116   3e-26   
gb|AGZ05627.1|  abscisic acid-insensitive 5                             114   1e-25   
ref|XP_006836037.1|  hypothetical protein AMTR_s00114p00031980          114   2e-25   
ref|XP_008804818.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    112   7e-25   
dbj|BAF36444.1|  bZip type transcription factor TaABI5                  108   9e-24   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010907998.1|  PREDICTED: LOW QUALITY PROTEIN: protein ABSC...    108   1e-23   
emb|CDM80221.1|  unnamed protein product                                107   3e-23   
emb|CDM81873.1|  unnamed protein product                                106   5e-23   
emb|CDM81865.1|  unnamed protein product                                105   8e-23   
gb|AAM75355.1|AF519804_1  ABA response element binding factor           105   1e-22   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009411951.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    104   2e-22   
ref|XP_010907582.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    104   2e-22   
gb|ABH05131.1|  ABA responsive element binding factor 1                 103   4e-22   Hordeum vulgare subsp. vulgare [barley]
dbj|BAK03778.1|  predicted protein                                      103   5e-22   
dbj|BAF61106.1|  bZip type transcription factor TmABI5                  103   6e-22   Triticum monococcum [einkorn wheat]
ref|XP_010046725.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...    103   6e-22   
emb|CDM81868.1|  unnamed protein product                                102   1e-21   
gb|ADM88570.1|  ABA-binding protein 1                                   102   2e-21   
ref|XP_008778650.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...    101   3e-21   
gb|AAK39132.1|AF369792_1  bZIP transcription factor 6                   101   4e-21   Phaseolus vulgaris [French bean]
ref|XP_007136688.1|  hypothetical protein PHAVU_009G065500g             101   4e-21   
emb|CDM80228.1|  unnamed protein product                                100   5e-21   
gb|AGV54705.1|  bZIP transcription factor 6                             100   6e-21   
ref|XP_007015839.1|  Basic-leucine zipper transcription factor fa...  99.8    1e-20   
ref|XP_003523938.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  99.8    1e-20   
gb|EMS53578.1|  Protein ABSCISIC ACID-INSENSITIVE 5                   99.4    2e-20   
gb|EMS52135.1|  Protein ABSCISIC ACID-INSENSITIVE 5                   99.0    2e-20   
gb|AGY78337.1|  hypothetical protein                                  98.6    3e-20   
ref|XP_004970655.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...  98.6    3e-20   
ref|XP_002965670.1|  hypothetical protein SELMODRAFT_227594           98.2    3e-20   
gb|KHG05813.1|  abscisic acid-insensitive 5-like protein 1            98.2    3e-20   
ref|XP_002971668.1|  hypothetical protein SELMODRAFT_451399           98.2    3e-20   
gb|AAM75354.1|AF519803_1  ABA response element binding factor         97.8    4e-20   Triticum aestivum [Canadian hard winter wheat]
ref|XP_001753547.1|  predicted protein                                92.8    4e-20   
ref|XP_002456667.1|  hypothetical protein SORBIDRAFT_03g040510        97.8    5e-20   Sorghum bicolor [broomcorn]
gb|KHG27504.1|  abscisic acid-insensitive 5-like protein 1            97.4    7e-20   
gb|AGK07305.1|  basic region/leucine zipper motif transcription f...  97.4    9e-20   
gb|EEC71844.1|  hypothetical protein OsI_04509                        95.9    2e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_006826228.1|  hypothetical protein AMTR_s00132p00065700        97.1    3e-19   
ref|XP_006645053.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...  95.5    3e-19   
emb|CAN60742.1|  hypothetical protein VITISV_030212                   94.7    4e-19   Vitis vinifera
ref|XP_002274428.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  94.7    4e-19   Vitis vinifera
ref|XP_002510209.1|  DNA binding protein, putative                    95.5    4e-19   Ricinus communis
ref|XP_008236589.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  95.1    6e-19   
gb|ACG48984.1|  ABA response element binding factor                   95.1    6e-19   Zea mays [maize]
ref|XP_003528292.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  95.1    6e-19   
ref|NP_001151515.1|  ABA response element binding factor              94.7    6e-19   Zea mays [maize]
gb|ABM90394.1|  bZIP-type transcription factor ABI5 isoform 1         94.4    8e-19   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB90559.1|  putative ABA response element binding factor         94.4    8e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010269668.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  94.0    9e-19   
gb|EEE55706.1|  hypothetical protein OsJ_04142                        94.0    9e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EMT21515.1|  Protein ABSCISIC ACID-INSENSITIVE 5                   94.0    1e-18   
gb|KDP38330.1|  hypothetical protein JCGZ_04255                       94.4    1e-18   
emb|CBI28329.3|  unnamed protein product                              93.2    1e-18   
ref|XP_009371918.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  93.2    2e-18   
ref|XP_010269648.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  94.0    2e-18   
ref|XP_010647747.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  93.6    2e-18   
ref|XP_002285116.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  94.0    2e-18   Vitis vinifera
emb|CAN64991.1|  hypothetical protein VITISV_001773                   93.6    2e-18   Vitis vinifera
ref|XP_010066019.1|  PREDICTED: bZIP transcription factor TRAB1       93.6    2e-18   
gb|EPS73887.1|  hypothetical protein M569_00870                       89.0    3e-18   
gb|AAG13054.1|AC011807_13  Unknown protein                            92.4    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004294799.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  93.2    3e-18   
ref|XP_004501563.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  92.4    4e-18   
ref|NP_001185183.1|  abscisic acid-insensitive 5-like protein 4       92.4    4e-18   
gb|EMT09757.1|  Protein ABSCISIC ACID-INSENSITIVE 5                   92.0    5e-18   
ref|NP_564551.1|  abscisic acid-insensitive 5-like protein 4          92.0    5e-18   Arabidopsis thaliana [mouse-ear cress]
gb|KHN32879.1|  ABSCISIC ACID-INSENSITIVE 5-like protein 1            90.9    8e-18   
ref|XP_009406636.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  91.3    8e-18   
ref|XP_004501562.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  92.0    8e-18   
ref|XP_003541970.2|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  90.9    8e-18   
ref|XP_008383939.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  90.9    1e-17   
gb|ABG90380.1|  bZIP transcription factor                             91.7    1e-17   Caragana korshinskii
ref|XP_009631698.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  91.3    1e-17   
ref|XP_009631699.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  91.3    1e-17   
ref|XP_009791697.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  91.3    1e-17   
ref|XP_010263531.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  91.3    1e-17   
ref|XP_010263534.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  91.3    1e-17   
ref|XP_009406635.1|  PREDICTED: bZIP transcription factor TRAB1-l...  90.9    2e-17   
ref|XP_004293073.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...  90.5    2e-17   
ref|XP_010500522.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  90.5    2e-17   
ref|XP_009364307.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  90.1    2e-17   
ref|XP_010112189.1|  ABSCISIC ACID-INSENSITIVE 5-like protein 5       90.9    2e-17   
emb|CDY17109.1|  BnaC06g00420D                                        89.4    2e-17   
ref|XP_010538116.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  90.5    3e-17   
ref|XP_004230778.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  90.1    3e-17   
dbj|BAN15747.1|  ABA responsive element binding factor                90.1    3e-17   
ref|XP_006305034.1|  hypothetical protein CARUB_v10009399mg           89.7    4e-17   
ref|XP_006354875.1|  PREDICTED: ABRE binding factor isoform X1        90.5    4e-17   
ref|XP_009598935.1|  PREDICTED: bZIP transcription factor TRAB1-like  90.1    4e-17   
gb|KHG05529.1|  abscisic acid-insensitive 5-like protein 4            90.1    4e-17   
ref|XP_010461819.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  89.7    4e-17   
ref|NP_001274925.1|  ABRE binding factor                              90.1    4e-17   
ref|XP_010461821.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  89.4    4e-17   
dbj|BAB61098.1|  phi-2                                                90.1    4e-17   Nicotiana tabacum [American tobacco]
dbj|BAB02453.1|  abscisic acid responsive elements-binding factor     89.7    5e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KDP42271.1|  hypothetical protein JCGZ_01595                       90.1    5e-17   
gb|AGG39700.1|  bZIP transcription factor bZIP8                       89.7    5e-17   
ref|XP_002964990.1|  hypothetical protein SELMODRAFT_266892           89.4    6e-17   
ref|XP_006592764.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  88.2    6e-17   
ref|XP_010089831.1|  ABSCISIC ACID-INSENSITIVE 5-like protein 1       88.6    7e-17   
ref|NP_001189934.1|  ABRE binding factor 4                            89.4    7e-17   
ref|XP_002518757.1|  DNA binding protein, putative                    89.4    7e-17   Ricinus communis
gb|AHA43414.1|  abscisic acid-insensitive 5-like protein              89.0    7e-17   
ref|XP_006393221.1|  hypothetical protein EUTSA_v10012271mg           88.6    7e-17   
ref|NP_566629.1|  ABRE binding factor 4                               89.4    7e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KHG23315.1|  abscisic acid-insensitive 5-like protein 5            89.0    7e-17   
emb|CDY51041.1|  BnaA06g03040D                                        87.8    8e-17   
ref|XP_011074426.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  89.4    8e-17   
ref|XP_003596807.1|  Abscisic acid insensitive                        87.8    1e-16   
ref|NP_001154626.1|  ABRE binding factor 4                            89.0    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007017213.1|  Abscisic acid responsive elements-binding fa...  89.0    1e-16   
ref|XP_008220234.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  87.8    1e-16   
ref|XP_002977062.1|  hypothetical protein SELMODRAFT_443424           89.0    1e-16   
ref|XP_009147888.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  87.8    1e-16   
ref|XP_011083868.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  88.6    1e-16   
ref|XP_009793574.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  88.2    2e-16   
gb|KHG14558.1|  abscisic acid-insensitive 5-like protein 4            87.8    2e-16   
ref|XP_007042439.1|  Abscisic acid responsive element-binding fac...  88.2    2e-16   
emb|CDY63041.1|  BnaCnng41320D                                        87.4    2e-16   
ref|XP_008220233.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  88.2    2e-16   
ref|XP_007222748.1|  hypothetical protein PRUPE_ppa006503mg           87.8    2e-16   
ref|XP_010479442.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  87.8    2e-16   
ref|NP_001290004.1|  ABSCISIC ACID-INSENSITIVE 5-like protein 5       88.6    2e-16   
ref|XP_008228533.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  87.4    2e-16   
ref|XP_011017194.1|  PREDICTED: bZIP transcription factor TRAB1-like  88.2    2e-16   
ref|NP_191244.1|  ABA-responsive element binding protein 3            86.3    2e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AAK19601.1|AF334208_1  bZIP protein DPBF3                          86.3    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010479441.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  87.4    2e-16   
ref|XP_002883170.1|  hypothetical protein ARALYDRAFT_479444           87.8    2e-16   
ref|XP_008365140.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  85.9    3e-16   
ref|XP_008378041.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  87.0    3e-16   
ref|XP_003564107.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  86.3    3e-16   
ref|XP_006487113.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  87.8    3e-16   
ref|XP_006406516.1|  hypothetical protein EUTSA_v10020772mg           87.8    3e-16   
ref|XP_006487112.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  87.8    3e-16   
gb|AGG35955.1|  ABA-responsive element binding factor 1               86.7    3e-16   
ref|XP_008378039.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  87.0    4e-16   
gb|KHG25900.1|  abscisic acid-insensitive 5-like protein 5            87.0    4e-16   
ref|XP_008378040.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  87.0    4e-16   
ref|XP_010664065.1|  PREDICTED: ripening-related bZIP protein-lik...  86.7    4e-16   
ref|NP_001268150.1|  ripening-related bZIP protein-like               87.4    4e-16   
gb|EPS63836.1|  hypothetical protein M569_10951                       85.9    4e-16   
ref|XP_010525459.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  85.1    4e-16   
ref|XP_010548013.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  87.0    4e-16   
ref|XP_002302435.1|  bZIP transcription factor 6 family protein       87.0    5e-16   Populus trichocarpa [western balsam poplar]
ref|XP_009346256.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  87.0    5e-16   
ref|XP_009592272.1|  PREDICTED: bZIP transcription factor TRAB1-like  87.0    5e-16   
ref|XP_009774081.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  86.7    5e-16   
gb|AHD24943.1|  ABRE binding factor                                   87.0    5e-16   
ref|XP_007199909.1|  hypothetical protein PRUPE_ppa006752mg           86.3    6e-16   
ref|NP_001234596.1|  AREB-like protein                                86.7    6e-16   
ref|XP_010525458.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  84.7    6e-16   
ref|XP_010554752.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  85.1    6e-16   
ref|NP_001149951.1|  bZIP transcription factor family protein         85.5    6e-16   Zea mays [maize]
ref|XP_007199908.1|  hypothetical protein PRUPE_ppa006752mg           85.9    6e-16   
gb|ADM53098.1|  ABA responsive element binding factor                 86.7    7e-16   
ref|XP_009359667.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  85.9    7e-16   
ref|XP_010525455.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  84.7    7e-16   
ref|XP_003603049.1|  ABSCISIC ACID-INSENSITIVE 5-like protein         86.3    8e-16   
ref|XP_010530772.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  86.3    9e-16   
gb|EYU37667.1|  hypothetical protein MIMGU_mgv1a007484mg              85.9    9e-16   
ref|XP_009359648.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  85.9    1e-15   
ref|XP_008794151.1|  PREDICTED: LOW QUALITY PROTEIN: bZIP transcr...  85.9    1e-15   
ref|XP_010535682.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  84.7    1e-15   
gb|KDO59711.1|  hypothetical protein CISIN_1g013197mg                 85.9    1e-15   
ref|XP_006423009.1|  hypothetical protein CICLE_v10028435mg           85.9    1e-15   
ref|XP_009403361.1|  PREDICTED: bZIP transcription factor TRAB1       85.1    1e-15   
ref|XP_008454957.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  85.5    1e-15   
ref|XP_006297700.1|  hypothetical protein CARUB_v10013729mg           85.5    1e-15   
ref|XP_006297699.1|  hypothetical protein CARUB_v10013729mg           85.5    1e-15   
gb|KHN27651.1|  ABSCISIC ACID-INSENSITIVE 5-like protein 1            86.3    1e-15   
ref|XP_006423008.1|  hypothetical protein CICLE_v10028435mg           85.5    1e-15   
ref|XP_008797273.1|  PREDICTED: bZIP transcription factor TRAB1 i...  85.1    2e-15   
ref|NP_849777.1|  abscisic acid responsive elements-binding factor 2  85.1    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006423013.1|  hypothetical protein CICLE_v10028435mg           85.5    2e-15   
ref|XP_006423012.1|  hypothetical protein CICLE_v10028435mg           85.1    2e-15   
ref|XP_010507592.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  85.1    2e-15   
ref|XP_010507609.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  85.1    2e-15   
ref|XP_002523794.1|  conserved hypothetical protein                   84.3    2e-15   Ricinus communis
ref|NP_001185157.1|  abscisic acid responsive elements-binding fa...  85.1    2e-15   
ref|XP_009123529.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  84.3    2e-15   
gb|ABF29696.1|  abscisic acid responsive element-binding protein 2    84.7    2e-15   Populus suaveolens [Mongolian poplar]
ref|XP_009123528.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  84.7    2e-15   
gb|AFN84600.1|  abscisic acid responsive elements-binding factor 1    84.7    2e-15   
ref|XP_010943075.1|  PREDICTED: bZIP transcription factor TRAB1 i...  84.7    2e-15   
gb|KDO59713.1|  hypothetical protein CISIN_1g013197mg                 85.1    2e-15   
ref|XP_006434755.1|  hypothetical protein CICLE_v10001159mg           84.7    2e-15   
gb|AAC49759.1|  Dc3 promoter-binding factor-1                         84.3    2e-15   Helianthus annuus
ref|XP_004487500.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  83.6    2e-15   
ref|XP_010939413.1|  PREDICTED: bZIP transcription factor TRAB1 i...  84.3    2e-15   
ref|XP_009795221.1|  PREDICTED: bZIP transcription factor TRAB1-like  85.1    2e-15   
ref|XP_002970746.1|  hypothetical protein SELMODRAFT_94516            83.2    2e-15   
ref|NP_973981.2|  abscisic acid responsive elements-binding factor 2  84.7    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002969410.1|  hypothetical protein SELMODRAFT_91900            83.2    2e-15   
ref|XP_009399710.1|  PREDICTED: bZIP transcription factor TRAB1-like  84.7    3e-15   
gb|AIS25790.1|  ABA responsive element binding factor 1               84.0    3e-15   
ref|XP_002454604.1|  hypothetical protein SORBIDRAFT_04g034190        84.0    3e-15   Sorghum bicolor [broomcorn]
ref|XP_009123533.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  83.6    3e-15   
gb|AFW85358.1|  putative bZIP transcription factor superfamily pr...  84.0    3e-15   
ref|XP_008659130.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  84.0    3e-15   
gb|AFP33247.1|  ABA responsive element binding factor 1               83.6    3e-15   
ref|XP_008454956.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  84.7    3e-15   
gb|AFP33245.1|  ABA responsive element binding factor 1               83.6    3e-15   
gb|EYU36305.1|  hypothetical protein MIMGU_mgv1a007419mg              84.3    3e-15   
gb|EAZ00118.1|  hypothetical protein OsI_22122                        84.0    3e-15   
ref|XP_006434756.1|  hypothetical protein CICLE_v10001159mg           84.7    3e-15   
ref|XP_006473315.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  84.3    4e-15   
ref|XP_011088250.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  84.3    4e-15   
ref|XP_006292966.1|  hypothetical protein CARUB_v10019243mg           83.2    4e-15   
ref|XP_010943073.1|  PREDICTED: bZIP transcription factor TRAB1 i...  84.0    4e-15   
dbj|BAJ94534.1|  predicted protein                                    83.2    4e-15   
ref|XP_002891529.1|  abscisic acid responsive element-binding fac...  84.0    4e-15   
ref|XP_008797272.1|  PREDICTED: bZIP transcription factor TRAB1 i...  84.3    4e-15   
emb|CDY65560.1|  BnaA10g28780D                                        82.8    4e-15   
ref|XP_004136974.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  84.0    4e-15   
ref|XP_006346411.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  84.0    4e-15   
ref|XP_010939411.1|  PREDICTED: bZIP transcription factor TRAB1 i...  84.0    4e-15   
ref|XP_006374927.1|  bZIP transcription factor 6 family protein       84.0    4e-15   
ref|XP_007156508.1|  hypothetical protein PHAVU_003G291800g           84.0    4e-15   
ref|XP_010461496.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  84.0    5e-15   
ref|XP_010427524.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  82.4    5e-15   
ref|XP_007156509.1|  hypothetical protein PHAVU_003G291800g           84.0    5e-15   
ref|XP_006346410.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  84.0    5e-15   
ref|XP_010427522.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  82.4    5e-15   
ref|XP_011014474.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  83.6    5e-15   
ref|XP_009135624.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  83.2    5e-15   
emb|CDX82302.1|  BnaA03g35190D                                        83.2    6e-15   
ref|XP_011029850.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  83.6    6e-15   
gb|AFN84601.1|  abscisic acid responsive elements-binding factor 2    83.6    6e-15   
ref|XP_009419106.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  83.6    6e-15   
ref|XP_006473314.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  83.6    7e-15   
ref|XP_011005982.1|  PREDICTED: bZIP transcription factor TRAB1-like  83.6    7e-15   
ref|XP_006393640.1|  hypothetical protein EUTSA_v10011493mg           83.2    8e-15   
ref|XP_004291101.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  83.6    8e-15   
ref|XP_004149281.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  82.0    9e-15   
ref|XP_009620201.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  82.8    9e-15   
ref|XP_006402943.1|  hypothetical protein EUTSA_v10006121mg           81.6    1e-14   
gb|KGN46957.1|  hypothetical protein Csa_6G152920                     82.0    1e-14   
ref|XP_008373133.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  83.2    1e-14   
ref|XP_002313119.1|  hypothetical protein POPTR_0009s10400g           82.8    1e-14   
ref|XP_010500203.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  82.8    1e-14   
ref|XP_006290403.1|  hypothetical protein CARUB_v10018770mg           80.9    1e-14   
ref|XP_006583882.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  82.8    1e-14   
ref|XP_011000551.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  82.8    1e-14   
emb|CAB88528.1|  bZIP transcription factor-like protein               81.3    1e-14   
ref|XP_006393641.1|  hypothetical protein EUTSA_v10011493mg           82.8    1e-14   
ref|XP_008458573.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  81.6    1e-14   
ref|XP_006307554.1|  hypothetical protein CARUB_v10009177mg           82.4    2e-14   
ref|XP_008458574.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  81.6    2e-14   
gb|AHA43415.1|  AREB-like protein                                     82.8    2e-14   
ref|XP_009112062.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  82.0    2e-14   
ref|XP_010251669.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  81.6    2e-14   
ref|XP_010107932.1|  ABSCISIC ACID-INSENSITIVE 5-like protein 6       82.8    2e-14   
gb|AAK19600.1|AF334207_1  bZIP protein DPBF2                          81.3    2e-14   
ref|NP_566870.1|  basic leucine zipper transcription factor 67        81.3    2e-14   
ref|XP_004954029.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  81.6    2e-14   
ref|XP_010514780.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  81.3    2e-14   
gb|EEE57861.1|  hypothetical protein OsJ_08504                        81.3    2e-14   
emb|CCE88374.1|  abscisic acid responsive elements-binding factor 2   81.6    2e-14   
gb|AFN84603.1|  abscisic acid responsive elements-binding factor 4    82.0    2e-14   
gb|AEF32521.1|  stress-related bZIP transcription factor              81.3    2e-14   
gb|AEQ28124.1|  ABA response element binding protein 1                82.4    2e-14   
gb|AEQ28125.1|  ABA response element binding protein 1                82.0    2e-14   
ref|NP_001048225.1|  Os02g0766700                                     81.3    2e-14   
ref|XP_004954028.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  81.3    3e-14   
ref|XP_010479095.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  82.0    3e-14   
gb|EAY87653.1|  hypothetical protein OsI_09065                        81.3    3e-14   
gb|AGG35957.1|  ABA-responsive element binding factor 4               81.6    3e-14   
ref|XP_008458572.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  81.6    3e-14   
ref|XP_002894019.1|  hypothetical protein ARALYDRAFT_473850           81.6    3e-14   
emb|CDX92320.1|  BnaA05g20870D                                        80.9    3e-14   
ref|XP_010503099.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  80.5    4e-14   
ref|XP_002878113.1|  aba-responsive element binding protein 3         79.7    4e-14   
ref|XP_010425862.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  80.5    4e-14   
gb|KFK34922.1|  hypothetical protein AALP_AA5G211100                  79.7    4e-14   
ref|XP_009760513.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  81.3    4e-14   
ref|XP_006384406.1|  hypothetical protein POPTR_0004s14790g           81.3    4e-14   
ref|XP_006384405.1|  abscisic acid responsive element-binding fac...  81.3    4e-14   
ref|XP_010504594.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  79.7    4e-14   
ref|NP_001057118.1|  Os06g0211200                                     80.1    5e-14   
ref|XP_010516284.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  79.7    5e-14   
ref|XP_009145804.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  80.9    5e-14   
ref|XP_009145807.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  80.9    5e-14   
ref|XP_010427526.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  79.3    6e-14   
ref|XP_003596811.1|  BZIP transcription factor                        79.3    6e-14   
gb|AFA37978.1|  ABA responsive element-binding protein                80.9    6e-14   
ref|XP_008456645.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  79.3    6e-14   
emb|CDP17649.1|  unnamed protein product                              79.7    6e-14   
ref|XP_011032989.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  79.3    8e-14   
ref|XP_006402942.1|  hypothetical protein EUTSA_v10006121mg           79.0    8e-14   
gb|EEE65317.1|  hypothetical protein OsJ_20562                        79.7    8e-14   
ref|XP_002877341.1|  hypothetical protein ARALYDRAFT_484862           79.3    9e-14   
gb|AHN16206.1|  ABF4-2.1                                              80.1    9e-14   
emb|CDX99242.1|  BnaC05g33570D                                        79.7    9e-14   
gb|AGG39691.1|  bZIP transcription factor bZIP7                       79.3    9e-14   
ref|XP_008456642.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  79.0    9e-14   
ref|XP_004140925.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  79.0    9e-14   
ref|XP_008444613.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  80.1    1e-13   
gb|ACJ85325.1|  unknown                                               75.9    1e-13   
ref|XP_002512212.1|  DNA binding protein, putative                    79.0    1e-13   
gb|AEO45563.1|  abscisic acid-responsive protein bZIP2                80.1    1e-13   
ref|NP_001281045.1|  ABSCISIC ACID-INSENSITIVE 5-like protein 2       79.0    1e-13   
ref|XP_002436690.1|  hypothetical protein SORBIDRAFT_10g007090        79.0    1e-13   
gb|KEH38980.1|  ABA response element-binding factor                   78.2    1e-13   
ref|XP_008346168.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  78.6    1e-13   
gb|AIL01834.1|  bZIP transcription factor B                           79.0    1e-13   
ref|XP_004173635.1|  PREDICTED: LOW QUALITY PROTEIN: ABSCISIC ACI...  79.3    1e-13   
ref|XP_007218688.1|  hypothetical protein PRUPE_ppa008716mg           78.2    2e-13   
gb|AED99724.1|  stress-related bZIP transcription factor              79.0    2e-13   
ref|XP_006836156.1|  hypothetical protein AMTR_s00101p00038080        78.2    2e-13   
gb|KHG26680.1|  abscisic acid-insensitive 5-like protein 2            78.2    2e-13   
ref|XP_004306446.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  78.2    2e-13   
ref|XP_004142865.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  79.0    2e-13   
ref|XP_009759591.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  78.2    2e-13   
gb|ACU18290.1|  unknown                                               75.9    2e-13   
ref|XP_009402117.1|  PREDICTED: bZIP transcription factor TRAB1-like  79.0    2e-13   
gb|KHN37514.1|  ABSCISIC ACID-INSENSITIVE 5-like protein 4            79.3    2e-13   
gb|AIL01832.1|  bZIP transcription factor                             78.6    2e-13   
gb|AIL01831.1|  bZIP transcription factor                             78.6    2e-13   
emb|CDY18575.1|  BnaA01g26200D                                        78.2    2e-13   
gb|AIL01830.1|  bZIP transcription factor                             78.6    3e-13   
ref|XP_009614068.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  77.8    3e-13   
gb|AAQ14866.1|AF329450_1  transcription factor BZIP1                  79.0    3e-13   
ref|XP_010236077.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  78.2    3e-13   
ref|XP_010247608.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  78.2    3e-13   
ref|XP_010111311.1|  ABSCISIC ACID-INSENSITIVE 5-like protein 2       78.2    3e-13   
ref|XP_003570566.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  77.8    3e-13   
ref|XP_004964902.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  77.4    4e-13   
ref|XP_006487955.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  77.8    4e-13   
gb|KDP31558.1|  hypothetical protein JCGZ_15213                       77.8    5e-13   
ref|XP_010028468.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  78.2    5e-13   
gb|AIL01835.1|  bZIP transcription factor D                           77.4    5e-13   
ref|XP_011069985.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  77.0    5e-13   
ref|XP_010550827.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  77.0    5e-13   
ref|XP_010247606.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  77.8    5e-13   
ref|XP_003578228.1|  PREDICTED: bZIP transcription factor TRAB1-like  77.4    6e-13   
ref|XP_010516285.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  76.6    6e-13   
ref|XP_009394025.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...  78.2    6e-13   
tpg|DAA48436.1|  TPA: putative bZIP transcription factor superfam...  77.0    6e-13   
gb|KCW55207.1|  hypothetical protein EUGRSUZ_I01145                   77.8    7e-13   
ref|XP_010432479.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  77.8    7e-13   
ref|XP_010061749.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  77.4    8e-13   
gb|KDO53800.1|  hypothetical protein CISIN_1g0211461mg                75.9    8e-13   
gb|KCW68739.1|  hypothetical protein EUGRSUZ_F02337                   77.4    8e-13   
ref|XP_006378844.1|  enhanced em level family protein                 76.3    9e-13   
ref|XP_003523905.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  76.3    1e-12   
gb|KHG23193.1|  abscisic acid-insensitive 5-like protein 6            77.0    1e-12   
ref|XP_006585689.1|  PREDICTED: transcription factor bZIP70 isofo...  75.9    1e-12   
ref|XP_008231208.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  75.1    1e-12   
ref|XP_008231752.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  76.3    1e-12   
gb|KDO57343.1|  hypothetical protein CISIN_1g0206972mg                75.9    1e-12   
ref|XP_010487864.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  77.0    1e-12   
ref|XP_010487862.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  77.0    1e-12   
ref|XP_010031349.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  75.9    1e-12   
gb|AFW73613.1|  putative bZIP transcription factor superfamily pr...  76.6    1e-12   
ref|XP_006411374.1|  hypothetical protein EUTSA_v10017050mg           75.5    1e-12   
ref|NP_001238690.1|  stress-related protein 1                         77.0    1e-12   
ref|XP_011046491.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  75.9    1e-12   
ref|XP_004511153.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  75.9    1e-12   
ref|XP_008664522.1|  PREDICTED: bZIP transcription factor TRAB1-like  77.0    1e-12   
ref|XP_010487865.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  76.6    2e-12   
ref|XP_006404457.1|  hypothetical protein EUTSA_v10011159mg           75.9    2e-12   
ref|XP_003531785.1|  PREDICTED: transcription factor bZIP70 isofo...  75.5    2e-12   
ref|XP_003607958.1|  ABSCISIC ACID-INSENSITIVE 5-like protein         76.3    2e-12   
ref|XP_006471287.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  75.5    2e-12   
gb|KDO53799.1|  hypothetical protein CISIN_1g0211461mg                75.1    2e-12   
ref|XP_008375407.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  75.5    2e-12   
tpg|DAA48435.1|  TPA: putative bZIP transcription factor superfam...  76.3    2e-12   
ref|NP_001150949.1|  bZIP transcription factor ABI5                   75.9    2e-12   
ref|XP_009355071.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  75.1    2e-12   
emb|CDX69020.1|  BnaC01g04330D                                        75.5    2e-12   
ref|XP_011079132.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  75.5    2e-12   
ref|XP_006432530.1|  hypothetical protein CICLE_v10001893mg           75.1    2e-12   
ref|XP_009355069.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  75.1    2e-12   
emb|CDY68227.1|  BnaAnng26550D                                        75.5    2e-12   
ref|NP_001280812.1|  ABSCISIC ACID-INSENSITIVE 5-like protein 2       75.1    2e-12   
ref|XP_008231203.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  74.3    3e-12   
emb|CAA19882.1|  bZIP transcription factor-like protein               75.9    3e-12   
gb|AGG35961.1|  ABA-responsive element binding factor AREB3.1         74.3    3e-12   
ref|XP_009116385.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  74.3    3e-12   
ref|XP_007206656.1|  hypothetical protein PRUPE_ppa022266mg           73.6    3e-12   
ref|XP_006656761.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  73.6    3e-12   
gb|AFW80594.1|  hypothetical protein ZEAMMB73_047779                  76.3    3e-12   
ref|XP_003628123.1|  BZIP transcription factor                        74.7    3e-12   
ref|XP_004973666.1|  PREDICTED: bZIP transcription factor TRAB1-like  75.1    3e-12   
ref|XP_003555418.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  73.9    3e-12   
gb|KDO57342.1|  hypothetical protein CISIN_1g0206972mg                74.7    3e-12   
ref|NP_001031785.2|  abscisic acid responsive elements-binding fa...  75.5    4e-12   
ref|XP_006430421.1|  hypothetical protein CICLE_v10012205mg           74.7    4e-12   
ref|XP_006481971.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  74.7    4e-12   
ref|NP_567949.1|  abscisic acid responsive elements-binding factor 3  75.5    4e-12   
ref|XP_006481970.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  74.7    4e-12   
emb|CDO97182.1|  unnamed protein product                              75.5    4e-12   
ref|XP_009116383.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  73.9    4e-12   
ref|XP_010552516.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  75.1    4e-12   
ref|XP_009339238.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  74.3    5e-12   
ref|XP_010552514.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  75.1    5e-12   
ref|XP_009339232.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  74.3    5e-12   
ref|XP_009339236.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  74.3    5e-12   
gb|EEC84700.1|  hypothetical protein OsI_31640                        74.7    5e-12   
ref|XP_010552515.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  75.1    5e-12   
ref|NP_001063362.1|  Os09g0456200                                     74.7    5e-12   
gb|KDP27076.1|  hypothetical protein JCGZ_22073                       73.9    6e-12   
ref|XP_006412286.1|  hypothetical protein EUTSA_v10025203mg           74.7    7e-12   
gb|AIA57942.1|  basic leucine zipper protein                          73.9    7e-12   
gb|AGG35962.1|  ABA-responsive element binding factor AREB3.2         73.2    7e-12   
ref|XP_006339213.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  73.9    7e-12   
ref|XP_003543823.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  72.8    8e-12   
ref|XP_006649073.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  72.4    8e-12   
gb|EEE68849.1|  hypothetical protein OsJ_27642                        74.7    8e-12   
ref|XP_009621966.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  74.3    9e-12   
ref|XP_006593615.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  72.8    9e-12   
ref|XP_007150073.1|  hypothetical protein PHAVU_005G124200g           73.2    9e-12   
ref|XP_006424253.1|  hypothetical protein CICLE_v10028635mg           73.9    9e-12   
ref|XP_010466063.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  74.3    1e-11   
ref|XP_010466068.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  74.3    1e-11   
ref|XP_009150299.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  73.6    1e-11   
ref|XP_011046490.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  73.2    1e-11   
ref|XP_010466066.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  73.9    1e-11   
emb|CDY10500.1|  BnaCnng04010D                                        73.2    1e-11   
ref|XP_011000917.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  72.8    2e-11   
ref|XP_002265747.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  72.8    2e-11   
gb|EAZ44981.1|  hypothetical protein OsJ_29624                        73.6    2e-11   
dbj|BAG16725.1|  basic region leucine zipper protein                  73.2    2e-11   
gb|ACU20685.1|  unknown                                               70.9    2e-11   



>ref|XP_009768885.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 isoform X1 [Nicotiana 
sylvestris]
Length=433

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 113/165 (68%), Gaps = 16/165 (10%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            M VPESE  SQGEVESPLQ    Q      N    SLGRQ+SIYSLTLDEFQHTLCESGK
Sbjct  1    MGVPESEVVSQGEVESPLQPDQNQ----HKNHQFPSLGRQASIYSLTLDEFQHTLCESGK  56

Query  470  NFGSMNMDEFLNSIWTAEENQ-----------ahahaqphphphvgaaaESNAVTHNFML  616
            NFGSMNMDEFLNSIWTAEENQ            HAH   H H    +  E+ +  H F +
Sbjct  57   NFGSMNMDEFLNSIWTAEENQAHAHAHAHAAHGHAHEHSHAHSQAPSTGEATSTPH-FAI  115

Query  617  GQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
            GQ++V  EK IA+Q SL RQ SLTLP PLCRKTVDEVW+EIHK+ 
Sbjct  116  GQSNVSMEKAIAKQPSLPRQGSLTLPEPLCRKTVDEVWSEIHKSQ  160



>ref|XP_009768886.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 isoform X2 [Nicotiana 
sylvestris]
Length=422

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 113/165 (68%), Gaps = 16/165 (10%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            M VPESE  SQGEVESPLQ    Q      N    SLGRQ+SIYSLTLDEFQHTLCESGK
Sbjct  1    MGVPESEVVSQGEVESPLQPDQNQ----HKNHQFPSLGRQASIYSLTLDEFQHTLCESGK  56

Query  470  NFGSMNMDEFLNSIWTAEENQ-----------ahahaqphphphvgaaaESNAVTHNFML  616
            NFGSMNMDEFLNSIWTAEENQ            HAH   H H    +  E+ +  H F +
Sbjct  57   NFGSMNMDEFLNSIWTAEENQAHAHAHAHAAHGHAHEHSHAHSQAPSTGEATSTPH-FAI  115

Query  617  GQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
            GQ++V  EK IA+Q SL RQ SLTLP PLCRKTVDEVW+EIHK+ 
Sbjct  116  GQSNVSMEKAIAKQPSLPRQGSLTLPEPLCRKTVDEVWSEIHKSQ  160



>ref|XP_009586572.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009586573.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 isoform X1 [Nicotiana 
tomentosiformis]
Length=435

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 114/165 (69%), Gaps = 16/165 (10%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            M VPESE  SQGEVESPLQ    Q      N    SLGRQ+SIYSLTLDEFQHTLCESGK
Sbjct  1    MGVPESEMVSQGEVESPLQPDQNQH----KNHQFPSLGRQASIYSLTLDEFQHTLCESGK  56

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphph-----------phvgaaaESNAVTHNFML  616
            NFGSMNMDEFLNSIWTAEENQAHAHA  H                 +  E+ +  H F +
Sbjct  57   NFGSMNMDEFLNSIWTAEENQAHAHAHAHAAHAHSNAHSHGHSQAPSTGEATSTPH-FAI  115

Query  617  GQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
            GQ++V  EK IA+Q SL RQ SLTLP PLCRKTVDEVW+EIHK+ 
Sbjct  116  GQSNVSMEKAIAKQPSLPRQGSLTLPEPLCRKTVDEVWSEIHKSQ  160



>ref|XP_009586574.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 isoform X2 [Nicotiana 
tomentosiformis]
Length=422

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 114/165 (69%), Gaps = 16/165 (10%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            M VPESE  SQGEVESPLQ    Q      N    SLGRQ+SIYSLTLDEFQHTLCESGK
Sbjct  1    MGVPESEMVSQGEVESPLQPDQNQ----HKNHQFPSLGRQASIYSLTLDEFQHTLCESGK  56

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphph-----------phvgaaaESNAVTHNFML  616
            NFGSMNMDEFLNSIWTAEENQAHAHA  H                 +  E+ +  H F +
Sbjct  57   NFGSMNMDEFLNSIWTAEENQAHAHAHAHAAHAHSNAHSHGHSQAPSTGEATSTPH-FAI  115

Query  617  GQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
            GQ++V  EK IA+Q SL RQ SLTLP PLCRKTVDEVW+EIHK+ 
Sbjct  116  GQSNVSMEKAIAKQPSLPRQGSLTLPEPLCRKTVDEVWSEIHKSQ  160



>ref|XP_010325920.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 isoform X2 [Solanum 
lycopersicum]
Length=415

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 110/154 (71%), Gaps = 7/154 (5%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            M VPESE  SQ EV+SPLQ    Q    KNN    SLGRQ+SIYSLTLDEFQHT+CESGK
Sbjct  1    MGVPESEMVSQSEVQSPLQQDQNQH---KNNP-FPSLGRQASIYSLTLDEFQHTVCESGK  56

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAEKGI  649
            NFGSMNMDEFLNSIWTAEENQAHAHAQPH        A S      F LGQ +V  EK I
Sbjct  57   NFGSMNMDEFLNSIWTAEENQAHAHAQPHCQAASTGEATS---APRFALGQGNVSLEKAI  113

Query  650  ARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
              Q SL RQ SLTLP PLC KTVDEVW+EIHKT 
Sbjct  114  VEQPSLPRQGSLTLPAPLCSKTVDEVWSEIHKTQ  147



>ref|XP_010325918.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010325919.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 isoform X1 [Solanum 
lycopersicum]
Length=426

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 110/154 (71%), Gaps = 7/154 (5%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            M VPESE  SQ EV+SPLQ    Q    KNN    SLGRQ+SIYSLTLDEFQHT+CESGK
Sbjct  1    MGVPESEMVSQSEVQSPLQQDQNQH---KNNP-FPSLGRQASIYSLTLDEFQHTVCESGK  56

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAEKGI  649
            NFGSMNMDEFLNSIWTAEENQAHAHAQPH        A S      F LGQ +V  EK I
Sbjct  57   NFGSMNMDEFLNSIWTAEENQAHAHAQPHCQAASTGEATS---APRFALGQGNVSLEKAI  113

Query  650  ARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
              Q SL RQ SLTLP PLC KTVDEVW+EIHKT 
Sbjct  114  VEQPSLPRQGSLTLPAPLCSKTVDEVWSEIHKTQ  147



>ref|XP_006341248.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Solanum 
tuberosum]
Length=427

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 113/155 (73%), Gaps = 5/155 (3%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            M VPESE  SQ EV+SPLQ    Q    KNN    SLGRQ+SIYSLTLDEFQHT+CESGK
Sbjct  1    MGVPESEMVSQSEVQSPLQPDQNQN---KNNP-FPSLGRQASIYSLTLDEFQHTVCESGK  56

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTH-NFMLGQASVPAEKG  646
            NFGSMNMDEFLNSIWTAEENQAHAHA  H  PH  AA+   A +   F LGQ +V  +K 
Sbjct  57   NFGSMNMDEFLNSIWTAEENQAHAHAHVHAQPHCQAASTGEATSAPRFALGQGNVSLQKA  116

Query  647  IARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
            I  Q SL RQ SLTLP PLC KTVDEVW+EIHKT 
Sbjct  117  IVEQPSLPRQGSLTLPAPLCSKTVDEVWSEIHKTQ  151



>ref|XP_004167581.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Cucumis 
sativus]
 gb|KGN59126.1| hypothetical protein Csa_3G776860 [Cucumis sativus]
Length=443

 Score =   163 bits (412),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 116/164 (71%), Gaps = 8/164 (5%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MVV ES+  S  EVESPLQ + + +Q +      SSLGRQSSIYSLTLDEFQHTLCESGK
Sbjct  1    MVVKESDMISHDEVESPLQSEQQLKQHR-----FSSLGRQSSIYSLTLDEFQHTLCESGK  55

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAEKGI  649
            NFGSMNMDEFL SIWTAEENQA   +Q         AA SNA  H  + G AS+  ++ I
Sbjct  56   NFGSMNMDEFLTSIWTAEENQAINASQSGTAVVAAVAALSNAQGHLPVSGGASM-EKRNI  114

Query  650  ARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTHqqqqqqHNSD  781
             +Q SL RQ SLTLP PLCRKTVDEVW+EIHK+   Q + HNS+
Sbjct  115  EKQASLPRQGSLTLPAPLCRKTVDEVWSEIHKSQ--QGRNHNSN  156



>ref|XP_011019902.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 [Populus euphratica]
Length=374

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 105/152 (69%), Gaps = 10/152 (7%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MVV ESE  SQGEVESPLQ   +Q +    N   SSLGRQSSIYSLTLDEFQHTLCESG+
Sbjct  1    MVVTESELNSQGEVESPLQPDQQQTK----NHAFSSLGRQSSIYSLTLDEFQHTLCESGR  56

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAEKGI  649
            NFGSMNMDEFL SIWTAEENQA A +      +      + +   N   G       +G+
Sbjct  57   NFGSMNMDEFLASIWTAEENQATATSANMSGNNQIIIDNNASQVLNDAYGH------RGV  110

Query  650  ARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
            ++Q SL+RQ SL+LP PLCRKTVDEVW EIHK
Sbjct  111  SQQPSLSRQESLSLPAPLCRKTVDEVWFEIHK  142



>ref|XP_009374729.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5, partial [Pyrus 
x bretschneideri]
Length=452

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 104/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            M V ESE  SQG+V+SPL    +     + N+ LSSLGRQSSIYSLTLDEFQHTLCESGK
Sbjct  14   MGVSESEIISQGKVDSPLLSDEQ-----EKNQFLSSLGRQSSIYSLTLDEFQHTLCESGK  68

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAEKGI  649
            NFGSMNMDEFL SIWTAEENQ       +          +N +  +  L  AS  AEK I
Sbjct  69   NFGSMNMDEFLTSIWTAEENQ---AINSNHTNTSTTNNNTNNIEVHMPLADAS--AEKRI  123

Query  650  ARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
            A Q SL RQ SLTLP PLCRKTVDEVW+EIHK
Sbjct  124  ATQPSLPRQGSLTLPAPLCRKTVDEVWSEIHK  155



>ref|XP_011077930.1| PREDICTED: LOW QUALITY PROTEIN: cell division protein FtsZ homolog 
2-2, chloroplastic-like [Sesamum indicum]
Length=892

 Score =   165 bits (417),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 111/168 (66%), Gaps = 17/168 (10%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MV  +S+  SQG+ E P+Q   +       N  L SLGRQSSIYSLTLDEFQHTLCESGK
Sbjct  1    MVATDSDIVSQGDAEPPVQSSQQHT----KNLILQSLGRQSSIYSLTLDEFQHTLCESGK  56

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAEKGI  649
            NFGSMNMDEFLNSIWTAEENQ         H     A  +NA   +F + + +   +KGI
Sbjct  57   NFGSMNMDEFLNSIWTAEENQ--------AHATSATATSNNANAVHFPVQETNTKTDKGI  108

Query  650  ARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTHqqqqqqHNSDGKFQ  793
            A+Q SL RQ SL++P PLCRKTVDEVW+EIHK       QHN+D + Q
Sbjct  109  AKQPSLPRQGSLSIPEPLCRKTVDEVWSEIHKKQ-----QHNNDTQGQ  151



>gb|ACA35280.1| abscisic acid insensitive [Cucumis sativus]
Length=747

 Score =   162 bits (410),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 116/164 (71%), Gaps = 8/164 (5%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MVV ES+  S  EVESPLQ + + +Q +      SSLGRQSSIYSLTLDEFQHTLCESGK
Sbjct  1    MVVKESDMISHDEVESPLQSEQQLKQHR-----FSSLGRQSSIYSLTLDEFQHTLCESGK  55

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAEKGI  649
            NFGSMNMDEFL SIWTAEENQA   +Q         AA SNA  H  + G AS+  ++ I
Sbjct  56   NFGSMNMDEFLTSIWTAEENQAINASQSGTAVVAAVAALSNAQGHLPVSGGASM-EKRNI  114

Query  650  ARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTHqqqqqqHNSD  781
             +Q SL RQ SLTLP PLCRKTVDEVW+EIHK+   Q + HNS+
Sbjct  115  EKQASLPRQGSLTLPAPLCRKTVDEVWSEIHKSQ--QGRNHNSN  156



>ref|XP_009366660.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Pyrus x 
bretschneideri]
Length=413

 Score =   159 bits (402),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 101/152 (66%), Gaps = 8/152 (5%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            M V ESE  S GEV+SPL    +       N   SSLGRQSSIYSLTLDEFQHTLCESGK
Sbjct  1    MGVSESEINSHGEVDSPLLSDQQA-----KNHLFSSLGRQSSIYSLTLDEFQHTLCESGK  55

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAEKGI  649
            NFGSMNMDEFL SIWTAEENQA      +          +N   H   L +AS  AEK I
Sbjct  56   NFGSMNMDEFLTSIWTAEENQAINSNLTNTTTTANNNNMNNIEVH-MPLAEAS--AEKRI  112

Query  650  ARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
            A Q SL RQ SLTLP PLCRKTVDEVW+EIH+
Sbjct  113  AMQPSLPRQGSLTLPEPLCRKTVDEVWSEIHR  144



>ref|XP_002528738.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF33650.1| DNA binding protein, putative [Ricinus communis]
Length=403

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 101/152 (66%), Gaps = 8/152 (5%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MVV ESE  SQ EV+SPLQ   +       N   SSLGRQSSIYSLTLDEFQHTLCESGK
Sbjct  1    MVVTESEVISQNEVDSPLQPDQQ-----PRNLPFSSLGRQSSIYSLTLDEFQHTLCESGK  55

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAEKGI  649
            NFGSMNMDEFL SIW AEENQA A +      +      +   + N  L   S    + I
Sbjct  56   NFGSMNMDEFLTSIWNAEENQATATSSSDRINNTNNNRGNRLSSFNDHL---SANDHRAI  112

Query  650  ARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
            +RQ SL RQ SLTLP PLCRKTVDEVW+EIH+
Sbjct  113  SRQPSLPRQGSLTLPAPLCRKTVDEVWSEIHR  144



>ref|XP_002308147.1| ABA insensitive 5 family protein [Populus trichocarpa]
 gb|EEE91670.1| ABA insensitive 5 family protein [Populus trichocarpa]
Length=373

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 104/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MVV ESE  SQGEVESPLQ   +Q +    N   SSLGRQSSIYSLTLDEFQHTLCESG+
Sbjct  1    MVVTESELNSQGEVESPLQPDQQQTK----NHAFSSLGRQSSIYSLTLDEFQHTLCESGR  56

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAEKGI  649
            NFGSMNMDEFL SIWTAEENQA A +      +      + +   N   G       +G 
Sbjct  57   NFGSMNMDEFLASIWTAEENQATATSANMSGNNQIIIDNNASQVLNDPYGH------RGA  110

Query  650  ARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
            ++Q SL RQ SL+LP PLCRKTV+EVW+EIHK
Sbjct  111  SQQPSLPRQESLSLPAPLCRKTVEEVWSEIHK  142



>ref|XP_011094355.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 [Sesamum indicum]
 ref|XP_011094356.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 [Sesamum indicum]
Length=401

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 104/162 (64%), Gaps = 16/162 (10%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MV  +SE  SQG VES    Q E  QQQ  N+ + SLGRQSSIYSLTLDEFQHTLCESGK
Sbjct  1    MVANDSEIISQGNVES----QLESSQQQPENQTVQSLGRQSSIYSLTLDEFQHTLCESGK  56

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAEKGI  649
            NFGSMNMDEFLNSIWTAEE+Q                 ++ A  +  +  Q     +KGI
Sbjct  57   NFGSMNMDEFLNSIWTAEESQ------------AQGHTQATAAANTVLALQEGNTTDKGI  104

Query  650  ARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTHqqqqqqHN  775
            ++Q SL RQ S  +P PLCRKTV+EVW+EIHKT       H+
Sbjct  105  SKQPSLPRQGSFNIPEPLCRKTVEEVWSEIHKTQPHNGGSHS  146



>ref|XP_008386997.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 isoform X2 [Malus 
domestica]
Length=433

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 102/152 (67%), Gaps = 10/152 (7%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            M V ESE  SQG+V+SPL    +     + N+  SSLGRQSSIYSLTLDEFQHTLCESGK
Sbjct  25   MGVSESEIISQGKVDSPLLSDQQ-----EKNQLFSSLGRQSSIYSLTLDEFQHTLCESGK  79

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAEKGI  649
            NFGSMNMDEFL SIWTAEENQ       +          +N +  +  L  AS  A+K I
Sbjct  80   NFGSMNMDEFLTSIWTAEENQ---AINSNHTNTSTTNNNTNNIEVHMPLADAS--ADKHI  134

Query  650  ARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
            A Q SL RQ SLTLP PLCRKTVDEVW+ IHK
Sbjct  135  ATQPSLPRQGSLTLPAPLCRKTVDEVWSVIHK  166



>ref|XP_008386994.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 isoform X1 [Malus 
domestica]
 ref|XP_008386996.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 isoform X1 [Malus 
domestica]
 ref|XP_008366599.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Malus domestica]
 ref|XP_008366600.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Malus domestica]
Length=461

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 102/152 (67%), Gaps = 10/152 (7%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            M V ESE  SQG+V+SPL    +     + N+  SSLGRQSSIYSLTLDEFQHTLCESGK
Sbjct  25   MGVSESEIISQGKVDSPLLSDQQ-----EKNQLFSSLGRQSSIYSLTLDEFQHTLCESGK  79

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAEKGI  649
            NFGSMNMDEFL SIWTAEENQ       +          +N +  +  L  AS  A+K I
Sbjct  80   NFGSMNMDEFLTSIWTAEENQ---AINSNHTNTSTTNNNTNNIEVHMPLADAS--ADKHI  134

Query  650  ARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
            A Q SL RQ SLTLP PLCRKTVDEVW+ IHK
Sbjct  135  ATQPSLPRQGSLTLPAPLCRKTVDEVWSVIHK  166



>ref|XP_010101577.1| Protein ABSCISIC ACID-INSENSITIVE 5 [Morus notabilis]
 gb|EXB88716.1| Protein ABSCISIC ACID-INSENSITIVE 5 [Morus notabilis]
Length=426

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 101/165 (61%), Gaps = 29/165 (18%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MVVPE E   Q                QKNN   SSLGRQSSIYSLTLDEFQH LCESGK
Sbjct  1    MVVPEPEIDQQ----------------QKNNHPFSSLGRQSSIYSLTLDEFQHALCESGK  44

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaa----------ESNAVTHNFM-L  616
            NFGSMNMDEFL SIWTAEENQA      + + +               + N   HN + L
Sbjct  45   NFGSMNMDEFLTSIWTAEENQAINSNSQNNNNNNNNNQHNSNNGNNYLDGNTGDHNNLSL  104

Query  617  GQASVPAEKG--IARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
             + +  AEKG  IARQ SL RQ SLTLP PLCRKTVDEVW+EIH+
Sbjct  105  REVTAAAEKGGVIARQASLTRQGSLTLPAPLCRKTVDEVWSEIHR  149



>ref|XP_006594214.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like isoform X2 
[Glycine max]
Length=494

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 115/168 (68%), Gaps = 15/168 (9%)
 Frame = +2

Query  248  LVSPRTPERRELAKMVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSS-IYS  424
            +++ +  ER +   MVVPESE  SQ EVESPLQL+ +QQQ    N+  SSLGRQSS IYS
Sbjct  28   VLNKKEKERNQEEHMVVPESEMNSQNEVESPLQLEQQQQQHNNKNDPFSSLGRQSSSIYS  87

Query  425  LTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTH  604
            LTLDEFQHTL ESGKNFGSMNMDEFL+SIW+AEENQ   +     + +        A+T 
Sbjct  88   LTLDEFQHTLWESGKNFGSMNMDEFLSSIWSAEENQ-VLNNSVSNNNNNMNNLSLEALT-  145

Query  605  NFMLGQASVPAEKGIARQQ-SLARQASLTLPPPLCRKTVDEVWAEIHK  745
                       EKG+ R+Q SL RQ SLTLP PLCRKTVDEVW+EIHK
Sbjct  146  -----------EKGVIRKQPSLPRQGSLTLPAPLCRKTVDEVWSEIHK  182



>ref|XP_004149224.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Cucumis 
sativus]
Length=436

 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 97/131 (74%), Gaps = 3/131 (2%)
 Frame = +2

Query  389  LSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphph  568
             SSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFL SIWTAEENQA   +Q      
Sbjct  22   FSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLTSIWTAEENQAINASQSGTAVV  81

Query  569  vgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKT  748
               AA SNA  H  + G AS+  ++ I +Q SL RQ SLTLP PLCRKTVDEVW+EIHK+
Sbjct  82   AAVAALSNAQGHLPVSGGASM-EKRNIEKQASLPRQGSLTLPAPLCRKTVDEVWSEIHKS  140

Query  749  HqqqqqqHNSD  781
               Q + HNS+
Sbjct  141  Q--QGRNHNSN  149



>emb|CAN71955.1| hypothetical protein VITISV_009883 [Vitis vinifera]
Length=392

 Score =   154 bits (388),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 105/153 (69%), Gaps = 23/153 (15%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MV  ESE  SQ EVES       Q+ QQ  N G+ SLGRQSSIYSLTLDEFQHTLCE+GK
Sbjct  1    MVGSESETLSQSEVES-----GLQEDQQPKNHGMPSLGRQSSIYSLTLDEFQHTLCENGK  55

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFM-LGQASVPAEKG  646
            NFGSMNMDEFL S+WTAEENQA                  N ++++ M L + S+  EK 
Sbjct  56   NFGSMNMDEFLTSVWTAEENQATNF---------------NHISNSLMSLRETSM--EKP  98

Query  647  IARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
            IA+Q SLARQ SL+LP P C+KTVDEVW+EIHK
Sbjct  99   IAKQPSLARQGSLSLPAPFCQKTVDEVWSEIHK  131



>ref|XP_004305345.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Fragaria 
vesca subsp. vesca]
Length=437

 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 106/153 (69%), Gaps = 7/153 (5%)
 Frame = +2

Query  296  VPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGKNF  475
            V ESE  S    ESPLQ         KNN+  +SLGR+SSIYSLTLDEFQHTLCE+GKNF
Sbjct  4    VSESETMSHSREESPLQSDQHA----KNNQLFTSLGRESSIYSLTLDEFQHTLCENGKNF  59

Query  476  GSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQAS-VPAEKG--  646
            GSMNMDEFLNSIWTAEENQA      + + ++ A   +N  + N     +S V  EK   
Sbjct  60   GSMNMDEFLNSIWTAEENQAINSTHHNNNNNLNANHINNISSSNVQHHASSEVSTEKKGM  119

Query  647  IARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
            IARQ SLARQ SLTLP PLCRKTVDEVW+EIH+
Sbjct  120  IARQPSLARQGSLTLPAPLCRKTVDEVWSEIHR  152



>ref|XP_010654080.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 [Vitis vinifera]
Length=402

 Score =   154 bits (388),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 105/153 (69%), Gaps = 23/153 (15%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MV  ESE  SQ EVES       Q+ QQ  N G+ SLGRQSSIYSLTLDEFQHTLCE+GK
Sbjct  1    MVGSESETLSQSEVES-----GLQEDQQPKNHGMPSLGRQSSIYSLTLDEFQHTLCENGK  55

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFM-LGQASVPAEKG  646
            NFGSMNMDEFL SIWTAEENQA                  N ++++ M L + S+  EK 
Sbjct  56   NFGSMNMDEFLTSIWTAEENQATNF---------------NHISNSQMSLSETSM--EKP  98

Query  647  IARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
            IA+Q SLARQ SL+LP P C+KTVDEVW+EIHK
Sbjct  99   IAKQPSLARQGSLSLPAPFCQKTVDEVWSEIHK  131



>ref|XP_003541461.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like isoform X1 
[Glycine max]
Length=453

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 108/154 (70%), Gaps = 15/154 (10%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSS-IYSLTLDEFQHTLCESG  466
            MVVPESE  SQ EVESPLQL+ +QQQ    N+  SSLGRQSS IYSLTLDEFQHTL ESG
Sbjct  1    MVVPESEMNSQNEVESPLQLEQQQQQHNNKNDPFSSLGRQSSSIYSLTLDEFQHTLWESG  60

Query  467  KNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAEKG  646
            KNFGSMNMDEFL+SIW+AEENQ   +     + +        A+T            EKG
Sbjct  61   KNFGSMNMDEFLSSIWSAEENQ-VLNNSVSNNNNNMNNLSLEALT------------EKG  107

Query  647  IARQQ-SLARQASLTLPPPLCRKTVDEVWAEIHK  745
            + R+Q SL RQ SLTLP PLCRKTVDEVW+EIHK
Sbjct  108  VIRKQPSLPRQGSLTLPAPLCRKTVDEVWSEIHK  141



>ref|XP_006481876.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Citrus sinensis]
Length=537

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 105/159 (66%), Gaps = 13/159 (8%)
 Frame = +2

Query  287  KMVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESG  466
            KMV PE E  SQGEVES         +  ++ + L+ LGRQSSIYSLTLDEFQHTLCESG
Sbjct  44   KMVAPEPETLSQGEVES-------ALRADQHQKTLTLLGRQSSIYSLTLDEFQHTLCESG  96

Query  467  KNFGSMNMDEFLNSIWTAEENQahahaqphp----hphvgaaaESNAVTHNFMLGQASVP  634
            KNFGSMNMDEFL SIW AEENQA   +        +  +  A  +N    + ++ + +  
Sbjct  97   KNFGSMNMDEFLTSIWNAEENQAINSSTQDSNINGNNIINNAMSNNHTVQHLLVNETTTA  156

Query  635  --AEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
              A   I +Q SL+RQASLTLP PLCRKTV+EVW+EIH+
Sbjct  157  TTAHGSIVKQPSLSRQASLTLPAPLCRKTVEEVWSEIHR  195



>ref|XP_010049460.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 isoform X2 [Eucalyptus 
grandis]
Length=423

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 106/164 (65%), Gaps = 9/164 (5%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MVV ESE     EVES       Q  QQ  +   S+LGRQSSIYSLTLDEFQH LCESGK
Sbjct  1    MVVSESEIIRPEEVES-----QLQIDQQPKSHPFSTLGRQSSIYSLTLDEFQHALCESGK  55

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVT--HNFMLGQASVPAEK  643
            NFGSMNMDEFL SIW AEENQA   +  +   + G       V+      LG  S    K
Sbjct  56   NFGSMNMDEFLTSIWNAEENQAINTSGNNNITNNGTEITDQHVSLGDTSTLGDTST--SK  113

Query  644  GIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTHqqqqqqHN  775
            GIA+QQSL RQ SLTLP PLCRKTVDEVW+EIHK  Q Q+Q +N
Sbjct  114  GIAKQQSLPRQGSLTLPAPLCRKTVDEVWSEIHKGQQSQRQSNN  157



>gb|KDO61128.1| hypothetical protein CISIN_1g043882mg [Citrus sinensis]
Length=456

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 104/158 (66%), Gaps = 13/158 (8%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MV PE E  SQGEVES         +  ++ + L+ LGRQSSIYSLTLDEFQHTLCESGK
Sbjct  1    MVAPEPETLSQGEVES-------ALRADQHQKTLTLLGRQSSIYSLTLDEFQHTLCESGK  53

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphp----hphvgaaaESNAVTHNFMLGQ--ASV  631
            NFGSMNMDEFL SIW AEENQA   +        +  +  A  +N    +  + +  A+ 
Sbjct  54   NFGSMNMDEFLTSIWNAEENQAINSSTQDSNINANNVINNAMSNNHTVQHLPVNETTAAT  113

Query  632  PAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
             A   I +Q SL+RQASLTLP PLCRKTV+EVW+EIH+
Sbjct  114  TAHGSIVKQPSLSRQASLTLPAPLCRKTVEEVWSEIHR  151



>ref|XP_006430223.1| hypothetical protein CICLE_v10013385mg [Citrus clementina]
 gb|ESR43463.1| hypothetical protein CICLE_v10013385mg [Citrus clementina]
Length=462

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 104/158 (66%), Gaps = 13/158 (8%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MV PE E  SQGEVES         +  ++ + L+ LGRQSSIYSLTLDEFQHTLCESGK
Sbjct  1    MVAPEPETLSQGEVES-------ALRADQHQKTLTLLGRQSSIYSLTLDEFQHTLCESGK  53

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphp----hphvgaaaESNAVTHNFMLGQ--ASV  631
            NFGSMNMDEFL SIW AEENQA   +        +  +  A  +N    +  + +  A+ 
Sbjct  54   NFGSMNMDEFLTSIWNAEENQAINSSTQDSNINANNVINNAMSNNHTVQHLPVNETTAAT  113

Query  632  PAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
             A   I +Q SL+RQASLTLP PLCRKTV+EVW+EIH+
Sbjct  114  TAHGSIVKQPSLSRQASLTLPAPLCRKTVEEVWSEIHR  151



>gb|KDP42738.1| hypothetical protein JCGZ_23678 [Jatropha curcas]
Length=419

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 104/155 (67%), Gaps = 17/155 (11%)
 Frame = +2

Query  290  MVVPESEAASQGEVE-SPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESG  466
            MVV +SE  SQ EVE SPLQ   +       N  L+SLG QSSIYSLTLDEFQHTLCESG
Sbjct  1    MVVTDSEVLSQSEVEESPLQPDQQA----NKNHPLASLGTQSSIYSLTLDEFQHTLCESG  56

Query  467  KNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAEKG  646
            KNFGSMNMDEFL SIW AEENQA A +             +N     F+     V +++G
Sbjct  57   KNFGSMNMDEFLTSIWNAEENQATATSNNDHI--------NNKGNQVFI----DVGSDRG  104

Query  647  IARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
            I++Q SL RQ SL+LP PLCRKTV+EVW+EIH+ H
Sbjct  105  ISKQPSLPRQGSLSLPAPLCRKTVEEVWSEIHREH  139



>gb|KCW89189.1| hypothetical protein EUGRSUZ_A01499 [Eucalyptus grandis]
Length=383

 Score =   150 bits (380),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 106/164 (65%), Gaps = 9/164 (5%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MVV ESE     EVES       Q  QQ  +   S+LGRQSSIYSLTLDEFQH LCESGK
Sbjct  1    MVVSESEIIRPEEVES-----QLQIDQQPKSHPFSTLGRQSSIYSLTLDEFQHALCESGK  55

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVT--HNFMLGQASVPAEK  643
            NFGSMNMDEFL SIW AEENQA   +  +   + G       V+      LG  S    K
Sbjct  56   NFGSMNMDEFLTSIWNAEENQAINTSGNNNITNNGTEITDQHVSLGDTSTLGDTS--TSK  113

Query  644  GIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTHqqqqqqHN  775
            GIA+QQSL RQ SLTLP PLCRKTVDEVW+EIHK  Q Q+Q +N
Sbjct  114  GIAKQQSLPRQGSLTLPAPLCRKTVDEVWSEIHKGQQSQRQSNN  157



>ref|XP_010049452.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 isoform X1 [Eucalyptus 
grandis]
Length=429

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 106/164 (65%), Gaps = 9/164 (5%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MVV ESE     EVES       Q  QQ  +   S+LGRQSSIYSLTLDEFQH LCESGK
Sbjct  1    MVVSESEIIRPEEVES-----QLQIDQQPKSHPFSTLGRQSSIYSLTLDEFQHALCESGK  55

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVT--HNFMLGQASVPAEK  643
            NFGSMNMDEFL SIW AEENQA   +  +   + G       V+      LG  S    K
Sbjct  56   NFGSMNMDEFLTSIWNAEENQAINTSGNNNITNNGTEITDQHVSLGDTSTLGDTST--SK  113

Query  644  GIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTHqqqqqqHN  775
            GIA+QQSL RQ SLTLP PLCRKTVDEVW+EIHK  Q Q+Q +N
Sbjct  114  GIAKQQSLPRQGSLTLPAPLCRKTVDEVWSEIHKGQQSQRQSNN  157



>gb|KHN13511.1| Protein ABSCISIC ACID-INSENSITIVE 5 [Glycine soja]
Length=431

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 109/158 (69%), Gaps = 24/158 (15%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlq---lqaeqqqqqKNNEGLSSLGRQSS-IYSLTLDEFQHTLC  457
            MVVPES+  SQ EVESPLQ    Q +Q      N   SSLGRQSS IYSLTLDEFQHTL 
Sbjct  1    MVVPESQMNSQNEVESPLQLEEQQQQQNNNNNKNHPFSSLGRQSSSIYSLTLDEFQHTLW  60

Query  458  ESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVT-HNFMLGQASVP  634
            E+GKNFGSMNMDEFL+SIW+AEENQ                  +N+V+ HN +  +AS  
Sbjct  61   ENGKNFGSMNMDEFLSSIWSAEENQVL----------------NNSVSNHNNLSLEAST-  103

Query  635  AEKGIARQQ-SLARQASLTLPPPLCRKTVDEVWAEIHK  745
             EKG+ R++ SL RQ SLTLP PLCRKTVDEVW+EIHK
Sbjct  104  -EKGVIRKEPSLPRQGSLTLPAPLCRKTVDEVWSEIHK  140



>gb|KHG26140.1| abscisic acid-insensitive 5 -like protein [Gossypium arboreum]
Length=414

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 104/152 (68%), Gaps = 9/152 (6%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MVV ESE    GEVESPLQ   +Q    + N   S LGRQSSIYSLTLDEFQHTLC+ GK
Sbjct  1    MVVSESEI---GEVESPLQGANQQ----QKNHPFSELGRQSSIYSLTLDEFQHTLCDGGK  53

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAEKGI  649
            NFGSMNMDEFL SIW AEENQA      + +  + +A + ++   +    + S  + KGI
Sbjct  54   NFGSMNMDEFLTSIWNAEENQAINSNNNNTNHQINSANKQDSDQVHLSFNETS--SSKGI  111

Query  650  ARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
            A+Q SL RQ SLTLP PLCRKTVDEVW+EI +
Sbjct  112  AKQPSLPRQGSLTLPAPLCRKTVDEVWSEIQR  143



>ref|XP_007027726.1| Basic-leucine zipper transcription factor family protein, putative 
isoform 5 [Theobroma cacao]
 gb|EOY08228.1| Basic-leucine zipper transcription factor family protein, putative 
isoform 5 [Theobroma cacao]
Length=374

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 106/164 (65%), Gaps = 12/164 (7%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MV+ ESE    GEVES     + Q  QQ+ N   SSLGRQSSIYSLTLDEFQHT+CE GK
Sbjct  1    MVITESEI---GEVES-----SLQVDQQQKNHPFSSLGRQSSIYSLTLDEFQHTVCEDGK  52

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAEKGI  649
            NFGSMNMDEF+ SIW AEENQA      +   +      S+ V     L      +  GI
Sbjct  53   NFGSMNMDEFITSIWNAEENQAINSNIYNQQSNCANKQVSSYV----HLSLNETTSNNGI  108

Query  650  ARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTHqqqqqqHNSD  781
            A+Q SL RQ SLTLP PLCRKTVDEVW+E+HK  Q Q Q +NS+
Sbjct  109  AKQPSLPRQGSLTLPAPLCRKTVDEVWSEMHKGQQGQGQSNNSN  152



>ref|XP_007027724.1| Basic-leucine zipper transcription factor family protein, putative 
isoform 3 [Theobroma cacao]
 gb|EOY08226.1| Basic-leucine zipper transcription factor family protein, putative 
isoform 3 [Theobroma cacao]
Length=410

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 106/164 (65%), Gaps = 12/164 (7%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MV+ ESE    GEVES     + Q  QQ+ N   SSLGRQSSIYSLTLDEFQHT+CE GK
Sbjct  1    MVITESEI---GEVES-----SLQVDQQQKNHPFSSLGRQSSIYSLTLDEFQHTVCEDGK  52

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAEKGI  649
            NFGSMNMDEF+ SIW AEENQA      +   +      S+ V     L      +  GI
Sbjct  53   NFGSMNMDEFITSIWNAEENQAINSNIYNQQSNCANKQVSSYV----HLSLNETTSNNGI  108

Query  650  ARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTHqqqqqqHNSD  781
            A+Q SL RQ SLTLP PLCRKTVDEVW+E+HK  Q Q Q +NS+
Sbjct  109  AKQPSLPRQGSLTLPAPLCRKTVDEVWSEMHKGQQGQGQSNNSN  152



>ref|XP_007027725.1| Basic-leucine zipper transcription factor family protein, putative 
isoform 4 [Theobroma cacao]
 ref|XP_007027727.1| Basic-leucine zipper transcription factor family protein, putative 
isoform 4 [Theobroma cacao]
 gb|EOY08227.1| Basic-leucine zipper transcription factor family protein, putative 
isoform 4 [Theobroma cacao]
 gb|EOY08229.1| Basic-leucine zipper transcription factor family protein, putative 
isoform 4 [Theobroma cacao]
Length=383

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 106/164 (65%), Gaps = 12/164 (7%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MV+ ESE    GEVES     + Q  QQ+ N   SSLGRQSSIYSLTLDEFQHT+CE GK
Sbjct  1    MVITESEI---GEVES-----SLQVDQQQKNHPFSSLGRQSSIYSLTLDEFQHTVCEDGK  52

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAEKGI  649
            NFGSMNMDEF+ SIW AEENQA      +   +      S+ V     L      +  GI
Sbjct  53   NFGSMNMDEFITSIWNAEENQAINSNIYNQQSNCANKQVSSYV----HLSLNETTSNNGI  108

Query  650  ARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTHqqqqqqHNSD  781
            A+Q SL RQ SLTLP PLCRKTVDEVW+E+HK  Q Q Q +NS+
Sbjct  109  AKQPSLPRQGSLTLPAPLCRKTVDEVWSEMHKGQQGQGQSNNSN  152



>ref|XP_007027722.1| Basic-leucine zipper transcription factor family protein, putative 
isoform 1 [Theobroma cacao]
 ref|XP_007027723.1| Basic-leucine zipper transcription factor family protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY08224.1| Basic-leucine zipper transcription factor family protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY08225.1| Basic-leucine zipper transcription factor family protein, putative 
isoform 1 [Theobroma cacao]
Length=418

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 106/164 (65%), Gaps = 12/164 (7%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MV+ ESE    GEVES     + Q  QQ+ N   SSLGRQSSIYSLTLDEFQHT+CE GK
Sbjct  1    MVITESEI---GEVES-----SLQVDQQQKNHPFSSLGRQSSIYSLTLDEFQHTVCEDGK  52

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAEKGI  649
            NFGSMNMDEF+ SIW AEENQA      +   +      S+ V     L      +  GI
Sbjct  53   NFGSMNMDEFITSIWNAEENQAINSNIYNQQSNCANKQVSSYV----HLSLNETTSNNGI  108

Query  650  ARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTHqqqqqqHNSD  781
            A+Q SL RQ SLTLP PLCRKTVDEVW+E+HK  Q Q Q +NS+
Sbjct  109  AKQPSLPRQGSLTLPAPLCRKTVDEVWSEMHKGQQGQGQSNNSN  152



>ref|XP_010271676.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like isoform X2 
[Nelumbo nucifera]
 ref|XP_010271677.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like isoform X2 
[Nelumbo nucifera]
 ref|XP_010271678.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like isoform X2 
[Nelumbo nucifera]
Length=410

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 96/152 (63%), Gaps = 20/152 (13%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MVVPESEA ++GEVE+  +   E   +  +   LSSLGRQSSIYSLTLDEFQH LCE+GK
Sbjct  1    MVVPESEAHARGEVEATAEQPPEDASKTHS---LSSLGRQSSIYSLTLDEFQHALCENGK  57

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAEKGI  649
            NFGSMNMDEFLN+IWTAEENQA                  ++   N       V A K  
Sbjct  58   NFGSMNMDEFLNNIWTAEENQAI-----------------HSNNENSQTNPDEVRAGKLR  100

Query  650  ARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
              Q  L RQ SLTLP  LC KTVDEVWAEIHK
Sbjct  101  CNQPGLLRQGSLTLPAQLCHKTVDEVWAEIHK  132



>ref|XP_006589850.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
[Glycine max]
Length=939

 Score =   150 bits (379),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 109/158 (69%), Gaps = 24/158 (15%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlq---lqaeqqqqqKNNEGLSSLGRQSS-IYSLTLDEFQHTLC  457
            MVVPES+  SQ EVESPLQ    Q +Q      N   SSLGRQSS IYSLTLDEFQHTL 
Sbjct  1    MVVPESQMNSQNEVESPLQLEEQQQQQNNNNNKNHPFSSLGRQSSSIYSLTLDEFQHTLW  60

Query  458  ESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVT-HNFMLGQASVP  634
            E+GKNFGSMNMDEFL+SIW+AEENQ                  +N+V+ HN +  +AS  
Sbjct  61   ENGKNFGSMNMDEFLSSIWSAEENQVL----------------NNSVSNHNNLSLEAST-  103

Query  635  AEKGIARQQ-SLARQASLTLPPPLCRKTVDEVWAEIHK  745
             EKG+ R++ SL RQ SLTLP PLCRKTVDEVW+EIHK
Sbjct  104  -EKGVIRKEPSLPRQGSLTLPAPLCRKTVDEVWSEIHK  140



>ref|XP_010271672.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010271673.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010271675.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like isoform X1 
[Nelumbo nucifera]
Length=478

 Score =   146 bits (369),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 96/152 (63%), Gaps = 20/152 (13%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MVVPESEA ++GEVE+  +   E   +  +   LSSLGRQSSIYSLTLDEFQH LCE+GK
Sbjct  69   MVVPESEAHARGEVEATAEQPPEDASKTHS---LSSLGRQSSIYSLTLDEFQHALCENGK  125

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAEKGI  649
            NFGSMNMDEFLN+IWTAEENQA                  ++   N       V A K  
Sbjct  126  NFGSMNMDEFLNNIWTAEENQAI-----------------HSNNENSQTNPDEVRAGKLR  168

Query  650  ARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
              Q  L RQ SLTLP  LC KTVDEVWAEIHK
Sbjct  169  CNQPGLLRQGSLTLPAQLCHKTVDEVWAEIHK  200



>emb|CBI30287.3| unnamed protein product [Vitis vinifera]
Length=353

 Score =   142 bits (358),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 93/152 (61%), Gaps = 37/152 (24%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MV  ESE  SQ EVES       Q+ QQ  N G+ SLGRQSSIYSLTLDEFQHTLCE+GK
Sbjct  1    MVGSESETLSQSEVES-----GLQEDQQPKNHGMPSLGRQSSIYSLTLDEFQHTLCENGK  55

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAEKGI  649
            NFGSMNMDEFL SIWTAEENQA                       NF            I
Sbjct  56   NFGSMNMDEFLTSIWTAEENQAT----------------------NF----------NHI  83

Query  650  ARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
            +  Q LARQ SL+LP P C+KTVDEVW+EIHK
Sbjct  84   SNSQILARQGSLSLPAPFCQKTVDEVWSEIHK  115



>ref|XP_007145326.1| hypothetical protein PHAVU_007G229600g [Phaseolus vulgaris]
 gb|ESW17320.1| hypothetical protein PHAVU_007G229600g [Phaseolus vulgaris]
Length=421

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 103/154 (67%), Gaps = 21/154 (14%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MVV ES+  SQ EVESP++L+ +       N    SLGR++SIYSLTLDEFQHTL ESGK
Sbjct  1    MVVAESDMNSQNEVESPIELEQQHNM--NKNHPFPSLGREASIYSLTLDEFQHTLWESGK  58

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAEKGI  649
            NFGSMNMDEFL SIW AEE+Q                  +N   ++  L +AS  AEKG+
Sbjct  59   NFGSMNMDEFLTSIWCAEESQ----------------ILNNNNMNSLSLSEAS--AEKGL  100

Query  650  ARQQ-SLARQASLTLPPPLCRKTVDEVWAEIHKT  748
             R+Q SL RQ SLTLP PLCRKTVDEVW+EIHK 
Sbjct  101  IRKQPSLPRQGSLTLPAPLCRKTVDEVWSEIHKV  134



>gb|AFO63293.1| bZIP14 [Tamarix hispida]
Length=506

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 89/134 (66%), Gaps = 10/134 (7%)
 Frame = +2

Query  377  NNEGLSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqph  556
            NN   SSLGRQSSIYSLTLDEFQHTLC+ GKNFGSMNMDEFLNSIWTAEENQ   +    
Sbjct  45   NNYVFSSLGRQSSIYSLTLDEFQHTLCDGGKNFGSMNMDEFLNSIWTAEENQQALNVTST  104

Query  557  phphvgaaaE------SNAVT----HNFMLGQASVPAEKGIARQQSLARQASLTLPPPLC  706
             + +     +      +NAV     H+  L        +G+A Q SL RQ SLTLP PLC
Sbjct  105  NNNNNSTQQKEGNHNNTNAVGASNHHSQALTNFVGSNVRGLANQPSLGRQGSLTLPAPLC  164

Query  707  RKTVDEVWAEIHKT  748
            RKTVDEVW+EI ++
Sbjct  165  RKTVDEVWSEIQRS  178



>ref|XP_007203311.1| hypothetical protein PRUPE_ppa019833mg [Prunus persica]
 gb|EMJ04510.1| hypothetical protein PRUPE_ppa019833mg [Prunus persica]
Length=449

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 102/156 (65%), Gaps = 9/156 (6%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            M V ESE  S  EVESPLQ   +       N   +SLGRQSSIYSLTLDEFQHTLCE+GK
Sbjct  1    MGVSESEIISHDEVESPLQSDQQA-----TNHLFTSLGRQSSIYSLTLDEFQHTLCENGK  55

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTH----NFMLGQASVPA  637
            NFGSMNMDEFL SIWTAEENQA      + + +       N+  +    +  L +AS   
Sbjct  56   NFGSMNMDEFLTSIWTAEENQAINSNHTNINNNHNHHNHHNSNMNNIDAHMPLAEASEEK  115

Query  638  EKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
               IA+Q SL RQ SLTLP PLCRKTVDEVW+EIHK
Sbjct  116  AAAIAKQPSLPRQGSLTLPGPLCRKTVDEVWSEIHK  151



>ref|XP_010244710.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Nelumbo 
nucifera]
Length=432

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 98/155 (63%), Gaps = 26/155 (17%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MVVPESEA  + EVE      A+  ++      LSSLGRQSSIYSLTLDEFQHTLCE+GK
Sbjct  1    MVVPESEARGRVEVE---ITTAKPPEEVPKTHSLSSLGRQSSIYSLTLDEFQHTLCENGK  57

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQAS---VPAE  640
            +FGSMNMDEFLN+IWTAEENQ                    A+  N    Q++     A 
Sbjct  58   SFGSMNMDEFLNNIWTAEENQ--------------------AIGCNNERLQSNPDEAAAN  97

Query  641  KGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
            +  + Q S+ RQ S+TLP PLC KTVDEVWAEIHK
Sbjct  98   RANSGQPSVLRQGSITLPAPLCHKTVDEVWAEIHK  132



>gb|KHG21602.1| abscisic acid-insensitive 5 -like protein [Gossypium arboreum]
Length=422

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 100/154 (65%), Gaps = 13/154 (8%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MVV  SE    GEVES      ++  QQ  N  LS+ GRQSSIYSLTLDEFQHTLC  GK
Sbjct  1    MVVENSEV---GEVES----TLKEVDQQLKNHPLSAFGRQSSIYSLTLDEFQHTLC--GK  51

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAEKGI  649
            NFGSMNMDEFL SIW AEENQA      + H +      SN V  N  L + +  + KG+
Sbjct  52   NFGSMNMDEFLTSIWNAEENQATNSINNNHHNNGVNEQVSNHV--NLSLNETA--SSKGV  107

Query  650  ARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
            ARQ SL RQ SL+ P PLCRKTVDEVW+EI+K  
Sbjct  108  ARQSSLPRQGSLSFPAPLCRKTVDEVWSEINKVQ  141



>emb|CDP15406.1| unnamed protein product [Coffea canephora]
Length=435

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 97/155 (63%), Gaps = 4/155 (3%)
 Frame = +2

Query  290  MVVPESEAASQG-EVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESG  466
            MVV +SE  S G +VESP     +QQ     N   +SLG QSSIYSLTLDEFQ+T+CESG
Sbjct  1    MVVTDSEMTSHGSKVESPPLQSEQQQ---PKNHAFASLGSQSSIYSLTLDEFQNTVCESG  57

Query  467  KNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAEKG  646
            KNFGSMNMDEFLNSIWTAEENQA   +                ++       A +  +  
Sbjct  58   KNFGSMNMDEFLNSIWTAEENQAQVTSAAMVVAAANTNPNPKQLSQLGEANDAPIDQKGI  117

Query  647  IARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
            I +Q SL RQ SLTLP PL RKTV+EVW EIH++ 
Sbjct  118  ITKQLSLPRQGSLTLPGPLSRKTVEEVWTEIHQSQ  152



>ref|XP_010683741.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=451

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 83/126 (66%), Gaps = 9/126 (7%)
 Frame = +2

Query  377  NNEGLSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqph  556
            NN    SLGRQSSIYSLTLDEFQHTL ESGKNFGSMNMDEFLNSIWTAEENQ        
Sbjct  48   NNYVFPSLGRQSSIYSLTLDEFQHTLSESGKNFGSMNMDEFLNSIWTAEENQ--------  99

Query  557  phphvgaaaESNAVTHNFMLGQASVPAEKG-IARQQSLARQASLTLPPPLCRKTVDEVWA  733
             H        SN    +  +  A+     G I +Q SL RQ SLTLP PLCRKTVDEVW 
Sbjct  100  AHHSHHHENPSNIQLPSVNIAAAATSRGAGAITKQPSLPRQGSLTLPAPLCRKTVDEVWT  159

Query  734  EIHKTH  751
            EI ++H
Sbjct  160  EIQRSH  165



>ref|XP_007162892.1| hypothetical protein PHAVU_001G189400g [Phaseolus vulgaris]
 gb|ESW34886.1| hypothetical protein PHAVU_001G189400g [Phaseolus vulgaris]
Length=393

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 101/168 (60%), Gaps = 27/168 (16%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGL---SSLGRQSSIYSLTLDEFQHTLCE  460
            MVV E E  SQGEVES       QQ   KN+      SS+GRQ+SIYSLTLDEFQHTLCE
Sbjct  1    MVVEEGEMNSQGEVES-----RFQQDANKNHHSQFSPSSMGRQTSIYSLTLDEFQHTLCE  55

Query  461  SGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAE  640
            +GKNFGSMNMDEFL+SIW AEENQA                     + N  L Q     E
Sbjct  56   TGKNFGSMNMDEFLSSIWNAEENQAI------------------ITSSNLPLSQPFTDKE  97

Query  641  KGIARQQ-SLARQASLTLPPPLCRKTVDEVWAEIHKTHqqqqqqHNSD  781
                R+Q SL RQ SL+LP PLCRKTVDEVW++I K  Q     +N++
Sbjct  98   ATRLRKQPSLPRQPSLSLPAPLCRKTVDEVWSQIQKEQQNNNVLNNTE  145



>gb|EYU38630.1| hypothetical protein MIMGU_mgv1a006763mg [Erythranthe guttata]
Length=432

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 85/131 (65%), Gaps = 8/131 (6%)
 Frame = +2

Query  389  LSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphph  568
            L +LGRQSSIYSLTLDEFQ+TLCESGKNFGSMNMDEFLNSIWTAEENQA   + P     
Sbjct  33   LETLGRQSSIYSLTLDEFQNTLCESGKNFGSMNMDEFLNSIWTAEENQAQGQSHPTAAGG  92

Query  569  vgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKT  748
             G     NA     +           +++Q SL RQ SLT+P PLCRKTVDEVW+EIH  
Sbjct  93   SGGTTSVNATQFPQI--------NNTLSKQPSLPRQGSLTIPEPLCRKTVDEVWSEIHND  144

Query  749  HqqqqqqHNSD  781
                 +  N +
Sbjct  145  QPNNSRARNPN  155



>ref|XP_008241247.1| PREDICTED: LOW QUALITY PROTEIN: protein ABSCISIC ACID-INSENSITIVE 
5 [Prunus mume]
Length=436

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 85/123 (69%), Gaps = 1/123 (1%)
 Frame = +2

Query  380  NEGLSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphp  559
            N   SSLGRQSSIYSLTLDEFQHTLCE+GKNFGSMNMDEFL SIWTAEENQA      + 
Sbjct  16   NHFFSSLGRQSSIYSLTLDEFQHTLCENGKNFGSMNMDEFLTSIWTAEENQAINSNHTNI  75

Query  560  hphvgaaaESNAVTHNFM-LGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAE  736
            + +      +       M   +AS      IA+Q SL RQ SLTLP PLCRKTVDEVW+E
Sbjct  76   NNNHNHHNSNINNIDAHMPSAEASEEKAAAIAKQPSLPRQGSLTLPGPLCRKTVDEVWSE  135

Query  737  IHK  745
            IHK
Sbjct  136  IHK  138



>gb|ADL62859.1| abscisic acid insensitive [Prunus armeniaca]
Length=436

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 85/123 (69%), Gaps = 1/123 (1%)
 Frame = +2

Query  380  NEGLSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphp  559
            N   SSLGRQSSIYSLTLDEFQHTLCE+GKNFGSMNMDEFL SIWTAEENQA      + 
Sbjct  16   NHFFSSLGRQSSIYSLTLDEFQHTLCENGKNFGSMNMDEFLTSIWTAEENQAINSNHTNI  75

Query  560  hphvgaaaESNAVTHNFM-LGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAE  736
            + +      +       M   +AS      IA+Q SL RQ SLTLP PLCRKTVDEVW+E
Sbjct  76   NNNHNHHNSNINNIDAHMPSAEASEEKAAAIAKQPSLPRQGSLTLPGPLCRKTVDEVWSE  135

Query  737  IHK  745
            IHK
Sbjct  136  IHK  138



>ref|XP_010554860.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 [Tarenaya hassleriana]
Length=414

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 101/170 (59%), Gaps = 44/170 (26%)
 Frame = +2

Query  281  LAKMVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSS---------------LGRQSS  415
            + +MVVPE++   + EVES     A + + Q    G+SS               LGRQSS
Sbjct  1    MQEMVVPETDMMPRREVES-----ATKTEHQHPKHGVSSGSRAAGAVDSHVFPLLGRQSS  55

Query  416  IYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNA  595
            IYSLTLDEFQH+LCE G+NFGSMNMDEFL S+W AEENQ                  + A
Sbjct  56   IYSLTLDEFQHSLCEGGRNFGSMNMDEFLVSVWNAEENQQV----------------AAA  99

Query  596  VTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
              HN   G+ ++     IA+Q SL RQ SLT+P PLCRKTVDEVW+EIH+
Sbjct  100  SHHN---GKRAI-----IAKQPSLQRQGSLTVPAPLCRKTVDEVWSEIHR  141



>ref|XP_010509494.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 [Camelina sativa]
Length=445

 Score =   135 bits (340),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 97/168 (58%), Gaps = 16/168 (10%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqq-KNNEGLSSLGRQSSIYSLTLDEFQHTLCESG  466
            MV+ E++  S+ EVES      +      +N+   SSLGRQSSIYSLTLDEFQH LCE+G
Sbjct  1    MVLRETKMMSEREVESSTAQTRQNGVGGGENHHPFSSLGRQSSIYSLTLDEFQHALCENG  60

Query  467  KNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFML----------  616
            KNFGSMNMDEFL SIW AEEN     A    H         N   +N             
Sbjct  61   KNFGSMNMDEFLVSIWNAEENNNSQQAAAASHSVPPNPNGFNNNNNNGGESGVGVFGGGS  120

Query  617  -----GQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                    S   ++GIA+Q SL RQ SLTLP PLCRKTVDEVW+EIH+
Sbjct  121  TGNEGANNSNNNKRGIAKQPSLPRQGSLTLPAPLCRKTVDEVWSEIHR  168



>ref|XP_003553595.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Glycine 
max]
Length=387

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 98/156 (63%), Gaps = 29/156 (19%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQ-SSIYSLTLDEFQHTLCESG  466
            MV+ E E  SQGEVES LQ +A++          S LGRQ SSIYSLTLDEFQH+LCESG
Sbjct  1    MVIEEGEMKSQGEVESWLQQEAKKNHHSPLFSSSSYLGRQTSSIYSLTLDEFQHSLCESG  60

Query  467  KNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAEKG  646
            KNFGSMNMDEFL+SIW AEEN                   S A+T+N      +VP    
Sbjct  61   KNFGSMNMDEFLSSIWNAEEN-------------------SQAITNN------NVPLSST  95

Query  647  IA---RQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
            +    +Q SL RQ SL+LP PLCRKTVDEVW++I K
Sbjct  96   LTILRKQPSLPRQPSLSLPAPLCRKTVDEVWSQIQK  131



>emb|CDX75056.1| BnaA05g08020D [Brassica napus]
Length=399

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 94/156 (60%), Gaps = 16/156 (10%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqae----qqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLC  457
            MV  E+E  S+ EVE+      +           N   SSLGRQSSIYSLTLDEFQH LC
Sbjct  1    MVSRETEMMSEREVETSTAQARQNGGAGGGGGGENHPFSSLGRQSSIYSLTLDEFQHALC  60

Query  458  ESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPA  637
            E+GKNFGSMNMDEFL SIW AEEN  + H              S A +H        V  
Sbjct  61   ENGKNFGSMNMDEFLVSIWNAEENNNNNHQA------------SAAASHPVPPNHNGVNK  108

Query  638  EKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
            + GIA+Q SL RQ SLTLP PLCRKTV+EVW+EIH+
Sbjct  109  KPGIAKQPSLPRQGSLTLPAPLCRKTVEEVWSEIHR  144



>gb|AGG35953.1| ABA insensitive PP2C protein 5 [Brassica napus]
Length=438

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 95/167 (57%), Gaps = 15/167 (9%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqae----qqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLC  457
            MV  E+E  S+ EVE+      +           N   SSLGRQSSIYSLTLDEFQH LC
Sbjct  1    MVSRETEMMSEREVETSTAQARQNGGAGGGGGGENHPFSSLGRQSSIYSLTLDEFQHALC  60

Query  458  ESGKNFGSMNMDEFLNSIWTAEENQahahaqphph-----------phvgaaaESNAVTH  604
            E+GKNFGSMNMDEFL SIW AEEN  ++H                  +     ES     
Sbjct  61   ENGKNFGSMNMDEFLVSIWNAEENNNNSHQAAAASHPVPPNHNGFNNNNNGGTESGVFGG  120

Query  605  NFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                G   V  + GIA+Q SL RQ SLTLP PLCRKTV+EVW+EIH+
Sbjct  121  GGSSGNQGVNKKPGIAKQPSLPRQGSLTLPAPLCRKTVEEVWSEIHR  167



>ref|XP_006296104.1| hypothetical protein CARUB_v10025255mg [Capsella rubella]
 gb|EOA29002.1| hypothetical protein CARUB_v10025255mg [Capsella rubella]
Length=440

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 98/161 (61%), Gaps = 9/161 (6%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MV+ E++  S+ EVES            +++   SSLGRQSSIYSLTLDEFQH LCE+GK
Sbjct  1    MVLRETKMMSEREVESSTAQGRPNGGGGESHHPFSSLGRQSSIYSLTLDEFQHALCENGK  60

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphp---hphvgaaaESNAVTHNFMLGQASVPAE  640
            NFGSMNMDEFL SIW AEEN  +     H    + +      +   +     G  S   E
Sbjct  61   NFGSMNMDEFLVSIWNAEENNNNQQTASHSVPPNHNGFNNNNNGGESGVGAFGGGSTAHE  120

Query  641  ------KGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                  +GIA+Q SL RQ SLTLP PLCRKTVDEVW+EIH+
Sbjct  121  GANSSKRGIAKQPSLPRQGSLTLPAPLCRKTVDEVWSEIHR  161



>gb|EPS62571.1| hypothetical protein M569_12220, partial [Genlisea aurea]
Length=271

 Score =   127 bits (319),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 79/125 (63%), Gaps = 34/125 (27%)
 Frame = +2

Query  395  SLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvg  574
            +LGRQ SIYSLTLDEFQHTL ESGKNFGSMNMDEFLNSIWTAEENQ+H            
Sbjct  2    TLGRQPSIYSLTLDEFQHTLNESGKNFGSMNMDEFLNSIWTAEENQSH------------  49

Query  575  aaaESNAVTHNFMLGQASVPAEKGIARQQ--------SLARQASLTLPPPLCRKTVDEVW  730
                          G AS   + G A QQ        +LARQ SLTLP  LCRKTVDEVW
Sbjct  50   --------------GGASQIDDGGTANQQPPPPPPHGNLARQGSLTLPEQLCRKTVDEVW  95

Query  731  AEIHK  745
            ++IH+
Sbjct  96   SDIHR  100



>emb|CDY43738.1| BnaAnng07530D [Brassica napus]
Length=404

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 94/159 (59%), Gaps = 7/159 (4%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MVV E++  S  EVES  +           N   +SLGRQSSIYSLTLDEFQH LCE+GK
Sbjct  1    MVVRETKMMSGREVESSTRHNGGAGAGGGENHPFTSLGRQSSIYSLTLDEFQHALCENGK  60

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPA----  637
            NFGSMNMDEFL SIW AEEN  + H     HP        N       +      +    
Sbjct  61   NFGSMNMDEFLVSIWNAEENNNNNHQAAASHPVPPNHNGFNNGGGESGVFGGGGSSGNQR  120

Query  638  ---EKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                +GIA+Q SL RQ SLTLP PLCRKTVDEVW+EIH+
Sbjct  121  DNKRQGIAKQPSLPRQGSLTLPSPLCRKTVDEVWSEIHR  159



>ref|XP_009141571.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Brassica 
rapa]
Length=403

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 94/159 (59%), Gaps = 7/159 (4%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MVV E++  S  EVES  +           N   +SLGRQSSIYSLTLDEFQH LCE+GK
Sbjct  1    MVVRETKMMSGREVESSTRHNGGAGAGGGENHPFTSLGRQSSIYSLTLDEFQHALCENGK  60

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPA----  637
            NFGSMNMDEFL SIW AEEN  + H     HP        N       +      +    
Sbjct  61   NFGSMNMDEFLVSIWNAEENNNNNHQAAASHPVPPNHNGFNNGGGESGVFGGGGSSGNQR  120

Query  638  ---EKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                +GIA+Q SL RQ SLTLP PLCRKTVDEVW+EIH+
Sbjct  121  DNKRQGIAKQPSLPRQGSLTLPSPLCRKTVDEVWSEIHR  159



>ref|XP_006410797.1| hypothetical protein EUTSA_v10016668mg [Eutrema salsugineum]
 ref|XP_006410798.1| hypothetical protein EUTSA_v10016668mg [Eutrema salsugineum]
 gb|ESQ52250.1| hypothetical protein EUTSA_v10016668mg [Eutrema salsugineum]
 gb|ESQ52251.1| hypothetical protein EUTSA_v10016668mg [Eutrema salsugineum]
Length=439

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 92/164 (56%), Gaps = 13/164 (8%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MVV E+    + EVES              N   SSLGRQSSIYSLTLDEFQH LCE+GK
Sbjct  1    MVVRETAMMPEREVESSTAQTRHNGGSGGENHPFSSLGRQSSIYSLTLDEFQHALCENGK  60

Query  470  NFGSMNMDEFLNSIWTAEENQah-------------ahaqphphphvgaaaESNAVTHNF  610
            NFGSMNMDEFL SIW AEEN  +              H   +   +    AESN      
Sbjct  61   NFGSMNMDEFLVSIWNAEENNNNQQAAAAASNPVPPNHNGFNNSNNNNGGAESNVFGGGG  120

Query  611  MLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
              G         IA++ SLARQ SLTLP PLCRKTVDEVW+EIH
Sbjct  121  SSGNQGANKRSVIAKEPSLARQGSLTLPAPLCRKTVDEVWSEIH  164



>ref|XP_010516839.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Camelina 
sativa]
Length=444

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 97/165 (59%), Gaps = 13/165 (8%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqq-KNNEGLSSLGRQSSIYSLTLDEFQHTLCESG  466
            MV+ E++  S+ EVES      +      +N+   SSLGRQSSIYSLTLDEFQH LCE+G
Sbjct  1    MVLRETKMMSEREVESSTAQARQNGVGGGENHHPFSSLGRQSSIYSLTLDEFQHALCENG  60

Query  467  KNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFML----------  616
            KNFGSMNMDEFL SIW AEEN  +  A             +N                  
Sbjct  61   KNFGSMNMDEFLVSIWNAEENNNNQQAAASHSVPPNHNGFNNNNNGGESGVGVFGGGSTG  120

Query  617  --GQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
              G  S   ++GIA+Q SL RQ SLTLP PLCRKTVDEVW+EIH+
Sbjct  121  NEGDNSNNNKRGIAKQPSLPRQGSLTLPAPLCRKTVDEVWSEIHR  165



>ref|NP_565840.1| protein abscisic acid-insensitive 5 [Arabidopsis thaliana]
 sp|Q9SJN0.1|ABI5_ARATH RecName: Full=Protein ABSCISIC ACID-INSENSITIVE 5; AltName: Full=Dc3 
promoter-binding factor 1; Short=AtDPBF1; AltName: Full=Protein 
GROWTH-INSENSITIVITY TO ABA 1; AltName: Full=bZIP 
transcription factor 39; Short=AtbZIP39 [Arabidopsis thaliana]
 gb|AAD21438.1| abscisic acid insensitive 5 (ABI5) [Arabidopsis thaliana]
 gb|AAK19599.1| bZIP protein [Arabidopsis thaliana]
 gb|ABH04624.1| At2g36270 [Arabidopsis thaliana]
 gb|AEC09226.1| protein abscisic acid-insensitive 5 [Arabidopsis thaliana]
Length=442

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 92/166 (55%), Gaps = 14/166 (8%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MV  E++  S+ EVES +            N   +SLGRQSSIYSLTLDEFQH LCE+GK
Sbjct  1    MVTRETKLTSEREVESSMAQARHNGGGGGENHPFTSLGRQSSIYSLTLDEFQHALCENGK  60

Query  470  NFGSMNMDEFLNSIWTAE--------------ENQahahaqphphphvgaaaESNAVTHN  607
            NFGSMNMDEFL SIW AE               +   A+     + +         V   
Sbjct  61   NFGSMNMDEFLVSIWNAEENNNNQQQAAAAAGSHSVPANHNGFNNNNNNGGEGGVGVFSG  120

Query  608  FMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
               G      ++GIA + SL RQ SLTLP PLCRKTVDEVW+EIH+
Sbjct  121  GSRGNEDANNKRGIANESSLPRQGSLTLPAPLCRKTVDEVWSEIHR  166



>ref|XP_002881435.1| hypothetical protein ARALYDRAFT_321332 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57694.1| hypothetical protein ARALYDRAFT_321332 [Arabidopsis lyrata subsp. 
lyrata]
Length=439

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 97/163 (60%), Gaps = 11/163 (7%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESGK  469
            MV  E++  S+ EVES +            N   +SLGRQSSIYSLTLDEFQH LCE+GK
Sbjct  1    MVTRETKLMSEREVESSMAQARHNGGGGGENHPFTSLGRQSSIYSLTLDEFQHALCENGK  60

Query  470  NFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPA----  637
            NFGSMNMDEFL SIW AEEN  +  A           A  N   +N   G+  V      
Sbjct  61   NFGSMNMDEFLVSIWNAEENNNNQQAAAAAAASHSVPANHNGFNNNNNGGEGGVFGGGSR  120

Query  638  -------EKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                   ++GIA++ SL RQ SLTLP PLCRKTVDEVW+EIH+
Sbjct  121  GNEEANNKRGIAKEPSLPRQGSLTLPAPLCRKTVDEVWSEIHR  163



>emb|CDX84141.1| BnaC04g09030D [Brassica napus]
Length=394

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 94/153 (61%), Gaps = 15/153 (10%)
 Frame = +2

Query  290  MVVPESEAASQGEVE-SPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCESG  466
            MV  E+E  S+ EVE S  Q +         N   SSLGRQSSIYSLTLDEFQH LCE+G
Sbjct  1    MVGRETEMMSEREVETSTAQARQNGGAGGGENHPFSSLGRQSSIYSLTLDEFQHALCENG  60

Query  467  KNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAEKG  646
            KNFGSMNMDEFL SIW AEEN                  ++ A +H         P   G
Sbjct  61   KNFGSMNMDEFLVSIWNAEENN-------------NNNHQAAAASHPVPPRVNKKPG-IG  106

Query  647  IARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
            IA+Q SL+RQ SLTLP PLCRKTV+EVW+EIH+
Sbjct  107  IAKQPSLSRQGSLTLPAPLCRKTVEEVWSEIHR  139



>gb|EYU35478.1| hypothetical protein MIMGU_mgv1a023701mg [Erythranthe guttata]
Length=359

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 79/125 (63%), Gaps = 28/125 (22%)
 Frame = +2

Query  395  SLGRQSS-IYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphv  571
            SLGRQSS IYSLTLDEFQHTLC+SGKNFGSMNMDEFLNSI+TAEENQ             
Sbjct  35   SLGRQSSSIYSLTLDEFQHTLCDSGKNFGSMNMDEFLNSIFTAEENQE------------  82

Query  572  gaaaESNAVTHNFMLGQASVPAEKGIARQQ------SLARQASLTLPPPLCRKTVDEVWA  733
                      H  M  Q  +P + G  ++       +L RQ SL +P PL RKTVD+VW+
Sbjct  83   ---------NHTMMTQQQLIPQQGGHEKKTPLKAGPALTRQGSLEVPEPLSRKTVDQVWS  133

Query  734  EIHKT  748
            EIHKT
Sbjct  134  EIHKT  138



>ref|XP_010505159.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Camelina 
sativa]
Length=444

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 96/167 (57%), Gaps = 15/167 (9%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqq-KNNEGLSSLGRQSSIYSLTLDEFQHTLCESG  466
            MV+ E++  S+ EVES      +      +N+   SSLGRQSSIYSLTLDEFQH LCE+G
Sbjct  1    MVLRETKMMSEREVESSTAQTRQNGVGGGENHHPFSSLGRQSSIYSLTLDEFQHALCENG  60

Query  467  KNFGSMNMDEFLNSIWTAEENQahahaqph--------------phphvgaaaESNAVTH  604
            KNFGSMNMDEFL SIW AEEN  +  A                               + 
Sbjct  61   KNFGSMNMDEFLVSIWNAEENNNNQQAAASHSVPPNHNGFKNNNNGGESVVGVFGGGGST  120

Query  605  NFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                  ++   ++GIA+Q SL RQ SLTLP PLCRKTVDEVW+EIH+
Sbjct  121  GNEGANSNNNNKRGIAKQPSLPRQGSLTLPAPLCRKTVDEVWSEIHR  167



>ref|XP_009143603.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 [Brassica rapa]
Length=438

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 90/168 (54%), Gaps = 16/168 (10%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqae---qqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCE  460
            MV  E+E  S+ EVE+      +          N   SSLGRQSSIYSLTLDEFQH LCE
Sbjct  1    MVGRETEMMSEREVETSTAQARQNGGAGGGGGENHPFSSLGRQSSIYSLTLDEFQHALCE  60

Query  461  SGKNFGSMNMDEFLNSIW-------------TAEENQahahaqphphphvgaaaESNAVT  601
            +GKNFGSMNMDEFL SIW              A  +          + + G         
Sbjct  61   NGKNFGSMNMDEFLVSIWNAEENNNNNHQASAAASHPVPPSHNGFNNNNNGGTESGVFSG  120

Query  602  HNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                 G   V  + GIA+Q SL RQ SLTLP PLCRKTV+EVW+EIH+
Sbjct  121  GGGSSGNQGVNKKPGIAKQPSLPRQGSLTLPAPLCRKTVEEVWSEIHR  168



>gb|KHN02230.1| Protein ABSCISIC ACID-INSENSITIVE 5 [Glycine soja]
Length=338

 Score =   122 bits (307),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 92/149 (62%), Gaps = 29/149 (19%)
 Frame = +2

Query  290  MVVPESEAASQGEVESPlqlqaeqqqqqKNNEGLSSLGRQ-SSIYSLTLDEFQHTLCESG  466
            MV+ E E  SQGEVES LQ +A++          S LGRQ SSIYSLTLDEFQH+LCESG
Sbjct  1    MVIEEGEMKSQGEVESWLQQEAKKNHHSPLFSSSSYLGRQTSSIYSLTLDEFQHSLCESG  60

Query  467  KNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAEKG  646
            KNFGSMNMDEFL+SIW AEEN                   S A+T+N      +VP    
Sbjct  61   KNFGSMNMDEFLSSIWNAEEN-------------------SQAITNN------NVPLSST  95

Query  647  IA---RQQSLARQASLTLPPPLCRKTVDE  724
            +    +Q SL RQ SL+LP PLCRKTVDE
Sbjct  96   LTILRKQPSLPRQPSLSLPAPLCRKTVDE  124



>ref|XP_004494169.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like isoform X1 
[Cicer arietinum]
Length=447

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 96/155 (62%), Gaps = 18/155 (12%)
 Frame = +2

Query  287  KMVVPESEAA-SQGEVESPlqlqaeqqqqqKNNE-GLSSLGRQSSIYSLTLDEFQHTLCE  460
            KMVV E E   +QGEVES L    E  +   NN    S   + SSIYSLTLDEFQH+LCE
Sbjct  20   KMVVREGEINWTQGEVESALHRDEEANKIDVNNIISSSLGRQSSSIYSLTLDEFQHSLCE  79

Query  461  SGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAE  640
            SGKNFGSMNMDEFL+SIW AEENQ  A               +N   +       SV   
Sbjct  80   SGKNFGSMNMDEFLSSIWNAEENQQAA---------------TNNNNNINNNNNLSV-IS  123

Query  641  KGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
            K I++Q SL RQ SL++P PLCRKTV++VW+EIHK
Sbjct  124  KEISKQASLPRQNSLSIPAPLCRKTVEQVWSEIHK  158



>ref|XP_004494170.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like isoform X2 
[Cicer arietinum]
 ref|XP_004494171.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like isoform X3 
[Cicer arietinum]
Length=427

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 95/154 (62%), Gaps = 18/154 (12%)
 Frame = +2

Query  290  MVVPESEAA-SQGEVESPlqlqaeqqqqqKNNE-GLSSLGRQSSIYSLTLDEFQHTLCES  463
            MVV E E   +QGEVES L    E  +   NN    S   + SSIYSLTLDEFQH+LCES
Sbjct  1    MVVREGEINWTQGEVESALHRDEEANKIDVNNIISSSLGRQSSSIYSLTLDEFQHSLCES  60

Query  464  GKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAEK  643
            GKNFGSMNMDEFL+SIW AEENQ  A               +N   +       SV   K
Sbjct  61   GKNFGSMNMDEFLSSIWNAEENQQAA---------------TNNNNNINNNNNLSV-ISK  104

Query  644  GIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
             I++Q SL RQ SL++P PLCRKTV++VW+EIHK
Sbjct  105  EISKQASLPRQNSLSIPAPLCRKTVEQVWSEIHK  138



>ref|XP_003625810.1| Abscisic acid insensitive [Medicago truncatula]
 gb|AES82028.1| ABA response element-binding factor [Medicago truncatula]
Length=431

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 93/154 (60%), Gaps = 19/154 (12%)
 Frame = +2

Query  290  MVVPESEAA-SQGEVESPlqlqaeqqqqqKNNE-GLSSLGRQSSIYSLTLDEFQHTLCES  463
            MVV E E    QGEVES  +   E  +   NN    S   + SSIYSLTLDEFQH+LC+S
Sbjct  1    MVVREGEMNWQQGEVESLQREGEEAIRNDVNNVISSSLGRQSSSIYSLTLDEFQHSLCDS  60

Query  464  GKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQASVPAEK  643
            GKNFGSMNMDEFL+SIW AEE                   +  A  +N         A+K
Sbjct  61   GKNFGSMNMDEFLSSIWNAEE-----------------NQQQAASNNNNSNNNNLSAAQK  103

Query  644  GIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
            GI++Q SL RQ SL++P PLCRKTV++VW+EIHK
Sbjct  104  GISKQASLPRQNSLSIPAPLCRKTVEQVWSEIHK  137



>gb|AFZ45968.1| ABA insensitve 5-like protein [Brassica oleracea var. capitata]
Length=425

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 83/134 (62%), Gaps = 12/134 (9%)
 Frame = +2

Query  380  NEGLSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphp  559
            N   SSLGRQSSIYS TLDEFQH LCE+GKNFGSMNMDEFL SIW AEEN  +       
Sbjct  25   NHPFSSLGRQSSIYSSTLDEFQHALCENGKNFGSMNMDEFLVSIWNAEENNNNNQQAAAA  84

Query  560  hphvgaaaE--SNAVTHNFMLGQASVPAEK----------GIARQQSLARQASLTLPPPL  703
               V  +    +N  T + + G     +            GIA+Q SL RQ SLTLP PL
Sbjct  85   SHPVPPSHNGFNNGGTESGVFGGGGGGSSGNQGVNKKPGIGIAKQPSLPRQDSLTLPAPL  144

Query  704  CRKTVDEVWAEIHK  745
            CRKTV+EVW+EIH+
Sbjct  145  CRKTVEEVWSEIHR  158



>gb|AGZ05627.1| abscisic acid-insensitive 5 [Gladiolus hybrid cultivar]
Length=406

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 71/116 (61%), Gaps = 15/116 (13%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSSIYSLTLDE Q+T+CE GK FGSMNMDEFLN+IW+ EE  A              
Sbjct  40   LTRQSSIYSLTLDEIQNTVCEPGKTFGSMNMDEFLNNIWSVEEAAATGGGANVNVDINVT  99

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
            AA  +A  H                +Q SL RQ SL+LP PLCRKTVDEVWAEIH+
Sbjct  100  AAADDAAAHQ---------------QQTSLQRQGSLSLPAPLCRKTVDEVWAEIHR  140



>ref|XP_006836037.1| hypothetical protein AMTR_s00114p00031980 [Amborella trichopoda]
 gb|ERM98890.1| hypothetical protein AMTR_s00114p00031980 [Amborella trichopoda]
Length=386

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 73/117 (62%), Gaps = 18/117 (15%)
 Frame = +2

Query  392  SSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphv  571
            S L RQ SIYSLTLDEFQ TLCE GKNFGSMNMDEFL++IWTAEE+Q             
Sbjct  31   SPLARQGSIYSLTLDEFQSTLCEPGKNFGSMNMDEFLSNIWTAEESQ-------------  77

Query  572  gaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
                 + A         A  P +  + RQ SL RQ SLT+P PL +KTV+EVW++IH
Sbjct  78   -----AMAAAMEAAASHAEEPNKSSMHRQPSLPRQNSLTIPAPLSQKTVEEVWSDIH  129



>ref|XP_008804818.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Phoenix 
dactylifera]
 ref|XP_008804819.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Phoenix 
dactylifera]
 ref|XP_008804820.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Phoenix 
dactylifera]
 ref|XP_008804821.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Phoenix 
dactylifera]
Length=404

 Score =   112 bits (279),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 74/130 (57%), Gaps = 26/130 (20%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSSIYSLTLDE Q+T+CE GK FGSMNMDEFL +IW  EE Q               
Sbjct  40   LMRQSSIYSLTLDEIQNTVCEPGKAFGSMNMDEFLTNIWNVEEGQI--------------  85

Query  578  aaESNA-VTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTHq  754
               +NA       +G   +PA         L RQ S+T+PPPLCRKTVDEVW +IH+   
Sbjct  86   ---ANAHAQKQPHIGGGGMPAAA------PLQRQGSITIPPPLCRKTVDEVWEDIHRDQ-  135

Query  755  qqqqqHNSDG  784
               ++ N DG
Sbjct  136  -NARRQNVDG  144



>dbj|BAF36444.1| bZip type transcription factor TaABI5 [Triticum aestivum]
 dbj|BAF62438.1| bZip type transcription factor TaABI5 [Triticum aestivum]
Length=390

 Score =   108 bits (270),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 73/121 (60%), Gaps = 27/121 (22%)
 Frame = +2

Query  404  RQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaa  583
            RQSSI++LTLDE Q+++CE+G+NFGSMNMDEF+++IW AEE Q                 
Sbjct  34   RQSSIFALTLDELQYSVCEAGRNFGSMNMDEFMSNIWNAEEFQ-----------------  76

Query  584  ESNAVTHNFMLGQASVPA-------EKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
               A T   ++G    P            A   +LARQ S +LPPPLCRKTV+EVWAEI+
Sbjct  77   ---AATGGGLVGMEVAPVVGAGAGGGGADAGGSNLARQESFSLPPPLCRKTVEEVWAEIN  133

Query  743  K  745
            +
Sbjct  134  R  134



>ref|XP_010907998.1| PREDICTED: LOW QUALITY PROTEIN: protein ABSCISIC ACID-INSENSITIVE 
5-like [Elaeis guineensis]
Length=377

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 74/133 (56%), Gaps = 27/133 (20%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSSIYSLTLDE Q+T+CE GK FGSMNMDEFL +IW  EE Q               
Sbjct  32   LMRQSSIYSLTLDEIQNTVCEPGKTFGSMNMDEFLANIWNVEEGQ---------------  76

Query  578  aaESNAVTHNFMLGQASVPAEKGI---ARQQSLARQASLTLPPPLCRKTVDEVWAEIHKT  748
                  + H    G  + P  +G         L RQ S+++P PLCRKTVDEVW EIH+ 
Sbjct  77   ------IAH--AAGSEAQPNGEGAPPPPPPPPLQRQVSISIPAPLCRKTVDEVWTEIHRG  128

Query  749  Hqqqq-qqHNSDG  784
             +    QQH SDG
Sbjct  129  RKVDHPQQHGSDG  141



>emb|CDM80221.1| unnamed protein product [Triticum aestivum]
Length=387

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 73/121 (60%), Gaps = 27/121 (22%)
 Frame = +2

Query  404  RQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaa  583
            RQSSI++LTLDE Q+++CE+G NFGSMNMDEF+++IW AEE Q                 
Sbjct  35   RQSSIFALTLDELQYSVCEAGHNFGSMNMDEFMSNIWNAEEFQ-----------------  77

Query  584  ESNAVTHNFMLGQASVPA-------EKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
               A T   ++G    P          G A   +LARQ S +LPPPLCRKTV+EVWAEI+
Sbjct  78   ---AATGGGLVGMEVAPVVGAGGGGGGGDAGGSNLARQESFSLPPPLCRKTVEEVWAEIN  134

Query  743  K  745
            +
Sbjct  135  R  135



>emb|CDM81873.1| unnamed protein product [Triticum aestivum]
Length=391

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 73/121 (60%), Gaps = 27/121 (22%)
 Frame = +2

Query  404  RQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaa  583
            RQSSI++LTLDE Q+++CE+G NFGSMNMDEF+++IW AEE Q                 
Sbjct  35   RQSSIFALTLDELQYSVCEAGHNFGSMNMDEFMSNIWNAEEFQ-----------------  77

Query  584  ESNAVTHNFMLGQASVPA-------EKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
               A T   ++G    P          G A   +LARQ S +LPPPLCRKTV+EVWAEI+
Sbjct  78   ---AATGGGLVGMEVAPVVGAGGGGGGGDAGGSNLARQESFSLPPPLCRKTVEEVWAEIN  134

Query  743  K  745
            +
Sbjct  135  R  135



>emb|CDM81865.1| unnamed protein product [Triticum aestivum]
Length=390

 Score =   105 bits (263),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 72/121 (60%), Gaps = 27/121 (22%)
 Frame = +2

Query  404  RQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaa  583
            RQSSI++L LDE Q+++CE+G+NFGSMNMDEF+++IW AEE Q                 
Sbjct  34   RQSSIFALKLDELQYSVCEAGRNFGSMNMDEFMSNIWNAEEFQ-----------------  76

Query  584  ESNAVTHNFMLGQASVPAEKGIARQQ-------SLARQASLTLPPPLCRKTVDEVWAEIH  742
               A T   ++G    P       +        +LARQ S +LPPPLCRKTV+EVWAEI+
Sbjct  77   ---AATGGGLVGMEVAPVVGAGGGEGGVYAGGSNLARQESFSLPPPLCRKTVEEVWAEIN  133

Query  743  K  745
            +
Sbjct  134  R  134



>gb|AAM75355.1|AF519804_1 ABA response element binding factor [Triticum aestivum]
Length=391

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 73/121 (60%), Gaps = 27/121 (22%)
 Frame = +2

Query  404  RQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaa  583
            RQSSI++LTLDE Q+++CE+G+NFGSMNMDEF+++IW A+E Q                 
Sbjct  34   RQSSIFALTLDELQYSVCEAGRNFGSMNMDEFMSNIWNADEFQ-----------------  76

Query  584  ESNAVTHNFMLG-------QASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
               A T   ++G        A        A   +LARQ S +LPPPLCRKTVDEVWAEI+
Sbjct  77   ---AATGGGLVGMEVAPVVGAGGGGGGLDAGGSNLARQESFSLPPPLCRKTVDEVWAEIN  133

Query  743  K  745
            +
Sbjct  134  R  134



>ref|XP_009411951.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009411952.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009411953.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009411954.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009411955.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009411956.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Musa acuminata 
subsp. malaccensis]
Length=408

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 72/116 (62%), Gaps = 14/116 (12%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ++IYSLTLDE Q+ +CE GK FGSMNMDEFL +IW  EE QA A A  +    +  
Sbjct  51   LMRQNTIYSLTLDEIQNAVCEPGKTFGSMNMDEFLTNIWNVEEIQAAAAANNNNEVPINH  110

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
             AES A       G+ +  A         L RQ SLTLP PL RKTVDEVWAEIH+
Sbjct  111  LAESTA-------GRQAAEAP-------PLRRQGSLTLPAPLSRKTVDEVWAEIHR  152



>ref|XP_010907582.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Elaeis guineensis]
 ref|XP_010907583.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Elaeis guineensis]
 ref|XP_010907584.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Elaeis guineensis]
Length=398

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 67/116 (58%), Gaps = 22/116 (19%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSSIYSLTLDE Q+T+CE GK+FGSMNMDEFL +IW  EE Q  +            
Sbjct  38   LMRQSSIYSLTLDEIQNTVCEPGKSFGSMNMDEFLTNIWNVEEGQIAS------------  85

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
               +NA     + G               L RQ S+ +P PLCRKTVDEVW++IH+
Sbjct  86   ---ANAQNQQHIGGGGP-------PAAPPLQRQGSIAVPAPLCRKTVDEVWSDIHR  131



>gb|ABH05131.1| ABA responsive element binding factor 1 [Hordeum vulgare subsp. 
vulgare]
Length=394

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 72/122 (59%), Gaps = 28/122 (23%)
 Frame = +2

Query  404  RQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaa  583
            RQSSI++LTLDE Q+++C  G+NFGSMNMDEF+++IW AEE                   
Sbjct  30   RQSSIFALTLDELQNSVCNPGRNFGSMNMDEFMSNIWNAEEFL-----------------  72

Query  584  ESNAVTHNFMLGQASVPA--------EKGIARQQSLARQASLTLPPPLCRKTVDEVWAEI  739
               A T   ++G   VP         + G A   +L RQ S +LPPPLCRKTV+EVWAEI
Sbjct  73   ---AATGGCLVGMEEVPVVGGGGSGGDGGDAGGSTLCRQGSFSLPPPLCRKTVEEVWAEI  129

Query  740  HK  745
            ++
Sbjct  130  NR  131



>dbj|BAK03778.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04963.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=398

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 71/122 (58%), Gaps = 28/122 (23%)
 Frame = +2

Query  404  RQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaa  583
            RQSSI++LTLDE Q+++C  G+NFGSMNMDEF+++IW AEE                   
Sbjct  34   RQSSIFALTLDELQNSVCNPGRNFGSMNMDEFMSNIWNAEEFL-----------------  76

Query  584  ESNAVTHNFMLGQASVPA--------EKGIARQQSLARQASLTLPPPLCRKTVDEVWAEI  739
               A T   ++G   VP           G A   +L RQ S +LPPPLCRKTV+EVWAEI
Sbjct  77   ---AATGGCLVGMEEVPVVGGGGSGGGGGDAGGSTLCRQGSFSLPPPLCRKTVEEVWAEI  133

Query  740  HK  745
            ++
Sbjct  134  NR  135



>dbj|BAF61106.1| bZip type transcription factor TmABI5 [Triticum monococcum]
 dbj|BAF62441.1| abscisic acid insensitive 5 homologue [Triticum monococcum]
Length=390

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 73/121 (60%), Gaps = 27/121 (22%)
 Frame = +2

Query  404  RQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaa  583
            RQSSI++LTLDE Q+++CE+G+NFGSMNMDEF+++IW A+E Q                 
Sbjct  34   RQSSIFALTLDELQYSVCEAGRNFGSMNMDEFMSNIWNADEFQ-----------------  76

Query  584  ESNAVTHNFMLG-------QASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
               A T   ++G        A        A   +LARQ S +LPPPLCRKTV+EVWAEI+
Sbjct  77   ---AATGGSLVGMEVAPVVGAGGGGGGLDAGGSNLARQESFSLPPPLCRKTVEEVWAEIN  133

Query  743  K  745
            +
Sbjct  134  R  134



>ref|XP_010046725.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1 [Eucalyptus 
grandis]
Length=365

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 70/121 (58%), Gaps = 29/121 (24%)
 Frame = +2

Query  392  SSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphv  571
            SSLG+Q+SI SLTLDE Q+    SGK+FGSMNMDEFL SIW+ EENQ+            
Sbjct  37   SSLGKQNSILSLTLDEIQY---RSGKSFGSMNMDEFLASIWSVEENQS------------  81

Query  572  gaaaESNAVTHNFMLGQASVP-AEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKT  748
                         +  Q   P A    A Q SLARQ S ++P PLC KTVDEVW EIHK 
Sbjct  82   -------------LPCQNEPPSANINTAGQSSLARQGSFSIPTPLCNKTVDEVWEEIHKD  128

Query  749  H  751
            H
Sbjct  129  H  129



>emb|CDM81868.1| unnamed protein product [Triticum aestivum]
Length=391

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 73/121 (60%), Gaps = 27/121 (22%)
 Frame = +2

Query  404  RQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaa  583
            RQSSI++LTLDE Q+++CE+G+NFGSMNMDEF+++IW AEE Q                 
Sbjct  35   RQSSIFALTLDELQYSVCEAGRNFGSMNMDEFMSNIWNAEEFQ-----------------  77

Query  584  ESNAVTHNFMLGQASVPA-------EKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
               A T   ++G    P          G A   +LARQ S +LPPP+C+KTV+EVW EI+
Sbjct  78   ---AATGGGLVGMEMAPVVGAGGGRGGGDAGGSNLARQESFSLPPPMCQKTVEEVWDEIN  134

Query  743  K  745
            +
Sbjct  135  R  135



>gb|ADM88570.1| ABA-binding protein 1 [Triticum aestivum]
Length=372

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 73/121 (60%), Gaps = 27/121 (22%)
 Frame = +2

Query  404  RQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaa  583
            RQSSI++LTLDE Q+++CE+G+NFGSMNMDEF+++IW+AEE Q                 
Sbjct  35   RQSSIFALTLDELQYSVCEAGRNFGSMNMDEFMSNIWSAEEFQ-----------------  77

Query  584  ESNAVTHNFMLGQASVPA-------EKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
               A T   ++G    P          G A   +LARQ S +LPPP+C+KTV+EVW EI 
Sbjct  78   ---AATGGGLVGMEMAPVVGAGGGRGGGDAGGSNLARQESFSLPPPMCQKTVEEVWDEIS  134

Query  743  K  745
            +
Sbjct  135  R  135



>ref|XP_008778650.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7 [Phoenix 
dactylifera]
Length=330

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 64/118 (54%), Gaps = 25/118 (21%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSSIYSLTLDE Q+ +CE G+ FGSMNMDEFL +IW  EE Q               
Sbjct  23   LMRQSSIYSLTLDEIQNKVCEPGQTFGSMNMDEFLANIWNVEEGQI--------------  68

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
               +NA          S     G        RQ S+T+P PLCRKTVDEVWAEIH+  
Sbjct  69   ---ANAA--------GSEAQPNGGGVPPPPQRQGSITIPLPLCRKTVDEVWAEIHRCR  115



>gb|AAK39132.1|AF369792_1 bZIP transcription factor 6 [Phaseolus vulgaris]
Length=415

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 66/119 (55%), Gaps = 26/119 (22%)
 Frame = +2

Query  395  SLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvg  574
            SL RQSS+YSLT DEF +T+  SGK+FGSMNMDE L +IWTAEE Q              
Sbjct  23   SLTRQSSVYSLTFDEFMNTMGGSGKDFGSMNMDELLKNIWTAEEVQT-------------  69

Query  575  aaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
                         +  A V A+ G A    L RQ SLTLP  L +KTVDEVW +I K +
Sbjct  70   -------------MASAGVAADDGGAGISHLQRQGSLTLPRTLSQKTVDEVWKDISKDY  115



>ref|XP_007136688.1| hypothetical protein PHAVU_009G065500g [Phaseolus vulgaris]
 ref|XP_007136689.1| hypothetical protein PHAVU_009G065500g [Phaseolus vulgaris]
 gb|ESW08682.1| hypothetical protein PHAVU_009G065500g [Phaseolus vulgaris]
 gb|ESW08683.1| hypothetical protein PHAVU_009G065500g [Phaseolus vulgaris]
Length=415

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 66/119 (55%), Gaps = 26/119 (22%)
 Frame = +2

Query  395  SLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvg  574
            SL RQSS+YSLT DEF +T+  SGK+FGSMNMDE L +IWTAEE Q              
Sbjct  23   SLTRQSSVYSLTFDEFMNTMGGSGKDFGSMNMDELLKNIWTAEEVQT-------------  69

Query  575  aaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
                         +  A V A+ G A    L RQ SLTLP  L +KTVDEVW +I K +
Sbjct  70   -------------MASAGVAADDGGAGISHLQRQGSLTLPRTLSQKTVDEVWKDISKDY  115



>emb|CDM80228.1| unnamed protein product [Triticum aestivum]
Length=391

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 72/121 (60%), Gaps = 27/121 (22%)
 Frame = +2

Query  404  RQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaa  583
            RQSSI++LTLDE Q+++CE+G+NFGSMNMDEF+++IW AEE Q                 
Sbjct  35   RQSSIFALTLDELQYSVCEAGRNFGSMNMDEFMSNIWNAEEFQ-----------------  77

Query  584  ESNAVTHNFMLGQASVPA-------EKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
               A T   ++G    P          G A   +LARQ S +LPP LC+K V+EVWAEI+
Sbjct  78   ---AATGGGLVGMEMAPVVGAGGGGGGGDAGGSNLARQESFSLPPTLCQKMVEEVWAEIN  134

Query  743  K  745
            +
Sbjct  135  R  135



>gb|AGV54705.1| bZIP transcription factor 6 [Phaseolus vulgaris]
Length=415

 Score =   100 bits (250),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 66/119 (55%), Gaps = 26/119 (22%)
 Frame = +2

Query  395  SLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvg  574
            SL RQSS+YSLT DEF +T+  SGK+FGSMNMDE L +IWTAEE Q              
Sbjct  23   SLTRQSSVYSLTFDEFMNTMGGSGKDFGSMNMDELLKNIWTAEEVQT-------------  69

Query  575  aaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
                         +  A V A+ G A    L RQ SLTLP  L +KTVDEVW +I K +
Sbjct  70   -------------MASAGVAADDGGAGISHLQRQGSLTLPRTLSQKTVDEVWKDISKDY  115



>ref|XP_007015839.1| Basic-leucine zipper transcription factor family protein, putative 
[Theobroma cacao]
 gb|EOY33458.1| Basic-leucine zipper transcription factor family protein, putative 
[Theobroma cacao]
Length=382

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 70/122 (57%), Gaps = 26/122 (21%)
 Frame = +2

Query  380  NEGLSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphp  559
            ++ +S L +Q+SI+SLTLDE Q    +SGK FGSMNMDEFL ++W  EENQ  +      
Sbjct  33   DQSISCLNKQNSIFSLTLDEIQ---LKSGKTFGSMNMDEFLANLWNVEENQVPSQ-----  84

Query  560  hphvgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEI  739
                              L Q     +KG+  Q +LARQ S ++P PLC+KTVDEVW EI
Sbjct  85   ------------------LNQNEPINDKGMGSQPTLARQGSFSIPTPLCKKTVDEVWFEI  126

Query  740  HK  745
             K
Sbjct  127  QK  128



>ref|XP_003523938.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5-like isoform 
X1 [Glycine max]
 ref|XP_006578027.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5-like isoform 
X2 [Glycine max]
 gb|ABC47854.1| bzip transcription factor [Glycine max]
Length=417

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 65/119 (55%), Gaps = 26/119 (22%)
 Frame = +2

Query  395  SLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvg  574
            SL RQ S+YSLT DEF +++  SGK+FGSMNMDE L +IWTAEE Q              
Sbjct  22   SLTRQPSVYSLTFDEFMNSMGGSGKDFGSMNMDELLKNIWTAEEVQT-------------  68

Query  575  aaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
                         +  A V A+ G A    L RQ SLTLP  L +KTVDEVW +I K H
Sbjct  69   -------------MASAGVAADDGGAGVSHLQRQGSLTLPRTLSQKTVDEVWKDISKDH  114



>gb|EMS53578.1| Protein ABSCISIC ACID-INSENSITIVE 5 [Triticum urartu]
Length=411

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 70/121 (58%), Gaps = 27/121 (22%)
 Frame = +2

Query  404  RQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaa  583
            RQSSI++ TLDE Q+++CE+G NFGSMNMDEF+++IW A+E Q                 
Sbjct  30   RQSSIFAPTLDELQYSMCEAGHNFGSMNMDEFMSNIWNAKEFQE----------------  73

Query  584  ESNAVTHNFMLGQASVPA-------EKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
                VT   ++G    P            A   +LARQ S +LPPPLC+K V+EVWAEI+
Sbjct  74   ----VTGGVLVGMEVAPVVGADGGRGGEDAGGSNLARQESFSLPPPLCQKMVEEVWAEIN  129

Query  743  K  745
            +
Sbjct  130  R  130



>gb|EMS52135.1| Protein ABSCISIC ACID-INSENSITIVE 5 [Triticum urartu]
Length=381

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 70/121 (58%), Gaps = 27/121 (22%)
 Frame = +2

Query  404  RQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaa  583
            RQSSI++ TLDE Q+++CE+ +NFGSMNMDEF+++IW A+E Q                 
Sbjct  34   RQSSIFAPTLDELQYSMCEARRNFGSMNMDEFMSNIWNAKEFQ-----------------  76

Query  584  ESNAVTHNFMLGQASVPAEKGIARQQ-------SLARQASLTLPPPLCRKTVDEVWAEIH  742
               A T   ++G    P       +        +LARQ S +LPPPLCRK V+EVWAEI+
Sbjct  77   ---AATGGVLVGMEVAPVVGVDGGRGGEDAGGSNLARQESFSLPPPLCRKMVEEVWAEIN  133

Query  743  K  745
            +
Sbjct  134  R  134



>gb|AGY78337.1| hypothetical protein [Setaria italica]
Length=399

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 68/117 (58%), Gaps = 10/117 (9%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ+SI SLTL+E Q++LCE G+NFGSMNMDEF+ +IW AEE QA             A
Sbjct  42   LARQASIMSLTLEELQNSLCEPGRNFGSMNMDEFMANIWNAEEFQAATGGCKEDAEQEAA  101

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKT  748
            AA +   T     G  S            L RQ S  LPPPL RKTV+EVWAEI++ 
Sbjct  102  AAAAAVPTAAVEKGGGS----------GGLVRQGSYALPPPLSRKTVEEVWAEINQA  148



>ref|XP_004970655.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Setaria 
italica]
Length=409

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 68/117 (58%), Gaps = 10/117 (9%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ+SI SLTL+E Q++LCE G+NFGSMNMDEF+ +IW AEE QA             A
Sbjct  42   LARQASIMSLTLEELQNSLCEPGRNFGSMNMDEFMANIWNAEEFQAATGGCKEDAEQEAA  101

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKT  748
            AA +   T     G  S            L RQ S  LPPPL RKTV+EVWAEI++ 
Sbjct  102  AAAAAVPTAAVEKGGGS----------GGLVRQGSYALPPPLSRKTVEEVWAEINQA  148



>ref|XP_002965670.1| hypothetical protein SELMODRAFT_227594 [Selaginella moellendorffii]
 gb|EFJ33090.1| hypothetical protein SELMODRAFT_227594 [Selaginella moellendorffii]
Length=377

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 64/120 (53%), Gaps = 30/120 (25%)
 Frame = +2

Query  386  GLSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphp  565
            G  S+ RQ+SIYSLTLDE Q TL E GKNFGSMNMDEFL +IWTAEE+QA          
Sbjct  14   GAGSIARQTSIYSLTLDELQTTLGEPGKNFGSMNMDEFLKNIWTAEESQA----------  63

Query  566  hvgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                            +  A  P    + RQ SL       LP  L RKTVDEVW  IH+
Sbjct  64   ----------------MAAAMAPDNSALCRQPSL----RAPLPRTLSRKTVDEVWKGIHR  103



>gb|KHG05813.1| abscisic acid-insensitive 5-like protein 1 [Gossypium arboreum]
Length=364

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 84/156 (54%), Gaps = 32/156 (21%)
 Frame = +2

Query  290  MVVPESEAASQGEVE---SPlqlqaeqqqqqKNNEGLSSLGRQSSIYSLTLDEFQHTLCE  460
            M + ESE+ + G ++   SP Q      ++   +   SS  +Q+SI+SLTLDE Q    +
Sbjct  1    MALSESESVAYGGIKKTGSPTQAPESPHEESTPDRSNSSPNKQNSIFSLTLDEIQ---LK  57

Query  461  SGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVTHNFMLGQAS-VPA  637
            SGK FGSMNMDEFL ++W  EENQ                          +L Q   +  
Sbjct  58   SGKTFGSMNMDEFLANLWNVEENQQ-------------------------VLSQPEPIDG  92

Query  638  EKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
            +KG+  Q SLARQ S ++P PLC+KTVDEVW EI K
Sbjct  93   DKGMGCQPSLARQGSFSVPTPLCKKTVDEVWFEIQK  128



>ref|XP_002971668.1| hypothetical protein SELMODRAFT_451399 [Selaginella moellendorffii]
 gb|EFJ27417.1| hypothetical protein SELMODRAFT_451399 [Selaginella moellendorffii]
Length=382

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 64/120 (53%), Gaps = 30/120 (25%)
 Frame = +2

Query  386  GLSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphp  565
            G  S+ RQ+SIYSLTLDE Q TL E GKNFGSMNMDEFL +IWTAEE+QA          
Sbjct  14   GAGSIARQTSIYSLTLDELQTTLGEPGKNFGSMNMDEFLKNIWTAEESQA----------  63

Query  566  hvgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                            +  A  P    + RQ SL       LP  L RKTVDEVW  IH+
Sbjct  64   ----------------MAAAMAPDNSALCRQPSL----RAPLPRTLSRKTVDEVWKGIHR  103



>gb|AAM75354.1|AF519803_1 ABA response element binding factor [Triticum aestivum]
Length=351

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 67/115 (58%), Gaps = 27/115 (23%)
 Frame = +2

Query  422  SLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaaESNAVT  601
            +LTLDE Q+++CE+G+NFGSMNMDEF+++IW AEE Q                    A T
Sbjct  1    ALTLDELQYSVCEAGRNFGSMNMDEFMSNIWNAEEFQ--------------------AAT  40

Query  602  HNFMLGQASVPA-------EKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
               ++G    P            A   +LARQ S +LPPPLCRKTV+EVWAEI++
Sbjct  41   GGGLVGMEVAPVVGAGAGGGGADAGGSNLARQESFSLPPPLCRKTVEEVWAEINR  95



>ref|XP_001753547.1| predicted protein [Physcomitrella patens]
 gb|EDQ81770.1| predicted protein, partial [Physcomitrella patens]
Length=88

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 64/107 (60%), Gaps = 19/107 (18%)
 Frame = +2

Query  395  SLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvg  574
            SL RQSSIYSLTLDEFQ+ L E GKNFGSMNMDEFL +IWTAEE+QA A A         
Sbjct  1    SLARQSSIYSLTLDEFQNALSEPGKNFGSMNMDEFLKNIWTAEESQAMAAAMGS------  54

Query  575  aaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKT  715
                         +G A       ++RQ SL RQ S+TLP  L RKT
Sbjct  55   -------------VGDAGQGGGGMLSRQSSLQRQGSITLPRTLSRKT  88



>ref|XP_002456667.1| hypothetical protein SORBIDRAFT_03g040510 [Sorghum bicolor]
 gb|EES01787.1| hypothetical protein SORBIDRAFT_03g040510 [Sorghum bicolor]
Length=401

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 67/116 (58%), Gaps = 6/116 (5%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSSI SLTL+E Q++LCE G+NFGSMNMDEF+ +IW AEE QA              
Sbjct  37   LARQSSIMSLTLEELQNSLCEPGRNFGSMNMDEFMANIWNAEEFQAATGTGGCSKEGTER  96

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                  V        A+   E G A    L RQ S  LPPPL RKTV+EVWAEI++
Sbjct  97   EPMMMPVAA-----AAAGTGENG-AGASGLVRQGSFALPPPLSRKTVEEVWAEINQ  146



>gb|KHG27504.1| abscisic acid-insensitive 5-like protein 1 [Gossypium arboreum]
Length=391

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 71/122 (58%), Gaps = 24/122 (20%)
 Frame = +2

Query  380  NEGLSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphp  559
            ++ +SSL +Q SI+SLTLDE Q    +SGK FGSMNMDEFL ++W  EENQA        
Sbjct  37   DQSVSSLNKQGSIFSLTLDEIQ---LKSGKAFGSMNMDEFLANLWNVEENQAPPQ-----  88

Query  560  hphvgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEI  739
                        +  N    +A    +KG   Q +LARQ S ++P PLC+KTVDEVW EI
Sbjct  89   ------------LDQN----EARDDKDKGKGGQPTLARQGSFSIPTPLCKKTVDEVWFEI  132

Query  740  HK  745
             K
Sbjct  133  QK  134



>gb|AGK07305.1| basic region/leucine zipper motif transcription factor [Taraxacum 
brevicorniculatum]
Length=406

 Score = 97.4 bits (241),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 64/117 (55%), Gaps = 29/117 (25%)
 Frame = +2

Query  392  SSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphv  571
            S L RQSSIYSLT DE Q+TL   GK+FGSMNMDE L +IWTAEE Q             
Sbjct  28   SPLTRQSSIYSLTFDELQNTLGGGGKDFGSMNMDELLKNIWTAEETQ-------------  74

Query  572  gaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
                 S A T NF           GI    ++ RQ SLTLP  L +KTVDEVW E+ 
Sbjct  75   -----SMASTSNF-----------GIPNNANIQRQGSLTLPRTLTQKTVDEVWRELQ  115



>gb|EEC71844.1| hypothetical protein OsI_04509 [Oryza sativa Indica Group]
Length=384

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 72/121 (60%), Gaps = 15/121 (12%)
 Frame = +2

Query  383  EGLSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphph  562
            E ++ L RQSSI SLTL+E Q++LCE G+NFGSMNMDEF+ +IW AEE Q          
Sbjct  30   EEIAPLARQSSILSLTLEELQNSLCEPGRNFGSMNMDEFVANIWNAEEFQ------ATTG  83

Query  563  phvgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
               GA  E+  V            +  G A    L RQ S +LP PLC+KTV+EVWAEI+
Sbjct  84   GCKGAMEETKVVDSG---------SGSGDAGGSGLCRQGSFSLPLPLCQKTVEEVWAEIN  134

Query  743  K  745
            +
Sbjct  135  Q  135



>ref|XP_006826228.1| hypothetical protein AMTR_s00132p00065700 [Amborella trichopoda]
 gb|ERM93465.1| hypothetical protein AMTR_s00132p00065700 [Amborella trichopoda]
Length=493

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 66/116 (57%), Gaps = 20/116 (17%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ S+YSLTLDEFQ+ L   GK+FGSMNMDEFL +IWTAEE+Q               
Sbjct  39   LARQPSVYSLTLDEFQNALGGMGKDFGSMNMDEFLKNIWTAEESQ---------------  83

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                 A+   F     +      + RQ SL RQ SLTLP  L +KTVDEVW ++ K
Sbjct  84   -----AMALAFEGNLGNSSNNSNLPRQFSLQRQGSLTLPRTLSQKTVDEVWRDLFK  134



>ref|XP_006645053.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Oryza brachyantha]
Length=387

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 72/121 (60%), Gaps = 17/121 (14%)
 Frame = +2

Query  383  EGLSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphph  562
            E ++ L RQSSI SLTL+E Q++LCE G+NFGSMNMDEF+ +IW AEE QA         
Sbjct  34   EQVAPLARQSSILSLTLEELQNSLCEPGRNFGSMNMDEFVANIWNAEEFQA---------  84

Query  563  phvgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
                    +       M    +V A  G A    L RQ S +LP PLC+KTV+EVWAEI+
Sbjct  85   --------ATGGCKGAMEETKAVGAGGGDAGGSGLCRQGSFSLPLPLCQKTVEEVWAEIN  136

Query  743  K  745
            +
Sbjct  137  Q  137



>emb|CAN60742.1| hypothetical protein VITISV_030212 [Vitis vinifera]
Length=338

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 65/112 (58%), Gaps = 26/112 (23%)
 Frame = +2

Query  404  RQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaa  583
            RQ+S++SLTLDE+Q     SGK+FGSMNMDE +NSIW  +EN             V +  
Sbjct  31   RQNSVFSLTLDEYQ---VRSGKSFGSMNMDELINSIWNGDEN---------ILYSVSSQD  78

Query  584  ESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEI  739
            E N   H              +A Q  L RQAS ++PPPLC+KT+DEVW+EI
Sbjct  79   EPNNDKH--------------MADQTDLPRQASFSIPPPLCKKTIDEVWSEI  116



>ref|XP_002274428.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1 [Vitis 
vinifera]
 ref|XP_010651900.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1 [Vitis 
vinifera]
Length=348

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 65/112 (58%), Gaps = 26/112 (23%)
 Frame = +2

Query  404  RQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaa  583
            RQ+S++SLTLDE+Q     SGK+FGSMNMDE +NSIW  +EN             V +  
Sbjct  31   RQNSVFSLTLDEYQ---VRSGKSFGSMNMDELINSIWNGDEN---------ILYSVSSQD  78

Query  584  ESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEI  739
            E N   H              +A Q  L RQAS ++PPPLC+KT+DEVW+EI
Sbjct  79   EPNNDKH--------------MADQTDLPRQASFSIPPPLCKKTIDEVWSEI  116



>ref|XP_002510209.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF52396.1| DNA binding protein, putative [Ricinus communis]
Length=422

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 66/118 (56%), Gaps = 30/118 (25%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ+SIYSLT DEFQ ++   GK+FGSMNMDE L +IWTAEE                 
Sbjct  30   LTRQTSIYSLTFDEFQSSMGGIGKDFGSMNMDELLKNIWTAEE-----------------  72

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
                   THN +   AS    +G   Q+ L RQ SLTLP  L +KTVDEVW +I K +
Sbjct  73   -------THNMV---ASCSGTQG---QEGLQRQGSLTLPRTLSQKTVDEVWKDISKEY  117



>ref|XP_008236589.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7 [Prunus 
mume]
Length=429

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 64/116 (55%), Gaps = 27/116 (23%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSS+YSLT DEFQ+T+   GK+FGSMNMDE L +IWTAEE Q               
Sbjct  29   LARQSSVYSLTFDEFQNTIGGLGKDFGSMNMDELLKNIWTAEETQ---------------  73

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                  VT     G+ S P         +L RQ SLTLP  L +KTVDEVW ++ +
Sbjct  74   -----GVTSTSGAGEGSAPG-------GNLQRQGSLTLPRTLSQKTVDEVWKDLIR  117



>gb|ACG48984.1| ABA response element binding factor [Zea mays]
 gb|AFW84488.1| putative bZIP transcription factor superfamily protein [Zea mays]
Length=412

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 63/117 (54%), Gaps = 8/117 (7%)
 Frame = +2

Query  389  LSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphph  568
            +  L RQSSI SLTL+E Q++LCE G+NFGSMNMDEF+ +IW AEE QA           
Sbjct  40   VDPLARQSSIMSLTLEELQNSLCEPGRNFGSMNMDEFMANIWNAEEFQAATAGCNKEGAE  99

Query  569  vgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEI  739
                  +         G             + L RQ S  LPPPL RKTV+EVWAEI
Sbjct  100  REPVPVATTTGTGENGGGGGS--------GRGLVRQGSFALPPPLSRKTVEEVWAEI  148



>ref|XP_003528292.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor bZIP71 [Glycine 
max]
Length=433

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 65/120 (54%), Gaps = 27/120 (23%)
 Frame = +2

Query  395  SLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvg  574
            SL RQ S+YSLT DEF +++  SGK+FGSMNMDE L +IWTAEE Q              
Sbjct  22   SLTRQPSVYSLTFDEFMNSMGGSGKDFGSMNMDELLKNIWTAEEVQT-------------  68

Query  575  aaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPP-PLCRKTVDEVWAEIHKTH  751
                         +  A V A+ G A    L RQ SLTLP  P  +KTVDEVW +I K +
Sbjct  69   -------------MASAGVAADDGGAGASHLQRQGSLTLPADPXAQKTVDEVWKDISKEY  115



>ref|NP_001151515.1| ABA response element binding factor [Zea mays]
 gb|ACG43145.1| ABA response element binding factor [Zea mays]
Length=408

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 63/117 (54%), Gaps = 8/117 (7%)
 Frame = +2

Query  389  LSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphph  568
            +  L RQSSI SLTL+E Q++LCE G+NFGSMNMDEF+ +IW AEE QA           
Sbjct  36   VDPLARQSSIMSLTLEELQNSLCEPGRNFGSMNMDEFMANIWNAEEFQAATAGCNKEGAE  95

Query  569  vgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEI  739
                  +         G             + L RQ S  LPPPL RKTV+EVWAEI
Sbjct  96   REPVPVATTTGTGENGGGGGS--------GRGLVRQGSFALPPPLSRKTVEEVWAEI  144



>gb|ABM90394.1| bZIP-type transcription factor ABI5 isoform 1 [Oryza sativa]
Length=378

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 71/121 (59%), Gaps = 15/121 (12%)
 Frame = +2

Query  383  EGLSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphph  562
            E ++ L RQSSI SLTL+E Q++LCE G+NFGSMNMDEF+ +IW AEE Q          
Sbjct  34   EEIAPLARQSSILSLTLEELQNSLCEPGRNFGSMNMDEFVANIWNAEEFQ------ATTG  87

Query  563  phvgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
               GA  E+  V            +  G A    L RQ S +LP PLC+KTV+EVW EI+
Sbjct  88   GCKGAMEEAKVVDSG---------SGSGDAGGSGLCRQGSFSLPLPLCQKTVEEVWTEIN  138

Query  743  K  745
            +
Sbjct  139  Q  139



>dbj|BAB90559.1| putative ABA response element binding factor [Oryza sativa Japonica 
Group]
 dbj|BAB91752.1| putative ABA response element binding factor [Oryza sativa Japonica 
Group]
 gb|ABM90395.1| bZIP-type transcription factor ABI5 isoform 2 [Oryza sativa]
Length=388

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 71/121 (59%), Gaps = 15/121 (12%)
 Frame = +2

Query  383  EGLSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphph  562
            E ++ L RQSSI SLTL+E Q++LCE G+NFGSMNMDEF+ +IW AEE Q          
Sbjct  34   EEIAPLARQSSILSLTLEELQNSLCEPGRNFGSMNMDEFVANIWNAEEFQ------ATTG  87

Query  563  phvgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
               GA  E+  V            +  G A    L RQ S +LP PLC+KTV+EVW EI+
Sbjct  88   GCKGAMEEAKVVDSG---------SGSGDAGGSGLCRQGSFSLPLPLCQKTVEEVWTEIN  138

Query  743  K  745
            +
Sbjct  139  Q  139



>ref|XP_010269668.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X2 [Nelumbo nucifera]
Length=369

 Score = 94.0 bits (232),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 64/116 (55%), Gaps = 27/116 (23%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ SI+SLTLDE Q+T+   GK+FGSMNMDEFL +IWTAEE Q               
Sbjct  31   LARQPSIFSLTLDEVQNTMGGLGKDFGSMNMDEFLKNIWTAEEAQ---------------  75

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                 A+   F   +  VP         +L RQ SLTLP  L +KTVDEVW +I K
Sbjct  76   -----AMASTFGGTEGGVPGT-------NLQRQGSLTLPRTLSQKTVDEVWRDIFK  119



>gb|EEE55706.1| hypothetical protein OsJ_04142 [Oryza sativa Japonica Group]
Length=384

 Score = 94.0 bits (232),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 71/121 (59%), Gaps = 15/121 (12%)
 Frame = +2

Query  383  EGLSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphph  562
            E ++ L RQSSI SLTL+E Q++LCE G+NFGSMNMDEF+ +IW AEE Q          
Sbjct  30   EEIAPLARQSSILSLTLEELQNSLCEPGRNFGSMNMDEFVANIWNAEEFQ------ATTG  83

Query  563  phvgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
               GA  E+  V            +  G A    L RQ S +LP PLC+KTV+EVW EI+
Sbjct  84   GCKGAMEEAKVVDSG---------SGSGDAGGSGLCRQGSFSLPLPLCQKTVEEVWTEIN  134

Query  743  K  745
            +
Sbjct  135  Q  135



>gb|EMT21515.1| Protein ABSCISIC ACID-INSENSITIVE 5 [Aegilops tauschii]
Length=397

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 71/121 (59%), Gaps = 27/121 (22%)
 Frame = +2

Query  404  RQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaa  583
            RQSSI++LT DE Q+++CE+G+NFGSMNMDEF+++IW A+E Q                 
Sbjct  34   RQSSIFALTSDELQYSVCEAGRNFGSMNMDEFMSNIWNAKEFQ-----------------  76

Query  584  ESNAVTHNFMLGQASVPA-------EKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
               A T   ++G    P            AR  +LARQ S +LPP LC++TV+EVW EI+
Sbjct  77   ---AATSGVLVGMEVDPVVGAGRGGGGEDARGTNLARQESFSLPPQLCQETVEEVWTEIN  133

Query  743  K  745
            +
Sbjct  134  R  134



>gb|KDP38330.1| hypothetical protein JCGZ_04255 [Jatropha curcas]
Length=413

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 64/118 (54%), Gaps = 32/118 (27%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ+SIYSLT DE Q T+   GK+FGSMNMDE L +IWTAEE Q               
Sbjct  30   LARQTSIYSLTFDELQSTMGGIGKDFGSMNMDELLKNIWTAEETQN--------------  75

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
                       M+  ++ P       Q+SL RQ SLTLP  L +KTVDEVW +I K +
Sbjct  76   -----------MVAASTGP-------QESLQRQGSLTLPRTLSQKTVDEVWKDISKEY  115



>emb|CBI28329.3| unnamed protein product [Vitis vinifera]
Length=324

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 65/112 (58%), Gaps = 26/112 (23%)
 Frame = +2

Query  404  RQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaa  583
            RQ+S++SLTLDE+Q     SGK+FGSMNMDE +NSIW  +EN             V +  
Sbjct  31   RQNSVFSLTLDEYQ---VRSGKSFGSMNMDELINSIWNGDEN---------ILYSVSSQD  78

Query  584  ESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEI  739
            E N   H              +A Q  L RQAS ++PPPLC+KT+DEVW+EI
Sbjct  79   EPNNDKH--------------MADQTDLPRQASFSIPPPLCKKTIDEVWSEI  116



>ref|XP_009371918.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1 [Pyrus 
x bretschneideri]
Length=372

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 67/117 (57%), Gaps = 28/117 (24%)
 Frame = +2

Query  404  RQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaa  583
            +Q+SI+SLTLDE Q   C+SG+NFGSMNMDEFL +IW+ EE+Q  +              
Sbjct  45   KQNSIFSLTLDEIQ---CKSGRNFGSMNMDEFLANIWSVEEDQEPSK-------------  88

Query  584  ESNAVTHNFMLGQASVPAEKGIARQ-QSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
                       G      EK    Q ++L+RQ S  +P PLC+KTVDEVW+EI K+ 
Sbjct  89   -----------GDQDSANEKDTTFQPKTLSRQGSFCIPTPLCKKTVDEVWSEIDKSR  134



>ref|XP_010269648.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010269652.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010269660.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X1 [Nelumbo nucifera]
Length=424

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 64/116 (55%), Gaps = 27/116 (23%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ SI+SLTLDE Q+T+   GK+FGSMNMDEFL +IWTAEE Q               
Sbjct  31   LARQPSIFSLTLDEVQNTMGGLGKDFGSMNMDEFLKNIWTAEEAQ---------------  75

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                 A+   F   +  VP         +L RQ SLTLP  L +KTVDEVW +I K
Sbjct  76   -----AMASTFGGTEGGVPGT-------NLQRQGSLTLPRTLSQKTVDEVWRDIFK  119



>ref|XP_010647747.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X2 [Vitis vinifera]
Length=424

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 65/117 (56%), Gaps = 28/117 (24%)
 Frame = +2

Query  395  SLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvg  574
            SL RQ SIYSLT+DEFQ++L   GK+FGSMNMDE L +IWTAEE Q    +         
Sbjct  23   SLTRQPSIYSLTIDEFQNSLGGVGKDFGSMNMDELLKNIWTAEETQNMTSSAG-------  75

Query  575  aaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                          G+ SVP         +L RQ SLTLP  + +KTVDEVW ++ K
Sbjct  76   --------------GEGSVPGG-------NLQRQGSLTLPRTISQKTVDEVWKDLLK  111



>ref|XP_002285116.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X1 [Vitis vinifera]
 ref|XP_003631613.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X1 [Vitis vinifera]
 ref|XP_010647745.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X1 [Vitis vinifera]
 ref|XP_010647746.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X1 [Vitis vinifera]
Length=435

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 65/117 (56%), Gaps = 28/117 (24%)
 Frame = +2

Query  395  SLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvg  574
            SL RQ SIYSLT+DEFQ++L   GK+FGSMNMDE L +IWTAEE Q    +         
Sbjct  23   SLTRQPSIYSLTIDEFQNSLGGVGKDFGSMNMDELLKNIWTAEETQNMTSSAG-------  75

Query  575  aaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                          G+ SVP         +L RQ SLTLP  + +KTVDEVW ++ K
Sbjct  76   --------------GEGSVPGG-------NLQRQGSLTLPRTISQKTVDEVWKDLLK  111



>emb|CAN64991.1| hypothetical protein VITISV_001773 [Vitis vinifera]
Length=425

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 65/117 (56%), Gaps = 28/117 (24%)
 Frame = +2

Query  395  SLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvg  574
            SL RQ SIYSLT+DEFQ++L   GK+FGSMNMDE L +IWTAEE Q    +         
Sbjct  23   SLTRQPSIYSLTIDEFQNSLGGVGKDFGSMNMDELLKNIWTAEETQNMTSSAG-------  75

Query  575  aaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                          G+ SVP         +L RQ SLTLP  + +KTVDEVW ++ K
Sbjct  76   --------------GEGSVPGG-------NLQRQGSLTLPRTISQKTVDEVWKDLLK  111



>ref|XP_010066019.1| PREDICTED: bZIP transcription factor TRAB1 [Eucalyptus grandis]
 gb|KCW63772.1| hypothetical protein EUGRSUZ_G01436 [Eucalyptus grandis]
 gb|KCW63773.1| hypothetical protein EUGRSUZ_G01436 [Eucalyptus grandis]
Length=425

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 64/117 (55%), Gaps = 27/117 (23%)
 Frame = +2

Query  395  SLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvg  574
            SL RQ SIY+LT DEFQ+T    GK+FGSMNMDE L +IWTAEE Q              
Sbjct  28   SLTRQPSIYALTFDEFQNTWGGLGKDFGSMNMDELLKNIWTAEETQ--------------  73

Query  575  aaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                  A+T     G  SVP         ++ RQ SLTLP  L +KTVDEVW ++ K
Sbjct  74   ------AMTSTTGTGDGSVPGG-------NIQRQGSLTLPRTLSQKTVDEVWKDLLK  117



>gb|EPS73887.1| hypothetical protein M569_00870, partial [Genlisea aurea]
Length=134

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 60/116 (52%), Gaps = 31/116 (27%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ SIYSLT DEFQ TL   GK+FGSMNM+E L SIWTAEEN                
Sbjct  3    LFRQPSIYSLTFDEFQSTLGGPGKDFGSMNMEELLKSIWTAEENH---------------  47

Query  578  aaESNAVTHNFMLGQASVP--AEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEI  739
                          QA VP  A  G      + RQ SLTLP  L +KTVDEVW ++
Sbjct  48   --------------QAVVPPSAVFGTLNSGGIQRQGSLTLPRTLSQKTVDEVWRDV  89



>gb|AAG13054.1|AC011807_13 Unknown protein [Arabidopsis thaliana]
Length=343

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 64/118 (54%), Gaps = 27/118 (23%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSS+YSLT DE Q TL E GK+FGSMNMDE L +IWTAE+ QA              
Sbjct  23   LARQSSLYSLTFDELQSTLGEPGKDFGSMNMDELLKNIWTAEDTQA--------------  68

Query  578  aaESNAVTHNFMLGQASV--PAEKG-IARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
                      FM   +SV  P   G +     L RQ SLTLP  L +KTVDEVW  ++
Sbjct  69   ----------FMTTTSSVAAPGPSGFVPGGNGLQRQGSLTLPRTLSQKTVDEVWKYLN  116



>ref|XP_004294799.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7-like [Fragaria 
vesca subsp. vesca]
Length=432

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 66/117 (56%), Gaps = 27/117 (23%)
 Frame = +2

Query  395  SLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvg  574
            SL RQ+S+YSLT DEFQ+T+   GK+FGSMNMDE L +IW+AEE Q              
Sbjct  28   SLARQTSVYSLTFDEFQNTMGGLGKDFGSMNMDELLKNIWSAEETQ--------------  73

Query  575  aaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                   +T     G+ + P         +L RQ SLTLP  L +KTVD+VW E+++
Sbjct  74   ------GITSTSGAGEGNAPVG-------NLQRQGSLTLPRTLSQKTVDDVWKELNR  117



>ref|XP_004501563.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5-like isoform 
X2 [Cicer arietinum]
Length=379

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 67/119 (56%), Gaps = 34/119 (29%)
 Frame = +2

Query  395  SLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvg  574
            SL RQ+S+YSLT+DEF +++  SGK+FGSMNMDE L +IW+AEE Q              
Sbjct  26   SLARQTSVYSLTVDEFMNSMGGSGKDFGSMNMDELLKNIWSAEEVQ--------------  71

Query  575  aaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
                             ++  E+GI+    L RQ SLTLP  L +KTVDEVW +I K +
Sbjct  72   -----------------TMGGEEGISH---LQRQGSLTLPRTLSQKTVDEVWKDISKDY  110



>ref|NP_001185183.1| abscisic acid-insensitive 5-like protein 4 [Arabidopsis thaliana]
 gb|AEE32465.1| abscisic acid responsive element-binding factor 1 [Arabidopsis 
thaliana]
Length=403

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 64/118 (54%), Gaps = 27/118 (23%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSS+YSLT DE Q TL E GK+FGSMNMDE L +IWTAE+ QA              
Sbjct  23   LARQSSLYSLTFDELQSTLGEPGKDFGSMNMDELLKNIWTAEDTQA--------------  68

Query  578  aaESNAVTHNFMLGQASV--PAEKG-IARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
                      FM   +SV  P   G +     L RQ SLTLP  L +KTVDEVW  ++
Sbjct  69   ----------FMTTTSSVAAPGPSGFVPGGNGLQRQGSLTLPRTLSQKTVDEVWKYLN  116



>gb|EMT09757.1| Protein ABSCISIC ACID-INSENSITIVE 5 [Aegilops tauschii]
Length=391

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 68/121 (56%), Gaps = 27/121 (22%)
 Frame = +2

Query  404  RQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaa  583
            RQSSI++LTLD  Q+++CE+G+NFGSMNMDEF ++IW A+E Q                 
Sbjct  34   RQSSIFALTLDGLQYSVCEAGRNFGSMNMDEFTSNIWNAKEFQ-----------------  76

Query  584  ESNAVTHNFMLGQ-------ASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
               A T   ++G        A        A    LA   S +LPPPLCRKTV+EVWA+I+
Sbjct  77   ---AATGGVLVGMEVAPVVGAGGGGGSEDAGGSKLAWHESFSLPPPLCRKTVEEVWAKIN  133

Query  743  K  745
            +
Sbjct  134  R  134



>ref|NP_564551.1| abscisic acid-insensitive 5-like protein 4 [Arabidopsis thaliana]
 sp|Q9M7Q5.1|AI5L4_ARATH RecName: Full=ABSCISIC ACID-INSENSITIVE 5-like protein 4; AltName: 
Full=Abscisic acid responsive elements-binding factor 
1; Short=ABRE-binding factor 1; AltName: Full=bZIP transcription 
factor 35; Short=AtbZIP35 [Arabidopsis thaliana]
 gb|AAF27179.1|AF093544_1 abscisic acid responsive elements-binding factor [Arabidopsis 
thaliana]
 gb|AAP40402.1| putative abscisic acid responsive elements-binding factor [Arabidopsis 
thaliana]
 gb|AAP40462.1| putative abscisic acid responsive elements-binding factor [Arabidopsis 
thaliana]
 dbj|BAE99050.1| abscisic acid responsive elements-binding factor [Arabidopsis 
thaliana]
 gb|AEE32464.1| abscisic acid responsive element-binding factor 1 [Arabidopsis 
thaliana]
Length=392

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 64/118 (54%), Gaps = 27/118 (23%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSS+YSLT DE Q TL E GK+FGSMNMDE L +IWTAE+ QA              
Sbjct  23   LARQSSLYSLTFDELQSTLGEPGKDFGSMNMDELLKNIWTAEDTQA--------------  68

Query  578  aaESNAVTHNFMLGQASV--PAEKG-IARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
                      FM   +SV  P   G +     L RQ SLTLP  L +KTVDEVW  ++
Sbjct  69   ----------FMTTTSSVAAPGPSGFVPGGNGLQRQGSLTLPRTLSQKTVDEVWKYLN  116



>gb|KHN32879.1| ABSCISIC ACID-INSENSITIVE 5-like protein 1 [Glycine soja]
Length=336

 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 74/132 (56%), Gaps = 24/132 (18%)
 Frame = +2

Query  386  GLSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphp  565
              S L +Q+SI SLTLDEF    C++GK+ GSMNMDEFL+SIW +++N            
Sbjct  18   AFSQLSKQNSILSLTLDEF---YCKNGKSLGSMNMDEFLSSIWNSDDN------------  62

Query  566  hvgaaaESNAVTHNFMLGQASVPAEKGIARQ-QSLARQASLTLPPPLCRKTVDEVWAEIH  742
                    N V         +   +  IA +  ++++  SL++PPP+C+KTVDEVW++IH
Sbjct  63   --------NQVNPPLPTLDEAAKGKSVIATEPTTISQPGSLSVPPPICKKTVDEVWSQIH  114

Query  743  KTHqqqqqqHNS  778
            K+       +NS
Sbjct  115  KSQPDHNDANNS  126



>ref|XP_009406636.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=365

 Score = 91.3 bits (225),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 62/114 (54%), Gaps = 29/114 (25%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ S+YSLT+DEFQ TL   GK+FGSMNMDE L +IWTAE                  
Sbjct  23   LARQGSVYSLTMDEFQSTLGGIGKDFGSMNMDELLRNIWTAE------------------  64

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEI  739
              ES A+T    LG  S P          L RQ SLTLP  L +KTVDEVW ++
Sbjct  65   --ESYAMTA--ALGDGSGPGS-------GLQRQGSLTLPRTLSQKTVDEVWRDL  107



>ref|XP_004501562.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5-like isoform 
X1 [Cicer arietinum]
Length=429

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 67/119 (56%), Gaps = 34/119 (29%)
 Frame = +2

Query  395  SLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvg  574
            SL RQ+S+YSLT+DEF +++  SGK+FGSMNMDE L +IW+AEE Q              
Sbjct  26   SLARQTSVYSLTVDEFMNSMGGSGKDFGSMNMDELLKNIWSAEEVQ--------------  71

Query  575  aaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
                             ++  E+GI+    L RQ SLTLP  L +KTVDEVW +I K +
Sbjct  72   -----------------TMGGEEGISH---LQRQGSLTLPRTLSQKTVDEVWKDISKDY  110



>ref|XP_003541970.2| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1-like [Glycine 
max]
Length=336

 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 74/131 (56%), Gaps = 24/131 (18%)
 Frame = +2

Query  389  LSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphph  568
             S L +Q+SI SLTLDEF    C++GK+ GSMNMDEFL+SIW +++N             
Sbjct  19   FSQLSKQNSILSLTLDEF---YCKNGKSLGSMNMDEFLSSIWNSDDN-------------  62

Query  569  vgaaaESNAVTHNFMLGQASVPAEKGIARQ-QSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                   N V         +   +  IA +  ++++  SL++PPP+C+KTVDEVW++IHK
Sbjct  63   -------NQVNPPLPTLDEAAKGKSVIATEPTTISQPGSLSVPPPICKKTVDEVWSQIHK  115

Query  746  THqqqqqqHNS  778
            +       +NS
Sbjct  116  SQPDHNDANNS  126



>ref|XP_008383939.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1 [Malus 
domestica]
 ref|XP_008383940.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1 [Malus 
domestica]
Length=372

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 66/117 (56%), Gaps = 28/117 (24%)
 Frame = +2

Query  404  RQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaa  583
            + +SI+SLTLDE Q   C+SG+NFGSMNMDEFL +IW+ EE+Q  +              
Sbjct  45   KHNSIFSLTLDEIQ---CKSGRNFGSMNMDEFLANIWSVEEDQEPSK-------------  88

Query  584  ESNAVTHNFMLGQASVPAEKGIARQ-QSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
                       G      EK    Q ++L+RQ S  +P PLC+KTVDEVW+EI K+ 
Sbjct  89   -----------GDQDSANEKDTTFQPKTLSRQGSFCIPTPLCKKTVDEVWSEIDKSR  134



>gb|ABG90380.1| bZIP transcription factor [Caragana korshinskii]
Length=423

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 64/118 (54%), Gaps = 34/118 (29%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSS+YSLT+DEF +++  SGK+FGSMNMDE L +IWTAEE Q     +         
Sbjct  31   LTRQSSVYSLTVDEFMNSMGGSGKDFGSMNMDELLKNIWTAEEVQTMGGEE---------  81

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
                 AV+H                    L RQ SLTLP  L +KTVD+VW +I K H
Sbjct  82   -----AVSH--------------------LQRQGSLTLPRTLSQKTVDQVWKDISKDH  114



>ref|XP_009631698.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 6 isoform 
X1 [Nicotiana tomentosiformis]
Length=415

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 67/123 (54%), Gaps = 29/123 (24%)
 Frame = +2

Query  377  NNEGLSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqph  556
            NN+  S L RQSSIYS T DE Q T C  GK+FGSMNMD+ L +IWTAEE+Q        
Sbjct  25   NNDNFS-LARQSSIYSFTFDELQST-CGLGKDFGSMNMDDLLKNIWTAEESQ--------  74

Query  557  phphvgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAE  736
                        A++ +   G  SVP         +L RQ SLTLP  + +KTVDEVW +
Sbjct  75   ------------ALSSSVAGGNVSVPVG-------NLQRQGSLTLPRTISQKTVDEVWKD  115

Query  737  IHK  745
              K
Sbjct  116  FQK  118



>ref|XP_009631699.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 6 isoform 
X2 [Nicotiana tomentosiformis]
Length=409

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 67/123 (54%), Gaps = 29/123 (24%)
 Frame = +2

Query  377  NNEGLSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqph  556
            NN+  S L RQSSIYS T DE Q T C  GK+FGSMNMD+ L +IWTAEE+Q        
Sbjct  25   NNDNFS-LARQSSIYSFTFDELQST-CGLGKDFGSMNMDDLLKNIWTAEESQ--------  74

Query  557  phphvgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAE  736
                        A++ +   G  SVP         +L RQ SLTLP  + +KTVDEVW +
Sbjct  75   ------------ALSSSVAGGNVSVPVG-------NLQRQGSLTLPRTISQKTVDEVWKD  115

Query  737  IHK  745
              K
Sbjct  116  FQK  118



>ref|XP_009791697.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7 [Nicotiana 
sylvestris]
 ref|XP_009791704.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7 [Nicotiana 
sylvestris]
Length=409

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 67/123 (54%), Gaps = 29/123 (24%)
 Frame = +2

Query  377  NNEGLSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqph  556
            NN+  S L RQSSIYS T DE Q T C  GK+FGSMNMD+ L +IWTAEE+Q        
Sbjct  25   NNDNFS-LARQSSIYSFTFDELQST-CGLGKDFGSMNMDDLLKNIWTAEESQ--------  74

Query  557  phphvgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAE  736
                        A++ +   G  SVP         +L RQ SLTLP  + +KTVDEVW +
Sbjct  75   ------------AMSSSVAGGNVSVPVG-------NLQRQGSLTLPRTISQKTVDEVWKD  115

Query  737  IHK  745
              K
Sbjct  116  FQK  118



>ref|XP_010263531.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010263532.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010263533.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X1 [Nelumbo nucifera]
Length=422

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 62/116 (53%), Gaps = 28/116 (24%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ SIYSLT DEFQ+T+   GK+FGSMNMDEFL +IWTAEE QA              
Sbjct  27   LARQPSIYSLTFDEFQNTMGGLGKDFGSMNMDEFLKNIWTAEEAQAM-------------  73

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                           AS    +G      L RQ SLTLP  L +KTVDEVW +I K
Sbjct  74   ---------------ASFGGAEGGFPGGGLQRQGSLTLPRTLSQKTVDEVWRDIFK  114



>ref|XP_010263534.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X2 [Nelumbo nucifera]
Length=412

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 62/116 (53%), Gaps = 28/116 (24%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ SIYSLT DEFQ+T+   GK+FGSMNMDEFL +IWTAEE QA              
Sbjct  27   LARQPSIYSLTFDEFQNTMGGLGKDFGSMNMDEFLKNIWTAEEAQA--------------  72

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                           AS    +G      L RQ SLTLP  L +KTVDEVW +I K
Sbjct  73   --------------MASFGGAEGGFPGGGLQRQGSLTLPRTLSQKTVDEVWRDIFK  114



>ref|XP_009406635.1| PREDICTED: bZIP transcription factor TRAB1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=398

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 62/114 (54%), Gaps = 29/114 (25%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ S+YSLT+DEFQ TL   GK+FGSMNMDE L +IWTAE                  
Sbjct  23   LARQGSVYSLTMDEFQSTLGGIGKDFGSMNMDELLRNIWTAE------------------  64

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEI  739
              ES A+T    LG  S P          L RQ SLTLP  L +KTVDEVW ++
Sbjct  65   --ESYAMTA--ALGDGSGPGS-------GLQRQGSLTLPRTLSQKTVDEVWRDL  107



>ref|XP_004293073.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Fragaria 
vesca subsp. vesca]
Length=366

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 68/116 (59%), Gaps = 21/116 (18%)
 Frame = +2

Query  404  RQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaa  583
            +Q+SI+SLTLDE Q    +SGK+FGSMNMDEFL +IW+A+ENQ  +           A  
Sbjct  37   KQNSIFSLTLDEIQ---SKSGKSFGSMNMDEFLANIWSADENQVSSEQPNQGDQENPANG  93

Query  584  ESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
            +             S PA        SL+RQ S ++P PLC+KTV+EVW+EI KT 
Sbjct  94   KDTT----------SNPA--------SLSRQGSFSIPTPLCKKTVEEVWSEIDKTR  131



>ref|XP_010500522.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 4 [Camelina 
sativa]
 ref|XP_010500523.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 4 [Camelina 
sativa]
Length=397

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 63/119 (53%), Gaps = 28/119 (24%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSS+YSLT DE Q+TL E GK+FGSMNMDE L +IWTAEE QA              
Sbjct  28   LARQSSLYSLTFDELQNTLGEPGKDFGSMNMDELLKNIWTAEEAQA--------------  73

Query  578  aaESNAVTHNFMLGQASVPAEKG----IARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
                      FM    S  A  G    +     L RQ SLTLP  L +KTVDEVW  ++
Sbjct  74   ----------FMTTTPSSVAASGPSGFVPGGNVLQRQGSLTLPRTLSQKTVDEVWKHLN  122



>ref|XP_009364307.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1 [Pyrus 
x bretschneideri]
Length=372

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 67/117 (57%), Gaps = 28/117 (24%)
 Frame = +2

Query  404  RQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaa  583
            +Q+SI+SLTLDE Q+   +SG+NFGSMNMDEFL +IW+ EE+Q  +              
Sbjct  45   KQNSIFSLTLDEIQY---KSGRNFGSMNMDEFLANIWSVEEDQEPSK-------------  88

Query  584  ESNAVTHNFMLGQASVPAEKGIARQ-QSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
                       G      EK    Q ++L+RQ S  +P PLC+KTVDEVW+EI K+ 
Sbjct  89   -----------GDQDSANEKDTTFQPKTLSRQGSFCIPTPLCKKTVDEVWSEIDKSR  134



>ref|XP_010112189.1| ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Morus notabilis]
 gb|EXC32855.1| ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Morus notabilis]
Length=446

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 65/117 (56%), Gaps = 25/117 (21%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCES-GKNFGSMNMDEFLNSIWTAEENQahahaqphphphvg  574
            L RQSSIYSLT DEFQ+T+  S GK+FGSMNMDE L +IW+AEE Q+             
Sbjct  30   LVRQSSIYSLTFDEFQNTMGGSLGKDFGSMNMDELLKNIWSAEEIQSMTS----------  79

Query  575  aaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                         +G ASV  + G      L RQ SLTLP  L +KTVDEVW  I K
Sbjct  80   -------------VGGASVAVQSG-GGGAPLQRQGSLTLPRTLSQKTVDEVWRNISK  122



>emb|CDY17109.1| BnaC06g00420D [Brassica napus]
Length=335

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 68/123 (55%), Gaps = 24/123 (20%)
 Frame = +2

Query  377  NNEGLSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqph  556
            +  G ++L RQ SIYSLT DEFQ +L   GK+FGSMNMDE L +IWTAEE QA A A   
Sbjct  32   DGSGGAALTRQGSIYSLTFDEFQSSL---GKDFGSMNMDELLKNIWTAEETQAMAVAAS-  87

Query  557  phphvgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAE  736
                      ++ V      GQ  +P          L RQ SLTLP  L  KTVD+VW +
Sbjct  88   ----------TSGVIPLAGGGQEGLP----------LQRQGSLTLPRTLSTKTVDQVWKD  127

Query  737  IHK  745
            + K
Sbjct  128  LSK  130



>ref|XP_010538116.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Tarenaya 
hassleriana]
 ref|XP_010538117.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Tarenaya 
hassleriana]
Length=433

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 65/119 (55%), Gaps = 31/119 (26%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ SIYSLT DEFQ +L   GK+FGSMNMDE L +IW+AEE QA A            
Sbjct  36   LNRQGSIYSLTFDEFQSSL---GKDFGSMNMDELLKNIWSAEETQAMA------------  80

Query  578  aaESNAVTHNFMLGQASVPAEKGIAR-QQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
                           ++   E G  R Q+ L RQ SLTLP  L +KTVDEVW +I K +
Sbjct  81   ---------------STSGVEAGAVRGQEGLQRQGSLTLPRTLSQKTVDEVWKDISKDY  124



>ref|XP_004230778.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7 [Solanum 
lycopersicum]
Length=414

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 61/116 (53%), Gaps = 26/116 (22%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSSIYSLT DE Q T    GK+FGS+NM+E L SIWTAEE+QA              
Sbjct  31   LARQSSIYSLTFDELQTTFSGLGKDFGSINMEELLKSIWTAEESQAATS-----------  79

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                           ++   E GIA   +L RQ SLTLP  L +KTVDEVW    K
Sbjct  80   ---------------STGGGEDGIAPVGNLQRQGSLTLPRTLSQKTVDEVWRNFQK  120



>dbj|BAN15747.1| ABA responsive element binding factor [Dianthus caryophyllus]
Length=410

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 60/114 (53%), Gaps = 18/114 (16%)
 Frame = +2

Query  404  RQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaa  583
            RQSSIYSLT DEFQ+TL  +GK+FGSMNMDE L SIW AEE Q                 
Sbjct  30   RQSSIYSLTFDEFQNTLGGAGKDFGSMNMDELLKSIWNAEETQ-----------------  72

Query  584  ESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
             S A       G  S   + G      L RQ SLT+P  L  + VDEVW +I K
Sbjct  73   -SMATATATAPGAGSSGQDGGNNSGGYLQRQGSLTIPRTLSLRKVDEVWKDIAK  125



>ref|XP_006305034.1| hypothetical protein CARUB_v10009399mg [Capsella rubella]
 gb|EOA37932.1| hypothetical protein CARUB_v10009399mg [Capsella rubella]
Length=389

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 63/118 (53%), Gaps = 27/118 (23%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSS+YSLT DE Q TL E GK+FGSMNMDE L +IW+AEE QA              
Sbjct  28   LARQSSLYSLTFDELQSTLGEPGKDFGSMNMDELLKNIWSAEETQA--------------  73

Query  578  aaESNAVTHNFMLGQASVPAEKG---IARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
                      FM   +SV A      +     L RQ SLTLP  L +KTVDEVW  ++
Sbjct  74   ----------FMTTPSSVAASGPSGYVPGGNGLQRQGSLTLPRTLSQKTVDEVWKHLN  121



>ref|XP_006354875.1| PREDICTED: ABRE binding factor isoform X1 [Solanum tuberosum]
 ref|XP_006354876.1| PREDICTED: ABRE binding factor isoform X2 [Solanum tuberosum]
Length=453

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 63/119 (53%), Gaps = 26/119 (22%)
 Frame = +2

Query  395  SLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvg  574
             L RQSSIYSLT DEF  +   SGK+FGSMNMDE L +IW AEENQ              
Sbjct  34   GLPRQSSIYSLTFDEFLSSTGGSGKDFGSMNMDELLKNIWNAEENQ--------------  79

Query  575  aaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
                   +    + GQ     E G+ R   L RQ SLTLP  L  KTVDEVW ++ K H
Sbjct  80   ------TIGGPGINGQ-----EVGVPRGH-LQRQGSLTLPRTLSHKTVDEVWRDMSKEH  126



>ref|XP_009598935.1| PREDICTED: bZIP transcription factor TRAB1-like [Nicotiana tomentosiformis]
Length=442

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 65/118 (55%), Gaps = 29/118 (25%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSS+YSLT DEF   L  SGK+FGSMNMDE L +IW+AEE+Q               
Sbjct  33   LARQSSVYSLTFDEF---LRGSGKDFGSMNMDELLKNIWSAEESQN--------------  75

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
                        +G + V  ++   R  +L RQ SLTLP  L +KT+DEVW ++ K +
Sbjct  76   ------------MGTSGVGGQEAGVRGGNLQRQGSLTLPRTLSQKTIDEVWKDMSKEY  121



>gb|KHG05529.1| abscisic acid-insensitive 5-like protein 4 [Gossypium arboreum]
Length=426

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 63/116 (54%), Gaps = 26/116 (22%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSSIYSLT DE Q+T    GK+FGSMNMDE L +I TAEE QA              
Sbjct  29   LTRQSSIYSLTFDELQNTFGGIGKDFGSMNMDELLKNISTAEETQA--------------  74

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                      FM   ASVP  +G     +L RQ SLTLP  L +KTVDEVW  + K
Sbjct  75   ----------FMT--ASVPGGEGSLSGGNLQRQGSLTLPRTLSQKTVDEVWRNLMK  118



>ref|XP_010461819.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 4 isoform 
X1 [Camelina sativa]
 ref|XP_010461820.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 4 isoform 
X1 [Camelina sativa]
Length=398

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 62/119 (52%), Gaps = 28/119 (24%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSS+YSLT DE Q TL E GK+FGSMNMDE L +IWTAEE QA              
Sbjct  28   LARQSSLYSLTFDELQSTLGEPGKDFGSMNMDELLKNIWTAEEAQA--------------  73

Query  578  aaESNAVTHNFMLGQASVPAEKG----IARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
                      FM    S  A  G    +     L RQ SLTLP  L +KTVDEVW  ++
Sbjct  74   ----------FMTTTPSSVAASGPSGFVPGGNVLQRQGSLTLPRTLSQKTVDEVWKHLN  122



>ref|NP_001274925.1| ABRE binding factor [Solanum tuberosum]
 gb|ADL70202.1| ABRE binding factor [Solanum tuberosum]
Length=453

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 63/119 (53%), Gaps = 26/119 (22%)
 Frame = +2

Query  395  SLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvg  574
             L RQSSIYSLT DEF  +   SGK+FGSMNMDE L +IW AEENQ              
Sbjct  34   GLPRQSSIYSLTFDEFLSSTGGSGKDFGSMNMDELLKNIWNAEENQ--------------  79

Query  575  aaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
                   +    + GQ     E G+ R   L RQ SLTLP  L  KTVDEVW ++ K H
Sbjct  80   ------TIGGPGINGQ-----EVGVPRGH-LQRQGSLTLPRTLSHKTVDEVWRDMSKEH  126



>ref|XP_010461821.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 4 isoform 
X2 [Camelina sativa]
Length=388

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 62/119 (52%), Gaps = 28/119 (24%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSS+YSLT DE Q TL E GK+FGSMNMDE L +IWTAEE QA              
Sbjct  28   LARQSSLYSLTFDELQSTLGEPGKDFGSMNMDELLKNIWTAEEAQA--------------  73

Query  578  aaESNAVTHNFMLGQASVPAEKG----IARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
                      FM    S  A  G    +     L RQ SLTLP  L +KTVDEVW  ++
Sbjct  74   ----------FMTTTPSSVAASGPSGFVPGGNVLQRQGSLTLPRTLSQKTVDEVWKHLN  122



>dbj|BAB61098.1| phi-2 [Nicotiana tabacum]
Length=464

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 64/117 (55%), Gaps = 28/117 (24%)
 Frame = +2

Query  395  SLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvg  574
            SL RQSSIYS T DE Q T C  GK+FGSMNMD+ L +IWTAEE+Q              
Sbjct  85   SLARQSSIYSFTFDELQST-CGLGKDFGSMNMDDLLKNIWTAEESQ--------------  129

Query  575  aaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                  A++ +   G  SVP         +L RQ SLTLP  + +KTVDEVW +  K
Sbjct  130  ------ALSSSVAGGNVSVPVG-------NLQRQGSLTLPRTISQKTVDEVWKDFQK  173



>dbj|BAB02453.1| abscisic acid responsive elements-binding factor [Arabidopsis 
thaliana]
Length=442

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 62/119 (52%), Gaps = 34/119 (29%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSS+YSLT DE Q+TL   GK+FGSMNMDE L SIWTAEE QA              
Sbjct  34   LARQSSVYSLTFDELQNTLGGPGKDFGSMNMDELLKSIWTAEEAQA--------------  79

Query  578  aaESNAVTHNFMLGQASVPAEKGIAR--------QQSLARQASLTLPPPLCRKTVDEVW  730
                        +   S PA   +A+          +L RQ SLTLP  + +KTVDEVW
Sbjct  80   ------------MAMTSAPAATAVAQPGAGIPPPGGNLQRQGSLTLPRTISQKTVDEVW  126



>gb|KDP42271.1| hypothetical protein JCGZ_01595 [Jatropha curcas]
Length=456

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 67/121 (55%), Gaps = 28/121 (23%)
 Frame = +2

Query  386  GLSSLGRQSSIYSLTLDEFQHTLCES-GKNFGSMNMDEFLNSIWTAEENQahahaqphph  562
            G S L RQSSIYSLT DEFQ++     GK+ GSMNMDE L +IWTAEE Q          
Sbjct  25   GNSPLVRQSSIYSLTFDEFQNSWGGGLGKDLGSMNMDELLKNIWTAEETQ----------  74

Query  563  phvgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
                      A+T+   +G+ S P         +L RQ SLTLP  L +KTVDEVW ++ 
Sbjct  75   ----------AMTNTVGVGEGSFPG-------GNLQRQGSLTLPRTLSQKTVDEVWRDLI  117

Query  743  K  745
            K
Sbjct  118  K  118



>gb|AGG39700.1| bZIP transcription factor bZIP8 [Camellia sinensis]
Length=436

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 64/118 (54%), Gaps = 21/118 (18%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ+SIYSLT DEFQ T+  SGK+FGSMNMDE L +IW+AEE Q               
Sbjct  28   LARQTSIYSLTFDEFQSTIGGSGKDFGSMNMDELLKNIWSAEETQTVGTTSGL-------  80

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
                          Q     ++G+A    L RQ SLTLP  L +KTVDEVW ++ K +
Sbjct  81   --------------QGQGQGQEGVAPNGHLQRQGSLTLPRTLSQKTVDEVWRDLAKEY  124



>ref|XP_002964990.1| hypothetical protein SELMODRAFT_266892 [Selaginella moellendorffii]
 gb|EFJ33828.1| hypothetical protein SELMODRAFT_266892 [Selaginella moellendorffii]
Length=400

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 61/114 (54%), Gaps = 33/114 (29%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ SIYSLTLDEFQ +L E GKNFGSMNMDE L +IWTAEE+Q               
Sbjct  3    LPRQQSIYSLTLDEFQSSLGEPGKNFGSMNMDELLKNIWTAEESQ---------------  47

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEI  739
                 A+   F+          GI RQ SL     L LP  L  KTVDEVW +I
Sbjct  48   -----AMAAAFL----------GIQRQNSLTL---LPLPQSLSAKTVDEVWKDI  83



>ref|XP_006592764.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1-like [Glycine 
max]
Length=334

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 73/130 (56%), Gaps = 24/130 (18%)
 Frame = +2

Query  389  LSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphph  568
             S L +Q+SI SLTLDEF    C++GK+ GSMNMDEFL+SIW +++N             
Sbjct  19   FSQLSKQNSILSLTLDEF---YCKNGKSLGSMNMDEFLSSIWNSDDN-------------  62

Query  569  vgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKT  748
                   N V  +      +   +  +A + +   Q  L++PPP+C+KTVDE+W++IHK+
Sbjct  63   -------NQVNPSLPTLDEAAKGKSVVATEPTTISQP-LSVPPPICKKTVDEIWSQIHKS  114

Query  749  HqqqqqqHNS  778
                 + +NS
Sbjct  115  QPHYNEANNS  124



>ref|XP_010089831.1| ABSCISIC ACID-INSENSITIVE 5-like protein 1 [Morus notabilis]
 gb|EXB38447.1| ABSCISIC ACID-INSENSITIVE 5-like protein 1 [Morus notabilis]
Length=383

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 68/119 (57%), Gaps = 13/119 (11%)
 Frame = +2

Query  389  LSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphph  568
            L SL +Q+SI+SLT DE Q    +SG++FGSMNM+EF+ +IW+ EENQ       +    
Sbjct  40   LPSLNKQNSIFSLTFDEIQG---KSGRSFGSMNMEEFIANIWSVEENQVSPQQTNNQEQ-  95

Query  569  vgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                     V +N     A          + +L+RQ S ++P PLC+KTVDE+W EIHK
Sbjct  96   ---------VLNNDKKLSAQPSNNNNSTNKSTLSRQGSFSIPIPLCKKTVDEIWFEIHK  145



>ref|NP_001189934.1| ABRE binding factor 4 [Arabidopsis thaliana]
 gb|AEE76220.1| ABRE binding factor 4 [Arabidopsis thaliana]
Length=432

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 62/119 (52%), Gaps = 34/119 (29%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSS+YSLT DE Q+TL   GK+FGSMNMDE L SIWTAEE QA              
Sbjct  34   LARQSSVYSLTFDELQNTLGGPGKDFGSMNMDELLKSIWTAEEAQA--------------  79

Query  578  aaESNAVTHNFMLGQASVPAEKGIAR--------QQSLARQASLTLPPPLCRKTVDEVW  730
                        +   S PA   +A+          +L RQ SLTLP  + +KTVDEVW
Sbjct  80   ------------MAMTSAPAATAVAQPGAGIPPPGGNLQRQGSLTLPRTISQKTVDEVW  126



>ref|XP_002518757.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF43682.1| DNA binding protein, putative [Ricinus communis]
Length=433

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 66/121 (55%), Gaps = 28/121 (23%)
 Frame = +2

Query  386  GLSSLGRQSSIYSLTLDEFQHTLCES-GKNFGSMNMDEFLNSIWTAEENQahahaqphph  562
            G+S L RQ SIYSLT DEFQ+T     GK+ GSMNMDE L +IWTAEE Q          
Sbjct  25   GISPLARQGSIYSLTFDEFQNTWGGGLGKDLGSMNMDELLKNIWTAEETQ----------  74

Query  563  phvgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
                      A+T+       SV    G A   +L RQ SLTLP  L +KTVDEVW ++ 
Sbjct  75   ----------AMTN-------SVVGVDGSAPGGNLQRQGSLTLPRTLSQKTVDEVWKDLV  117

Query  743  K  745
            K
Sbjct  118  K  118



>gb|AHA43414.1| abscisic acid-insensitive 5-like protein [Solanum nigrum]
Length=415

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 66/130 (51%), Gaps = 26/130 (20%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSSIYSLT DE Q T    GK+FGS+NM+E L SIWTAEE+Q               
Sbjct  31   LARQSSIYSLTFDELQTTFSGLGKDFGSINMEELLKSIWTAEESQ---------------  75

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTHqq  757
                 AVT       ++   E G A   +L RQ SLTLP  L +KTVDEVW    K    
Sbjct  76   -----AVTS------STGGGEDGNAPIGNLQRQGSLTLPRTLSQKTVDEVWRNFQKETTV  124

Query  758  qqqqHNSDGK  787
              +  +  GK
Sbjct  125  STKDGSDTGK  134



>ref|XP_006393221.1| hypothetical protein EUTSA_v10012271mg [Eutrema salsugineum]
 gb|ESQ30507.1| hypothetical protein EUTSA_v10012271mg [Eutrema salsugineum]
Length=386

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 63/129 (49%), Gaps = 20/129 (16%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSS+Y+LT+DE Q TL E GK+FGSMNMDE L +IWTAEE QA              
Sbjct  28   LARQSSLYALTIDELQSTLGEPGKDFGSMNMDELLKNIWTAEETQAIMTTPSSIA-----  82

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTHqq  757
                           A  P+   +     L RQ SLTLP  L +KTVDEVW  +      
Sbjct  83   ---------------AVQPSTGFVPGGNLLQRQGSLTLPRTLSQKTVDEVWKNLMSKESG  127

Query  758  qqqqHNSDG  784
                 NS G
Sbjct  128  NGDMGNSCG  136



>ref|NP_566629.1| ABRE binding factor 4 [Arabidopsis thaliana]
 sp|Q9M7Q2.1|AI5L7_ARATH RecName: Full=ABSCISIC ACID-INSENSITIVE 5-like protein 7; AltName: 
Full=ABA-responsive element-binding protein 2; AltName: 
Full=Abscisic acid responsive elements-binding factor 4; Short=ABRE-binding 
factor 4; AltName: Full=bZIP transcription 
factor 38; Short=AtbZIP38 [Arabidopsis thaliana]
 gb|AAF27182.1|AF093547_1 abscisic acid responsive elements-binding factor [Arabidopsis 
thaliana]
 dbj|BAB12405.1| ABA-responsive element binding protein 2 (AREB2) [Arabidopsis 
thaliana]
 gb|AAK92834.1| putative abscisic acid responsive elements-binding factor [Arabidopsis 
thaliana]
 gb|AAM14237.1| putative abscisic acid responsive elements-binding factor [Arabidopsis 
thaliana]
 gb|AEE76218.1| ABRE binding factor 4 [Arabidopsis thaliana]
Length=431

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 62/119 (52%), Gaps = 34/119 (29%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSS+YSLT DE Q+TL   GK+FGSMNMDE L SIWTAEE QA              
Sbjct  34   LARQSSVYSLTFDELQNTLGGPGKDFGSMNMDELLKSIWTAEEAQA--------------  79

Query  578  aaESNAVTHNFMLGQASVPAEKGIAR--------QQSLARQASLTLPPPLCRKTVDEVW  730
                        +   S PA   +A+          +L RQ SLTLP  + +KTVDEVW
Sbjct  80   ------------MAMTSAPAATAVAQPGAGIPPPGGNLQRQGSLTLPRTISQKTVDEVW  126



>gb|KHG23315.1| abscisic acid-insensitive 5-like protein 5 [Gossypium arboreum]
Length=404

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 59/118 (50%), Gaps = 30/118 (25%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ SIYSLT DEFQ T+   GK+FGSMNMDE L +IW+AEE Q  A            
Sbjct  26   LSRQPSIYSLTFDEFQSTMGGIGKDFGSMNMDELLKNIWSAEETQTMASYSG--------  77

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
                                  G+     L RQ SLTLP  L +KTVDEVW +I K +
Sbjct  78   ----------------------GLDAYGGLQRQGSLTLPRTLSQKTVDEVWKDISKEY  113



>emb|CDY51041.1| BnaA06g03040D [Brassica napus]
Length=330

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 59/114 (52%), Gaps = 17/114 (15%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            LGRQSS+YSLT DE Q TL E GK FGSMNMDE L +IWTAEE              V  
Sbjct  28   LGRQSSLYSLTFDELQSTLGEPGKEFGSMNMDELLKNIWTAEETTQPIMTTTSSVASVQQ  87

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEI  739
                   +  F  G  S+           + RQ SLTLP  L +KTVDEVW  +
Sbjct  88   P------SSGFAPGGGSL-----------VQRQGSLTLPRTLSQKTVDEVWKHL  124



>ref|XP_011074426.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Sesamum 
indicum]
 ref|XP_011074427.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Sesamum 
indicum]
Length=433

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 64/121 (53%), Gaps = 34/121 (28%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ SIYSLT +EFQ T+  SGK+FGSMNMDE L SIW+AEENQ               
Sbjct  30   LTRQPSIYSLTFEEFQSTVGGSGKDFGSMNMDELLKSIWSAEENQ---------------  74

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQS---LARQASLTLPPPLCRKTVDEVWAEIHKT  748
                            +V +  G   Q+    L +Q SLTLP  L +KTVDEVW +I K 
Sbjct  75   ----------------NVGSTSGGGCQEGSGYLQKQGSLTLPRTLSQKTVDEVWRDISKE  118

Query  749  H  751
            +
Sbjct  119  Y  119



>ref|XP_003596807.1| Abscisic acid insensitive [Medicago truncatula]
 gb|AES67058.1| bZIP transcription factor [Medicago truncatula]
Length=324

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 75/131 (57%), Gaps = 33/131 (25%)
 Frame = +2

Query  389  LSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphph  568
             S   +Q+SI SLTLDEFQ   C+SGK+F S+NMDEFL SIW++ +              
Sbjct  19   FSQPSKQTSILSLTLDEFQ---CKSGKSFSSLNMDEFLASIWSSND--------------  61

Query  569  vgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQ--ASLTLPPPLCRKTVDEVWAEIH  742
                 E+   THN          +  +  Q ++++Q   S ++PPP+C+KTVDEVW+EIH
Sbjct  62   -----EATTHTHN---------TKNVVTTQHTISQQFGNSFSVPPPICKKTVDEVWSEIH  107

Query  743  KTHqqqqqqHN  775
            K  QQ ++ +N
Sbjct  108  KNQQQFKETNN  118



>ref|NP_001154626.1| ABRE binding factor 4 [Arabidopsis thaliana]
 gb|AEE76219.1| ABRE binding factor 4 [Arabidopsis thaliana]
Length=415

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 62/119 (52%), Gaps = 34/119 (29%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSS+YSLT DE Q+TL   GK+FGSMNMDE L SIWTAEE QA              
Sbjct  34   LARQSSVYSLTFDELQNTLGGPGKDFGSMNMDELLKSIWTAEEAQA--------------  79

Query  578  aaESNAVTHNFMLGQASVPAEKGIAR--------QQSLARQASLTLPPPLCRKTVDEVW  730
                        +   S PA   +A+          +L RQ SLTLP  + +KTVDEVW
Sbjct  80   ------------MAMTSAPAATAVAQPGAGIPPPGGNLQRQGSLTLPRTISQKTVDEVW  126



>ref|XP_007017213.1| Abscisic acid responsive elements-binding factor 2 isoform 1 
[Theobroma cacao]
 ref|XP_007017214.1| Abscisic acid responsive elements-binding factor 2 isoform 1 
[Theobroma cacao]
 gb|EOY14438.1| Abscisic acid responsive elements-binding factor 2 isoform 1 
[Theobroma cacao]
 gb|EOY14439.1| Abscisic acid responsive elements-binding factor 2 isoform 1 
[Theobroma cacao]
Length=436

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 59/116 (51%), Gaps = 30/116 (26%)
 Frame = +2

Query  404  RQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvgaaa  583
            RQ SIYSLT DEFQ T+   GK+FGSMNMDE L +IW+AEE Q  A              
Sbjct  35   RQPSIYSLTFDEFQSTIGGIGKDFGSMNMDELLKNIWSAEETQTMAS-------------  81

Query  584  ESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
                             +  G+     L RQ SLTLP  L +KTVDEVW +I K +
Sbjct  82   -----------------SSGGLEGNGGLQRQGSLTLPRTLSQKTVDEVWKDIAKEY  120



>ref|XP_008220234.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X2 [Prunus mume]
Length=368

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 63/120 (53%), Gaps = 23/120 (19%)
 Frame = +2

Query  386  GLSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphp  565
            G++ L RQSSIYSLT +E Q+T+  SGK+FGSMNMDE L SIWTAEE Q  A +      
Sbjct  16   GINPLARQSSIYSLTFEELQNTIGGSGKDFGSMNMDELLKSIWTAEETQIMAPSGGGAGG  75

Query  566  hvgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
              G                             SL RQ SLTLP  L +KTVDEVW  I K
Sbjct  76   QNGLGLGG-----------------------GSLQRQGSLTLPRTLSQKTVDEVWKNISK  112



>ref|XP_002977062.1| hypothetical protein SELMODRAFT_443424 [Selaginella moellendorffii]
 gb|EFJ21671.1| hypothetical protein SELMODRAFT_443424 [Selaginella moellendorffii]
Length=463

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 72/120 (60%), Gaps = 9/120 (8%)
 Frame = +2

Query  386  GLSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphp  565
            G  +L RQ SIYSLTLDEFQ +L E GKNFGSMNMD+ L +IWTAEE+QA A A    + 
Sbjct  33   GSMALPRQQSIYSLTLDEFQSSLGEPGKNFGSMNMDDLLKNIWTAEESQAMAAALFSSND  92

Query  566  hvgaaaESNAVTHNFMLGQASVPAEK--GIARQQSLARQASLTLPPPLCRKTVDEVWAEI  739
               ++A +     +  L    +P +   GI RQ SL     L LP  L  KTVDEVW +I
Sbjct  93   PSSSSAGAVVAAEDPSL----LPRQPSLGIQRQNSLTL---LPLPQSLSAKTVDEVWKDI  145



>ref|XP_009147888.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 4 [Brassica 
rapa]
Length=368

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 59/114 (52%), Gaps = 17/114 (15%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            LGRQSS+YSLT DE Q TL E GK FGSMNMDE L +IWTAEE              V  
Sbjct  28   LGRQSSLYSLTFDELQSTLGEPGKEFGSMNMDELLKNIWTAEETTQPIMTTTSSVASVQQ  87

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEI  739
                   +  F  G  S+           + RQ SLTLP  L +KTVDEVW  +
Sbjct  88   P------SSGFAPGGGSL-----------VQRQGSLTLPRTLSQKTVDEVWKHL  124



>ref|XP_011083868.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Sesamum 
indicum]
 ref|XP_011083869.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Sesamum 
indicum]
 ref|XP_011083870.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Sesamum 
indicum]
 ref|XP_011083871.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Sesamum 
indicum]
Length=435

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 67/123 (54%), Gaps = 36/123 (29%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSS+YSLT +EFQ+T+  SGK+FGSMNMDE L +IW+AEE+Q               
Sbjct  30   LVRQSSVYSLTFEEFQNTVGGSGKDFGSMNMDELLKNIWSAEESQ---------------  74

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQS-----LARQASLTLPPPLCRKTVDEVWAEIH  742
                     NF        A  G A Q+      L RQ SLTLP  L +KTVDEVW ++ 
Sbjct  75   ---------NF-------GATYGNAGQEGNGNGYLQRQGSLTLPRTLSQKTVDEVWRDMS  118

Query  743  KTH  751
            K +
Sbjct  119  KEY  121



>ref|XP_009793574.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Nicotiana 
sylvestris]
Length=436

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 60/118 (51%), Gaps = 25/118 (21%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ SIYSLT DEF  T   SGK+FGSMNMDE L +IW AEE+Q               
Sbjct  32   LPRQPSIYSLTFDEFLSTTGGSGKDFGSMNMDELLKNIWNAEESQT--------------  77

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
                       M G      E G  +  +L RQ SLTLP  L  KTVDEVW ++ K +
Sbjct  78   -----------MGGSGINGQEVGSVQSGNLQRQGSLTLPRTLSHKTVDEVWKDMSKEY  124



>gb|KHG14558.1| abscisic acid-insensitive 5-like protein 4 [Gossypium arboreum]
Length=406

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 64/116 (55%), Gaps = 27/116 (23%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSSIYSLT DE Q+T    GK+FGSMNMDE L +I TAEE Q               
Sbjct  29   LARQSSIYSLTFDELQNTFGGLGKDFGSMNMDELLRNISTAEETQG--------------  74

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                        L  ASVP  +G++   +L RQ SLTLP  L +KTV+EVW ++ K
Sbjct  75   ------------LMTASVPGGEGVS-GGNLQRQGSLTLPRTLSQKTVEEVWKDLFK  117



>ref|XP_007042439.1| Abscisic acid responsive element-binding factor 1, putative isoform 
1 [Theobroma cacao]
 ref|XP_007042440.1| Abscisic acid responsive element-binding factor 1, putative isoform 
1 [Theobroma cacao]
 gb|EOX98270.1| Abscisic acid responsive element-binding factor 1, putative isoform 
1 [Theobroma cacao]
 gb|EOX98271.1| Abscisic acid responsive element-binding factor 1, putative isoform 
1 [Theobroma cacao]
Length=423

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 63/116 (54%), Gaps = 26/116 (22%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSSIYSLT DE Q+T    GK+FGSMNMDE L +I TAEE Q               
Sbjct  29   LARQSSIYSLTFDELQNTFGGLGKDFGSMNMDELLKNISTAEETQ---------------  73

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                 AVT       ASV   +G     +L RQ SLTLP  L +KTVDEVW ++ K
Sbjct  74   -----AVTT------ASVAGGEGSFSGGNLQRQGSLTLPRTLSQKTVDEVWRDLMK  118



>emb|CDY63041.1| BnaCnng41320D [Brassica napus]
Length=354

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 57/111 (51%), Gaps = 29/111 (26%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSS+YSLT DE Q T C  GK+ GSMNMDE L SIWTAEE QA              
Sbjct  27   LARQSSVYSLTFDELQSTFCGPGKDLGSMNMDELLKSIWTAEEAQA--------------  72

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVW  730
                       M   A      G+    +L RQ SLTLP  + +KTVDEVW
Sbjct  73   -----------MTSSAVAQPNDGV----NLQRQGSLTLPRTISQKTVDEVW  108



>ref|XP_008220233.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X1 [Prunus mume]
Length=419

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 63/120 (53%), Gaps = 23/120 (19%)
 Frame = +2

Query  386  GLSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphp  565
            G++ L RQSSIYSLT +E Q+T+  SGK+FGSMNMDE L SIWTAEE Q  A +      
Sbjct  16   GINPLARQSSIYSLTFEELQNTIGGSGKDFGSMNMDELLKSIWTAEETQIMAPSGGGAGG  75

Query  566  hvgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
              G                             SL RQ SLTLP  L +KTVDEVW  I K
Sbjct  76   QNGLGLGG-----------------------GSLQRQGSLTLPRTLSQKTVDEVWKNISK  112



>ref|XP_007222748.1| hypothetical protein PRUPE_ppa006503mg [Prunus persica]
 gb|EMJ23947.1| hypothetical protein PRUPE_ppa006503mg [Prunus persica]
Length=409

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 63/120 (53%), Gaps = 23/120 (19%)
 Frame = +2

Query  386  GLSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphp  565
            G++ L RQSSIYSLT +E Q+T+  SGK+FGSMNMDE L SIWTAEE Q  A +      
Sbjct  16   GINPLARQSSIYSLTFEELQNTIGGSGKDFGSMNMDELLKSIWTAEETQIMAPSGGGAGG  75

Query  566  hvgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
              G                             SL RQ SLTLP  L +KTVDEVW  I K
Sbjct  76   QNGLGLGG-----------------------GSLQRQGSLTLPRTLSQKTVDEVWKNISK  112



>ref|XP_010479442.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 4 isoform 
X2 [Camelina sativa]
Length=418

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 61/119 (51%), Gaps = 28/119 (24%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSS+YSLT DE Q TL E GK+FGSMNMDE L +IWTAEE QA              
Sbjct  28   LARQSSLYSLTFDELQSTLGEPGKDFGSMNMDELLKNIWTAEEAQA--------------  73

Query  578  aaESNAVTHNFMLGQASVPAEKG----IARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
                      FM       A  G    +     L RQ SLTLP  L +KTVDEVW  ++
Sbjct  74   ----------FMTTTPYSVAASGPSGFVPGGNVLQRQGSLTLPRTLSQKTVDEVWKHLN  122



>ref|NP_001290004.1| ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010685236.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Beta vulgaris 
subsp. vulgaris]
 emb|CAP66259.1| ABA-responsive element binding protein 1 [Beta vulgaris subsp. 
vulgaris]
Length=489

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 66/117 (56%), Gaps = 11/117 (9%)
 Frame = +2

Query  395  SLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvg  574
            SL RQ S+YSLT DEFQ+TL   GK+FGSMNMDE L +IW+AEE Q  A         V 
Sbjct  40   SLARQLSVYSLTFDEFQNTLGGMGKDFGSMNMDELLKNIWSAEETQCMAPGAGAGTAAVA  99

Query  575  aaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
            AAA                  ++G +    L RQ SLTLP  L +KTVDEVW +I K
Sbjct  100  AAAAV-----------VGSGIQEGGSSGGYLQRQGSLTLPRTLSQKTVDEVWKDIAK  145



>ref|XP_008228533.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1 [Prunus 
mume]
Length=380

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 62/117 (53%), Gaps = 25/117 (21%)
 Frame = +2

Query  404  RQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEE-NQahahaqphphphvgaa  580
            +Q+SI SLTLDE Q   C+SG+NFGSMNMDEFL +IW+ EE NQ                
Sbjct  47   KQNSILSLTLDEIQ---CKSGRNFGSMNMDEFLANIWSVEEENQTQQQPSQCDQEASAKE  103

Query  581  aESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
               N  T                     L+RQ S ++P PLC+KTVDEVW+EI ++ 
Sbjct  104  TTINPST---------------------LSRQGSFSIPTPLCKKTVDEVWSEIDRSR  139



>ref|XP_011017194.1| PREDICTED: bZIP transcription factor TRAB1-like [Populus euphratica]
Length=454

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 64/123 (52%), Gaps = 30/123 (24%)
 Frame = +2

Query  386  GLSSLGRQSSIYSLTLDEFQHTLCES-GKNFGSMNMDEFLNSIWTAEENQahahaqphph  562
            G S L RQSSIYSLT DE Q+T+  S GK+FGSMNMDE L +IW+AEE Q          
Sbjct  24   GNSPLTRQSSIYSLTFDELQNTMGGSLGKDFGSMNMDELLKNIWSAEETQT---------  74

Query  563  phvgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
                                 +     G+    +L RQ SLTLP  L ++TVDEVW ++ 
Sbjct  75   --------------------IATATSTGVQEGGALQRQGSLTLPRTLSQRTVDEVWKDMS  114

Query  743  KTH  751
            K +
Sbjct  115  KEY  117



>ref|NP_191244.1| ABA-responsive element binding protein 3 [Arabidopsis thaliana]
 sp|Q9LES3.1|AI5L2_ARATH RecName: Full=ABSCISIC ACID-INSENSITIVE 5-like protein 2; AltName: 
Full=ABA-responsive element-binding protein 3; AltName: 
Full=Dc3 promoter-binding factor 3; Short=AtDPBF3; AltName: 
Full=bZIP transcription factor 66; Short=AtbZIP66 [Arabidopsis 
thaliana]
 emb|CAC00748.1| promoter-binding factor-like protein [Arabidopsis thaliana]
 dbj|BAB12406.1| ABA-responsive element binding protein 3 (AREB3) [Arabidopsis 
thaliana]
 gb|AAL32526.1| promoter-binding factor-like protein [Arabidopsis thaliana]
 gb|AAM10232.1| promoter-binding factor-like protein [Arabidopsis thaliana]
 gb|AEE79574.1| ABA-responsive element binding protein 3 [Arabidopsis thaliana]
Length=297

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 62/117 (53%), Gaps = 29/117 (25%)
 Frame = +2

Query  395  SLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvg  574
            SL RQSS+YSLTLDE Q+ L  SGK  GSMN+DE L S+ + E NQ              
Sbjct  15   SLNRQSSLYSLTLDEVQNHLGSSGKALGSMNLDELLKSVCSVEANQP-------------  61

Query  575  aaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                            +S+    G A Q+ L+RQ SLTLP  L +KTVDEVW +I +
Sbjct  62   ----------------SSMAVNGGAAAQEGLSRQGSLTLPRDLSKKTVDEVWKDIQQ  102



>gb|AAK19601.1|AF334208_1 bZIP protein DPBF3 [Arabidopsis thaliana]
Length=297

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 62/117 (53%), Gaps = 29/117 (25%)
 Frame = +2

Query  395  SLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvg  574
            SL RQSS+YSLTLDE Q+ L  SGK  GSMN+DE L S+ + E NQ              
Sbjct  15   SLNRQSSLYSLTLDEVQNHLGSSGKALGSMNLDELLKSVCSVEANQP-------------  61

Query  575  aaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                            +S+    G A Q+ L+RQ SLTLP  L +KTVDEVW +I +
Sbjct  62   ----------------SSMAVNGGAAAQEGLSRQGSLTLPRDLSKKTVDEVWKDIQQ  102



>ref|XP_010479441.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 4 isoform 
X1 [Camelina sativa]
Length=397

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 61/119 (51%), Gaps = 28/119 (24%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSS+YSLT DE Q TL E GK+FGSMNMDE L +IWTAEE QA              
Sbjct  28   LARQSSLYSLTFDELQSTLGEPGKDFGSMNMDELLKNIWTAEEAQA--------------  73

Query  578  aaESNAVTHNFMLGQASVPAEKG----IARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
                      FM       A  G    +     L RQ SLTLP  L +KTVDEVW  ++
Sbjct  74   ----------FMTTTPYSVAASGPSGFVPGGNVLQRQGSLTLPRTLSQKTVDEVWKHLN  122



>ref|XP_002883170.1| hypothetical protein ARALYDRAFT_479444 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59429.1| hypothetical protein ARALYDRAFT_479444 [Arabidopsis lyrata subsp. 
lyrata]
Length=432

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 62/111 (56%), Gaps = 20/111 (18%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSS+YSLT DE Q+TL   GK+FGSMNMDE L SIWTAEE Q              A
Sbjct  35   LARQSSVYSLTFDELQNTLGGPGKDFGSMNMDELLKSIWTAEEAQ------------GLA  82

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVW  730
               S+A T     G   +P         +L RQ SLTLP  + +KTVDEVW
Sbjct  83   MTSSSAATAVAQPG-TGIPGG-------NLQRQGSLTLPRTISQKTVDEVW  125



>ref|XP_008365140.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7 [Malus 
domestica]
Length=258

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 61/116 (53%), Gaps = 22/116 (19%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            + RQSSIY+LT +E Q+T+  SGK+FGSMNMDE L SIWTAEE Q  A A        G 
Sbjct  16   IARQSSIYTLTFEELQNTIGGSGKDFGSMNMDELLKSIWTAEETQIIAPAAGGAGGQDGL  75

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
               S                        SL RQ SLTLP  L +KTVDEVW  + K
Sbjct  76   DHGSGG----------------------SLQRQGSLTLPRTLSQKTVDEVWKNLSK  109



>ref|XP_008378041.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X3 [Malus domestica]
Length=368

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 61/116 (53%), Gaps = 22/116 (19%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            + RQSSIY+LT +E Q+T+  SGK+FGSMNMDE L SIWTAEE Q  A A        G 
Sbjct  16   IARQSSIYTLTFEELQNTIGGSGKDFGSMNMDELLKSIWTAEETQIIAPAAGGAGGQDGL  75

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
               S                        SL RQ SLTLP  L +KTVDEVW  + K
Sbjct  76   DHGSGG----------------------SLQRQGSLTLPRTLSQKTVDEVWKNLSK  109



>ref|XP_003564107.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Brachypodium 
distachyon]
Length=328

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 69/118 (58%), Gaps = 16/118 (14%)
 Frame = +2

Query  386  GLSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphp  565
            G  +L RQ SIYSLT DEFQ  L  +GK+FGSMNMDE L +IWTAEE+            
Sbjct  8    GAPALARQGSIYSLTFDEFQSALGGAGKDFGSMNMDELLRNIWTAEESN-----------  56

Query  566  hvgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEI  739
                 A + A T    +  ++V A+    +QQ++ RQ SLTLP  L + TVDEVW +I
Sbjct  57   -----AIAAAATATTAVPASNVDAQPPQPQQQAILRQGSLTLPRTLSQMTVDEVWRDI  109



>ref|XP_006487113.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7-like isoform 
X2 [Citrus sinensis]
Length=451

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 63/116 (54%), Gaps = 26/116 (22%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ S+YSLT +EFQ+T    GK+FGSMNMDE L +IWTAEEN          +    A
Sbjct  26   LARQPSVYSLTFEEFQNTWGGLGKDFGSMNMDELLKNIWTAEENH-------AMNSSASA  78

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
            A ESNA   N                   L RQ SLTLP  L +KTVDEVW ++ K
Sbjct  79   AGESNAPGGN-------------------LQRQGSLTLPRTLSQKTVDEVWRDLMK  115



>ref|XP_006406516.1| hypothetical protein EUTSA_v10020772mg [Eutrema salsugineum]
 gb|ESQ47969.1| hypothetical protein EUTSA_v10020772mg [Eutrema salsugineum]
Length=432

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 63/112 (56%), Gaps = 28/112 (25%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSS+YSLT DE Q+TL   GK+FGSMNMDE L SIWTAEE QA              
Sbjct  33   LARQSSVYSLTFDELQNTLGGPGKDFGSMNMDELLKSIWTAEEAQAM-------------  79

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQ-QSLARQASLTLPPPLCRKTVDEVW  730
                 A+T          PA   +A+   +L RQ SLTLP  + +KTVDEVW
Sbjct  80   -----AMTS---------PAVTAVAQPGGNLQRQGSLTLPRTISQKTVDEVW  117



>ref|XP_006487112.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7-like isoform 
X1 [Citrus sinensis]
Length=452

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 63/116 (54%), Gaps = 26/116 (22%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ S+YSLT +EFQ+T    GK+FGSMNMDE L +IWTAEEN          +    A
Sbjct  26   LARQPSVYSLTFEEFQNTWGGLGKDFGSMNMDELLKNIWTAEENH-------AMNSSASA  78

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
            A ESNA   N                   L RQ SLTLP  L +KTVDEVW ++ K
Sbjct  79   AGESNAPGGN-------------------LQRQGSLTLPRTLSQKTVDEVWRDLMK  115



>gb|AGG35955.1| ABA-responsive element binding factor 1 [Brassica napus]
Length=362

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 59/114 (52%), Gaps = 17/114 (15%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            LGRQSS+YSLT DE Q TL E GK FGSMNMDE L +IWTAEE              V  
Sbjct  28   LGRQSSLYSLTFDELQSTLGEPGKEFGSMNMDELLKNIWTAEETTQPIMTTTSSIASVQQ  87

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEI  739
             +   A            P   G+ +     RQ SLTLP  L +KTVDEVW  +
Sbjct  88   PSSGFA------------PGGGGLVQ-----RQGSLTLPRTLSQKTVDEVWKHL  124



>ref|XP_008378039.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X1 [Malus domestica]
Length=420

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 61/116 (53%), Gaps = 22/116 (19%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            + RQSSIY+LT +E Q+T+  SGK+FGSMNMDE L SIWTAEE Q  A A        G 
Sbjct  16   IARQSSIYTLTFEELQNTIGGSGKDFGSMNMDELLKSIWTAEETQIIAPAAGGAGGQDGL  75

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
               S                        SL RQ SLTLP  L +KTVDEVW  + K
Sbjct  76   DHGSGG----------------------SLQRQGSLTLPRTLSQKTVDEVWKNLSK  109



>gb|KHG25900.1| abscisic acid-insensitive 5-like protein 5 [Gossypium arboreum]
Length=417

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 60/118 (51%), Gaps = 30/118 (25%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ SIYSLT DEFQ T+   GK+FGSMNMDE L +IW+AEE Q               
Sbjct  28   LTRQPSIYSLTFDEFQSTMGGIGKDFGSMNMDELLRNIWSAEEIQTM-------------  74

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
                 A +   + G               L RQ SLTLP  L +KTVDEVW +I K +
Sbjct  75   -----ASSGGVLEGNG------------GLQRQGSLTLPRTLSQKTVDEVWKDISKEY  115



>ref|XP_008378040.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X2 [Malus domestica]
Length=419

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 61/116 (53%), Gaps = 22/116 (19%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            + RQSSIY+LT +E Q+T+  SGK+FGSMNMDE L SIWTAEE Q  A A        G 
Sbjct  16   IARQSSIYTLTFEELQNTIGGSGKDFGSMNMDELLKSIWTAEETQIIAPAAGGAGGQDGL  75

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
               S                        SL RQ SLTLP  L +KTVDEVW  + K
Sbjct  76   DHGSGG----------------------SLQRQGSLTLPRTLSQKTVDEVWKNLSK  109



>ref|XP_010664065.1| PREDICTED: ripening-related bZIP protein-like isoform X2 [Vitis 
vinifera]
Length=404

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 62/118 (53%), Gaps = 20/118 (17%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ SIYSLT DEFQ T+   GK+FGSMNMDE L +IW+AEE Q  A            
Sbjct  28   LVRQGSIYSLTFDEFQSTMGGIGKDFGSMNMDELLKNIWSAEEAQTMAAVAAAT------  81

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
                             +  ++G+     L RQ SLTLP  L +KTVDEVW ++ K +
Sbjct  82   --------------APPISVQEGVVAGGYLQRQGSLTLPRTLSQKTVDEVWKDMSKEY  125



>ref|NP_001268150.1| ripening-related bZIP protein-like [Vitis vinifera]
 ref|XP_010664064.1| PREDICTED: ripening-related bZIP protein-like isoform X1 [Vitis 
vinifera]
 emb|CAB85632.1| putative ripening-related bZIP protein [Vitis vinifera]
Length=447

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 62/118 (53%), Gaps = 20/118 (17%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ SIYSLT DEFQ T+   GK+FGSMNMDE L +IW+AEE Q  A            
Sbjct  28   LVRQGSIYSLTFDEFQSTMGGIGKDFGSMNMDELLKNIWSAEEAQTMAAVAAAT------  81

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
                             +  ++G+     L RQ SLTLP  L +KTVDEVW ++ K +
Sbjct  82   --------------APPISVQEGVVAGGYLQRQGSLTLPRTLSQKTVDEVWKDMSKEY  125



>gb|EPS63836.1| hypothetical protein M569_10951, partial [Genlisea aurea]
Length=335

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 62/117 (53%), Gaps = 28/117 (24%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSSIYSLTLDEFQ T+   G NFGSMNMDE L +I +AEENQ               
Sbjct  26   LSRQSSIYSLTLDEFQSTV---GMNFGSMNMDELLKNICSAEENQ---------------  67

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQS-LARQASLTLPPPLCRKTVDEVWAEIHK  745
                     N +   +   +  GI    S L RQ SLTLP  L  KTVDEVW +I K
Sbjct  68   ---------NLVSASSDSNSRDGIGFYSSHLQRQGSLTLPRTLSHKTVDEVWHDILK  115



>ref|XP_010525459.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 [Tarenaya 
hassleriana]
Length=253

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 64/129 (50%), Gaps = 35/129 (27%)
 Frame = +2

Query  395  SLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvg  574
            +L RQ S+YSLTL E Q  L  SGK  GSMN+DE L S+W+AE NQ+             
Sbjct  17   TLPRQGSLYSLTLGEVQTHLASSGKPLGSMNLDELLKSVWSAEANQSP------------  64

Query  575  aaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTHq  754
                             +VPA       Q L+RQ SLTLP  L +KTVDEVW EI ++ +
Sbjct  65   ----------------VNVPA-------QGLSRQGSLTLPGELSKKTVDEVWREIQQSKR  101

Query  755  qqqqqHNSD  781
                Q   D
Sbjct  102  GGSAQERKD  110



>ref|XP_010548013.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 6 [Tarenaya 
hassleriana]
 ref|XP_010548014.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 6 [Tarenaya 
hassleriana]
 ref|XP_010548015.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 6 [Tarenaya 
hassleriana]
 ref|XP_010548017.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 6 [Tarenaya 
hassleriana]
Length=419

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 63/116 (54%), Gaps = 0/116 (0%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ+S++SLT DEFQ+T    GK+FGSMNMDE L +IWTAEE+QA        +     
Sbjct  27   LARQNSVFSLTFDEFQNTWVGLGKDFGSMNMDELLKNIWTAEESQAMNTTTTTTNNINNG  86

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
               +   ++   +               +L RQ S TLP  L +KTVDEVW E+ K
Sbjct  87   NNSNIGNSNGLAVAMGGGGDGCVGFSGGNLQRQGSFTLPRTLSQKTVDEVWRELMK  142



>ref|XP_002302435.1| bZIP transcription factor 6 family protein [Populus trichocarpa]
 gb|EEE81708.1| bZIP transcription factor 6 family protein [Populus trichocarpa]
Length=456

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 65/123 (53%), Gaps = 30/123 (24%)
 Frame = +2

Query  386  GLSSLGRQSSIYSLTLDEFQHTLCES-GKNFGSMNMDEFLNSIWTAEENQahahaqphph  562
            G S L RQSSIYSLT DE Q+T+  S GK+FGSMNMDE L +IW+AEE Q          
Sbjct  24   GNSPLTRQSSIYSLTFDELQNTMGGSLGKDFGSMNMDELLKNIWSAEETQT---------  74

Query  563  phvgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
                            M    S   E+G      L RQ SLTLP  L ++TVDEVW ++ 
Sbjct  75   ----------------MATATSTVVEEG----GGLQRQGSLTLPRTLSQRTVDEVWKDMS  114

Query  743  KTH  751
            K +
Sbjct  115  KEY  117



>ref|XP_009346256.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Pyrus 
x bretschneideri]
 ref|XP_009346257.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Pyrus 
x bretschneideri]
 ref|XP_009346258.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Pyrus 
x bretschneideri]
Length=431

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 64/120 (53%), Gaps = 26/120 (22%)
 Frame = +2

Query  386  GLSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphp  565
            G   L RQSS+YSLT DEFQ+T+   GK++GSMNMDE L +IWTAEE Q           
Sbjct  25   GSFGLVRQSSVYSLTFDEFQNTIGGLGKDYGSMNMDELLKNIWTAEETQ-----------  73

Query  566  hvgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                         + + G+ + P         +L RQ SLTLP  L +KTVDEVW  + +
Sbjct  74   --------GMTATSGVGGEVNAPGS-------NLQRQGSLTLPRTLSQKTVDEVWKNLIR  118



>ref|XP_009592272.1| PREDICTED: bZIP transcription factor TRAB1-like [Nicotiana tomentosiformis]
 ref|XP_009592273.1| PREDICTED: bZIP transcription factor TRAB1-like [Nicotiana tomentosiformis]
Length=434

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 59/118 (50%), Gaps = 25/118 (21%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ SIYSLT DEF  T   SGK+FGSMNMDE L +IW AEE+Q               
Sbjct  27   LPRQPSIYSLTFDEFLSTTGGSGKDFGSMNMDELLKNIWNAEESQT--------------  72

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
                       M G      E G  +   L RQ SLTLP  L  KTVDEVW ++ K +
Sbjct  73   -----------MGGSGINGQEVGGVQSGHLQRQGSLTLPRTLSHKTVDEVWRDMSKEY  119



>ref|XP_009774081.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7 [Nicotiana 
sylvestris]
Length=410

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 63/116 (54%), Gaps = 27/116 (23%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSSIYSLT DE Q T    GK+FGSMNM++ L +IWTAEE Q               
Sbjct  31   LARQSSIYSLTFDELQTTFSGLGKDFGSMNMEDLLKNIWTAEETQ---------------  75

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
               + A T   + G  SV AE       +L RQ SLTLP  L +KTVDEVW +  K
Sbjct  76   ---ATASTTGGVDG--SVAAE-------NLQRQGSLTLPRTLSQKTVDEVWRDFQK  119



>gb|AHD24943.1| ABRE binding factor [Nicotiana tabacum]
Length=434

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 59/118 (50%), Gaps = 25/118 (21%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ SIYSLT DEF  T   SGK+FGSMNMDE L +IW AEE+Q               
Sbjct  27   LPRQPSIYSLTFDEFLSTTGGSGKDFGSMNMDELLKNIWNAEESQT--------------  72

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
                       M G      E G  +   L RQ SLTLP  L  KTVDEVW ++ K +
Sbjct  73   -----------MGGSGINGQEVGGVQSGHLQRQGSLTLPRTLSHKTVDEVWRDMSKEY  119



>ref|XP_007199909.1| hypothetical protein PRUPE_ppa006752mg [Prunus persica]
 gb|EMJ01108.1| hypothetical protein PRUPE_ppa006752mg [Prunus persica]
Length=396

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 59/110 (54%), Gaps = 27/110 (25%)
 Frame = +2

Query  395  SLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvg  574
            +L RQ S+YSLT DEFQ+T+   GK+FGSMNMDE L +IWTAEE Q              
Sbjct  28   TLARQPSVYSLTFDEFQNTIGGLGKDFGSMNMDELLKNIWTAEETQ--------------  73

Query  575  aaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDE  724
                   VT     G+ S P         +L RQ SLTLP  L +KTVDE
Sbjct  74   ------GVTSTSGAGEGSAPG-------GNLQRQGSLTLPRTLSQKTVDE  110



>ref|NP_001234596.1| AREB-like protein [Solanum lycopersicum]
 ref|XP_010320059.1| PREDICTED: AREB-like protein isoform X1 [Solanum lycopersicum]
 gb|AAS20434.1| AREB-like protein [Solanum lycopersicum]
Length=447

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 59/119 (50%), Gaps = 26/119 (22%)
 Frame = +2

Query  395  SLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvg  574
             L RQ SIYSLT DEF  +   SGK+FGSMNMDE L +IW AEENQ              
Sbjct  31   GLPRQPSIYSLTFDEFLSSTGGSGKDFGSMNMDELLKNIWNAEENQT-------------  77

Query  575  aaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
                         +G   +  ++       L RQ SLTLP  L  KTVDEVW ++ K H
Sbjct  78   -------------IGGPGINGQEVGVPGGHLQRQGSLTLPRTLSHKTVDEVWRDMSKEH  123



>ref|XP_010525458.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 [Tarenaya 
hassleriana]
Length=279

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 65/131 (50%), Gaps = 35/131 (27%)
 Frame = +2

Query  395  SLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvg  574
            +L RQ S+YSLTL E Q  L  SGK  GSMN+DE L S+W+AE NQ+             
Sbjct  17   TLPRQGSLYSLTLGEVQTHLASSGKPLGSMNLDELLKSVWSAEANQSP------------  64

Query  575  aaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTHq  754
                             +VPA       Q L+RQ SLTLP  L +KTVDEVW EI ++ +
Sbjct  65   ----------------VNVPA-------QGLSRQGSLTLPGELSKKTVDEVWREIQQSKR  101

Query  755  qqqqqHNSDGK  787
                Q   D +
Sbjct  102  GGSAQERKDKR  112



>ref|XP_010554752.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 [Tarenaya 
hassleriana]
Length=285

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 60/117 (51%), Gaps = 31/117 (26%)
 Frame = +2

Query  395  SLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvg  574
            +L RQ S+YSLTLDE Q  L ESG+  GSMN+DE L S+W+AE NQ+ +           
Sbjct  17   TLPRQGSLYSLTLDEVQTHLGESGRPLGSMNLDELLKSVWSAEANQSSSAMPV-------  69

Query  575  aaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                 N   H                    L+RQ SLTLP  L +KTVDEVW EI +
Sbjct  70   -----NGAGHG-------------------LSRQGSLTLPGELSKKTVDEVWREIQQ  102



>ref|NP_001149951.1| bZIP transcription factor family protein [Zea mays]
 gb|ACG37315.1| bZIP transcription factor family protein [Zea mays]
Length=336

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 61/118 (52%), Gaps = 17/118 (14%)
 Frame = +2

Query  386  GLSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphp  565
            G  SL RQ S+YSLT DEFQ  L  + K+FGSMNMDE L +IWTAEE+ A   A P    
Sbjct  8    GAPSLARQGSVYSLTFDEFQTALGGASKDFGSMNMDELLRNIWTAEESNAMTAAAPTTAA  67

Query  566  hvgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEI  739
                        H     QA  P          + RQ S TLP  L +KTVDEVW EI
Sbjct  68   ASMD-------AHGQHQQQAGAP----------IQRQGSFTLPRTLSQKTVDEVWREI  108



>ref|XP_007199908.1| hypothetical protein PRUPE_ppa006752mg [Prunus persica]
 gb|EMJ01107.1| hypothetical protein PRUPE_ppa006752mg [Prunus persica]
Length=357

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 59/110 (54%), Gaps = 27/110 (25%)
 Frame = +2

Query  395  SLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvg  574
            +L RQ S+YSLT DEFQ+T+   GK+FGSMNMDE L +IWTAEE Q              
Sbjct  28   TLARQPSVYSLTFDEFQNTIGGLGKDFGSMNMDELLKNIWTAEETQ--------------  73

Query  575  aaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDE  724
                   VT     G+ S P         +L RQ SLTLP  L +KTVDE
Sbjct  74   ------GVTSTSGAGEGSAPG-------GNLQRQGSLTLPRTLSQKTVDE  110



>gb|ADM53098.1| ABA responsive element binding factor [Citrus trifoliata]
Length=448

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 64/116 (55%), Gaps = 26/116 (22%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ S+Y+LT +EFQ+T    GK+FGSMNMDE L +IWTAEEN          +   GA
Sbjct  26   LARQPSVYTLTFEEFQNTWGGLGKDFGSMNMDELLKNIWTAEENH-------AMNSSAGA  78

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
            A ESNA   N                   L RQ SLTLP  L +KTVDEVW ++ K
Sbjct  79   AGESNAPGGN-------------------LQRQGSLTLPRTLSQKTVDEVWRDLMK  115



>ref|XP_009359667.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X2 [Pyrus x bretschneideri]
Length=364

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 59/116 (51%), Gaps = 22/116 (19%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSSIYSLT +E Q+T+   GK+FGSMNMDE L SIWTAEE Q  A A        G 
Sbjct  16   LARQSSIYSLTFEELQNTIGGPGKDFGSMNMDELLKSIWTAEETQIRAPAGGAAGGQDGL  75

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                                        SL RQ SLTLP  L +KTVDEVW  + K
Sbjct  76   GHGG----------------------GGSLQRQGSLTLPRTLSQKTVDEVWKNLSK  109



>ref|XP_010525455.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 [Tarenaya 
hassleriana]
Length=282

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 65/131 (50%), Gaps = 35/131 (27%)
 Frame = +2

Query  395  SLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvg  574
            +L RQ S+YSLTL E Q  L  SGK  GSMN+DE L S+W+AE NQ+             
Sbjct  17   TLPRQGSLYSLTLGEVQTHLASSGKPLGSMNLDELLKSVWSAEANQSP------------  64

Query  575  aaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTHq  754
                             +VPA       Q L+RQ SLTLP  L +KTVDEVW EI ++ +
Sbjct  65   ----------------VNVPA-------QGLSRQGSLTLPGELSKKTVDEVWREIQQSKR  101

Query  755  qqqqqHNSDGK  787
                Q   D +
Sbjct  102  GGSAQERKDKR  112



>ref|XP_003603049.1| ABSCISIC ACID-INSENSITIVE 5-like protein [Medicago truncatula]
 gb|AES73300.1| ABA response element-binding factor [Medicago truncatula]
Length=431

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 64/118 (54%), Gaps = 33/118 (28%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ S+YSLT+DEF +++  SGK+FGSMNMDE L +IW+AEE Q               
Sbjct  27   LTRQPSVYSLTVDEFMNSMGGSGKDFGSMNMDELLKNIWSAEEVQ---------------  71

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKTH  751
                            ++  E+ I+    L RQ SLTLP  L +KTVDEVW +I K +
Sbjct  72   ----------------TMGGEEAISNH--LQRQGSLTLPRTLSQKTVDEVWKDISKDY  111



>ref|XP_010530772.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 6 [Tarenaya 
hassleriana]
 ref|XP_010530773.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 6 [Tarenaya 
hassleriana]
Length=427

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 67/116 (58%), Gaps = 1/116 (1%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ+S++SLT DEFQ+T    GK+FGSMNMDE L +IW AEENQA  +     + ++  
Sbjct  27   LARQNSVFSLTFDEFQNTWGGLGKDFGSMNMDELLKNIWNAEENQAMRNDNSSNNNNINN  86

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                N    N +          G A   +L RQ SLTLP  L +KTVDEVW E+ +
Sbjct  87   GNSINTGNSNSLGVAVGGDGCVGFA-GGNLQRQGSLTLPRTLSQKTVDEVWKELMR  141



>gb|EYU37667.1| hypothetical protein MIMGU_mgv1a007484mg [Erythranthe guttata]
 gb|EYU37668.1| hypothetical protein MIMGU_mgv1a007484mg [Erythranthe guttata]
 gb|EYU37669.1| hypothetical protein MIMGU_mgv1a007484mg [Erythranthe guttata]
Length=406

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 61/116 (53%), Gaps = 31/116 (27%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSS+YSLT DEFQ TL  SGK+FGSMNM++ L SIWTAEE+QA              
Sbjct  30   LVRQSSVYSLTFDEFQSTLGGSGKDFGSMNMEDLLKSIWTAEESQAVGGGDGG-------  82

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                                    A   +L RQ SLTLP  L +KTVDEVW ++ K
Sbjct  83   ------------------------APAGNLQRQGSLTLPRTLSQKTVDEVWRDVLK  114



>ref|XP_009359648.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009359658.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X1 [Pyrus x bretschneideri]
Length=415

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 59/116 (51%), Gaps = 22/116 (19%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSSIYSLT +E Q+T+   GK+FGSMNMDE L SIWTAEE Q  A A        G 
Sbjct  16   LARQSSIYSLTFEELQNTIGGPGKDFGSMNMDELLKSIWTAEETQIRAPAGGAAGGQDGL  75

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                                        SL RQ SLTLP  L +KTVDEVW  + K
Sbjct  76   GHGGGG----------------------SLQRQGSLTLPRTLSQKTVDEVWKNLSK  109



>ref|XP_008794151.1| PREDICTED: LOW QUALITY PROTEIN: bZIP transcription factor TRAB1-like 
[Phoenix dactylifera]
Length=412

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 60/114 (53%), Gaps = 19/114 (17%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ S+YSLT DEFQ TL   GK+FGSMNMDEFL +IWTAEE+QA A A        G 
Sbjct  26   LARQPSVYSLTFDEFQSTLGGPGKDFGSMNMDEFLKNIWTAEESQAMATALGGAGGASGG  85

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEI  739
              +                          L RQ SLTLP  L +KTVDEVW + 
Sbjct  86   GIDGGVAGM-------------------GLQRQGSLTLPRTLSQKTVDEVWRDF  120



>ref|XP_010535682.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1 [Tarenaya 
hassleriana]
 ref|XP_010535683.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1 [Tarenaya 
hassleriana]
Length=341

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 61/115 (53%), Gaps = 25/115 (22%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            LGRQ+SI SLTLDE Q    +SGKNFG+MNMDEFL +IWT E +     +         +
Sbjct  40   LGRQNSILSLTLDEIQ---TKSGKNFGAMNMDEFLANIWTVEASNVEPASANANATAATS  96

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
                 +V                      LARQ SL++P PLC+KTVDEVW EI 
Sbjct  97   ETVPYSV----------------------LARQGSLSVPVPLCKKTVDEVWFEIQ  129



>gb|KDO59711.1| hypothetical protein CISIN_1g013197mg [Citrus sinensis]
 gb|KDO59712.1| hypothetical protein CISIN_1g013197mg [Citrus sinensis]
Length=417

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 64/116 (55%), Gaps = 26/116 (22%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ S+YSLT +EFQ+T    GK+FGSMNMDE L +IWTAEE+          +   GA
Sbjct  26   LARQPSVYSLTFEEFQNTWGGLGKDFGSMNMDELLKNIWTAEESH-------AMNSSAGA  78

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
            A ESNA   N                   L RQ SLTLP  L +KTVDEVW ++ K
Sbjct  79   AGESNAPGGN-------------------LQRQGSLTLPRTLSQKTVDEVWRDLMK  115



>ref|XP_006423009.1| hypothetical protein CICLE_v10028435mg [Citrus clementina]
 ref|XP_006423011.1| hypothetical protein CICLE_v10028435mg [Citrus clementina]
 gb|ESR36249.1| hypothetical protein CICLE_v10028435mg [Citrus clementina]
 gb|ESR36251.1| hypothetical protein CICLE_v10028435mg [Citrus clementina]
Length=417

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 64/116 (55%), Gaps = 26/116 (22%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ S+YSLT +EFQ+T    GK+FGSMNMDE L +IWTAEE+          +   GA
Sbjct  26   LARQPSVYSLTFEEFQNTWGGLGKDFGSMNMDELLKNIWTAEESH-------AMNSSAGA  78

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
            A ESNA   N                   L RQ SLTLP  L +KTVDEVW ++ K
Sbjct  79   AGESNAPGGN-------------------LQRQGSLTLPRTLSQKTVDEVWRDLMK  115



>ref|XP_009403361.1| PREDICTED: bZIP transcription factor TRAB1 [Musa acuminata subsp. 
malaccensis]
Length=383

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 62/114 (54%), Gaps = 26/114 (23%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ SIYSLT DE Q TL   GK+FGSMNMDE L ++WTAE                  
Sbjct  19   LARQGSIYSLTFDELQTTLGGLGKDFGSMNMDELLKNVWTAE------------------  60

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEI  739
              E+ A+T  F  G+    A  G+ +QQ L     LTLP  L +KTVDEVW ++
Sbjct  61   --ETYAMTAAFGEGRGGTAAGPGL-QQQGL-----LTLPRTLSQKTVDEVWRDL  106



>ref|XP_008454957.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 6 isoform 
X2 [Cucumis melo]
 ref|XP_008454958.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 6 isoform 
X2 [Cucumis melo]
Length=409

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 67/121 (55%), Gaps = 25/121 (21%)
 Frame = +2

Query  383  EGLSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphph  562
            +G  +L RQ SIYSLT DEFQ+T    GK+ GSMNMDE L +IWTAEE+Q          
Sbjct  20   QGNFTLTRQPSIYSLTFDEFQNTWNGLGKDVGSMNMDELLKNIWTAEESQ----------  69

Query  563  phvgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIH  742
                      AVT        + P   GI    +L RQASLTLP  + +KTVDEVW ++ 
Sbjct  70   ----------AVTS-----AGAAPGGAGITNGGNLQRQASLTLPMTISQKTVDEVWKDLS  114

Query  743  K  745
            K
Sbjct  115  K  115



>ref|XP_006297700.1| hypothetical protein CARUB_v10013729mg [Capsella rubella]
 gb|EOA30598.1| hypothetical protein CARUB_v10013729mg [Capsella rubella]
Length=438

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 60/111 (54%), Gaps = 19/111 (17%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSS+YSLT DE Q TL   GK+FGSMNMDE L SIWTAEE+QA A           A
Sbjct  33   LARQSSVYSLTFDELQSTLGGPGKDFGSMNMDELLKSIWTAEESQAIAMTSSSSTAAAVA  92

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVW  730
                           A +P         +L RQ SLTLP  + +KTVDEVW
Sbjct  93   QPT------------AGIPVG-------NLQRQGSLTLPRTISQKTVDEVW  124



>ref|XP_006297699.1| hypothetical protein CARUB_v10013729mg [Capsella rubella]
 gb|EOA30597.1| hypothetical protein CARUB_v10013729mg [Capsella rubella]
Length=437

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 60/111 (54%), Gaps = 19/111 (17%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQSS+YSLT DE Q TL   GK+FGSMNMDE L SIWTAEE+QA A           A
Sbjct  33   LARQSSVYSLTFDELQSTLGGPGKDFGSMNMDELLKSIWTAEESQAIAMTSSSSTAAAVA  92

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVW  730
                           A +P         +L RQ SLTLP  + +KTVDEVW
Sbjct  93   QPT------------AGIPVG-------NLQRQGSLTLPRTISQKTVDEVW  124



>gb|KHN27651.1| ABSCISIC ACID-INSENSITIVE 5-like protein 1 [Glycine soja]
Length=644

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 72/131 (55%), Gaps = 24/131 (18%)
 Frame = +2

Query  386  GLSSLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphp  565
              S L +Q+SI SLTLDEF    C++GK+ GSMNMDEFL+SIW +++N            
Sbjct  328  AFSQLSKQNSILSLTLDEF---YCKNGKSLGSMNMDEFLSSIWNSDDN------------  372

Query  566  hvgaaaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
                    N V  +      +   +  +A + +   Q  L++PPP+C+KTVDE+W++IHK
Sbjct  373  --------NQVNPSLPTLDEAAKGKSVVATEPTTISQP-LSVPPPICKKTVDEIWSQIHK  423

Query  746  THqqqqqqHNS  778
            +       +NS
Sbjct  424  SQPDHNDANNS  434



>ref|XP_006423008.1| hypothetical protein CICLE_v10028435mg [Citrus clementina]
 ref|XP_006423010.1| hypothetical protein CICLE_v10028435mg [Citrus clementina]
 ref|XP_006423014.1| hypothetical protein CICLE_v10028435mg [Citrus clementina]
 gb|ESR36248.1| hypothetical protein CICLE_v10028435mg [Citrus clementina]
 gb|ESR36250.1| hypothetical protein CICLE_v10028435mg [Citrus clementina]
 gb|ESR36254.1| hypothetical protein CICLE_v10028435mg [Citrus clementina]
 gb|KDO59710.1| hypothetical protein CISIN_1g013197mg [Citrus sinensis]
Length=447

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 64/116 (55%), Gaps = 26/116 (22%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ S+YSLT +EFQ+T    GK+FGSMNMDE L +IWTAEE+          +   GA
Sbjct  26   LARQPSVYSLTFEEFQNTWGGLGKDFGSMNMDELLKNIWTAEESH-------AMNSSAGA  78

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
            A ESNA   N                   L RQ SLTLP  L +KTVDEVW ++ K
Sbjct  79   AGESNAPGGN-------------------LQRQGSLTLPRTLSQKTVDEVWRDLMK  115



>ref|XP_008797273.1| PREDICTED: bZIP transcription factor TRAB1 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008797274.1| PREDICTED: bZIP transcription factor TRAB1 isoform X2 [Phoenix 
dactylifera]
Length=412

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 66/116 (57%), Gaps = 19/116 (16%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ+S+YSLT  E Q+TL   GK+FGSMNMDE L +IWTAEE+QA A A      + GA
Sbjct  25   LARQASVYSLTFGELQNTLGSLGKDFGSMNMDELLKNIWTAEESQAMAAALGSAGGYSGA  84

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
              + +                 G+     L RQ SLTLP  L +KTVDEVW ++ +
Sbjct  85   GLDGSGA---------------GVG----LQRQGSLTLPRTLSQKTVDEVWKDVIR  121



>ref|NP_849777.1| abscisic acid responsive elements-binding factor 2 [Arabidopsis 
thaliana]
 sp|Q9M7Q4.1|AI5L5_ARATH RecName: Full=ABSCISIC ACID-INSENSITIVE 5-like protein 5; AltName: 
Full=ABA-responsive element-binding protein 1; AltName: 
Full=Abscisic acid responsive elements-binding factor 2; Short=ABRE-binding 
factor 2; AltName: Full=bZIP transcription 
factor 36; Short=AtbZIP36 [Arabidopsis thaliana]
 gb|AAF27180.1|AF093545_1 abscisic acid responsive elements-binding factor [Arabidopsis 
thaliana]
 dbj|BAB12404.1| ABA-responsive element binding protein 1 (AREB1) [Arabidopsis 
thaliana]
 gb|ABH04550.1| At1g45249 [Arabidopsis thaliana]
 gb|AEE32110.1| abscisic acid responsive elements-binding factor 2 [Arabidopsis 
thaliana]
Length=416

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 60/117 (51%), Gaps = 29/117 (25%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ SIYSLT DEFQ ++   GK+FGSMNMDE L +IW+AEE QA              
Sbjct  21   LTRQGSIYSLTFDEFQSSV---GKDFGSMNMDELLKNIWSAEETQA--------------  63

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHKT  748
                        +    VP   G      L RQ SLTLP  L +KTVD+VW ++ K 
Sbjct  64   ------------MASGVVPVLGGGQEGLQLQRQGSLTLPRTLSQKTVDQVWKDLSKV  108



>ref|XP_006423013.1| hypothetical protein CICLE_v10028435mg [Citrus clementina]
 gb|ESR36253.1| hypothetical protein CICLE_v10028435mg [Citrus clementina]
 gb|KDO59709.1| hypothetical protein CISIN_1g013197mg [Citrus sinensis]
Length=448

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 64/116 (55%), Gaps = 26/116 (22%)
 Frame = +2

Query  398  LGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQahahaqphphphvga  577
            L RQ S+YSLT +EFQ+T    GK+FGSMNMDE L +IWTAEE+          +   GA
Sbjct  26   LARQPSVYSLTFEEFQNTWGGLGKDFGSMNMDELLKNIWTAEESH-------AMNSSAGA  78

Query  578  aaESNAVTHNFMLGQASVPAEKGIARQQSLARQASLTLPPPLCRKTVDEVWAEIHK  745
            A ESNA   N                   L RQ SLTLP  L +KTVDEVW ++ K
Sbjct  79   AGESNAPGGN-------------------LQRQGSLTLPRTLSQKTVDEVWRDLMK  115



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1590667407420