BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c12440_g2_i1 len=466 path=[830:0-465]

Length=466
                                                                      Score     E

ref|XP_009784881.1|  PREDICTED: uncharacterized protein LOC104233217  76.6    4e-15   
ref|XP_009605572.1|  PREDICTED: uncharacterized protein LOC104100112  76.6    5e-15   
gb|KDP31154.1|  hypothetical protein JCGZ_11530                       72.8    1e-13   
gb|EYU28649.1|  hypothetical protein MIMGU_mgv1a026485mg              72.0    2e-13   
dbj|BAF02556.1|  hypothetical protein                                 70.1    1e-12   Nicotiana benthamiana
emb|CDP00223.1|  unnamed protein product                              68.9    3e-12   
ref|XP_007036095.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...  65.9    1e-10   
ref|XP_010111975.1|  hypothetical protein L484_004752                 63.5    2e-10   
ref|XP_002511462.1|  conserved hypothetical protein                   63.2    3e-10   Ricinus communis
emb|CDP00222.1|  unnamed protein product                              62.0    1e-09   
gb|AFK48292.1|  unknown                                               61.2    2e-09   
gb|EYU22460.1|  hypothetical protein MIMGU_mgv1a021725mg              60.5    3e-09   
ref|XP_006357205.1|  PREDICTED: uncharacterized protein LOC102580215  60.8    3e-09   
ref|XP_007225092.1|  hypothetical protein PRUPE_ppa016729mg           60.5    3e-09   
ref|XP_003525171.1|  PREDICTED: uncharacterized protein LOC100813287  60.1    4e-09   
gb|EPS61171.1|  hypothetical protein M569_13633                       60.5    4e-09   
ref|XP_011089453.1|  PREDICTED: uncharacterized protein LOC105170400  60.1    5e-09   
ref|XP_002322148.1|  hypothetical protein POPTR_0015s08200g           59.3    9e-09   Populus trichocarpa [western balsam poplar]
ref|XP_008812202.1|  PREDICTED: uncharacterized protein LOC103723154  58.2    2e-08   
ref|XP_003549642.1|  PREDICTED: uncharacterized protein LOC100500585  57.8    3e-08   
gb|ACU15704.1|  unknown                                               57.8    3e-08   Glycine max [soybeans]
emb|CDY66962.1|  BnaC01g43480D                                        57.4    4e-08   
ref|XP_003523061.1|  PREDICTED: uncharacterized protein LOC100527101  57.0    4e-08   
ref|XP_010678686.1|  PREDICTED: uncharacterized protein LOC104894204  57.0    5e-08   
ref|XP_006439735.1|  hypothetical protein CICLE_v10023101mg           57.0    6e-08   
ref|XP_008346750.1|  PREDICTED: uncharacterized protein LOC103409734  57.0    6e-08   
ref|XP_004508823.1|  PREDICTED: uncharacterized protein LOC101506467  56.2    1e-07   
ref|XP_010272074.1|  PREDICTED: uncharacterized protein LOC104607972  55.8    1e-07   
ref|XP_008393077.1|  PREDICTED: uncharacterized protein LOC103455261  55.5    2e-07   
ref|XP_007138124.1|  hypothetical protein PHAVU_009G182200g           54.7    3e-07   
emb|CDY69815.1|  BnaCnng65480D                                        54.7    3e-07   
ref|XP_010913460.1|  PREDICTED: uncharacterized protein LOC105039139  54.3    4e-07   
gb|ACJ85978.1|  unknown                                               54.3    4e-07   Medicago truncatula
ref|XP_008453134.1|  PREDICTED: uncharacterized protein LOC103493940  53.9    7e-07   
emb|CDX83794.1|  BnaC08g18510D                                        54.3    7e-07   
ref|XP_010255294.1|  PREDICTED: uncharacterized protein LOC104596014  53.5    8e-07   
ref|XP_003631290.1|  PREDICTED: uncharacterized protein LOC100262187  53.5    8e-07   
ref|XP_010037601.1|  PREDICTED: uncharacterized protein LOC104426300  53.5    1e-06   
ref|XP_009149382.1|  PREDICTED: uncharacterized protein LOC103872706  53.5    1e-06   
ref|XP_003527035.1|  PREDICTED: uncharacterized protein LOC100500306  52.8    1e-06   
ref|XP_003608927.1|  hypothetical protein MTR_4g106500                53.1    1e-06   
gb|KCW49329.1|  hypothetical protein EUGRSUZ_K02881                   53.1    1e-06   
emb|CDY41011.1|  BnaC05g14690D                                        52.8    2e-06   
ref|XP_006416541.1|  hypothetical protein EUTSA_v10009213mg           52.8    2e-06   
gb|AFK43736.1|  unknown                                               52.0    3e-06   
ref|XP_002318631.2|  hypothetical protein POPTR_0012s07750g           52.0    4e-06   Populus trichocarpa [western balsam poplar]
ref|XP_007155386.1|  hypothetical protein PHAVU_003G196800g           51.6    4e-06   
ref|XP_009117570.1|  PREDICTED: uncharacterized protein LOC103842668  51.6    4e-06   
ref|XP_010100526.1|  hypothetical protein L484_027841                 51.6    4e-06   
gb|EYU42522.1|  hypothetical protein MIMGU_mgv1a021011mg              51.2    5e-06   
dbj|BAJ96436.1|  predicted protein                                    51.6    5e-06   
ref|XP_007209811.1|  hypothetical protein PRUPE_ppa014245mg           51.2    5e-06   
ref|XP_008798052.1|  PREDICTED: uncharacterized protein LOC103713065  50.8    6e-06   
emb|CDX81910.1|  BnaC08g36910D                                        50.8    6e-06   
ref|XP_008239706.1|  PREDICTED: uncharacterized protein LOC103338291  51.2    6e-06   
ref|XP_009150884.1|  PREDICTED: uncharacterized protein LOC103874222  50.8    8e-06   
gb|AFK40139.1|  unknown                                               50.8    8e-06   
gb|AFK37342.1|  unknown                                               50.4    8e-06   
dbj|BAD44100.1|  unknown protein                                      50.4    1e-05   Arabidopsis thaliana [mouse-ear cress]
emb|CDY21685.1|  BnaA09g44360D                                        50.4    1e-05   
ref|NP_564069.1|  uncharacterized protein                             50.4    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890310.1|  hypothetical protein ARALYDRAFT_889331           50.4    1e-05   
ref|XP_009381624.1|  PREDICTED: uncharacterized protein LOC103969713  50.1    1e-05   
gb|EMS62266.1|  hypothetical protein TRIUR3_24608                     50.1    2e-05   
gb|KGN63616.1|  hypothetical protein Csa_1G005770                     50.1    2e-05   
ref|XP_006404290.1|  hypothetical protein EUTSA_v10010873mg           49.3    3e-05   
ref|XP_010550675.1|  PREDICTED: uncharacterized protein LOC104821473  49.3    3e-05   
emb|CDX96683.1|  BnaA08g22260D                                        49.3    3e-05   
ref|XP_009387342.1|  PREDICTED: uncharacterized protein LOC103974282  48.9    4e-05   
ref|XP_006303470.1|  hypothetical protein CARUB_v10010768mg           48.5    5e-05   
ref|XP_007044490.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...  48.5    6e-05   
ref|XP_009360448.1|  PREDICTED: uncharacterized protein LOC103950917  48.1    6e-05   
ref|XP_010048930.1|  PREDICTED: uncharacterized protein LOC104437641  48.1    8e-05   
ref|XP_002283678.1|  PREDICTED: uncharacterized protein LOC100257032  47.8    9e-05   Vitis vinifera
ref|NP_190401.1|  uncharacterized protein                             47.8    1e-04   Arabidopsis thaliana [mouse-ear cress]
gb|KDO82629.1|  hypothetical protein CISIN_1g043506mg                 47.4    2e-04   
gb|EPS61712.1|  hypothetical protein M569_13084                       47.0    2e-04   
ref|XP_006292140.1|  hypothetical protein CARUB_v10018344mg           47.0    2e-04   
ref|XP_006438498.1|  hypothetical protein CICLE_v10033215mg           47.0    2e-04   
ref|XP_004501960.1|  PREDICTED: uncharacterized protein LOC101507615  46.6    2e-04   
ref|XP_002877600.1|  hypothetical protein ARALYDRAFT_906055           46.6    2e-04   
gb|ABR17367.1|  unknown                                               46.6    2e-04   Picea sitchensis
gb|KFK34112.1|  hypothetical protein AALP_AA5G103300                  46.6    3e-04   
ref|XP_010236138.1|  PREDICTED: uncharacterized protein LOC100841...  46.6    3e-04   
ref|XP_008793776.1|  PREDICTED: uncharacterized protein LOC103709997  46.2    3e-04   
ref|XP_003570676.2|  PREDICTED: uncharacterized protein LOC100841...  46.2    3e-04   
ref|XP_009150208.1|  PREDICTED: uncharacterized protein LOC103873552  45.4    7e-04   
emb|CDX77891.1|  BnaC03g53280D                                        45.4    7e-04   
ref|NP_001057260.1|  Os06g0239200                                     45.4    7e-04   Oryza sativa Japonica Group [Japonica rice]
emb|CDY21810.1|  BnaA06g20790D                                        45.4    8e-04   



>ref|XP_009784881.1| PREDICTED: uncharacterized protein LOC104233217 [Nicotiana sylvestris]
Length=90

 Score = 76.6 bits (187),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    DQWDPEPL-YNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFHW  178
            DQWDP P  Y YK+ ND+++G  ++SK+S KVG+T  KTK+VASTGVKKVK+GA+AGF W
Sbjct  19   DQWDPAPASYEYKSFNDKKSGNNATSKISSKVGDTFGKTKSVASTGVKKVKSGATAGFQW  78

Query  179  IKDKYQKSRQKH  214
            IKDK  K  QKH
Sbjct  79   IKDKCHKPTQKH  90



>ref|XP_009605572.1| PREDICTED: uncharacterized protein LOC104100112 [Nicotiana tomentosiformis]
Length=89

 Score = 76.6 bits (187),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 56/72 (78%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    DQWDPEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFHWI  181
            DQWDP+P Y YK+ ND+++G GSS+  S    +T  KTK+VASTGVKKVKAGASAGFHWI
Sbjct  19   DQWDPKPTYEYKSYNDKKSGNGSSNISSKVG-DTFGKTKSVASTGVKKVKAGASAGFHWI  77

Query  182  KDKYQK-SRQKH  214
            KDK  K + QKH
Sbjct  78   KDKCHKPAAQKH  89



>gb|KDP31154.1| hypothetical protein JCGZ_11530 [Jatropha curcas]
Length=84

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 52/73 (71%), Gaps = 3/73 (4%)
 Frame = +2

Query  2    DQWD--PEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFH  175
            DQWD  P+P+YNY+T         S++K   KVGE L KTKAVASTG+KKVK G   GFH
Sbjct  13   DQWDDGPDPVYNYQT-KKSSGATNSTAKYKQKVGEGLGKTKAVASTGIKKVKEGTITGFH  71

Query  176  WIKDKYQKSRQKH  214
            WIKDKY K++QKH
Sbjct  72   WIKDKYNKTKQKH  84



>gb|EYU28649.1| hypothetical protein MIMGU_mgv1a026485mg [Erythranthe guttata]
Length=71

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 44/72 (61%), Gaps = 14/72 (19%)
 Frame = +2

Query  2    DQWDPEPLY-NYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFHW  178
            DQWDP+PLY N  TT D                    KTKA ASTGVKKVKAGA+AG HW
Sbjct  13   DQWDPQPLYSNPTTTTDNSGKLS-------------GKTKAAASTGVKKVKAGATAGIHW  59

Query  179  IKDKYQKSRQKH  214
            IK KYQK+ QKH
Sbjct  60   IKHKYQKTTQKH  71



>dbj|BAF02556.1| hypothetical protein [Nicotiana benthamiana]
Length=90

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    DQWDPEPL-YNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFHW  178
            DQWDP P    YK  ND+++G  ++SK+S KVG+T  KTK+VASTGVKKVK+GA+AGF W
Sbjct  19   DQWDPAPASXEYKXFNDKKSGTNATSKISSKVGDTFGKTKSVASTGVKKVKSGATAGFQW  78

Query  179  IKDKYQKSRQKH  214
            IKDK  K  QK 
Sbjct  79   IKDKCHKPTQKQ  90



>emb|CDP00223.1| unnamed protein product [Coffea canephora]
Length=81

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 51/70 (73%), Gaps = 1/70 (1%)
 Frame = +2

Query  2    DQWDPEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFHWI  181
            DQWDPEPL++    N + +G  SSSK S KVG  LDKTKA ASTGVKKVK GAS G HWI
Sbjct  13   DQWDPEPLHDRNNIN-KDSGAKSSSKFSSKVGHKLDKTKAAASTGVKKVKEGASVGIHWI  71

Query  182  KDKYQKSRQK  211
            KDK Q+  QK
Sbjct  72   KDKCQRKTQK  81



>ref|XP_007036095.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, 
putative, partial [Theobroma cacao]
 gb|EOY20596.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, 
putative, partial [Theobroma cacao]
Length=146

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 49/74 (66%), Gaps = 7/74 (9%)
 Frame = +2

Query  2    DQWD---PEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGF  172
            DQWD   P P+    +T   +N   S++K   KVGE L KTKAVASTGVKKVK G S G 
Sbjct  77   DQWDYSDPTPV----STTQNKNTKSSTAKYKQKVGEGLGKTKAVASTGVKKVKEGTSLGI  132

Query  173  HWIKDKYQKSRQKH  214
            HWIK+KY K+ QKH
Sbjct  133  HWIKEKYHKTTQKH  146



>ref|XP_010111975.1| hypothetical protein L484_004752 [Morus notabilis]
 gb|EXC32249.1| hypothetical protein L484_004752 [Morus notabilis]
Length=84

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 45/73 (62%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    DQWD--PEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFH  175
            DQWD  P+P+Y+ K ++    G     K      E   KTKAVASTGVKKVK G S GF 
Sbjct  14   DQWDNNPDPVYDAKKSSTGNGGAAVKYKQKVG--EGFVKTKAVASTGVKKVKEGTSMGFQ  71

Query  176  WIKDKYQKSRQKH  214
            WIKDKY K+ QKH
Sbjct  72   WIKDKYHKTTQKH  84



>ref|XP_002511462.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52064.1| conserved hypothetical protein [Ricinus communis]
Length=81

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 45/73 (62%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    DQWD--PEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFH  175
            DQWD  P+P+++Y+ +        +  K      E L KTK VASTG KKVK G  +GFH
Sbjct  11   DQWDDGPDPVHDYQNSKSNSTSSTAKYKQKVG--EGLGKTKEVASTGFKKVKEGTVSGFH  68

Query  176  WIKDKYQKSRQKH  214
            WIKDKYQK  QKH
Sbjct  69   WIKDKYQKKTQKH  81



>emb|CDP00222.1| unnamed protein product [Coffea canephora]
Length=85

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +2

Query  2    DQWDPEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFHWI  181
            DQWDPEP YN        N   S+SK S KVG+T  KTK VASTGVKKVK G  AGFHWI
Sbjct  16   DQWDPEPAYNGNYN--SNNKSSSTSKFSSKVGDTFGKTKDVASTGVKKVKEGTRAGFHWI  73

Query  182  KDKYQKSRQKH  214
            KDKYQK  QK+
Sbjct  74   KDKYQKRAQKN  84



>gb|AFK48292.1| unknown [Lotus japonicus]
Length=84

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    DQWDPEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFHWI  181
            DQWD  P      +N++ NGGG+++K   K+GE L KTK VAS+G+KK+K G S G HWI
Sbjct  14   DQWDDGPDPIMVGSNNKSNGGGATTKYKEKLGEGLGKTKTVASSGIKKLKDGTSVGIHWI  73

Query  182  KDKYQKSRQKH  214
            K KY K+ QKH
Sbjct  74   KTKYSKATQKH  84



>gb|EYU22460.1| hypothetical protein MIMGU_mgv1a021725mg [Erythranthe guttata]
Length=70

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 41/71 (58%), Gaps = 10/71 (14%)
 Frame = +2

Query  2    DQWDPEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFHWI  181
            DQWDPEP Y    T+++ +             +  DKTKA ASTGV+K KAGA+A   W+
Sbjct  10   DQWDPEPAYINPATSNKNSKFS----------DKFDKTKAAASTGVRKAKAGATAAIQWV  59

Query  182  KDKYQKSRQKH  214
            K KY K+  KH
Sbjct  60   KFKYHKTTTKH  70



>ref|XP_006357205.1| PREDICTED: uncharacterized protein LOC102580215 [Solanum tuberosum]
Length=87

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 43/68 (63%), Gaps = 4/68 (6%)
 Frame = +2

Query  2    DQWDPEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFHWI  181
            DQWD  P Y YK  + +      ++  S K   T  KTK+VAS+GVKKVK+GASA F+WI
Sbjct  19   DQWDSNPTYEYKNYDQKS----GNNGSSNKFSNTFGKTKSVASSGVKKVKSGASASFNWI  74

Query  182  KDKYQKSR  205
            KDK  KS 
Sbjct  75   KDKCHKSN  82



>ref|XP_007225092.1| hypothetical protein PRUPE_ppa016729mg [Prunus persica]
 gb|EMJ26291.1| hypothetical protein PRUPE_ppa016729mg [Prunus persica]
Length=83

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 49/74 (66%), Gaps = 7/74 (9%)
 Frame = +2

Query  2    DQWD---PEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGF  172
            DQWD   P+PL      ++ +N  G+ +K + KV E L KTK VAS G+ KVK+GA +GF
Sbjct  14   DQWDYTNPDPL----PVSETKNSSGAKAKYAKKVEEGLGKTKEVASNGMNKVKSGAQSGF  69

Query  173  HWIKDKYQKSRQKH  214
            HWIKDKYQK+  K 
Sbjct  70   HWIKDKYQKTTGKQ  83



>ref|XP_003525171.1| PREDICTED: uncharacterized protein LOC100813287 [Glycine max]
 gb|KHN48626.1| hypothetical protein glysoja_015774 [Glycine soja]
Length=80

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 48/73 (66%), Gaps = 5/73 (7%)
 Frame = +2

Query  2    DQWD--PEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFH  175
            DQWD  P+P+      ++ +N   +++K   K+GE   KTKAVASTGVKK+K G S G H
Sbjct  11   DQWDDGPDPVM---VGSNNKNSNDNTAKYKQKLGEGFGKTKAVASTGVKKLKDGTSVGLH  67

Query  176  WIKDKYQKSRQKH  214
            WIK KY K+ QKH
Sbjct  68   WIKTKYSKATQKH  80



>gb|EPS61171.1| hypothetical protein M569_13633 [Genlisea aurea]
Length=88

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 42/71 (59%), Gaps = 8/71 (11%)
 Frame = +2

Query  2    DQWDPEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFHWI  181
            DQWDP+P++ Y   +  ++ G           ETLD+ K  A+ G KKVKAG +AG  WI
Sbjct  26   DQWDPKPMHTYPIPDAGKSTGKFD--------ETLDRAKDAATVGFKKVKAGTAAGIRWI  77

Query  182  KDKYQKSRQKH  214
            K KY K+ QKH
Sbjct  78   KQKYHKTIQKH  88



>ref|XP_011089453.1| PREDICTED: uncharacterized protein LOC105170400 [Sesamum indicum]
Length=76

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 49/73 (67%), Gaps = 6/73 (8%)
 Frame = +2

Query  2    DQWD--PEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFH  175
            DQWD   +PL   K    +  G G+++K   KVGE L KTKAVASTGVKKVK G S GF 
Sbjct  8    DQWDTSSDPLPEKK----KSGGSGAAAKYGKKVGEGLGKTKAVASTGVKKVKEGTSIGFR  63

Query  176  WIKDKYQKSRQKH  214
            WIKDKYQK+  KH
Sbjct  64   WIKDKYQKTTHKH  76



>ref|XP_002322148.1| hypothetical protein POPTR_0015s08200g [Populus trichocarpa]
 ref|XP_006387643.1| hypothetical protein POPTR_0729s00200g [Populus trichocarpa]
 gb|EEF06275.1| hypothetical protein POPTR_0015s08200g [Populus trichocarpa]
 gb|ERP46557.1| hypothetical protein POPTR_0729s00200g [Populus trichocarpa]
Length=82

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  98   ETLDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQKH  214
            E L KTK VASTG+KKVK G S GF WIKDKYQK+ QKH
Sbjct  44   EGLGKTKQVASTGIKKVKEGTSVGFRWIKDKYQKTTQKH  82



>ref|XP_008812202.1| PREDICTED: uncharacterized protein LOC103723154 [Phoenix dactylifera]
Length=72

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 44/74 (59%), Gaps = 17/74 (23%)
 Frame = +2

Query  2    DQWD---PEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGF  172
            DQWD    EP+   K +   ++G              ++KTKAVASTG+KKVK G ++GF
Sbjct  13   DQWDYGDSEPVQEKKKSGGVKSG--------------VEKTKAVASTGLKKVKEGTTSGF  58

Query  173  HWIKDKYQKSRQKH  214
             WIKDKYQK  QKH
Sbjct  59   QWIKDKYQKRTQKH  72



>ref|XP_003549642.1| PREDICTED: uncharacterized protein LOC100500585 [Glycine max]
 gb|KHN18492.1| hypothetical protein glysoja_006905 [Glycine soja]
Length=83

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 48/73 (66%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    DQWD--PEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFH  175
            DQWD  P+P+     +   +N  G+++K   K+GE   KTKAVASTGVKK+K G S G H
Sbjct  11   DQWDDGPDPVMVGSNSYSNKNSNGNTAKYKQKLGEGFGKTKAVASTGVKKLKDGTSVGLH  70

Query  176  WIKDKYQKSRQKH  214
            WIK KY K+ QKH
Sbjct  71   WIKAKYSKATQKH  83



>gb|ACU15704.1| unknown [Glycine max]
Length=83

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 48/73 (66%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    DQWD--PEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFH  175
            DQWD  P+P+     +   +N  G+++K   K+GE   KTKAVASTGVKK+K G S G H
Sbjct  11   DQWDDGPDPVIVGSNSYSNKNSNGNTAKYKQKLGEGFGKTKAVASTGVKKLKDGTSVGLH  70

Query  176  WIKDKYQKSRQKH  214
            WIK KY K+ QKH
Sbjct  71   WIKAKYSKATQKH  83



>emb|CDY66962.1| BnaC01g43480D [Brassica napus]
Length=79

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    DQWDPEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFHWI  181
            DQWD     + KTT+D ++ GG+S K   KV   L KTKAVAS+G+KKVK G S G +W+
Sbjct  8    DQWDNSNQASGKTTDDGKSSGGASGKYKEKVEAGLGKTKAVASSGLKKVKIGTSLGLNWV  67

Query  182  KDKYQKSRQK  211
            KDKY K+  K
Sbjct  68   KDKYNKTTTK  77



>ref|XP_003523061.1| PREDICTED: uncharacterized protein LOC100527101 [Glycine max]
 gb|KHN16293.1| hypothetical protein glysoja_030268 [Glycine soja]
Length=68

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 40/73 (55%), Gaps = 16/73 (22%)
 Frame = +2

Query  2    DQWD--PEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFH  175
            DQWD  P+P+     +  + N               L KTKAVASTGVKK+K G S GF 
Sbjct  10   DQWDNGPDPVTVSNESKKKNNA--------------LGKTKAVASTGVKKLKEGTSVGFQ  55

Query  176  WIKDKYQKSRQKH  214
            WIK KY K+ QKH
Sbjct  56   WIKTKYHKTTQKH  68



>ref|XP_010678686.1| PREDICTED: uncharacterized protein LOC104894204 [Beta vulgaris 
subsp. vulgaris]
Length=86

 Score = 57.0 bits (136),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 43/73 (59%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    DQWDPEPLY--NYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFH  175
            DQWDP+P Y  +   + +++    S      KV E L KTK VAST  KKVK G S G  
Sbjct  14   DQWDPQPAYVSHENESKNKKKNNESGGGAKKKVEEGLTKTKEVASTSFKKVKQGTSMGIS  73

Query  176  WIKDKYQKSRQKH  214
            WIKDKY K+ QKH
Sbjct  74   WIKDKYHKTTQKH  86



>ref|XP_006439735.1| hypothetical protein CICLE_v10023101mg [Citrus clementina]
 ref|XP_006476680.1| PREDICTED: uncharacterized protein LOC102615221 [Citrus sinensis]
 gb|ESR52975.1| hypothetical protein CICLE_v10023101mg [Citrus clementina]
 gb|KDO69796.1| hypothetical protein CISIN_1g034709mg [Citrus sinensis]
Length=86

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 45/72 (63%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    DQWD--PEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFH  175
            DQWD  P+P+          N G  ++K   KVG+  DKTK+VASTG+KKVK G S GF 
Sbjct  14   DQWDDGPDPISVVPQKKRSNNNGTGAAKYKQKVGDGFDKTKSVASTGLKKVKEGTSVGFQ  73

Query  176  WIKDKYQKSRQK  211
            WIK KY K+ QK
Sbjct  74   WIKSKYHKTTQK  85



>ref|XP_008346750.1| PREDICTED: uncharacterized protein LOC103409734 [Malus domestica]
Length=82

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 49/72 (68%), Gaps = 6/72 (8%)
 Frame = +2

Query  2    DQWDPEPLYNYKTT--NDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFH  175
            DQWD    YN  +T   + +  GG ++K   KVGE L KTKAVASTG KKVK GASAGFH
Sbjct  14   DQWD----YNNNSTYPVEVKGDGGVAAKCKQKVGEGLVKTKAVASTGAKKVKVGASAGFH  69

Query  176  WIKDKYQKSRQK  211
            WIK+K QK+  K
Sbjct  70   WIKEKCQKTTSK  81



>ref|XP_004508823.1| PREDICTED: uncharacterized protein LOC101506467 [Cicer arietinum]
Length=82

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 42/73 (58%), Gaps = 8/73 (11%)
 Frame = +2

Query  2    DQWD--PEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFH  175
            DQWD  P+P+     +N++ N      K      E L KTK VASTG+KK+K G S G H
Sbjct  16   DQWDNGPDPIM--VGSNNKSNTTKYKEKFG----EGLGKTKGVASTGIKKLKDGTSVGLH  69

Query  176  WIKDKYQKSRQKH  214
            WIK KY K+  KH
Sbjct  70   WIKTKYSKATHKH  82



>ref|XP_010272074.1| PREDICTED: uncharacterized protein LOC104607972 [Nelumbo nucifera]
Length=83

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  98   ETLDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQKH  214
            E  +K+KAVASTG KKVK G S GF WIKDKYQK  +KH
Sbjct  45   EGFEKSKAVASTGFKKVKEGTSVGFQWIKDKYQKRTRKH  83



>ref|XP_008393077.1| PREDICTED: uncharacterized protein LOC103455261 [Malus domestica]
Length=83

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  98   ETLDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQK  211
            E L KTKAVAS G KKVK GASAGFHWIK+K QK  QK
Sbjct  45   EGLVKTKAVASVGAKKVKEGASAGFHWIKEKCQKVTQK  82



>ref|XP_007138124.1| hypothetical protein PHAVU_009G182200g [Phaseolus vulgaris]
 gb|ESW10118.1| hypothetical protein PHAVU_009G182200g [Phaseolus vulgaris]
Length=70

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 40/73 (55%), Gaps = 14/73 (19%)
 Frame = +2

Query  2    DQWD--PEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFH  175
            DQWD  P+P+     +  + N             + L+KTK VAS GVKK+K G S G  
Sbjct  10   DQWDNGPDPVSGSDESKKKSNN------------KALEKTKHVASNGVKKLKEGTSVGLQ  57

Query  176  WIKDKYQKSRQKH  214
            WIK KYQK+ QKH
Sbjct  58   WIKTKYQKTTQKH  70



>emb|CDY69815.1| BnaCnng65480D [Brassica napus]
Length=79

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    DQWDPEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFHWI  181
            DQWD     + KTT+D ++GGG+S K   KV   L KTKAVAS+G+KKVK G S G +W+
Sbjct  8    DQWDNSNQASGKTTDDGKSGGGASGKYKEKVEAGLGKTKAVASSGLKKVKIGTSLGLNWV  67

Query  182  KDKYQKSRQK  211
            KDKY K+  K
Sbjct  68   KDKYNKTTTK  77



>ref|XP_010913460.1| PREDICTED: uncharacterized protein LOC105039139 [Elaeis guineensis]
Length=73

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 42/71 (59%), Gaps = 12/71 (17%)
 Frame = +2

Query  2    DQWD-PEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFHW  178
            DQWD  +P  N + ++D  N               ++KTKAVASTG+KKVK G + G  W
Sbjct  13   DQWDYSDPPPNSEKSSDDSNKKSG-----------IEKTKAVASTGLKKVKEGTAHGIQW  61

Query  179  IKDKYQKSRQK  211
            IKDKYQK+ QK
Sbjct  62   IKDKYQKTTQK  72



>gb|ACJ85978.1| unknown [Medicago truncatula]
 gb|AFK41062.1| unknown [Medicago truncatula]
 gb|KEH35073.1| UVI1, putative [Medicago truncatula]
Length=71

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 39/73 (53%), Gaps = 13/73 (18%)
 Frame = +2

Query  2    DQWD--PEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFH  175
            DQWD  P+PL     +  + N             + LDKTK VAS+GVKK+K G S    
Sbjct  10   DQWDDGPDPLNGSNQSKKKSNKD-----------KVLDKTKTVASSGVKKLKEGTSVSLQ  58

Query  176  WIKDKYQKSRQKH  214
            WIK KY K+ QKH
Sbjct  59   WIKTKYNKTTQKH  71



>ref|XP_008453134.1| PREDICTED: uncharacterized protein LOC103493940 [Cucumis melo]
Length=86

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 47/73 (64%), Gaps = 3/73 (4%)
 Frame = +2

Query  2    DQWDPEPLYNYKTTNDRR---NgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGF  172
            DQWD     +  T N ++   +GG SS+K   KVGE L KTKAVAS GVKKVK G S GF
Sbjct  13   DQWDYNDSADVVTNNKKKISGSGGNSSAKYKQKVGEGLGKTKAVASNGVKKVKEGTSLGF  72

Query  173  HWIKDKYQKSRQK  211
             WIKDKY K+  K
Sbjct  73   QWIKDKYNKTAHK  85



>emb|CDX83794.1| BnaC08g18510D [Brassica napus]
Length=100

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  LDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQKH  214
            LDKTKAVAS+G KK+K G++ GF W+KDKY K+  KH
Sbjct  64   LDKTKAVASSGFKKLKTGSAVGFRWVKDKYHKTTNKH  100



>ref|XP_010255294.1| PREDICTED: uncharacterized protein LOC104596014 [Nelumbo nucifera]
Length=80

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 45/73 (62%), Gaps = 9/73 (12%)
 Frame = +2

Query  2    DQWD---PEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGF  172
            DQWD   P+P+   K + D      +++K   KVGE  +KTK+VAS G KKVK G S G 
Sbjct  13   DQWDYSNPDPIPEQKKSGD------ATAKYKKKVGEGFEKTKSVASAGFKKVKEGTSVGL  66

Query  173  HWIKDKYQKSRQK  211
             WIKDKYQK  QK
Sbjct  67   KWIKDKYQKRTQK  79



>ref|XP_003631290.1| PREDICTED: uncharacterized protein LOC100262187 [Vitis vinifera]
Length=75

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  98   ETLDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQK  211
            E   KTKA ASTG+KKVK GAS G HWIKDKY K+  K
Sbjct  37   EGFAKTKAAASTGMKKVKGGASVGLHWIKDKYHKTTNK  74



>ref|XP_010037601.1| PREDICTED: uncharacterized protein LOC104426300 [Eucalyptus grandis]
Length=84

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    DQWD--PEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFH  175
            DQWD  PEP+      ++R  G   + +   KVGE L KTK  AS  V+KVK G + GF 
Sbjct  12   DQWDHTPEPVSTPGRASNRLGGSTRTDRYKQKVGEGLVKTKTAASHSVQKVKEGTAVGFR  71

Query  176  WIKDKYQKSRQKH  214
            WIKDKY ++ +KH
Sbjct  72   WIKDKYHQTTRKH  84



>ref|XP_009149382.1| PREDICTED: uncharacterized protein LOC103872706 [Brassica rapa]
 emb|CDY26702.1| BnaA06g13200D [Brassica napus]
Length=85

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  98   ETLDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQKH  214
            + LDKTKAVAS+G KK+K G++ GF W+KDKY K+  KH
Sbjct  47   QGLDKTKAVASSGFKKLKTGSAMGFRWVKDKYHKTTNKH  85



>ref|XP_003527035.1| PREDICTED: uncharacterized protein LOC100500306 [Glycine max]
 gb|ACU15344.1| unknown [Glycine max]
 gb|KHN19341.1| hypothetical protein glysoja_012261 [Glycine soja]
Length=69

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  LDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQKH  214
              KTKAVASTGVKK+K G S G HWIK KY  + QKH
Sbjct  33   FGKTKAVASTGVKKLKEGTSVGLHWIKTKYHNTTQKH  69



>ref|XP_003608927.1| hypothetical protein MTR_4g106500 [Medicago truncatula]
 gb|AES91124.1| UVI1, putative [Medicago truncatula]
Length=82

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 42/73 (58%), Gaps = 8/73 (11%)
 Frame = +2

Query  2    DQWD--PEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFH  175
            DQWD  P+P+     TN+ ++      K      E L KTK VASTGVKK+K G S G +
Sbjct  16   DQWDNGPDPIM--ADTNNNKSTTKYKEKFG----EGLGKTKGVASTGVKKLKDGTSVGLN  69

Query  176  WIKDKYQKSRQKH  214
            WIK KY K+  KH
Sbjct  70   WIKTKYSKATHKH  82



>gb|KCW49329.1| hypothetical protein EUGRSUZ_K02881, partial [Eucalyptus grandis]
Length=97

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    DQWD--PEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFH  175
            DQWD  PEP+      ++R  G   + +   KVGE L KTK  AS  V+KVK G + GF 
Sbjct  25   DQWDHTPEPVSTPGRASNRLGGSTRTDRYKQKVGEGLVKTKTAASHSVQKVKEGTAVGFR  84

Query  176  WIKDKYQKSRQKH  214
            WIKDKY ++ +KH
Sbjct  85   WIKDKYHQTTRKH  97



>emb|CDY41011.1| BnaC05g14690D [Brassica napus]
Length=85

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  98   ETLDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQKH  214
            + LDKTK+VAS+G KK+K+G++ GF W+KDKY K+  KH
Sbjct  47   QGLDKTKSVASSGFKKLKSGSAMGFRWVKDKYHKTTNKH  85



>ref|XP_006416541.1| hypothetical protein EUTSA_v10009213mg [Eutrema salsugineum]
 gb|ESQ34894.1| hypothetical protein EUTSA_v10009213mg [Eutrema salsugineum]
Length=88

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  LDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQKH  214
            LDKTKAVAS+G KK+K G++ GF W+KDKY K+  KH
Sbjct  52   LDKTKAVASSGFKKLKNGSATGFRWVKDKYHKTTNKH  88



>gb|AFK43736.1| unknown [Medicago truncatula]
Length=82

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 42/73 (58%), Gaps = 8/73 (11%)
 Frame = +2

Query  2    DQWD--PEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFH  175
            DQWD  P+P+     TN+ ++      K      E L KTK VASTGVKK+K G S G +
Sbjct  16   DQWDNGPDPIM--ADTNNNKSTTKYKEKFG----EGLGKTKGVASTGVKKLKDGTSVGLN  69

Query  176  WIKDKYQKSRQKH  214
            WIK +Y K+  KH
Sbjct  70   WIKTEYSKATHKH  82



>ref|XP_002318631.2| hypothetical protein POPTR_0012s07750g [Populus trichocarpa]
 gb|EEE96851.2| hypothetical protein POPTR_0012s07750g [Populus trichocarpa]
Length=82

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  98   ETLDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQK  211
            E L KTK VAS G KKVK G S GF WIK+KYQK+ QK
Sbjct  44   EGLGKTKQVASIGFKKVKEGTSVGFQWIKEKYQKTTQK  81



>ref|XP_007155386.1| hypothetical protein PHAVU_003G196800g [Phaseolus vulgaris]
 gb|ESW27380.1| hypothetical protein PHAVU_003G196800g [Phaseolus vulgaris]
Length=80

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 46/76 (61%), Gaps = 11/76 (14%)
 Frame = +2

Query  2    DQWD--PEPL---YNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASA  166
            DQWD  P+P+    N K +ND       ++K   K+GE   KTKAVASTG KK+K G S 
Sbjct  11   DQWDDGPDPVTVGSNNKKSNDN------AAKYKQKLGEGFGKTKAVASTGAKKLKDGTSV  64

Query  167  GFHWIKDKYQKSRQKH  214
            G HWIK KY K+  K+
Sbjct  65   GLHWIKTKYSKATHKN  80



>ref|XP_009117570.1| PREDICTED: uncharacterized protein LOC103842668 [Brassica rapa]
Length=84

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  98   ETLDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQKH  214
            + LDKTKA+AS+G KK+K G++ GF W+KDKY K+  KH
Sbjct  46   QGLDKTKALASSGFKKLKTGSAIGFRWVKDKYHKTTNKH  84



>ref|XP_010100526.1| hypothetical protein L484_027841 [Morus notabilis]
 gb|EXB82660.1| hypothetical protein L484_027841 [Morus notabilis]
Length=81

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 45/73 (62%), Gaps = 6/73 (8%)
 Frame = +2

Query  2    DQWDPEPLYNYKTTNDRR--NgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFH  175
            DQWDPEP+    T  ++R   GG S ++ S K+ +  DKTKA AS G  KVK G + G  
Sbjct  13   DQWDPEPI----TVPEKRTPGGGSSKAQFSQKMEDGFDKTKAAASRGFVKVKNGTAVGVR  68

Query  176  WIKDKYQKSRQKH  214
            WIK+KY K+  KH
Sbjct  69   WIKEKYHKTTGKH  81



>gb|EYU42522.1| hypothetical protein MIMGU_mgv1a021011mg [Erythranthe guttata]
Length=73

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 48/70 (69%), Gaps = 7/70 (10%)
 Frame = +2

Query  2    DQWD--PEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFH  175
            DQWD   +PL   K     ++GGG+++K   KVGE L KTK+ A+TGVKKVK G S GF 
Sbjct  8    DQWDNSSDPLPEKK-----KSGGGAAAKYGKKVGEGLGKTKSAATTGVKKVKEGTSVGFR  62

Query  176  WIKDKYQKSR  205
            WIKDK QKS+
Sbjct  63   WIKDKCQKSK  72



>dbj|BAJ96436.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96667.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93581.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=90

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 38/70 (54%), Gaps = 15/70 (21%)
 Frame = +2

Query  2    DQWD----PEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAG  169
            DQWD    P P       N ++             G  ++KTKA A+TG+KKVKAG + G
Sbjct  13   DQWDTGADPSPRARGGNGNGKK-----------VQGGGVEKTKAAAATGLKKVKAGTAQG  61

Query  170  FHWIKDKYQK  199
            F WIKDKYQK
Sbjct  62   FQWIKDKYQK  71



>ref|XP_007209811.1| hypothetical protein PRUPE_ppa014245mg [Prunus persica]
 gb|EMJ11010.1| hypothetical protein PRUPE_ppa014245mg [Prunus persica]
Length=78

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  98   ETLDKTKAVASTGVKKVKAGASAGFHWIKDKYQK  199
            E L KTKAVASTG KKVK GASAGF WIK K QK
Sbjct  44   EGLVKTKAVASTGAKKVKEGASAGFQWIKQKCQK  77



>ref|XP_008798052.1| PREDICTED: uncharacterized protein LOC103713065 [Phoenix dactylifera]
 ref|XP_008798053.1| PREDICTED: uncharacterized protein LOC103713065 [Phoenix dactylifera]
Length=73

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  104  LDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQK  211
            ++KTKAVASTG+KKVK G + G  WIKDKYQK  QK
Sbjct  37   IEKTKAVASTGLKKVKEGTAHGIQWIKDKYQKRTQK  72



>emb|CDX81910.1| BnaC08g36910D [Brassica napus]
Length=66

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  LDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQKH  214
            LDKTK +AS+G KK+K G++ GF W+KDKY K+  KH
Sbjct  30   LDKTKTIASSGFKKLKTGSAIGFRWVKDKYHKTTNKH  66



>ref|XP_008239706.1| PREDICTED: uncharacterized protein LOC103338291 [Prunus mume]
Length=78

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  98   ETLDKTKAVASTGVKKVKAGASAGFHWIKDKYQK  199
            E L KTKAVASTG KKVK GASAGF WIK K QK
Sbjct  44   EGLVKTKAVASTGAKKVKEGASAGFQWIKQKCQK  77



>ref|XP_009150884.1| PREDICTED: uncharacterized protein LOC103874222 [Brassica rapa]
Length=80

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    DQWDPEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFHWI  181
            DQWD     + KTT+D ++G G+S K   KV   L KTKAVAS+G+KKVK G S G +W+
Sbjct  8    DQWDNSNQASGKTTDDGKSGAGASGKYKEKVEAGLGKTKAVASSGLKKVKIGTSLGLNWV  67

Query  182  KD  187
            KD
Sbjct  68   KD  69



>gb|AFK40139.1| unknown [Lotus japonicus]
Length=71

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 38/73 (52%), Gaps = 13/73 (18%)
 Frame = +2

Query  2    DQWD--PEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFH  175
            DQWD  P+P+        + NG            + L KTK VASTGVKK+K G S    
Sbjct  10   DQWDDGPDPVSGSNQHKKKSNGN-----------KVLGKTKTVASTGVKKLKEGTSVSLQ  58

Query  176  WIKDKYQKSRQKH  214
            WIK KY K+ QKH
Sbjct  59   WIKTKYSKTTQKH  71



>gb|AFK37342.1| unknown [Lotus japonicus]
Length=71

 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 38/73 (52%), Gaps = 13/73 (18%)
 Frame = +2

Query  2    DQWD--PEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFH  175
            DQWD  P+P+        + NG            + L KTK VASTGVKK+K G S    
Sbjct  10   DQWDDGPDPVSGSNQHKKKSNGN-----------KVLGKTKTVASTGVKKLKEGTSVSLQ  58

Query  176  WIKDKYQKSRQKH  214
            WIK KY K+ QKH
Sbjct  59   WIKTKYSKTTQKH  71



>dbj|BAD44100.1| unknown protein [Arabidopsis thaliana]
Length=86

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  98   ETLDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQKH  214
            + LDKTKAVAS+G KK+K G++ GF W+KDKY K+  K 
Sbjct  48   QGLDKTKAVASSGFKKLKTGSAIGFRWVKDKYHKTTHKQ  86



>emb|CDY21685.1| BnaA09g44360D [Brassica napus]
Length=84

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  98   ETLDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQKH  214
            + LDKTK++AS+G KK+K G++ GF W+KDKY K+  KH
Sbjct  46   QGLDKTKSLASSGFKKLKRGSAIGFRWVKDKYHKTTNKH  84



>ref|NP_564069.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL38896.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51362.1| unknown protein [Arabidopsis thaliana]
 gb|AAM64608.1| unknown [Arabidopsis thaliana]
 dbj|BAD42980.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43288.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43831.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44670.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29792.1| uncharacterized protein AT1G19020 [Arabidopsis thaliana]
Length=86

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  98   ETLDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQKH  214
            + LDKTKAVAS+G KK+K G++ GF W+KDKY K+  K 
Sbjct  48   QGLDKTKAVASSGFKKLKTGSAIGFRWVKDKYHKTTHKQ  86



>ref|XP_002890310.1| hypothetical protein ARALYDRAFT_889331 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66569.1| hypothetical protein ARALYDRAFT_889331 [Arabidopsis lyrata subsp. 
lyrata]
Length=85

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  98   ETLDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQK  211
            + LDKTKAVAS+G KK+K G++ GF W+KDKY K+  K
Sbjct  48   QGLDKTKAVASSGFKKLKTGSAIGFRWVKDKYHKTTHK  85



>ref|XP_009381624.1| PREDICTED: uncharacterized protein LOC103969713 [Musa acuminata 
subsp. malaccensis]
Length=74

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  LDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQKH  214
            ++KTK+  STG+KKVK G S G  WIKDKY K  QKH
Sbjct  38   MEKTKSATSTGIKKVKEGTSHGLQWIKDKYSKKTQKH  74



>gb|EMS62266.1| hypothetical protein TRIUR3_24608 [Triticum urartu]
Length=90

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  104  LDKTKAVASTGVKKVKAGASAGFHWIKDKYQK  199
            ++KTKA A+TG+KKVKAG + GF WIKDKYQK
Sbjct  40   VEKTKAAAATGLKKVKAGTAQGFQWIKDKYQK  71



>gb|KGN63616.1| hypothetical protein Csa_1G005770 [Cucumis sativus]
Length=84

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  98   ETLDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQK  211
            E L KTK+VAS GVKKVK G S GF WIK+KY K+  K
Sbjct  46   EGLGKTKSVASNGVKKVKEGTSLGFQWIKEKYNKTAHK  83



>ref|XP_006404290.1| hypothetical protein EUTSA_v10010873mg [Eutrema salsugineum]
 gb|ESQ45743.1| hypothetical protein EUTSA_v10010873mg [Eutrema salsugineum]
Length=80

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  LDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQKH  214
            L KTKA AS+G+KKVK G S GF+W+KDKY K+  K+
Sbjct  44   LGKTKAAASSGLKKVKIGTSLGFNWVKDKYNKTTTKN  80



>ref|XP_010550675.1| PREDICTED: uncharacterized protein LOC104821473 [Tarenaya hassleriana]
Length=77

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  98   ETLDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQKH  214
            E L+KTK+ A++G+KKVKAG S G  W+KDKY KS  K+
Sbjct  39   EGLEKTKSAATSGLKKVKAGTSLGLSWVKDKYHKSTNKN  77



>emb|CDX96683.1| BnaA08g22260D [Brassica napus]
Length=74

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 40/71 (56%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    DQWDPEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFHWI  181
            DQWD       ++          ++K   K G  LDKTKAVA +G KK+K G++ GF W+
Sbjct  4    DQWDNSGTAVVRSGGGGTASNSYTAKYKEKFGHGLDKTKAVAFSGFKKLKTGSAVGFRWV  63

Query  182  KDKYQKSRQKH  214
            KDKY K+  K+
Sbjct  64   KDKYNKTTNKY  74



>ref|XP_009387342.1| PREDICTED: uncharacterized protein LOC103974282 [Musa acuminata 
subsp. malaccensis]
Length=80

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  LDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQKH  214
            ++KTKA AS G+KKVK G+S GF WIKDKY +  ++H
Sbjct  44   VEKTKAAASAGLKKVKEGSSTGFRWIKDKYHERTRRH  80



>ref|XP_006303470.1| hypothetical protein CARUB_v10010768mg [Capsella rubella]
 gb|EOA36368.1| hypothetical protein CARUB_v10010768mg [Capsella rubella]
Length=87

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  98   ETLDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQK  211
            +  DKTKAVAS+G KK+K G++ GF W+KDKY K+  K
Sbjct  50   QGFDKTKAVASSGFKKLKTGSAIGFRWVKDKYHKTTHK  87



>ref|XP_007044490.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, 
putative [Theobroma cacao]
 gb|EOY00322.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, 
putative [Theobroma cacao]
Length=81

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 47/72 (65%), Gaps = 5/72 (7%)
 Frame = +2

Query  2    DQWD--PEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFH  175
            DQWD  P+PL    +   + + GG+ +K S KV + L KTKA A TG+KK K GA+AG +
Sbjct  13   DQWDYGPDPLPAEPS---KSSSGGAKAKCSKKVEDGLGKTKAAAVTGMKKAKVGAAAGIN  69

Query  176  WIKDKYQKSRQK  211
            WIK+K  K+ QK
Sbjct  70   WIKEKCSKTTQK  81



>ref|XP_009360448.1| PREDICTED: uncharacterized protein LOC103950917 [Pyrus x bretschneideri]
Length=82

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 44/72 (61%), Gaps = 5/72 (7%)
 Frame = +2

Query  2    DQWD--PEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFH  175
            DQWD  P+PL     +  + +GGG+ +K   KV E   KTKAVA+ G+ KVK G   GFH
Sbjct  13   DQWDYNPDPL---PASYTKSSGGGAKAKYGKKVEEGFGKTKAVAANGMNKVKVGTQFGFH  69

Query  176  WIKDKYQKSRQK  211
            WIKDK  K+  K
Sbjct  70   WIKDKCHKTTGK  81



>ref|XP_010048930.1| PREDICTED: uncharacterized protein LOC104437641 [Eucalyptus grandis]
 gb|KCW81356.1| hypothetical protein EUGRSUZ_C02738 [Eucalyptus grandis]
Length=85

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 44/76 (58%), Gaps = 8/76 (11%)
 Frame = +2

Query  2    DQWD--PEPLYNYKTTNDRRNgggssskvs---gkvgETLDKTKAVASTGVKKVKAGASA  166
            DQWD  P+P       ND++    SS   +    K+GE L KTK  AS GVKKVK G S 
Sbjct  13   DQWDNNPDPA---PAENDKKKSTASSITTAKYKEKMGEGLVKTKTAASDGVKKVKEGTSV  69

Query  167  GFHWIKDKYQKSRQKH  214
            G  WIK+KYQK+  K+
Sbjct  70   GIQWIKEKYQKTTGKN  85



>ref|XP_002283678.1| PREDICTED: uncharacterized protein LOC100257032 [Vitis vinifera]
Length=74

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 48/72 (67%), Gaps = 6/72 (8%)
 Frame = +2

Query  2    DQWD--PEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFH  175
            DQWD  P+P  + K     ++GGG++SK   KVGE L KTK  AS G+KKVKAG+S G  
Sbjct  7    DQWDYNPDPAADKKG----KSGGGAASKYGKKVGEGLGKTKVAASHGLKKVKAGSSVGLQ  62

Query  176  WIKDKYQKSRQK  211
            WIK+KY ++  K
Sbjct  63   WIKEKYHQTTHK  74



>ref|NP_190401.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB51065.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAQ65132.1| At3g48180 [Arabidopsis thaliana]
 dbj|BAD43372.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43385.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43902.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE78377.1| uncharacterized protein AT3G48180 [Arabidopsis thaliana]
Length=77

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 41/71 (58%), Gaps = 1/71 (1%)
 Frame = +2

Query  2    DQWDPEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFHWI  181
            +QWD     + KTT+    GG SS          L KTKA AS+G+KKVK G S G +W+
Sbjct  8    EQWDSNQQSSGKTTHGGEGGGASSKYKEKVGA-GLGKTKAAASSGLKKVKIGTSLGLNWV  66

Query  182  KDKYQKSRQKH  214
            KDKY K+  K+
Sbjct  67   KDKYNKTTTKN  77



>gb|KDO82629.1| hypothetical protein CISIN_1g043506mg [Citrus sinensis]
Length=92

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 39/68 (57%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    DQWDPEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFHWI  181
            DQWD +  +N   T +        +K   KVGE LDKTK VA TG+KK K GASA F WI
Sbjct  13   DQWDKDNHHNVNPTANYYTPEDKKAKYKKKVGEGLDKTKEVAITGMKKAKLGASASFKWI  72

Query  182  KDKYQKSR  205
            K K  ++ 
Sbjct  73   KQKCNRNN  80



>gb|EPS61712.1| hypothetical protein M569_13084, partial [Genlisea aurea]
Length=69

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  98   ETLDKTKAVASTGVKKVKAGASAGFHWIKDKYQK  199
            E L KTK+ A +GVKKV+ G S GF WIKDKYQK
Sbjct  36   EGLGKTKSAAVSGVKKVRDGTSIGFQWIKDKYQK  69



>ref|XP_006292140.1| hypothetical protein CARUB_v10018344mg [Capsella rubella]
 gb|EOA25038.1| hypothetical protein CARUB_v10018344mg [Capsella rubella]
Length=75

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  LDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQKH  214
            L KTKA A++G+KKVK G S G +W+KDKY KS  K+
Sbjct  39   LGKTKAAATSGLKKVKIGTSLGLNWVKDKYNKSTTKN  75



>ref|XP_006438498.1| hypothetical protein CICLE_v10033215mg [Citrus clementina]
 gb|ESR51738.1| hypothetical protein CICLE_v10033215mg [Citrus clementina]
Length=84

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 39/67 (58%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    DQWDPEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFHWI  181
            DQWD +  +N   T +        +K   KVGE LDKTK VA TG+KK K GASA F WI
Sbjct  13   DQWDKDNHHNVNPTANYYTPEDKKAKYKKKVGEGLDKTKEVAITGMKKAKLGASASFKWI  72

Query  182  KDKYQKS  202
            K K  ++
Sbjct  73   KQKCNRN  79



>ref|XP_004501960.1| PREDICTED: uncharacterized protein LOC101507615 [Cicer arietinum]
Length=69

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 36/73 (49%), Gaps = 15/73 (21%)
 Frame = +2

Query  2    DQWD--PEPLYNYKTTNDRRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAGFH  175
            DQW+  P+P+     +  + N               L KTK VASTGV+K+K G S    
Sbjct  10   DQWENGPDPVSGSNQSKKKSN-------------NILGKTKTVASTGVQKLKEGTSVSLK  56

Query  176  WIKDKYQKSRQKH  214
            WIK KY K+  KH
Sbjct  57   WIKTKYNKTTNKH  69



>ref|XP_002877600.1| hypothetical protein ARALYDRAFT_906055 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53859.1| hypothetical protein ARALYDRAFT_906055 [Arabidopsis lyrata subsp. 
lyrata]
Length=77

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  LDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQKH  214
            L KTKA AS+G+KKVK G S G +W+KDKY K+  K+
Sbjct  41   LGKTKAAASSGLKKVKIGTSLGLNWVKDKYNKTTTKN  77



>gb|ABR17367.1| unknown [Picea sitchensis]
Length=82

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 40/70 (57%), Gaps = 4/70 (6%)
 Frame = +2

Query  2    DQWDP--EPLYNYKTTND--RRNgggssskvsgkvgETLDKTKAVASTGVKKVKAGASAG  169
            DQWD      YN  + +D  R  G G  +KV       L+K K VAS GV+KVK+G S G
Sbjct  9    DQWDSTNNEEYNSNSASDVRREKGNGKMAKVKVVALSGLEKAKIVASVGVQKVKSGTSTG  68

Query  170  FHWIKDKYQK  199
              WIK++YQK
Sbjct  69   IKWIKNQYQK  78



>gb|KFK34112.1| hypothetical protein AALP_AA5G103300 [Arabis alpina]
Length=85

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  104  LDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQK  211
            L KTK+ A++G+KKVK G S GF+W+KDKY K+  K
Sbjct  48   LGKTKSAATSGLKKVKTGTSLGFNWVKDKYNKTTTK  83



>ref|XP_010236138.1| PREDICTED: uncharacterized protein LOC100841037 isoform X1 [Brachypodium 
distachyon]
Length=83

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  104  LDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQ  208
            ++KTKA A+TG+KKVK G + GF WIKDK QK +Q
Sbjct  36   VEKTKAAAATGLKKVKEGTAHGFQWIKDKCQKKKQ  70



>ref|XP_008793776.1| PREDICTED: uncharacterized protein LOC103709997 [Phoenix dactylifera]
Length=74

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  LDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQKH  214
            ++KTKA+ASTG+KK K GA+ G  W+K KYQK  Q+ 
Sbjct  38   VEKTKAMASTGLKKAKEGAARGMQWLKGKYQKRTQRR  74



>ref|XP_003570676.2| PREDICTED: uncharacterized protein LOC100841037 isoform X2 [Brachypodium 
distachyon]
Length=82

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  104  LDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQ  208
            ++KTKA A+TG+KKVK G + GF WIKDK QK +Q
Sbjct  36   VEKTKAAAATGLKKVKEGTAHGFQWIKDKCQKKKQ  70



>ref|XP_009150208.1| PREDICTED: uncharacterized protein LOC103873552 [Brassica rapa]
Length=81

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +2

Query  104  LDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQK  211
            L KTKA AS+G KKVK G S G  W+KDKY K+  K
Sbjct  44   LGKTKAAASSGFKKVKTGTSLGLSWVKDKYTKTTSK  79



>emb|CDX77891.1| BnaC03g53280D [Brassica napus]
Length=81

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +2

Query  104  LDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQK  211
            L KTKA AS+G KKVK G S G  W+KDKY K+  K
Sbjct  44   LGKTKAAASSGFKKVKTGTSLGLSWVKDKYTKTTSK  79



>ref|NP_001057260.1| Os06g0239200 [Oryza sativa Japonica Group]
 dbj|BAD37872.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD37909.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF19174.1| Os06g0239200 [Oryza sativa Japonica Group]
 gb|EAZ36429.1| hypothetical protein OsJ_20759 [Oryza sativa Japonica Group]
 gb|EAZ36430.1| hypothetical protein OsJ_20760 [Oryza sativa Japonica Group]
Length=93

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  104  LDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSR  205
            ++KTKA A++G++KVK G + GF WIKDKYQ+ +
Sbjct  43   MEKTKAAAASGLRKVKEGTAHGFQWIKDKYQQKK  76



>emb|CDY21810.1| BnaA06g20790D [Brassica napus]
Length=81

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +2

Query  104  LDKTKAVASTGVKKVKAGASAGFHWIKDKYQKSRQK  211
            L KTKA AS+G KKVK G S G  W+KDKY K+  K
Sbjct  44   LGKTKAAASSGFKKVKTGTSLGLSWVKDKYTKTTSK  79



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 514802592608