BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c124259_g1_i1 len=263 path=[1:0-262]

Length=263
                                                                      Score     E

ref|XP_004237658.1|  PREDICTED: protein GPR107-like                     111   7e-27   
ref|XP_006340512.1|  PREDICTED: protein GPR107-like                     109   2e-26   
ref|XP_010264826.1|  PREDICTED: protein GPR107-like                     109   3e-26   
ref|XP_009602816.1|  PREDICTED: protein GPR107-like                     108   4e-26   
ref|XP_009786074.1|  PREDICTED: protein GPR107-like                     107   1e-25   
ref|XP_002522009.1|  lung seven transmembrane receptor, putative      99.8    1e-22   Ricinus communis
ref|XP_006854372.1|  hypothetical protein AMTR_s00039p00168460        94.4    9e-21   
ref|XP_007030325.1|  Lung seven transmembrane receptor, putative      93.2    3e-20   
emb|CBI28639.3|  unnamed protein product                              92.4    4e-20   
emb|CAN62880.1|  hypothetical protein VITISV_000844                   92.4    6e-20   Vitis vinifera
ref|XP_010648945.1|  PREDICTED: protein GPR107                        92.4    6e-20   
ref|XP_002319667.2|  hypothetical protein POPTR_0013s04700g           89.4    8e-19   Populus trichocarpa [western balsam poplar]
ref|XP_006443271.1|  hypothetical protein CICLE_v10024007mg           88.6    1e-18   
ref|XP_006479006.1|  PREDICTED: protein GPR107-like                   88.2    2e-18   
ref|XP_010684174.1|  PREDICTED: protein GPR107-like                   85.5    2e-17   
ref|XP_011038588.1|  PREDICTED: LOW QUALITY PROTEIN: protein GPR107   84.7    4e-17   
ref|XP_010918999.1|  PREDICTED: protein GPR107-like                   82.8    2e-16   
ref|XP_010253381.1|  PREDICTED: protein GPR107-like                   82.0    3e-16   
ref|XP_006838562.1|  hypothetical protein AMTR_s00002p00206900        82.0    4e-16   
ref|XP_002989703.1|  hypothetical protein SELMODRAFT_428278           82.0    4e-16   
ref|XP_002991778.1|  hypothetical protein SELMODRAFT_430027           80.5    1e-15   
ref|XP_004961824.1|  PREDICTED: protein GPR107-like                   80.9    1e-15   
emb|CDX88933.1|  BnaA03g07160D                                        80.1    2e-15   
ref|XP_009131672.1|  PREDICTED: protein GPR107-like                   80.1    2e-15   
ref|XP_007027143.1|  Lung seven transmembrane receptor family pro...  80.1    2e-15   
ref|XP_010259993.1|  PREDICTED: protein GPR107-like                   79.7    2e-15   
ref|XP_008776258.1|  PREDICTED: protein GPR107-like                   79.7    2e-15   
ref|XP_002439928.1|  hypothetical protein SORBIDRAFT_09g022750        79.3    4e-15   Sorghum bicolor [broomcorn]
ref|NP_001183230.1|  uncharacterized LOC100501618 precursor           79.0    5e-15   
ref|XP_011077412.1|  PREDICTED: protein GPR107                        78.2    7e-15   
gb|EYU41662.1|  hypothetical protein MIMGU_mgv1a025131mg              78.2    8e-15   
emb|CDX70824.1|  BnaC03g09080D                                        77.8    1e-14   
ref|XP_004249516.1|  PREDICTED: protein GPR107-like                   77.4    1e-14   
ref|XP_002525014.1|  lung seven transmembrane receptor, putative      77.4    1e-14   Ricinus communis
ref|XP_006345680.1|  PREDICTED: protein GPR107-like                   77.4    2e-14   
gb|KFK38350.1|  hypothetical protein AALP_AA3G102700                  77.4    2e-14   
ref|XP_006339050.1|  PREDICTED: protein GPR107-like                   77.4    2e-14   
ref|XP_010529751.1|  PREDICTED: protein GPR107-like                   77.0    2e-14   
ref|XP_004246733.1|  PREDICTED: protein GPR107                        77.0    2e-14   
gb|KDP35561.1|  hypothetical protein JCGZ_08999                       76.6    3e-14   
ref|XP_010066849.1|  PREDICTED: protein GPR107-like                   76.6    3e-14   
ref|XP_004494982.1|  PREDICTED: protein GPR107-like                   76.6    3e-14   
ref|XP_011094786.1|  PREDICTED: protein GPR107-like                   76.6    3e-14   
emb|CDX92603.1|  BnaA10g16420D                                        76.6    3e-14   
emb|CDY13896.1|  BnaC09g39300D                                        76.6    3e-14   
ref|XP_010456575.1|  PREDICTED: protein GPR107-like                   75.9    4e-14   
ref|XP_009120965.1|  PREDICTED: LOW QUALITY PROTEIN: protein GPR107   76.3    4e-14   
ref|XP_008783613.1|  PREDICTED: protein GPR107                        76.3    4e-14   
ref|XP_006644974.1|  PREDICTED: protein GPR107-like                   76.3    4e-14   
gb|EMT16571.1|  hypothetical protein F775_12543                       76.3    4e-14   
ref|NP_197353.1|  candidate G-protein Coupled Receptor 7              76.3    4e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287752.1|  hypothetical protein CARUB_v10000963mg           76.3    4e-14   
ref|XP_002882624.1|  hypothetical protein ARALYDRAFT_478277           76.3    4e-14   
dbj|BAD94365.1|  putative protein                                     76.3    4e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010454100.1|  PREDICTED: protein GPR107-like                   75.9    5e-14   
ref|XP_010420618.1|  PREDICTED: protein GPR107-like isoform X1        75.9    5e-14   
ref|XP_002871820.1|  hypothetical protein ARALYDRAFT_488733           75.9    5e-14   
ref|XP_010492861.1|  PREDICTED: protein GPR107-like                   75.9    5e-14   
ref|XP_003537224.1|  PREDICTED: protein GPR107-like isoformX1         75.9    6e-14   
ref|XP_003521355.1|  PREDICTED: protein GPR107-like                   75.9    6e-14   
ref|XP_010910013.1|  PREDICTED: protein GPR107-like                   75.9    6e-14   
gb|EEC73611.1|  hypothetical protein OsI_08097                        75.9    6e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_006297691.1|  hypothetical protein CARUB_v10013721mg           75.5    7e-14   
ref|XP_010464605.1|  PREDICTED: protein GPR107-like                   75.5    7e-14   
ref|NP_187568.1|  lung seven transmembrane receptor family protein    75.5    7e-14   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD21602.1|  putative lung seven transmembrane receptor 1         75.5    7e-14   Oryza sativa Japonica Group [Japonica rice]
gb|KFK26091.1|  hypothetical protein AALP_AA8G201700                  75.5    7e-14   
ref|NP_001047450.1|  Os02g0618700                                     75.5    7e-14   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001151745.1|  protein GPR107                                   75.5    8e-14   Zea mays [maize]
gb|ACF87329.1|  unknown                                               75.5    8e-14   Zea mays [maize]
ref|XP_009126263.1|  PREDICTED: protein GPR107-like                   75.5    9e-14   
ref|NP_001044733.1|  Os01g0836800                                     75.5    9e-14   Oryza sativa Japonica Group [Japonica rice]
gb|EAY76414.1|  hypothetical protein OsI_04345                        75.5    9e-14   Oryza sativa Indica Group [Indian rice]
emb|CDY11221.1|  BnaA03g00570D                                        75.1    1e-13   
ref|XP_002322836.2|  hypothetical protein POPTR_0016s08220g           75.1    1e-13   Populus trichocarpa [western balsam poplar]
ref|XP_009385234.1|  PREDICTED: protein GPR107-like                   75.1    1e-13   
ref|XP_009780573.1|  PREDICTED: protein GPR107-like                   74.7    1e-13   
ref|XP_010489726.1|  PREDICTED: uncharacterized protein LOC104767390  74.3    1e-13   
ref|XP_006400401.1|  hypothetical protein EUTSA_v10013548mg           74.7    1e-13   
ref|XP_003575372.2|  PREDICTED: protein GPR107-like                   74.7    2e-13   
ref|XP_006647525.1|  PREDICTED: protein GPR107-like                   74.7    2e-13   
gb|KHN39394.1|  Protein GPR107-like protein                           73.6    2e-13   
ref|XP_010474113.1|  PREDICTED: protein GPR107-like                   74.3    2e-13   
gb|KDO49836.1|  hypothetical protein CISIN_1g013595mg                 73.9    3e-13   
emb|CDY02622.1|  BnaC02g08130D                                        73.9    3e-13   
ref|XP_004493910.1|  PREDICTED: protein GPR107-like                   73.9    3e-13   
ref|XP_009146920.1|  PREDICTED: protein GPR107                        73.9    3e-13   
emb|CDY44715.1|  BnaA05g28910D                                        73.9    3e-13   
ref|XP_007162690.1|  hypothetical protein PHAVU_001G172000g           73.6    3e-13   
ref|XP_007205216.1|  hypothetical protein PRUPE_ppa005913mg           73.6    3e-13   
ref|XP_009599070.1|  PREDICTED: protein GPR107-like                   73.9    3e-13   
ref|XP_011019265.1|  PREDICTED: protein GPR107                        73.6    3e-13   
ref|XP_003542477.1|  PREDICTED: protein GPR107-like isoformX1         73.6    4e-13   
ref|NP_001150692.1|  transmembrane receptor                           73.2    4e-13   Zea mays [maize]
ref|XP_006480714.1|  PREDICTED: protein GPR107-like                   73.2    4e-13   
ref|XP_004302804.1|  PREDICTED: protein GPR107-like                   73.2    5e-13   
ref|XP_002274179.1|  PREDICTED: protein GPR107-like                   73.2    5e-13   Vitis vinifera
ref|XP_007144492.1|  hypothetical protein PHAVU_007G160700g           73.2    5e-13   
ref|NP_001132310.1|  uncharacterized LOC100193752 precursor           73.2    5e-13   Zea mays [maize]
ref|NP_001140755.1|  uncharacterized LOC100272830 precursor           73.2    5e-13   Zea mays [maize]
ref|XP_006428980.1|  hypothetical protein CICLE_v10011742mg           72.8    8e-13   
dbj|BAJ88404.1|  predicted protein                                    72.4    9e-13   
dbj|BAJ85380.1|  predicted protein                                    72.4    9e-13   
ref|XP_010528248.1|  PREDICTED: protein GPR107-like                   72.4    1e-12   
emb|CDY41601.1|  BnaC05g43380D                                        72.4    1e-12   
ref|XP_008657086.1|  PREDICTED: protein GPR107-like                   72.4    1e-12   
ref|XP_004142094.1|  PREDICTED: protein GPR107-like                   72.0    1e-12   
ref|XP_008241753.1|  PREDICTED: protein GPR107-like                   71.6    2e-12   
emb|CBI25306.3|  unnamed protein product                              72.0    2e-12   
ref|XP_008350414.1|  PREDICTED: protein GPR107-like                   71.6    2e-12   
ref|XP_008447343.1|  PREDICTED: protein GPR107                        71.2    2e-12   
ref|XP_009798503.1|  PREDICTED: protein GPR107-like                   71.2    2e-12   
ref|XP_009596305.1|  PREDICTED: protein GPR107-like                   71.2    2e-12   
gb|KEH42324.1|  lung seven transmembrane receptor family protein      71.2    3e-12   
emb|CAN74527.1|  hypothetical protein VITISV_038603                   70.9    3e-12   Vitis vinifera
ref|XP_002282139.1|  PREDICTED: protein GPR107-like                   70.9    3e-12   Vitis vinifera
ref|XP_002308488.1|  hypothetical protein POPTR_0006s23140g           70.9    3e-12   Populus trichocarpa [western balsam poplar]
ref|XP_002972884.1|  hypothetical protein SELMODRAFT_441902           70.9    4e-12   
ref|XP_002988051.1|  hypothetical protein SELMODRAFT_183593           70.5    4e-12   
emb|CDM84868.1|  unnamed protein product                              70.9    4e-12   
emb|CDY58110.1|  BnaA02g35120D                                        70.5    4e-12   
dbj|BAJ98867.1|  predicted protein                                    70.5    4e-12   
ref|XP_002458727.1|  hypothetical protein SORBIDRAFT_03g039120        70.5    4e-12   Sorghum bicolor [broomcorn]
ref|XP_010558307.1|  PREDICTED: protein GPR107 isoform X2             70.1    4e-12   
dbj|BAK03411.1|  predicted protein                                    70.5    5e-12   
ref|XP_010558306.1|  PREDICTED: protein GPR107 isoform X1             70.1    5e-12   
ref|XP_003564559.1|  PREDICTED: protein GPR107-like                   70.1    6e-12   
ref|XP_006858265.1|  hypothetical protein AMTR_s00062p00210470        70.1    7e-12   
dbj|BAJ85112.1|  predicted protein                                    69.7    9e-12   
ref|XP_003580105.1|  PREDICTED: protein GPR107-like                   69.7    1e-11   
ref|XP_010922440.1|  PREDICTED: protein GPR107-like                   69.3    1e-11   
gb|EMT18499.1|  hypothetical protein F775_26439                       69.7    1e-11   
ref|XP_009341747.1|  PREDICTED: protein GPR107                        69.3    1e-11   
emb|CDP06670.1|  unnamed protein product                              68.9    1e-11   
ref|XP_011007322.1|  PREDICTED: protein GPR107-like                   68.9    1e-11   
ref|XP_003554340.1|  PREDICTED: protein GPR107-like isoform 2         68.9    2e-11   
dbj|BAK08179.1|  predicted protein                                    68.6    2e-11   
ref|XP_008345481.1|  PREDICTED: LOW QUALITY PROTEIN: protein GPR1...  68.2    3e-11   
gb|EPS69713.1|  hypothetical protein M569_05049                       67.8    3e-11   
ref|XP_006287780.1|  hypothetical protein CARUB_v10000990mg           67.4    5e-11   
ref|XP_009340899.1|  PREDICTED: protein GPR107-like                   67.4    5e-11   
ref|XP_009420074.1|  PREDICTED: protein GPR107-like                   67.4    7e-11   
ref|XP_002452464.1|  hypothetical protein SORBIDRAFT_04g026230        67.4    7e-11   Sorghum bicolor [broomcorn]
ref|NP_001055767.1|  Os05g0462500                                     66.2    1e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EAY98335.1|  hypothetical protein OsI_20245                        66.2    1e-10   Oryza sativa Indica Group [Indian rice]
gb|EPS70872.1|  seven transmembrane receptor                          65.5    2e-10   
ref|XP_009130750.1|  PREDICTED: protein GPR107-like                   65.1    3e-10   
ref|XP_002870983.1|  predicted protein                                65.1    4e-10   
gb|KEH35147.1|  lung seven transmembrane receptor family protein      64.7    4e-10   
ref|XP_010086763.1|  hypothetical protein L484_005732                 64.7    4e-10   
gb|EPS67071.1|  hypothetical protein M569_07703                       64.7    5e-10   
ref|XP_004976173.1|  PREDICTED: protein GPR107-like                   63.9    8e-10   
ref|NP_195883.1|  Lung seven transmembrane receptor family protein    63.5    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006352298.1|  PREDICTED: protein GPR107-like                   63.5    1e-09   
ref|XP_003625548.1|  Protein GPR107                                   63.2    2e-09   
ref|XP_007151967.1|  hypothetical protein PHAVU_004G090500g           63.2    2e-09   
ref|XP_006652496.1|  PREDICTED: protein GPR107-like                   63.2    2e-09   
ref|XP_010039089.1|  PREDICTED: protein GPR107-like                   63.2    2e-09   
ref|XP_004502059.1|  PREDICTED: protein GPR107-like                   63.2    2e-09   
ref|XP_002518919.1|  lung seven transmembrane receptor, putative      62.8    2e-09   Ricinus communis
ref|XP_010037886.1|  PREDICTED: protein GPR107-like                   62.4    3e-09   
gb|KCW49664.1|  hypothetical protein EUGRSUZ_K03178                   62.4    3e-09   
ref|XP_003542153.1|  PREDICTED: protein GPR107-like                   62.4    4e-09   
ref|XP_008448554.1|  PREDICTED: protein GPR107                        62.0    4e-09   
ref|NP_001053272.1|  Os04g0508600                                     62.4    4e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009773796.1|  PREDICTED: protein GPR107-like                   62.0    5e-09   
ref|XP_006350720.1|  PREDICTED: protein GPR107-like                   61.6    6e-09   
ref|XP_009625570.1|  PREDICTED: protein GPR107-like                   61.6    6e-09   
ref|XP_004244659.2|  PREDICTED: protein GPR107-like                   61.6    6e-09   
ref|XP_001759185.1|  predicted protein                                61.6    6e-09   
ref|NP_001152348.1|  protein GPR107 precursor                         61.6    7e-09   Zea mays [maize]
ref|XP_009406962.1|  PREDICTED: protein GPR107-like                   61.6    7e-09   
ref|XP_009105371.1|  PREDICTED: protein GPR107-like                   61.2    7e-09   
gb|ABR17223.1|  unknown                                               61.2    7e-09   Picea sitchensis
ref|XP_009784262.1|  PREDICTED: protein GPR107-like                   61.2    7e-09   
ref|XP_009396863.1|  PREDICTED: protein GPR107-like                   61.2    9e-09   
emb|CDP12235.1|  unnamed protein product                              61.2    9e-09   
ref|XP_008663377.1|  PREDICTED: protein GPR107-like                   60.8    1e-08   
ref|XP_009104916.1|  PREDICTED: protein GPR107-like                   60.8    1e-08   
emb|CDX68314.1|  BnaA07g23540D                                        60.8    1e-08   
ref|XP_011069685.1|  PREDICTED: protein GPR107-like                   60.8    1e-08   
ref|XP_009624831.1|  PREDICTED: protein GPR107-like                   60.8    1e-08   
tpg|DAA37003.1|  TPA: putative lung seven transmembrane receptor ...  60.5    1e-08   
emb|CDY49209.1|  BnaCnng16980D                                        60.5    1e-08   
ref|XP_003518627.1|  PREDICTED: protein GPR107-like                   60.5    2e-08   
ref|NP_199024.1|  lung seven transmembrane receptor family protein    60.5    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870592.1|  hypothetical protein ARALYDRAFT_915976           60.1    2e-08   
ref|XP_002446769.1|  hypothetical protein SORBIDRAFT_06g022100        60.1    2e-08   Sorghum bicolor [broomcorn]
gb|AAM63843.1|  unknown                                               60.1    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006282859.1|  hypothetical protein CARUB_v10006835mg           59.7    2e-08   
gb|KDP25212.1|  hypothetical protein JCGZ_20368                       59.7    3e-08   
ref|XP_010490727.1|  PREDICTED: protein GPR107 isoform X1             59.7    3e-08   
ref|XP_010267415.1|  PREDICTED: protein GPR107-like                   59.3    4e-08   
ref|XP_006405277.1|  hypothetical protein EUTSA_v10028347mg           59.3    4e-08   
ref|XP_007039375.1|  Lung seven transmembrane receptor family pro...  59.3    4e-08   
emb|CDY01901.1|  BnaC06g29410D                                        59.3    4e-08   
ref|XP_011070390.1|  PREDICTED: protein GPR107-like                   58.9    5e-08   
gb|KGN55664.1|  hypothetical protein Csa_3G002830                     58.9    5e-08   
ref|XP_004159716.1|  PREDICTED: protein GPR107-like                   58.9    5e-08   
emb|CDX80833.1|  BnaC03g00870D                                        58.5    5e-08   
ref|XP_004146137.1|  PREDICTED: protein GPR107-like                   58.9    6e-08   
ref|XP_004235013.1|  PREDICTED: protein GPR107-like                   58.5    7e-08   
ref|XP_010447100.1|  PREDICTED: protein GPR107-like isoform X1        58.5    8e-08   
ref|XP_010441394.1|  PREDICTED: protein GPR107-like                   58.5    8e-08   
ref|XP_010447108.1|  PREDICTED: protein GPR107-like isoform X2        58.5    8e-08   
ref|XP_002299422.1|  hypothetical protein POPTR_0001s11440g           58.2    1e-07   Populus trichocarpa [western balsam poplar]
ref|XP_009399989.1|  PREDICTED: protein GPR107-like                   58.2    1e-07   
ref|XP_004309534.1|  PREDICTED: protein GPR107-like                   58.2    1e-07   
ref|XP_011022403.1|  PREDICTED: protein GPR107                        57.8    1e-07   
ref|XP_010666150.1|  PREDICTED: protein GPR107-like                   57.8    1e-07   
ref|XP_010676916.1|  PREDICTED: protein GPR107                        57.4    2e-07   
ref|XP_002303695.1|  hypothetical protein POPTR_0003s14750g           57.4    2e-07   Populus trichocarpa [western balsam poplar]
ref|XP_006439214.1|  hypothetical protein CICLE_v10020208mg           57.0    2e-07   
gb|KDO76745.1|  hypothetical protein CISIN_1g013899mg                 57.0    2e-07   
gb|EYU45253.1|  hypothetical protein MIMGU_mgv1a003877mg              57.4    2e-07   
emb|CDP05000.1|  unnamed protein product                              57.0    2e-07   
ref|XP_006476279.1|  PREDICTED: protein GPR107-like                   56.2    4e-07   
ref|XP_007209144.1|  hypothetical protein PRUPE_ppa005847mg           56.2    4e-07   
ref|XP_001772011.1|  predicted protein                                56.2    5e-07   
gb|KFK24720.1|  hypothetical protein AALP_AA8G015900                  55.8    5e-07   
ref|XP_002279642.1|  PREDICTED: protein GPR107                        55.1    1e-06   Vitis vinifera
ref|XP_010251927.1|  PREDICTED: protein GPR107-like                   55.1    1e-06   
gb|KHN05945.1|  Protein GPR107-like protein                           54.7    1e-06   
ref|XP_003536969.1|  PREDICTED: protein GPR107-like                   54.7    1e-06   
ref|XP_006347499.1|  PREDICTED: protein GPR107-like                   54.7    2e-06   
ref|XP_008374157.1|  PREDICTED: protein GPR107-like                   54.3    2e-06   
ref|XP_008775764.1|  PREDICTED: protein GPR107-like                   54.3    2e-06   
ref|XP_008356560.1|  PREDICTED: protein GPR107-like                   53.9    3e-06   
ref|XP_006656603.1|  PREDICTED: protein GPR107-like                   53.9    3e-06   
ref|XP_009360196.1|  PREDICTED: protein GPR107                        53.9    3e-06   
ref|XP_008239261.1|  PREDICTED: protein GPR107-like                   53.9    3e-06   
ref|XP_005649187.1|  hypothetical protein COCSUDRAFT_53024            53.5    4e-06   
ref|XP_001763158.1|  predicted protein                                53.5    4e-06   
ref|XP_006846584.1|  hypothetical protein AMTR_s00018p00254770        53.5    4e-06   
ref|XP_010100208.1|  hypothetical protein L484_015353                 53.5    4e-06   
ref|XP_010490728.1|  PREDICTED: protein GPR107 isoform X2             53.1    5e-06   
gb|ABR17381.1|  unknown                                               52.0    1e-05   Picea sitchensis
ref|XP_008392135.1|  PREDICTED: protein GPR107                        52.0    1e-05   
ref|NP_001056698.1|  Os06g0132100                                     52.0    1e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010056015.1|  PREDICTED: protein GPR107                        51.2    3e-05   
gb|AFG50463.1|  hypothetical protein UMN_737_01                       48.5    3e-05   
gb|AEW09224.1|  hypothetical protein UMN_737_01                       48.5    3e-05   
ref|XP_003557135.1|  PREDICTED: protein GPR107                        50.4    4e-05   
gb|AEW09225.1|  hypothetical protein UMN_737_01                       48.1    4e-05   
gb|AFW86007.1|  putative lung seven transmembrane receptor family...  49.7    6e-05   
ref|NP_001141351.1|  uncharacterized protein LOC100273442 precursor   50.1    6e-05   Zea mays [maize]
gb|AGV54552.1|  protein GPR107-like isoform 1                         49.7    8e-05   
gb|AFW86008.1|  putative lung seven transmembrane receptor family...  50.1    8e-05   
ref|XP_010533538.1|  PREDICTED: protein GPR107                        49.3    9e-05   
emb|CBI32653.3|  unnamed protein product                              49.3    1e-04   
gb|AGV54874.1|  GPR107-like protein isoform 1                         49.3    1e-04   
ref|XP_004964437.1|  PREDICTED: protein GPR107-like                   49.3    1e-04   
ref|XP_009391935.1|  PREDICTED: protein GPR107-like                   48.9    1e-04   
ref|XP_002436416.1|  hypothetical protein SORBIDRAFT_10g002110        48.5    2e-04   Sorghum bicolor [broomcorn]
ref|NP_001140910.1|  uncharacterized LOC100272987 precursor           48.5    2e-04   Zea mays [maize]
gb|ACG34585.1|  protein GPR108 precursor                              48.5    2e-04   Zea mays [maize]
gb|AAQ06259.1|  unknown                                               48.1    2e-04   Sorghum bicolor [broomcorn]
ref|XP_008778725.1|  PREDICTED: protein GPR107-like                   47.0    7e-04   
ref|XP_003589506.1|  Cysteine protease                                47.0    7e-04   
gb|AES59757.2|  papain family cysteine protease                       47.0    8e-04   
ref|XP_009407946.1|  PREDICTED: protein GPR107-like                   46.6    8e-04   
dbj|BAJ90972.1|  predicted protein                                    46.6    9e-04   



>ref|XP_004237658.1| PREDICTED: protein GPR107-like [Solanum lycopersicum]
Length=457

 Score =   111 bits (277),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = -1

Query  263  LSPVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQL  84
            L P SS+N +  I +EPDEYNLIFGNCQ EF V+M V TE+YNVN NGEKDFLPAGQT L
Sbjct  120  LGPDSSYNISTTI-DEPDEYNLIFGNCQKEFLVTMNVHTEIYNVNDNGEKDFLPAGQTPL  178

Query  83   PMIffffFSVYLCFLAVWVSVCVKQ  9
            P ++F  F VY+ FL +W  VCVKQ
Sbjct  179  PKLYFLLFVVYIVFLGIWGFVCVKQ  203



>ref|XP_006340512.1| PREDICTED: protein GPR107-like, partial [Solanum tuberosum]
Length=437

 Score =   109 bits (273),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = -1

Query  263  LSPVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQL  84
            L P SS+N +  I +EPDEYNLIFGNCQ EF V+M V TE+YNVN NGEKDFLPAGQT L
Sbjct  120  LGPDSSYNTSTTI-DEPDEYNLIFGNCQKEFLVTMNVHTEIYNVNDNGEKDFLPAGQTIL  178

Query  83   PMIffffFSVYLCFLAVWVSVCVKQ  9
            P ++F  F VY  FL +W  +CVKQ
Sbjct  179  PKLYFLLFIVYFVFLGIWGFICVKQ  203



>ref|XP_010264826.1| PREDICTED: protein GPR107-like [Nelumbo nucifera]
Length=438

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 67/86 (78%), Gaps = 2/86 (2%)
 Frame = -1

Query  263  LSPVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQL  84
            L P S++N + VI E PDEY+L+FGNCQPE+ VSM V TEMYNV G G KDFLPAGQTQL
Sbjct  126  LYPDSTYNGS-VIVEHPDEYSLVFGNCQPEYEVSMDVHTEMYNVEG-GRKDFLPAGQTQL  183

Query  83   PMIffffFSVYLCFLAVWVSVCVKQS  6
            P ++F FF VY  F  +WVSVC+KQS
Sbjct  184  PKLYFLFFLVYTAFFTLWVSVCIKQS  209



>ref|XP_009602816.1| PREDICTED: protein GPR107-like [Nicotiana tomentosiformis]
Length=441

 Score =   108 bits (271),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = -1

Query  263  LSPVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQL  84
            L P S++NA+  I +EPDEYNLIFGNCQ EF V+M V TEMYNVN NGEKDFLPAGQT L
Sbjct  118  LGPDSTYNASTTI-DEPDEYNLIFGNCQKEFLVTMNVHTEMYNVN-NGEKDFLPAGQTPL  175

Query  83   PMIffffFSVYLCFLAVWVSVCVKQSE  3
            P  +F  F VYL FLA+W  +C+KQ +
Sbjct  176  PKFYFLCFIVYLAFLAIWGFICIKQRK  202



>ref|XP_009786074.1| PREDICTED: protein GPR107-like [Nicotiana sylvestris]
Length=438

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 66/87 (76%), Gaps = 2/87 (2%)
 Frame = -1

Query  263  LSPVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQL  84
            L P S++N +  I +EPDEYNLIFGNCQ EF V+M V TEMYNVN NGEKDFLPAGQT L
Sbjct  118  LGPDSTYNTSTTI-DEPDEYNLIFGNCQKEFLVTMNVHTEMYNVN-NGEKDFLPAGQTPL  175

Query  83   PMIffffFSVYLCFLAVWVSVCVKQSE  3
            P  +F  F VYL FLA+W  +C+KQ +
Sbjct  176  PKFYFLCFIVYLAFLAIWGFICIKQRK  202



>ref|XP_002522009.1| lung seven transmembrane receptor, putative [Ricinus communis]
 gb|EEF40413.1| lung seven transmembrane receptor, putative [Ricinus communis]
Length=437

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = -1

Query  254  VSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMI  75
            V+S N   +  ++PDEY+L+FGNCQPEF VSM V TEMYN+   G KDFLPAGQT LP +
Sbjct  127  VNSTNTGSIAIDDPDEYSLVFGNCQPEFEVSMYVHTEMYNLK-YGVKDFLPAGQTHLPRL  185

Query  74   ffffFSVYLCFLAVWVSVCVKQ  9
            +F FF +Y CFL +W+ +C+KQ
Sbjct  186  YFIFFLIYACFLGLWIFICIKQ  207



>ref|XP_006854372.1| hypothetical protein AMTR_s00039p00168460 [Amborella trichopoda]
 gb|ERN15839.1| hypothetical protein AMTR_s00039p00168460 [Amborella trichopoda]
Length=448

 Score = 94.4 bits (233),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 64/80 (80%), Gaps = 2/80 (3%)
 Frame = -1

Query  248  SHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIff  69
            SHN+T+ + + PDEY L+FGNCQPEF + M V TEMYN++G+  +DFLP+GQTQLP+++ 
Sbjct  127  SHNSTIQVMQ-PDEYTLVFGNCQPEFEIIMDVHTEMYNMDGD-VRDFLPSGQTQLPILYL  184

Query  68   ffFSVYLCFLAVWVSVCVKQ  9
            F+F +Y  F+ +W+++C++ 
Sbjct  185  FYFVIYCLFIGLWINICMRH  204



>ref|XP_007030325.1| Lung seven transmembrane receptor, putative [Theobroma cacao]
 gb|EOY10827.1| Lung seven transmembrane receptor, putative [Theobroma cacao]
Length=449

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 65/86 (76%), Gaps = 2/86 (2%)
 Frame = -1

Query  263  LSPVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQL  84
            L+  S+++ ++ I ++PD+Y+L+FGNCQPEF VSM V TEMYN+   GEKDFLPAGQT L
Sbjct  126  LTADSTYSGSIEI-DDPDKYSLVFGNCQPEFRVSMHVHTEMYNLK-EGEKDFLPAGQTPL  183

Query  83   PMIffffFSVYLCFLAVWVSVCVKQS  6
            P +FFFFF +Y  FL +WV  C+ Q 
Sbjct  184  PRLFFFFFLIYAAFLLIWVFACINQK  209



>emb|CBI28639.3| unnamed protein product [Vitis vinifera]
Length=412

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = -1

Query  254  VSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMI  75
            ++++N +++I EEPDEY+LIFGNCQ E  VSM V TEMYN+  +G K+FLPAGQT LP +
Sbjct  92   LAAYNGSMLI-EEPDEYSLIFGNCQSETQVSMDVHTEMYNIL-DGNKNFLPAGQTPLPRL  149

Query  74   ffffFSVYLCFLAVWVSVCVKQ  9
            +F FF +Y  F++VW+ +C+KQ
Sbjct  150  YFIFFLIYSIFVSVWIFICIKQ  171



>emb|CAN62880.1| hypothetical protein VITISV_000844 [Vitis vinifera]
Length=444

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = -1

Query  254  VSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMI  75
            ++++N +++I EEPDEY+LIFGNCQ E  VSM V TEMYN+  +G K+FLPAGQT LP +
Sbjct  124  LAAYNGSMLI-EEPDEYSLIFGNCQSETQVSMDVHTEMYNIL-DGNKNFLPAGQTPLPRL  181

Query  74   ffffFSVYLCFLAVWVSVCVKQ  9
            +F FF +Y  F++VW+ +C+KQ
Sbjct  182  YFIFFLIYSIFVSVWIFICIKQ  203



>ref|XP_010648945.1| PREDICTED: protein GPR107 [Vitis vinifera]
Length=444

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = -1

Query  254  VSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMI  75
            ++++N +++I EEPDEY+LIFGNCQ E  VSM V TEMYN+  +G K+FLPAGQT LP +
Sbjct  124  LAAYNGSMLI-EEPDEYSLIFGNCQSETQVSMDVHTEMYNIL-DGNKNFLPAGQTPLPRL  181

Query  74   ffffFSVYLCFLAVWVSVCVKQ  9
            +F FF +Y  F++VW+ +C+KQ
Sbjct  182  YFIFFLIYSIFVSVWIFICIKQ  203



>ref|XP_002319667.2| hypothetical protein POPTR_0013s04700g [Populus trichocarpa]
 gb|EEE95590.2| hypothetical protein POPTR_0013s04700g [Populus trichocarpa]
Length=453

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 56/81 (69%), Gaps = 2/81 (2%)
 Frame = -1

Query  251  SSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIf  72
            S++N +  I +E DEY+L+FGNCQPEF VSM V TEMYN+  +G K+FLP GQT LP  F
Sbjct  134  SAYNGSASI-DEADEYSLVFGNCQPEFEVSMYVHTEMYNLQ-DGAKNFLPIGQTFLPKFF  191

Query  71   fffFSVYLCFLAVWVSVCVKQ  9
               F +Y CF  +W  VC KQ
Sbjct  192  LSMFLIYTCFFGIWSFVCFKQ  212



>ref|XP_006443271.1| hypothetical protein CICLE_v10024007mg, partial [Citrus clementina]
 gb|ESR56511.1| hypothetical protein CICLE_v10024007mg, partial [Citrus clementina]
 gb|KDO52480.1| hypothetical protein CISIN_1g038842mg, partial [Citrus sinensis]
Length=423

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 61/83 (73%), Gaps = 2/83 (2%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P SS++  + I++ PDEY L+FGNCQPEF VSM V TEM+N + +G KD+LPAGQTQLP 
Sbjct  102  PNSSYSGAVNIND-PDEYILLFGNCQPEFQVSMFVKTEMHN-SQHGIKDYLPAGQTQLPR  159

Query  77   IffffFSVYLCFLAVWVSVCVKQ  9
            ++  FF  Y  F  +WV +C+KQ
Sbjct  160  LYLMFFFTYTLFFVMWVFICIKQ  182



>ref|XP_006479006.1| PREDICTED: protein GPR107-like [Citrus sinensis]
Length=434

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 61/83 (73%), Gaps = 2/83 (2%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P SS++  + I++ PDEY L+FGNCQPEF VSM V TEM+N + +G KD+LPAGQTQLP 
Sbjct  113  PNSSYSGAVNIND-PDEYILLFGNCQPEFQVSMFVKTEMHN-SQHGIKDYLPAGQTQLPR  170

Query  77   IffffFSVYLCFLAVWVSVCVKQ  9
            ++  FF  Y  F  +WV +C+KQ
Sbjct  171  LYLMFFFTYTLFFVMWVFICIKQ  193



>ref|XP_010684174.1| PREDICTED: protein GPR107-like [Beta vulgaris subsp. vulgaris]
Length=440

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 59/85 (69%), Gaps = 1/85 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            PVSS N +  I+  P+EY+L F NC P+  VSM V T MYN+  NG KD+LPAGQTQLP 
Sbjct  119  PVSSFNQSYPITI-PNEYSLFFANCNPQSSVSMTVTTLMYNLEFNGVKDYLPAGQTQLPT  177

Query  77   IffffFSVYLCFLAVWVSVCVKQSE  3
            ++FFF  +Y  FLA W++ CV+  +
Sbjct  178  LYFFFSVLYCVFLAYWIAACVRNKK  202



>ref|XP_011038588.1| PREDICTED: LOW QUALITY PROTEIN: protein GPR107 [Populus euphratica]
Length=453

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 55/81 (68%), Gaps = 2/81 (2%)
 Frame = -1

Query  251  SSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIf  72
            S++N +  I +E DEY+L+FGNCQPE  VSM + TEM N+  +G K+FLP GQT LP IF
Sbjct  134  SAYNGSASI-DEADEYSLVFGNCQPELEVSMHIHTEMCNLQ-DGAKNFLPIGQTFLPXIF  191

Query  71   fffFSVYLCFLAVWVSVCVKQ  9
               F +Y CF  +W  VC KQ
Sbjct  192  LSMFLIYTCFFGIWSFVCFKQ  212



>ref|XP_010918999.1| PREDICTED: protein GPR107-like [Elaeis guineensis]
Length=446

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = -1

Query  212  DEYNLIFGNCQPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            DEY+L+F NCQP+  V+M V TEMYNV G  G+KD+LPAG TQLP I+F FF VY  F  
Sbjct  137  DEYSLLFCNCQPDVEVTMDVRTEMYNVEGAGGDKDYLPAGTTQLPKIYFTFFLVYSVFFM  196

Query  35   VWVSVCVKQS  6
            VWV +CVK+ 
Sbjct  197  VWVFICVKKR  206



>ref|XP_010253381.1| PREDICTED: protein GPR107-like [Nelumbo nucifera]
Length=437

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = -1

Query  218  EPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFL  39
            EP+EY+L F NC P+  V+M V TEMYNV+ NG KD+LPAGQTQLPM++F F   YL FL
Sbjct  129  EPNEYSLFFSNCAPKSQVTMTVRTEMYNVD-NGVKDYLPAGQTQLPMLYFLFSLSYLAFL  187

Query  38   AVWVSVC  18
              W+  C
Sbjct  188  GFWIYFC  194



>ref|XP_006838562.1| hypothetical protein AMTR_s00002p00206900 [Amborella trichopoda]
 gb|ERN01131.1| hypothetical protein AMTR_s00002p00206900 [Amborella trichopoda]
Length=440

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 58/84 (69%), Gaps = 2/84 (2%)
 Frame = -1

Query  263  LSPVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQL  84
            L P  ++N +  +S  PDEY+L+F NC P   VSM V TEMYN+ G   KD+LPAGQTQL
Sbjct  117  LGPEFNYNHSYPVSV-PDEYSLVFANCNPNVEVSMNVHTEMYNLEGE-TKDYLPAGQTQL  174

Query  83   PMIffffFSVYLCFLAVWVSVCVK  12
            P ++F FF  Y+ F+ VW+ VC+K
Sbjct  175  PKLYFIFFLSYVAFMGVWIYVCMK  198



>ref|XP_002989703.1| hypothetical protein SELMODRAFT_428278 [Selaginella moellendorffii]
 gb|EFJ09180.1| hypothetical protein SELMODRAFT_428278 [Selaginella moellendorffii]
Length=447

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 39/85 (46%), Positives = 52/85 (61%), Gaps = 0/85 (0%)
 Frame = -1

Query  263  LSPVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQL  84
            L+ V S+   +    + +EY L F NCQP   VSM+V T MYNV+ NG K+FLP GQT+L
Sbjct  121  LNQVKSNYTNVFDVADTNEYGLFFANCQPHIRVSMKVRTSMYNVDANGRKNFLPFGQTEL  180

Query  83   PMIffffFSVYLCFLAVWVSVCVKQ  9
            P ++  F   Y+  L +W  VC KQ
Sbjct  181  PALYSIFALGYMVVLGLWGYVCYKQ  205



>ref|XP_002991778.1| hypothetical protein SELMODRAFT_430027 [Selaginella moellendorffii]
 gb|EFJ07182.1| hypothetical protein SELMODRAFT_430027 [Selaginella moellendorffii]
Length=447

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 38/85 (45%), Positives = 52/85 (61%), Gaps = 0/85 (0%)
 Frame = -1

Query  263  LSPVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQL  84
            L+ V S+   +    + +EY L F NCQP   VSM+V T MYNV+ NG K+FLP GQT+L
Sbjct  121  LNQVKSNYTNVFDVADTNEYGLFFANCQPHIRVSMKVRTSMYNVDANGRKNFLPFGQTEL  180

Query  83   PMIffffFSVYLCFLAVWVSVCVKQ  9
            P ++  F   Y+  + +W  VC KQ
Sbjct  181  PALYSIFALGYMVVVGLWGYVCYKQ  205



>ref|XP_004961824.1| PREDICTED: protein GPR107-like [Setaria italica]
Length=462

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            PDEY L F NC PE  VSMRV TEMYNVN +G KD+LP GQ  +P I+ FF   Y+ FLA
Sbjct  148  PDEYTLFFANCAPEALVSMRVRTEMYNVNADGFKDYLPVGQAPVPAIYGFFAFCYVAFLA  207

Query  35   VW  30
             W
Sbjct  208  AW  209



>emb|CDX88933.1| BnaA03g07160D [Brassica napus]
Length=438

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 43/80 (54%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P S  N +  ++  PDEY+L F NC PE  VSM V TEMYN + NG KD+LPAG TQLP 
Sbjct  117  PNSRFNQSYPVTS-PDEYSLFFANCLPETKVSMAVRTEMYNRDPNGSKDYLPAGSTQLPS  175

Query  77   IffffFSVYLCFLAVWVSVC  18
            ++ FFF  YL FL  W   C
Sbjct  176  LYSFFFLCYLTFLGYWSYTC  195



>ref|XP_009131672.1| PREDICTED: protein GPR107-like [Brassica rapa]
Length=438

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 43/80 (54%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P S  N +  ++  PDEY+L F NC PE  VSM V TEMYN + NG KD+LPAG TQLP 
Sbjct  117  PNSRFNQSYPVTS-PDEYSLFFANCLPETKVSMAVRTEMYNRDPNGSKDYLPAGSTQLPS  175

Query  77   IffffFSVYLCFLAVWVSVC  18
            ++ FFF  YL FL  W   C
Sbjct  176  LYSFFFLCYLSFLTYWSYTC  195



>ref|XP_007027143.1| Lung seven transmembrane receptor family protein [Theobroma cacao]
 gb|EOY07645.1| Lung seven transmembrane receptor family protein [Theobroma cacao]
Length=438

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 55/80 (69%), Gaps = 1/80 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P+S  + +  +S  P+EY+L F NC PE  VSM V TE+YN++ +G KDFL AG TQLP 
Sbjct  117  PLSRFDRSYPVSS-PNEYSLFFSNCAPETRVSMNVRTEIYNLDRDGSKDFLSAGLTQLPS  175

Query  77   IffffFSVYLCFLAVWVSVC  18
            ++ FF  +YL FLA W+ VC
Sbjct  176  LYTFFSILYLGFLAYWIYVC  195



>ref|XP_010259993.1| PREDICTED: protein GPR107-like [Nelumbo nucifera]
Length=435

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 57/78 (73%), Gaps = 6/78 (8%)
 Frame = -1

Query  251  SSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIf  72
            +S+N T     +P+EY+L F NC P+  V+M V TE+YN++ NG KD+LPAGQTQLPM++
Sbjct  121  NSYNIT-----DPNEYSLFFANCAPQSQVTMTVRTEIYNLD-NGVKDYLPAGQTQLPMLY  174

Query  71   fffFSVYLCFLAVWVSVC  18
            FFFF  YL FL  W+ +C
Sbjct  175  FFFFLSYLAFLVFWIYIC  192



>ref|XP_008776258.1| PREDICTED: protein GPR107-like [Phoenix dactylifera]
Length=446

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = -1

Query  218  EPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFL  39
             PDEY+L F NC PE  VSM V TEMYNV  +G +D+L  GQ  LP ++F F  VY+ FL
Sbjct  137  HPDEYSLFFANCNPESQVSMAVHTEMYNVRPDGSRDYLSVGQYPLPSLYFVFALVYVAFL  196

Query  38   AVWVSVCVK  12
            AVW+S  +K
Sbjct  197  AVWISYLIK  205



>ref|XP_002439928.1| hypothetical protein SORBIDRAFT_09g022750 [Sorghum bicolor]
 gb|EES18358.1| hypothetical protein SORBIDRAFT_09g022750 [Sorghum bicolor]
Length=460

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            PDEY L F NC PE  VSM V TEMYNVN +G KD+LP GQ  LP I+ FF   Y  FLA
Sbjct  151  PDEYTLFFANCAPEALVSMTVRTEMYNVNADGSKDYLPVGQAPLPAIYGFFAFCYAAFLA  210

Query  35   VW  30
             W
Sbjct  211  AW  212



>ref|NP_001183230.1| uncharacterized LOC100501618 precursor [Zea mays]
 gb|ACR36136.1| unknown [Zea mays]
 gb|AFW78289.1| putative lung seven transmembrane receptor family protein [Zea 
mays]
Length=457

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            PDEY L F NC PE  VSM V TEMYNVN +G KD+LP GQ  LP I+ FF   Y  FLA
Sbjct  148  PDEYTLFFANCAPEALVSMAVRTEMYNVNADGSKDYLPVGQAPLPAIYGFFAFCYAAFLA  207

Query  35   VW  30
             W
Sbjct  208  AW  209



>ref|XP_011077412.1| PREDICTED: protein GPR107 [Sesamum indicum]
Length=434

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 44/82 (54%), Positives = 55/82 (67%), Gaps = 2/82 (2%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P SS N +  I+  P+EY+L F NC P+  VSM V TE+YN +G  EKDFL AG TQLP 
Sbjct  115  PDSSFNHSYPITA-PNEYSLFFANCAPQSTVSMDVRTELYNFDGR-EKDFLSAGLTQLPT  172

Query  77   IffffFSVYLCFLAVWVSVCVK  12
            +FF FF +Y  F A W+ +CVK
Sbjct  173  LFFCFFVIYFAFFAFWIYICVK  194



>gb|EYU41662.1| hypothetical protein MIMGU_mgv1a025131mg [Erythranthe guttata]
Length=435

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 43/86 (50%), Positives = 56/86 (65%), Gaps = 2/86 (2%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNG-EKDFLPAGQTQLP  81
            P SS N +  I+  P+EY+L F NC PE  VSM V TE+YN++G G EKDFL AG TQLP
Sbjct  113  PHSSFNQSYPIAS-PNEYSLFFANCAPESAVSMNVRTELYNLDGRGREKDFLSAGLTQLP  171

Query  80   MIffffFSVYLCFLAVWVSVCVKQSE  3
             ++F F  +Y  FLA W  +C +  +
Sbjct  172  SLYFCFSVLYFGFLAYWFFICFQNKK  197



>emb|CDX70824.1| BnaC03g09080D [Brassica napus]
Length=439

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 42/80 (53%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P S  N +  ++  P+EY+L F NC PE  VSM V TEMYN + NG KD+LPAG TQLP 
Sbjct  118  PNSRFNQSYPVTS-PNEYSLFFANCLPETKVSMAVRTEMYNRDPNGSKDYLPAGSTQLPS  176

Query  77   IffffFSVYLCFLAVWVSVC  18
            ++ FFF  YL FL  W   C
Sbjct  177  LYSFFFLSYLAFLTYWSYTC  196



>ref|XP_004249516.1| PREDICTED: protein GPR107-like [Solanum lycopersicum]
Length=435

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 41/85 (48%), Positives = 58/85 (68%), Gaps = 2/85 (2%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P SS N +  ++  P+EY+L F NC PE  VSM V TE+YN++ N  KD+L AG TQLP 
Sbjct  115  PNSSFNRSYPVTS-PNEYSLFFANCAPESKVSMDVRTELYNLD-NQVKDYLSAGLTQLPT  172

Query  77   IffffFSVYLCFLAVWVSVCVKQSE  3
            ++F F  VY+ FL +W+SVC++  +
Sbjct  173  LYFLFSFVYIGFLGLWLSVCIRNKK  197



>ref|XP_002525014.1| lung seven transmembrane receptor, putative [Ricinus communis]
 gb|EEF37341.1| lung seven transmembrane receptor, putative [Ricinus communis]
Length=436

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P+SS + +  ++  P+EY+L F NC PE  VSM V TE+YN++G+G +DFL AG T LP 
Sbjct  115  PLSSFHQSYPVTA-PNEYSLFFANCAPETRVSMNVKTEVYNLDGDGSRDFLSAGLTHLPS  173

Query  77   IffffFSVYLCFLAVWVSVC  18
            ++F +   YL FL  W+  C
Sbjct  174  LYFIYSIAYLAFLGFWIYTC  193



>ref|XP_006345680.1| PREDICTED: protein GPR107-like [Solanum tuberosum]
Length=433

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 56/84 (67%), Gaps = 2/84 (2%)
 Frame = -1

Query  263  LSPVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQL  84
            L P SS +    ++  P+EY+L F NC PE  VSM V TE+YN++G   KD+L AG TQL
Sbjct  111  LPPNSSFDRAYPVTS-PNEYSLFFANCAPESKVSMDVRTELYNLDGR-VKDYLSAGLTQL  168

Query  83   PMIffffFSVYLCFLAVWVSVCVK  12
            P ++F F  VY  FLAVWV VC+K
Sbjct  169  PTLYFLFSLVYFGFLAVWVLVCLK  192



>gb|KFK38350.1| hypothetical protein AALP_AA3G102700 [Arabis alpina]
Length=437

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 39/66 (59%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            P+EY+L F NC PE  VSM+V TEMYN++ NG KD+LPAG T+LP ++ FFF  YL FL 
Sbjct  129  PNEYSLFFVNCVPETKVSMKVRTEMYNLDPNGSKDYLPAGSTRLPGLYLFFFLGYLAFLG  188

Query  35   VWVSVC  18
            VW   C
Sbjct  189  VWGYAC  194



>ref|XP_006339050.1| PREDICTED: protein GPR107-like [Solanum tuberosum]
Length=434

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 41/85 (48%), Positives = 58/85 (68%), Gaps = 2/85 (2%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P SS N +  ++  P+EY+L F NC PE  VSM V TE+YN++ N  KD+L AG TQLP 
Sbjct  114  PNSSFNRSYPVTS-PNEYSLFFANCAPESKVSMDVRTELYNLD-NQVKDYLSAGLTQLPT  171

Query  77   IffffFSVYLCFLAVWVSVCVKQSE  3
            ++F F  VY+ FL +W+SVC++  +
Sbjct  172  LYFLFSFVYIGFLGLWLSVCIRNKK  196



>ref|XP_010529751.1| PREDICTED: protein GPR107-like [Tarenaya hassleriana]
Length=442

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 40/80 (50%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P S  N +  ++  PDEY+L F NC PE  VSM V TEM+N + NG +D+LPAG TQLP 
Sbjct  121  PNSRFNQSYPVTS-PDEYSLFFANCAPETKVSMAVRTEMFNKDPNGSRDYLPAGLTQLPS  179

Query  77   IffffFSVYLCFLAVWVSVC  18
            ++F FF  Y+ FL  W  +C
Sbjct  180  LYFLFFLCYISFLGFWGYIC  199



>ref|XP_004246733.1| PREDICTED: protein GPR107 [Solanum lycopersicum]
Length=433

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 49/68 (72%), Gaps = 1/68 (1%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            P+EY+L F NC PE  VSM V TE+YN++G   KD+L AG TQLP ++F F  VY  FLA
Sbjct  126  PNEYSLFFANCAPESKVSMDVRTELYNLDGR-VKDYLSAGLTQLPTLYFLFSLVYFGFLA  184

Query  35   VWVSVCVK  12
            VWV VC+K
Sbjct  185  VWVLVCLK  192



>gb|KDP35561.1| hypothetical protein JCGZ_08999 [Jatropha curcas]
Length=439

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P+SS + +  ++  P+EY+L F NC PE  VSM V TE+YN+  +G +D+L AG TQLP 
Sbjct  118  PLSSFDRSFPVTA-PNEYSLFFANCAPETRVSMAVTTELYNLERDGSRDYLSAGLTQLPS  176

Query  77   IffffFSVYLCFLAVWVSVC  18
            ++FF+   YL FL  W+ +C
Sbjct  177  LYFFYSVAYLAFLGFWIYIC  196



>ref|XP_010066849.1| PREDICTED: protein GPR107-like [Eucalyptus grandis]
 gb|KCW64888.1| hypothetical protein EUGRSUZ_G02451 [Eucalyptus grandis]
Length=443

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            P+EY+L F NC PE  VSM V TE++N++ +G KDFL AGQTQLP +FF F  VYL F+ 
Sbjct  135  PNEYSLFFANCAPESRVSMEVRTELFNLDLDGSKDFLSAGQTQLPSLFFLFSLVYLAFVG  194

Query  35   VWVSVC  18
             W+  C
Sbjct  195  FWIYNC  200



>ref|XP_004494982.1| PREDICTED: protein GPR107-like [Cicer arietinum]
Length=440

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P +S N +  ++  P+E++L F NC PE  VSM V TE++N++ +  +D+L AGQTQLP 
Sbjct  119  PTASFNRSYPVTS-PNEFSLFFANCAPETSVSMAVRTELFNLDADSSRDYLSAGQTQLPT  177

Query  77   IffffFSVYLCFLAVWVSVC  18
            +FF F  VY  FL +W  VC
Sbjct  178  LFFLFSIVYFVFLVIWFHVC  197



>ref|XP_011094786.1| PREDICTED: protein GPR107-like [Sesamum indicum]
Length=434

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 41/82 (50%), Positives = 56/82 (68%), Gaps = 2/82 (2%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P SS N +  I+  P+EY+L F NC PE  V+M V TE+YN++G  EKDFL AG TQLP 
Sbjct  114  PHSSFNHSYPITS-PNEYSLFFANCAPESTVTMDVRTELYNLDGR-EKDFLSAGLTQLPS  171

Query  77   IffffFSVYLCFLAVWVSVCVK  12
            ++F F  +Y  FL+ W+ +C+K
Sbjct  172  LYFLFSVLYFGFLSYWIYICLK  193



>emb|CDX92603.1| BnaA10g16420D [Brassica napus]
Length=442

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P S  N +  ++  P+EY+L F NC PE  VSM V TEMYN + NG KD+LPAG TQLP 
Sbjct  121  PNSRFNHSYPVTS-PNEYSLFFANCVPETKVSMAVRTEMYNKDPNGSKDYLPAGATQLPS  179

Query  77   IffffFSVYLCFLAVWVSVC  18
            ++ FFF  Y+ FL  W   C
Sbjct  180  LYSFFFLCYVAFLGYWSYTC  199



>emb|CDY13896.1| BnaC09g39300D [Brassica napus]
Length=442

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P S  N +  ++  P+EY+L F NC PE  VSM V TEMYN + NG KD+LPAG TQLP 
Sbjct  121  PNSRFNHSYPVTS-PNEYSLFFANCVPETKVSMAVRTEMYNKDPNGSKDYLPAGATQLPS  179

Query  77   IffffFSVYLCFLAVWVSVC  18
            ++ FFF  Y+ FL  W   C
Sbjct  180  LYSFFFLCYVAFLGYWSYTC  199



>ref|XP_010456575.1| PREDICTED: protein GPR107-like, partial [Camelina sativa]
Length=385

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = -1

Query  218  EPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFL  39
             P+EY+L F NC PE  VSM V TEMYN + NG KD+LPAG TQLP ++ FFF  Y+ FL
Sbjct  131  SPNEYSLFFANCVPETKVSMAVRTEMYNKDPNGSKDYLPAGSTQLPTLYSFFFLCYVAFL  190

Query  38   AVWVSVC  18
              W   C
Sbjct  191  GFWSYTC  197



>ref|XP_009120965.1| PREDICTED: LOW QUALITY PROTEIN: protein GPR107 [Brassica rapa]
Length=442

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P S  N +  ++  P+EY+L F NC PE  VSM V TEMYN + NG KD+LPAG TQLP 
Sbjct  121  PNSRFNHSYPVTS-PNEYSLFFANCVPETKVSMAVRTEMYNKDPNGSKDYLPAGATQLPS  179

Query  77   IffffFSVYLCFLAVWVSVC  18
            ++ FFF  Y+ FL  W   C
Sbjct  180  LYSFFFLCYVAFLGYWSYTC  199



>ref|XP_008783613.1| PREDICTED: protein GPR107 [Phoenix dactylifera]
Length=449

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/67 (52%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            PDEY+L F NC PE  VSM V TEMYN   +G +D+L  GQ+++P ++FFF   Y+ FLA
Sbjct  140  PDEYSLFFANCNPESQVSMAVRTEMYNARPDGSRDYLSVGQSRVPTLYFFFALAYVAFLA  199

Query  35   VWVSVCV  15
            VW+  C+
Sbjct  200  VWIYFCL  206



>ref|XP_006644974.1| PREDICTED: protein GPR107-like [Oryza brachyantha]
Length=447

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 37/76 (49%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -1

Query  248  SHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIff  69
            ++N T  ++  PDEY+L F NC PE  V+M V T+MYN+N +G KD+L  GQ  +P I+ 
Sbjct  128  NYNKTFPVTH-PDEYSLFFANCAPETTVTMEVRTDMYNINPDGSKDYLSVGQAPVPAIYA  186

Query  68   ffFSVYLCFLAVWVSV  21
            FF   YL FLA+W+ V
Sbjct  187  FFTVCYLVFLAIWLYV  202



>gb|EMT16571.1| hypothetical protein F775_12543 [Aegilops tauschii]
Length=447

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 41/89 (46%), Positives = 54/89 (61%), Gaps = 4/89 (4%)
 Frame = -1

Query  263  LSPVSSHNATLVIS-EEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG---NGEKDFLPAG  96
            LS V    AT ++S ++PDEY ++F NCQ    V+M V TEMYNV G   +G +D LP G
Sbjct  119  LSDVPPGGATSILSIDDPDEYAVVFNNCQEGAEVTMDVRTEMYNVRGGVPDGLRDSLPVG  178

Query  95   QTQLPMIffffFSVYLCFLAVWVSVCVKQ  9
               LP I+     VY  FLAVWV  C+++
Sbjct  179  LQPLPNIYTVVSVVYFVFLAVWVWTCLRK  207



>ref|NP_197353.1| candidate G-protein Coupled Receptor 7 [Arabidopsis thaliana]
 gb|AED92574.1| candidate G-protein Coupled Receptor 7 [Arabidopsis thaliana]
Length=440

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            P+EY+L F NC PE  VSM V TEMYN + NG KD+LPAG TQLP ++ FFF  Y+ FL 
Sbjct  132  PNEYSLFFANCVPETKVSMAVRTEMYNKDPNGSKDYLPAGSTQLPTLYSFFFLCYVAFLG  191

Query  35   VWVSVC  18
             W   C
Sbjct  192  FWSYTC  197



>ref|XP_006287752.1| hypothetical protein CARUB_v10000963mg [Capsella rubella]
 gb|EOA20650.1| hypothetical protein CARUB_v10000963mg [Capsella rubella]
Length=443

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            P+EY+L F NC PE  VSM V TEMYN + NG KD+LPAG TQLP ++ FFF  Y+ FL 
Sbjct  135  PNEYSLFFANCVPETKVSMAVRTEMYNKDPNGSKDYLPAGSTQLPTLYSFFFLCYVAFLG  194

Query  35   VWVSVC  18
             W   C
Sbjct  195  FWSYTC  200



>ref|XP_002882624.1| hypothetical protein ARALYDRAFT_478277 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58883.1| hypothetical protein ARALYDRAFT_478277 [Arabidopsis lyrata subsp. 
lyrata]
Length=439

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = -1

Query  260  SPVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLP  81
            SP  S    L     P+EY+L F NC PE  +SM+V TEMYN++ NG KD+LPAG T+LP
Sbjct  116  SPPGSKYEHLYPVISPNEYSLFFVNCVPETKISMKVRTEMYNLDPNGSKDYLPAGSTRLP  175

Query  80   MIffffFSVYLCFLAVWVSVC  18
             ++FFF   YL FL +W   C
Sbjct  176  GLYFFFSLGYLAFLGLWGYAC  196



>dbj|BAD94365.1| putative protein [Arabidopsis thaliana]
Length=440

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            P+EY+L F NC PE  VSM V TEMYN + NG KD+LPAG TQLP ++ FFF  Y+ FL 
Sbjct  132  PNEYSLFFANCVPETKVSMAVRTEMYNKDPNGSKDYLPAGSTQLPTLYSFFFLCYVAFLG  191

Query  35   VWVSVC  18
             W   C
Sbjct  192  FWSYTC  197



>ref|XP_010454100.1| PREDICTED: protein GPR107-like [Camelina sativa]
Length=418

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            P+EY+L F NC PE  VSM V TEMYN + NG KD+LPAG TQLP ++ FFF  Y+ FL 
Sbjct  110  PNEYSLFFANCVPETKVSMAVRTEMYNKDPNGSKDYLPAGSTQLPTLYSFFFLCYVAFLG  169

Query  35   VWVSVC  18
             W   C
Sbjct  170  FWSYTC  175



>ref|XP_010420618.1| PREDICTED: protein GPR107-like isoform X1 [Camelina sativa]
 ref|XP_010420619.1| PREDICTED: protein GPR107-like isoform X2 [Camelina sativa]
Length=440

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            P+EY+L F NC PE  VSM V TEMYN + NG KD+LPAG TQLP ++ FFF  Y+ FL 
Sbjct  132  PNEYSLFFANCVPETKVSMAVRTEMYNKDPNGSKDYLPAGSTQLPTLYSFFFLCYVAFLG  191

Query  35   VWVSVC  18
             W   C
Sbjct  192  FWSYTC  197



>ref|XP_002871820.1| hypothetical protein ARALYDRAFT_488733 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48079.1| hypothetical protein ARALYDRAFT_488733 [Arabidopsis lyrata subsp. 
lyrata]
Length=440

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            P+EY+L F NC PE  VSM V TEMYN + NG KD+LPAG TQLP ++ FFF  Y+ FL 
Sbjct  132  PNEYSLFFANCVPETKVSMAVRTEMYNKDPNGSKDYLPAGSTQLPTLYSFFFLCYVAFLG  191

Query  35   VWVSVC  18
             W   C
Sbjct  192  FWSYTC  197



>ref|XP_010492861.1| PREDICTED: protein GPR107-like [Camelina sativa]
Length=441

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            P+EY+L F NC PE  VSM V TEMYN + NG KD+LPAG TQLP ++ FFF  Y+ FL 
Sbjct  133  PNEYSLFFANCVPETKVSMAVRTEMYNKDPNGSKDYLPAGSTQLPTLYSFFFLCYVAFLG  192

Query  35   VWVSVC  18
             W   C
Sbjct  193  FWSYTC  198



>ref|XP_003537224.1| PREDICTED: protein GPR107-like isoformX1 [Glycine max]
 ref|XP_006588734.1| PREDICTED: protein GPR107-like isoform X2 [Glycine max]
Length=442

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 2/68 (3%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGE--KDFLPAGQTQLPMIffffFSVYLCF  42
            P+EY+L F NC PE  VSM V TE+YN++ + E  +D+L AGQTQLP ++  F   Y  F
Sbjct  132  PNEYSLFFANCAPETSVSMLVHTELYNLDADSEHSRDYLSAGQTQLPTLYSLFSFAYFAF  191

Query  41   LAVWVSVC  18
            LA+W+ +C
Sbjct  192  LALWIYIC  199



>ref|XP_003521355.1| PREDICTED: protein GPR107-like [Glycine max]
Length=444

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            PV+S N +  ++  P+EY+L F NC PE  V+M V TE YN++ +G +D+L AGQT LP 
Sbjct  123  PVASFNRSYPVTS-PNEYSLFFANCAPETSVTMSVHTEAYNLDADGSRDYLSAGQTLLPS  181

Query  77   IffffFSVYLCFLAVWVSVC  18
            ++F FF  YL F + W+ +C
Sbjct  182  LYFLFFLTYLSFFSFWLYIC  201



>ref|XP_010910013.1| PREDICTED: protein GPR107-like [Elaeis guineensis]
Length=444

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = -1

Query  245  HNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIfff  66
            HN +  I+  PDEY+L F NC PE  VSM V TEMYN+  +G +D+L  GQ  +P ++F 
Sbjct  127  HNGSFPITH-PDEYSLFFANCNPESQVSMAVRTEMYNLRPDGTRDYLSVGQYPVPSLYFV  185

Query  65   fFSVYLCFLAVWVSVCVK  12
            F   Y+ F AVW+S  +K
Sbjct  186  FALAYVAFFAVWISYLIK  203



>gb|EEC73611.1| hypothetical protein OsI_08097 [Oryza sativa Indica Group]
Length=464

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 48/79 (61%), Gaps = 3/79 (4%)
 Frame = -1

Query  236  TLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVN---GNGEKDFLPAGQTQLPMIfff  66
            T V  ++PD+Y ++F NCQ    V++ V+TEMYNV     +G +D+LP G   LP I+  
Sbjct  146  TTVSIDDPDQYAVVFSNCQDGVEVTVDVYTEMYNVRDGISDGPRDYLPVGLRPLPTIYTV  205

Query  65   fFSVYLCFLAVWVSVCVKQ  9
               VY  FLA+W  VCV+ 
Sbjct  206  VSEVYFAFLALWACVCVRH  224



>ref|XP_006297691.1| hypothetical protein CARUB_v10013721mg [Capsella rubella]
 gb|EOA30589.1| hypothetical protein CARUB_v10013721mg [Capsella rubella]
Length=440

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            P+EY+L F NC PE  +SM+V TEMYN++ NG KD+LPAG T+LP ++FFF   YL FL 
Sbjct  132  PNEYSLFFVNCVPETKISMKVRTEMYNLDPNGSKDYLPAGSTRLPGLYFFFSLGYLAFLG  191

Query  35   VWVSVC  18
            +W   C
Sbjct  192  LWGYAC  197



>ref|XP_010464605.1| PREDICTED: protein GPR107-like [Camelina sativa]
Length=441

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            P+EY+L F NC PE  +SM+V TEMYN++ NG KD+LPAG T+LP ++FFF   YL FL 
Sbjct  133  PNEYSLFFVNCVPETKISMKVRTEMYNLDPNGSKDYLPAGSTRLPGLYFFFSLGYLAFLG  192

Query  35   VWVSVC  18
            +W   C
Sbjct  193  LWGYAC  198



>ref|NP_187568.1| lung seven transmembrane receptor family protein [Arabidopsis 
thaliana]
 gb|AAF62563.1| unknown protein [Arabidopsis thaliana]
 gb|AAO00892.1| unknown protein [Arabidopsis thaliana]
 gb|AAP31930.1| At3g09570 [Arabidopsis thaliana]
 gb|AEE74783.1| lung seven transmembrane receptor family protein [Arabidopsis 
thaliana]
Length=439

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            P+EY+L F NC PE  +SM+V TEMYN++ NG KD+LPAG T+LP ++FFF   YL FL 
Sbjct  131  PNEYSLFFVNCVPETKISMKVRTEMYNLDPNGSKDYLPAGSTRLPGLYFFFSLGYLAFLG  190

Query  35   VWVSVC  18
            +W   C
Sbjct  191  LWGYAC  196



>dbj|BAD21602.1| putative lung seven transmembrane receptor 1 [Oryza sativa Japonica 
Group]
 dbj|BAD21460.1| putative lung seven transmembrane receptor 1 [Oryza sativa Japonica 
Group]
Length=455

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 48/79 (61%), Gaps = 3/79 (4%)
 Frame = -1

Query  236  TLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVN---GNGEKDFLPAGQTQLPMIfff  66
            T V  ++PD+Y ++F NCQ    V++ V+TEMYNV     +G +D+LP G   LP I+  
Sbjct  137  TTVSIDDPDQYAVVFSNCQDGVEVTVDVYTEMYNVRDGISDGPRDYLPVGLRPLPTIYTV  196

Query  65   fFSVYLCFLAVWVSVCVKQ  9
               VY  FLA+W  VCV+ 
Sbjct  197  VSEVYFAFLALWACVCVRH  215



>gb|KFK26091.1| hypothetical protein AALP_AA8G201700 [Arabis alpina]
Length=442

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            P+EY+L F NC PE  VSM V TEMYN + NG KD+LPAG TQLP ++ FFF  Y+ FL 
Sbjct  134  PNEYSLFFANCVPETKVSMAVRTEMYNKDPNGSKDYLPAGSTQLPTLYSFFFLCYVTFLG  193

Query  35   VWVSVC  18
             W   C
Sbjct  194  YWSYTC  199



>ref|NP_001047450.1| Os02g0618700 [Oryza sativa Japonica Group]
 dbj|BAF09364.1| Os02g0618700 [Oryza sativa Japonica Group]
 dbj|BAG92080.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57387.1| hypothetical protein OsJ_07550 [Oryza sativa Japonica Group]
Length=464

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 48/79 (61%), Gaps = 3/79 (4%)
 Frame = -1

Query  236  TLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVN---GNGEKDFLPAGQTQLPMIfff  66
            T V  ++PD+Y ++F NCQ    V++ V+TEMYNV     +G +D+LP G   LP I+  
Sbjct  146  TTVSIDDPDQYAVVFSNCQDGVEVTVDVYTEMYNVRDGISDGPRDYLPVGLRPLPTIYTV  205

Query  65   fFSVYLCFLAVWVSVCVKQ  9
               VY  FLA+W  VCV+ 
Sbjct  206  VSEVYFAFLALWACVCVRH  224



>ref|NP_001151745.1| protein GPR107 [Zea mays]
 gb|ACG44199.1| protein GPR107 precursor [Zea mays]
Length=472

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 46/79 (58%), Gaps = 3/79 (4%)
 Frame = -1

Query  236  TLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVN---GNGEKDFLPAGQTQLPMIfff  66
            T V  + PDEY ++F NCQ    V+M V TEMYNV      G +D+LP G   LP I+  
Sbjct  139  TTVTIDYPDEYAVVFSNCQDGVEVTMDVRTEMYNVRRDASGGTRDYLPVGLQPLPAIYAG  198

Query  65   fFSVYLCFLAVWVSVCVKQ  9
               VYL FLA WV  CV+Q
Sbjct  199  VAVVYLAFLAGWVWACVRQ  217



>gb|ACF87329.1| unknown [Zea mays]
 gb|AFW72372.1| putative lung seven transmembrane receptor family protein [Zea 
mays]
Length=472

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 46/79 (58%), Gaps = 3/79 (4%)
 Frame = -1

Query  236  TLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVN---GNGEKDFLPAGQTQLPMIfff  66
            T V  + PDEY ++F NCQ    V+M V TEMYNV      G +D+LP G   LP I+  
Sbjct  139  TTVTIDYPDEYAVVFSNCQDGVEVTMDVRTEMYNVRRDASGGTRDYLPVGLQPLPAIYAG  198

Query  65   fFSVYLCFLAVWVSVCVKQ  9
               VYL FLA WV  CV+Q
Sbjct  199  VAVVYLAFLAGWVWACVRQ  217



>ref|XP_009126263.1| PREDICTED: protein GPR107-like [Brassica rapa]
Length=440

 Score = 75.5 bits (184),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 38/66 (58%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            P+EY+L F NC PE  VSM V TEMYN + NG KD+LPAG TQLP ++ FFF  Y  FL 
Sbjct  132  PNEYSLFFANCAPETKVSMAVRTEMYNKDPNGSKDYLPAGSTQLPSLYSFFFLCYATFLG  191

Query  35   VWVSVC  18
             W   C
Sbjct  192  YWGYTC  197



>ref|NP_001044733.1| Os01g0836800 [Oryza sativa Japonica Group]
 dbj|BAB89751.1| putative lung seven transmembrane receptor 1 [Oryza sativa Japonica 
Group]
 dbj|BAF06647.1| Os01g0836800 [Oryza sativa Japonica Group]
 dbj|BAG88066.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG90056.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93832.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97597.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99788.1| unnamed protein product [Oryza sativa Japonica Group]
Length=449

 Score = 75.5 bits (184),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = -1

Query  218  EPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFL  39
            +PDEY+L F NC PE  V+M V T+MYN N +G KD+L  GQ  +P I+ FF   YL FL
Sbjct  139  QPDEYSLFFANCAPETAVTMEVRTDMYNTNLDGSKDYLSVGQAPVPAIYAFFTVCYLVFL  198

Query  38   AVWVSV  21
            AVW+ V
Sbjct  199  AVWLYV  204



>gb|EAY76414.1| hypothetical protein OsI_04345 [Oryza sativa Indica Group]
Length=449

 Score = 75.5 bits (184),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = -1

Query  218  EPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFL  39
            +PDEY+L F NC PE  V+M V T+MYN N +G KD+L  GQ  +P I+ FF   YL FL
Sbjct  139  QPDEYSLFFANCAPETAVTMEVRTDMYNTNLDGSKDYLSVGQAPVPAIYAFFTVCYLVFL  198

Query  38   AVWVSV  21
            AVW+ V
Sbjct  199  AVWLYV  204



>emb|CDY11221.1| BnaA03g00570D [Brassica napus]
Length=413

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = -1

Query  218  EPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFL  39
             P  Y+L F NC P   VSM+  TEMYN++ NG KD+LPAG TQLP + F F   YL F 
Sbjct  106  SPGYYSLFFANCAPGTKVSMKFKTEMYNLDPNGSKDYLPAGSTQLPGLLFVFSLCYLTFF  165

Query  38   AVWVSVCVKQSE  3
             +WV +C  + +
Sbjct  166  GLWVYLCYNKKQ  177



>ref|XP_002322836.2| hypothetical protein POPTR_0016s08220g [Populus trichocarpa]
 gb|EEF04597.2| hypothetical protein POPTR_0016s08220g [Populus trichocarpa]
Length=441

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P+SS N +  ++  P+EY L F NC PE  VSM V T++YN++ +G KD+L AG TQLP 
Sbjct  120  PLSSFNQSYPVTA-PNEYLLFFANCAPETRVSMSVKTQVYNLDRDGSKDYLSAGLTQLPS  178

Query  77   IffffFSVYLCFLAVWVSVC  18
            +FF +F  Y  FL +W+ VC
Sbjct  179  LFFLYFLAYAAFLGLWIYVC  198



>ref|XP_009385234.1| PREDICTED: protein GPR107-like [Musa acuminata subsp. malaccensis]
Length=442

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 57/99 (58%), Gaps = 17/99 (17%)
 Frame = -1

Query  257  PVSSHNATLVIS----------------EEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG  126
            P+SSH  T V+                 E PDEY+L+FG+C      +M V TEMYN++G
Sbjct  103  PISSHFVTSVLRFKDLGTNASLSQSVDIENPDEYSLLFGSCNAGVETTMDVRTEMYNMDG  162

Query  125  NGEKDFLPAGQTQLPMIffffFSVYLCFLAVWVSVCVKQ  9
            +  KD+LPAG+  LP ++F F  VYL FL  W  VC+K+
Sbjct  163  S-TKDYLPAGRKPLPKMYFTFSVVYLVFLLAWAVVCIKE  200



>ref|XP_009780573.1| PREDICTED: protein GPR107-like [Nicotiana sylvestris]
Length=433

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            P+EY+L F NC PE  VSM V TE+YN++G   KD+L AG TQLP ++F FF  Y  FL 
Sbjct  126  PNEYSLFFANCAPESKVSMDVRTELYNLDGR-VKDYLSAGLTQLPTLYFLFFLAYFVFLG  184

Query  35   VWVSVCVKQSE  3
            VWV VC+K  +
Sbjct  185  VWVFVCLKNKK  195



>ref|XP_010489726.1| PREDICTED: uncharacterized protein LOC104767390 [Camelina sativa]
Length=365

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            P+EY+L F NC PE  VSM+V TEMYN++ +G KD+LPAG T+LP ++FFF   YL FL 
Sbjct  130  PNEYSLFFVNCVPETKVSMKVRTEMYNLDPSGSKDYLPAGSTRLPGLYFFFSLGYLAFLG  189

Query  35   VWVSVC  18
            +W   C
Sbjct  190  LWGYAC  195



>ref|XP_006400401.1| hypothetical protein EUTSA_v10013548mg [Eutrema salsugineum]
 gb|ESQ41854.1| hypothetical protein EUTSA_v10013548mg [Eutrema salsugineum]
Length=445

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            P+EY+L F NC PE  VSM V TEMYN + NG KD+LPAG TQLP ++ FFF  Y  FL 
Sbjct  137  PNEYSLFFANCVPETKVSMAVRTEMYNKDPNGSKDYLPAGSTQLPSLYSFFFLCYAAFLG  196

Query  35   VWVSVC  18
             W   C
Sbjct  197  FWSYTC  202



>ref|XP_003575372.2| PREDICTED: protein GPR107-like [Brachypodium distachyon]
Length=477

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 40/94 (43%), Positives = 55/94 (59%), Gaps = 9/94 (10%)
 Frame = -1

Query  263  LSPVSSHNATLVIS-EEPDEYNLIFGNCQPEFHVSMRVFTEMYNVN-GNGEK-------D  111
            LS V    AT +++ ++PDEY ++F NCQ    V+M V TEMYNV  G G+K       D
Sbjct  143  LSDVPPGGATSILTIDDPDEYAVVFNNCQDGVEVTMDVRTEMYNVRPGGGDKAAGLLIRD  202

Query  110  FLPAGQTQLPMIffffFSVYLCFLAVWVSVCVKQ  9
            +LP G   LP I+    +VYL FLA W   C+++
Sbjct  203  YLPVGLQPLPTIYTVVSAVYLAFLAAWAWTCLRR  236



>ref|XP_006647525.1| PREDICTED: protein GPR107-like [Oryza brachyantha]
Length=458

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/79 (42%), Positives = 47/79 (59%), Gaps = 3/79 (4%)
 Frame = -1

Query  236  TLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG---NGEKDFLPAGQTQLPMIfff  66
            T V  ++PD+Y ++F NCQ    V+M V TE+YNV G   +G +++LP G   LP I+  
Sbjct  141  TTVTIDDPDQYAVLFSNCQDGVEVTMDVLTELYNVRGGASDGPRNYLPVGLQPLPTIYTA  200

Query  65   fFSVYLCFLAVWVSVCVKQ  9
              +VY  FLA W   CV+ 
Sbjct  201  VSAVYFAFLAAWACACVRH  219



>gb|KHN39394.1| Protein GPR107-like protein [Glycine soja]
Length=334

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P +S N T  ++  P+EY+L F NC PE  V+M V TE YN++ +G +D+L AGQT LP 
Sbjct  13   PSASANHTYPVTI-PNEYSLFFANCAPETSVTMSVHTEAYNLDADGSRDYLSAGQTLLPS  71

Query  77   IffffFSVYLCFLAVWVSVC  18
            ++F FF  YL F + W+ +C
Sbjct  72   LYFLFFLTYLSFFSFWLYIC  91



>ref|XP_010474113.1| PREDICTED: protein GPR107-like [Camelina sativa]
Length=439

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            P+EY+L F NC PE  VSM+V TEMYN++ +G KD+LPAG T+LP ++FFF   YL FL 
Sbjct  131  PNEYSLFFVNCVPETKVSMKVRTEMYNLDPSGSKDYLPAGSTRLPGLYFFFSLGYLAFLG  190

Query  35   VWVSVC  18
            +W   C
Sbjct  191  LWGYAC  196



>gb|KDO49836.1| hypothetical protein CISIN_1g013595mg [Citrus sinensis]
Length=439

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            P+EY+L F NC PE  VSM V TE+YN++ +G +D+L AG TQLP +FFFF  +Y+ F  
Sbjct  131  PNEYSLFFANCAPETQVSMNVKTEVYNLDRDGSRDYLSAGLTQLPSLFFFFSVLYIGFFG  190

Query  35   VWVSVCVKQSE  3
            +W+ +C+    
Sbjct  191  IWIYICLTNKR  201



>emb|CDY02622.1| BnaC02g08130D [Brassica napus]
Length=440

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 40/80 (50%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P S  N +  ++  P+EY+L F NC PE  VSM V TEM+N + NG KD+LPAG TQLP 
Sbjct  119  PNSRFNHSYPVTS-PNEYSLFFANCAPETKVSMAVRTEMFNKDPNGSKDYLPAGSTQLPS  177

Query  77   IffffFSVYLCFLAVWVSVC  18
            ++ FFF  Y  FL  W   C
Sbjct  178  LYSFFFLCYATFLGYWGYTC  197



>ref|XP_004493910.1| PREDICTED: protein GPR107-like [Cicer arietinum]
Length=440

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P +S N +  ++  P+EY+L F NC PE  VSM V TE++N++ +G KD+L AGQTQLP 
Sbjct  118  PSASFNHSYPVTS-PNEYSLFFANCAPETSVSMSVRTEIFNLDSDGSKDYLSAGQTQLPS  176

Query  77   IffffFSVYLCFLAVWVSVC  18
            +FF FF  YL F   W+  C
Sbjct  177  LFFIFFLSYLIFFVFWLYTC  196



>ref|XP_009146920.1| PREDICTED: protein GPR107 [Brassica rapa]
Length=440

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P SS    L     P+EY+L F NC  +  +SM+V TEMYN++ NG KD+LPAG T+LP 
Sbjct  118  PPSSSYEHLYPVTSPNEYSLFFVNCVRDTKISMKVRTEMYNLDPNGSKDYLPAGSTRLPE  177

Query  77   IffffFSVYLCFLAVWVSVC  18
            ++F FF  YL FL +W  VC
Sbjct  178  LYFLFFIGYLAFLGLWGYVC  197



>emb|CDY44715.1| BnaA05g28910D [Brassica napus]
Length=441

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P SS    L     P+EY+L F NC  +  +SM+V TEMYN++ NG KD+LPAG T+LP 
Sbjct  119  PPSSSYEHLYPVTSPNEYSLFFVNCVRDTKISMKVRTEMYNLDPNGSKDYLPAGSTRLPE  178

Query  77   IffffFSVYLCFLAVWVSVC  18
            ++F FF  YL FL +W  VC
Sbjct  179  LYFLFFIGYLAFLGLWGYVC  198



>ref|XP_007162690.1| hypothetical protein PHAVU_001G172000g [Phaseolus vulgaris]
 gb|ESW34684.1| hypothetical protein PHAVU_001G172000g [Phaseolus vulgaris]
Length=440

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P +S N +  ++  P+EY+L F NC PE  V+M V TE YN++ +  +D+L AGQTQLP 
Sbjct  119  PAASFNRSYPVTS-PNEYSLFFANCAPETSVTMVVHTEAYNLDSDASRDYLSAGQTQLPS  177

Query  77   IffffFSVYLCFLAVWVSVC  18
            +FF F   Y  F A W+ +C
Sbjct  178  LFFLFSVTYFAFFAFWLYLC  197



>ref|XP_007205216.1| hypothetical protein PRUPE_ppa005913mg [Prunus persica]
 gb|EMJ06415.1| hypothetical protein PRUPE_ppa005913mg [Prunus persica]
Length=438

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P+SS N +  +S  P+EY+L F NC PE  VSM V TE+YN++ +G +D+L AG T LP 
Sbjct  117  PLSSFNHSYPVSA-PNEYSLFFANCAPETTVSMLVRTEVYNLDPDGARDYLSAGLTHLPS  175

Query  77   IffffFSVYLCFLAVWVSVC  18
            +FF FF  YL F+  WV +C
Sbjct  176  LFFVFFLAYLVFVGFWVYLC  195



>ref|XP_009599070.1| PREDICTED: protein GPR107-like [Nicotiana tomentosiformis]
Length=514

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            P+EY+L F NC PE  VSM V TE+YN++G   KD+L AG TQLP ++F F   Y  FL 
Sbjct  207  PNEYSLFFANCAPESKVSMDVRTELYNLDGR-VKDYLSAGLTQLPTLYFLFSLAYFGFLG  265

Query  35   VWVSVCVKQSE  3
            VWV VC+K  +
Sbjct  266  VWVLVCLKNKK  276



>ref|XP_011019265.1| PREDICTED: protein GPR107 [Populus euphratica]
Length=439

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P+SS N +  ++  P+EY+L F NC PE  VSM V TE+YN++ +G +D+L AG TQLP 
Sbjct  118  PLSSFNQSYPVTA-PNEYSLFFANCAPETRVSMSVKTEIYNLDRDGSRDYLSAGLTQLPW  176

Query  77   IffffFSVYLCFLAVWVSV  21
            ++  +F  Y  FL +W+ V
Sbjct  177  LYSLYFLAYAGFLGLWIYV  195



>ref|XP_003542477.1| PREDICTED: protein GPR107-like isoformX1 [Glycine max]
 ref|XP_006594086.1| PREDICTED: protein GPR107-like isoform X2 [Glycine max]
 ref|XP_006594087.1| PREDICTED: protein GPR107-like isoform X3 [Glycine max]
Length=442

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 53/82 (65%), Gaps = 3/82 (4%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGE--KDFLPAGQTQL  84
            P ++ N T  ++  P+EY++ F NC PE  VSM V TE+YN++ + E  +D+L AGQT L
Sbjct  119  PAATANYTYPVTI-PNEYSIFFANCAPETSVSMLVHTELYNLDADSEHSRDYLSAGQTHL  177

Query  83   PMIffffFSVYLCFLAVWVSVC  18
            P +F  F   Y  FLA+W+ +C
Sbjct  178  PTLFSLFSVAYFAFLALWIYIC  199



>ref|NP_001150692.1| transmembrane receptor [Zea mays]
 gb|ACG40018.1| transmembrane receptor [Zea mays]
Length=409

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            PDEY L F NC P   VSM V TEMYNV  +G KD+LP GQ  LP I   F   Y  FLA
Sbjct  106  PDEYALFFANCAPGSLVSMTVRTEMYNVGADGSKDYLPVGQAPLPAIHGVFALCYAAFLA  165

Query  35   VW  30
             W
Sbjct  166  AW  167



>ref|XP_006480714.1| PREDICTED: protein GPR107-like [Citrus sinensis]
Length=439

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            P+EY+L F NC PE  VSM V TE+YN++ +G +D+L AG TQLP +FFFF  +Y+ F  
Sbjct  131  PNEYSLFFANCVPETQVSMNVKTEVYNLDRDGSRDYLSAGLTQLPSLFFFFSVLYIGFFG  190

Query  35   VWVSVCVKQSE  3
            +W+ +C+    
Sbjct  191  IWIYICLTNKR  201



>ref|XP_004302804.1| PREDICTED: protein GPR107-like [Fragaria vesca subsp. vesca]
Length=442

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 35/80 (44%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P S+ N +  ++  P+EY+L F NC PE  V+M V TE+YN++ +G +D+L AG T LP 
Sbjct  121  PASTFNHSYPVTA-PNEYSLFFANCAPETTVTMDVRTEVYNLDPDGSRDYLSAGLTHLPS  179

Query  77   IffffFSVYLCFLAVWVSVC  18
            +F  F   YL FL  W+ +C
Sbjct  180  LFSVFSVAYLAFLGFWIYLC  199



>ref|XP_002274179.1| PREDICTED: protein GPR107-like [Vitis vinifera]
Length=443

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 50/85 (59%), Gaps = 1/85 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P +S N +  +S  P+EY+L F NC PE  V+M V T +YN++    KD+L AGQTQLP 
Sbjct  122  PHASFNQSYPVSS-PNEYSLFFANCAPESQVTMSVRTTVYNIDNGKTKDYLSAGQTQLPA  180

Query  77   IffffFSVYLCFLAVWVSVCVKQSE  3
            ++F F   Y  FL  W+  C +   
Sbjct  181  LYFLFSLAYFAFLVFWIHTCYRNKR  205



>ref|XP_007144492.1| hypothetical protein PHAVU_007G160700g [Phaseolus vulgaris]
 ref|XP_007144493.1| hypothetical protein PHAVU_007G160700g [Phaseolus vulgaris]
 gb|ESW16486.1| hypothetical protein PHAVU_007G160700g [Phaseolus vulgaris]
 gb|ESW16487.1| hypothetical protein PHAVU_007G160700g [Phaseolus vulgaris]
Length=439

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 38/80 (48%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P +S N T  ++   +EY+L F NC PE  VSM V TE+YN++ +  +D+L AGQTQLP 
Sbjct  118  PAASINRTFPVTI-ANEYSLFFANCAPETSVSMAVHTELYNLDPDTSRDYLSAGQTQLPS  176

Query  77   IffffFSVYLCFLAVWVSVC  18
            +FF F   Y  FLA+W  +C
Sbjct  177  LFFVFSVAYFAFLALWFYLC  196



>ref|NP_001132310.1| uncharacterized LOC100193752 precursor [Zea mays]
 gb|ACF81107.1| unknown [Zea mays]
 gb|AFW82247.1| putative lung seven transmembrane receptor family protein [Zea 
mays]
Length=456

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            PDEY L F NC P   VSM V TEMYNV  +G KD+LP GQ  LP I   F   Y  FLA
Sbjct  149  PDEYALFFANCAPGSLVSMTVRTEMYNVGADGSKDYLPVGQAPLPAIHGVFALCYAAFLA  208

Query  35   VW  30
             W
Sbjct  209  AW  210



>ref|NP_001140755.1| uncharacterized LOC100272830 precursor [Zea mays]
 gb|ACF78998.1| unknown [Zea mays]
 gb|ACF84555.1| unknown [Zea mays]
 gb|ACN28598.1| unknown [Zea mays]
 gb|ACN28731.1| unknown [Zea mays]
 gb|ACN34656.1| unknown [Zea mays]
 tpg|DAA56941.1| TPA: putative lung seven transmembrane receptor family protein 
[Zea mays]
Length=450

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 50/81 (62%), Gaps = 1/81 (1%)
 Frame = -1

Query  245  HNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIfff  66
            HN T  I+  PDEY+L F NC PE  VSM V T+MYN N +G +D+L  G   +P I+ F
Sbjct  132  HNQTFPITH-PDEYSLFFANCAPETSVSMEVRTDMYNTNPDGTRDYLSVGMASVPTIYAF  190

Query  65   fFSVYLCFLAVWVSVCVKQSE  3
            F   Y+ FLA W+ V + ++ 
Sbjct  191  FAVCYVVFLAGWLYVTLHRNR  211



>ref|XP_006428980.1| hypothetical protein CICLE_v10011742mg [Citrus clementina]
 gb|ESR42220.1| hypothetical protein CICLE_v10011742mg [Citrus clementina]
Length=439

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            P+EY+L F NC PE  VSM V TE+YN++ +G +D+L AG TQLP +FFFF  +Y+ F  
Sbjct  131  PNEYSLFFTNCVPETQVSMNVKTEVYNLDRDGSRDYLSAGLTQLPSLFFFFSVLYIGFFG  190

Query  35   VWVSVCVKQSE  3
            +W+ +C+    
Sbjct  191  IWIYICLTNKR  201



>dbj|BAJ88404.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            PDEY+L F NC PE  VSM V TEMYN N +G KD+LP GQ  +P I+ FF   Y  FLA
Sbjct  148  PDEYSLYFANCAPESLVSMNVRTEMYNANPDGSKDYLPVGQAPVPAIYGFFAFGYAAFLA  207

Query  35   VW  30
             W
Sbjct  208  GW  209



>dbj|BAJ85380.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            PDEY+L F NC PE  VSM V TEMYN N +G KD+LP GQ  +P I+ FF   Y  FLA
Sbjct  148  PDEYSLYFANCAPESLVSMNVRTEMYNANPDGSKDYLPVGQAPVPAIYGFFAFGYAAFLA  207

Query  35   VW  30
             W
Sbjct  208  GW  209



>ref|XP_010528248.1| PREDICTED: protein GPR107-like [Tarenaya hassleriana]
Length=444

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P S  N +  ++  P+EY+L F NC PE  VSM V TEMYN + NG KD+LPAG TQLP 
Sbjct  123  PNSGFNQSYPVTS-PNEYSLFFANCAPETKVSMAVRTEMYNKDPNGSKDYLPAGLTQLPS  181

Query  77   IffffFSVYLCFLAVWVSVC  18
            ++F FF  Y  F+  W   C
Sbjct  182  LYFLFFLCYTAFVGFWSYSC  201



>emb|CDY41601.1| BnaC05g43380D [Brassica napus]
Length=441

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P SS    L     P+EY+L F NC  +  +SM+V TEMYN++ NG KD+LPAG T+LP 
Sbjct  119  PPSSSYEHLYPVTSPNEYSLFFVNCVRDTKISMKVRTEMYNLDPNGSKDYLPAGSTRLPE  178

Query  77   IffffFSVYLCFLAVWVSVC  18
            ++F FF  YL FL +W   C
Sbjct  179  LYFLFFIGYLAFLGLWGYAC  198



>ref|XP_008657086.1| PREDICTED: protein GPR107-like [Zea mays]
 gb|AFW84653.1| putative lung seven transmembrane receptor family protein [Zea 
mays]
Length=448

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 37/75 (49%), Positives = 47/75 (63%), Gaps = 1/75 (1%)
 Frame = -1

Query  245  HNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIfff  66
            HN T  I+  PDEY+L F NC PE  V+M V T+MYN N +G KD+L  G   +P I+ F
Sbjct  130  HNQTFPITH-PDEYSLFFANCAPETSVTMEVRTDMYNTNLDGTKDYLSVGMASVPAIYAF  188

Query  65   fFSVYLCFLAVWVSV  21
            F   Y+ FLA W+ V
Sbjct  189  FAVCYVVFLAGWLYV  203



>ref|XP_004142094.1| PREDICTED: protein GPR107-like [Cucumis sativus]
 ref|XP_004172326.1| PREDICTED: protein GPR107-like [Cucumis sativus]
 gb|KGN54206.1| hypothetical protein Csa_4G293160 [Cucumis sativus]
Length=438

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            P+EY+L F NC PE  VSM+V TE++N++ +G KD+L AG TQLP ++F F   YL FL 
Sbjct  130  PNEYSLFFANCAPETSVSMQVRTEVFNLDRDGSKDYLSAGLTQLPSLYFVFSLAYLAFLG  189

Query  35   VWV  27
            +W+
Sbjct  190  LWI  192



>ref|XP_008241753.1| PREDICTED: protein GPR107-like [Prunus mume]
Length=438

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P+ S N +  +S  P+EY+L F NC PE  VSM V TE+YN++ +G +D+L AG T LP 
Sbjct  117  PLHSFNHSYPVSA-PNEYSLFFANCAPETTVSMLVRTEVYNLDPDGARDYLSAGLTHLPS  175

Query  77   IffffFSVYLCFLAVWVSVC  18
            +FF FF  YL F+  WV +C
Sbjct  176  LFFVFFLAYLVFVGFWVYLC  195



>emb|CBI25306.3| unnamed protein product [Vitis vinifera]
Length=484

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/70 (53%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = -1

Query  221  EEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCF  42
            + P+EY+L F NC PE  V+M V TE+YN++ NG KD+L AGQTQLP +FF F   Y  F
Sbjct  159  KNPNEYSLYFANCNPESLVTMSVHTEIYNLD-NGVKDYLSAGQTQLPALFFLFSLAYFVF  217

Query  41   LAVWVSVCVK  12
            L  W   C K
Sbjct  218  LGYWSYYCSK  227



>ref|XP_008350414.1| PREDICTED: protein GPR107-like [Malus domestica]
 ref|XP_008366712.1| PREDICTED: protein GPR107-like [Malus domestica]
Length=438

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P++S N +  +S  P+EY+L F NC P+  VSM V TE+YN++ +G +D+L AG T LP 
Sbjct  117  PLASFNHSYPVSA-PNEYSLFFANCAPDTTVSMLVRTEVYNLDPDGSRDYLSAGLTHLPS  175

Query  77   IffffFSVYLCFLAVWVSVC  18
            +F  FF  YL F+  WV +C
Sbjct  176  LFSVFFLAYLVFVGFWVYLC  195



>ref|XP_008447343.1| PREDICTED: protein GPR107 [Cucumis melo]
Length=438

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            P+EY+L F NC PE  VSM V TE++N++ +G KD+L AG TQLP ++F F   YL FL 
Sbjct  130  PNEYSLFFANCAPETSVSMLVRTEVFNLDRDGSKDYLSAGLTQLPSLYFVFSLAYLAFLG  189

Query  35   VWV  27
            +W+
Sbjct  190  LWI  192



>ref|XP_009798503.1| PREDICTED: protein GPR107-like [Nicotiana sylvestris]
Length=434

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 53/80 (66%), Gaps = 2/80 (3%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P SS N +  ++  P+EY+L F NC PE  VSM V TE+YN++ N  KD+L AG TQLP 
Sbjct  114  PNSSFNRSYPVTS-PNEYSLFFANCAPESKVSMDVRTELYNLD-NQVKDYLSAGLTQLPT  171

Query  77   IffffFSVYLCFLAVWVSVC  18
            ++F F  VY  FL +W+ VC
Sbjct  172  LYFLFSFVYFGFLGLWLYVC  191



>ref|XP_009596305.1| PREDICTED: protein GPR107-like [Nicotiana tomentosiformis]
Length=434

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 53/80 (66%), Gaps = 2/80 (3%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P SS N +  ++  P+EY+L F NC PE  VSM V TE+YN++ N  KD+L AG TQLP 
Sbjct  114  PNSSFNRSYPVTS-PNEYSLFFANCAPESKVSMDVRTELYNLD-NQVKDYLSAGLTQLPT  171

Query  77   IffffFSVYLCFLAVWVSVC  18
            ++F F  VY  FL +W+ VC
Sbjct  172  LYFLFSFVYFGFLGLWLYVC  191



>gb|KEH42324.1| lung seven transmembrane receptor family protein [Medicago truncatula]
Length=439

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 53/80 (66%), Gaps = 2/80 (3%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P ++ N +  ++  P+E++L F NC PE  VSM V TE++N++  G +D+L AGQTQLP 
Sbjct  119  PTAAFNRSYPVTS-PNEFSLFFANCAPETSVSMAVRTELFNLDA-GVRDYLSAGQTQLPS  176

Query  77   IffffFSVYLCFLAVWVSVC  18
            +FF F  VY  FL VW  VC
Sbjct  177  LFFLFSVVYFGFLGVWFYVC  196



>emb|CAN74527.1| hypothetical protein VITISV_038603 [Vitis vinifera]
Length=421

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = -1

Query  221  EEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCF  42
            + P+EY+L F NC PE  V+M V TE+YN++ NG KD+L AGQTQLP +FF F   Y  F
Sbjct  112  KNPNEYSLYFANCNPESLVTMSVHTEIYNLD-NGVKDYLSAGQTQLPALFFLFSLAYFVF  170

Query  41   LAVWVSVCVKQSE  3
            L  W   C K   
Sbjct  171  LGYWSYYCSKNKR  183



>ref|XP_002282139.1| PREDICTED: protein GPR107-like [Vitis vinifera]
Length=438

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = -1

Query  221  EEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCF  42
            + P+EY+L F NC PE  V+M V TE+YN++ NG KD+L AGQTQLP +FF F   Y  F
Sbjct  129  KNPNEYSLYFANCNPESLVTMSVHTEIYNLD-NGVKDYLSAGQTQLPALFFLFSLAYFVF  187

Query  41   LAVWVSVCVKQSE  3
            L  W   C K   
Sbjct  188  LGYWSYYCSKNKR  200



>ref|XP_002308488.1| hypothetical protein POPTR_0006s23140g [Populus trichocarpa]
 gb|EEE92011.1| hypothetical protein POPTR_0006s23140g [Populus trichocarpa]
Length=439

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P+SS + +  ++  P+EY+L F NC PE  VSM V TE+YN++ +G +D+L AG TQLP 
Sbjct  118  PLSSFSQSYPVTA-PNEYSLYFANCAPETRVSMSVKTEIYNLDRDGSRDYLSAGLTQLPS  176

Query  77   IffffFSVYLCFLAVWVSV  21
            ++  +F  Y  FL +W+ V
Sbjct  177  LYSLYFIAYAGFLGLWIYV  195



>ref|XP_002972884.1| hypothetical protein SELMODRAFT_441902 [Selaginella moellendorffii]
 gb|EFJ26105.1| hypothetical protein SELMODRAFT_441902 [Selaginella moellendorffii]
Length=433

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 39/82 (48%), Positives = 52/82 (63%), Gaps = 2/82 (2%)
 Frame = -1

Query  248  SHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIff  69
            ++N T  +++  +EY+L F NC     VSM V T MYN+ G+  KDFLPAGQTQLP +FF
Sbjct  116  TYNNTFPVADG-NEYSLFFINCHAHSQVSMIVETSMYNLEGS-VKDFLPAGQTQLPALFF  173

Query  68   ffFSVYLCFLAVWVSVCVKQSE  3
             F  VY+   A+W+  C K  E
Sbjct  174  TFALVYIALTALWIYFCAKHKE  195



>ref|XP_002988051.1| hypothetical protein SELMODRAFT_183593 [Selaginella moellendorffii]
 gb|EFJ10843.1| hypothetical protein SELMODRAFT_183593 [Selaginella moellendorffii]
Length=433

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 39/82 (48%), Positives = 52/82 (63%), Gaps = 2/82 (2%)
 Frame = -1

Query  248  SHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIff  69
            ++N T  +++  +EY+L F NC     VSM V T MYN+ G+  KDFLPAGQTQLP +FF
Sbjct  116  TYNNTFPVADG-NEYSLFFINCHAHSQVSMIVETSMYNLEGS-VKDFLPAGQTQLPALFF  173

Query  68   ffFSVYLCFLAVWVSVCVKQSE  3
             F  VY+   A+W+  C K  E
Sbjct  174  TFALVYIALTALWIYFCAKHKE  195



>emb|CDM84868.1| unnamed protein product [Triticum aestivum]
Length=448

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 33/63 (52%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            PDEY+L F NC PE  V+M V T+MYN N +G KD+L  GQ  +P I+ FF   Y+ FLA
Sbjct  139  PDEYSLFFANCAPETAVTMEVRTDMYNTNPDGSKDYLSVGQAPVPTIYAFFALGYVAFLA  198

Query  35   VWV  27
             W+
Sbjct  199  AWL  201



>emb|CDY58110.1| BnaA02g35120D [Brassica napus]
Length=441

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 40/80 (50%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P S  N +  ++  P+EY+L F NC PE  VSM V TEMYN + NG KD+LPAG TQLP 
Sbjct  120  PNSRFNHSYPVTS-PNEYSLFFANCAPETKVSMAVRTEMYNKDPNGSKDYLPAGSTQLPS  178

Query  77   IffffFSVYLCFLAVWVSVC  18
            ++ FFF  Y  FL      C
Sbjct  179  LYSFFFLCYATFLGYLGYTC  198



>dbj|BAJ98867.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=434

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 37/72 (51%), Positives = 46/72 (64%), Gaps = 1/72 (1%)
 Frame = -1

Query  242  NATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffff  63
            N T  IS  PDEY+L F NC PE  V+M V T+MYN N +G KD+L  GQ  +P I+ FF
Sbjct  131  NKTFPISH-PDEYSLFFANCAPETAVTMEVRTDMYNTNLDGSKDYLSVGQAPVPTIYAFF  189

Query  62   FSVYLCFLAVWV  27
               Y+ FLA W+
Sbjct  190  ALGYVAFLAGWL  201



>ref|XP_002458727.1| hypothetical protein SORBIDRAFT_03g039120 [Sorghum bicolor]
 gb|EES03847.1| hypothetical protein SORBIDRAFT_03g039120 [Sorghum bicolor]
Length=405

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 36/75 (48%), Positives = 48/75 (64%), Gaps = 1/75 (1%)
 Frame = -1

Query  245  HNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIfff  66
            +N T  I+  PDEY+L F NC PE  V+M V T+MYN N +G KD+L  G + +P I+ F
Sbjct  87   YNKTFPITH-PDEYSLFFANCAPETSVTMEVRTDMYNTNPDGTKDYLSVGMSSVPGIYAF  145

Query  65   fFSVYLCFLAVWVSV  21
            F   Y+ FLA W+ V
Sbjct  146  FAVCYVVFLAGWLYV  160



>ref|XP_010558307.1| PREDICTED: protein GPR107 isoform X2 [Tarenaya hassleriana]
Length=351

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            P  ++L F NC PE  VSM V T MYN++  G KD+LP+G T+LP ++FFFF  Y  FL 
Sbjct  132  PSGHSLFFANCAPETRVSMEVRTAMYNLDAKGSKDYLPSGLTRLPGLYFFFFLCYWAFLC  191

Query  35   VWVSVC  18
            +WV +C
Sbjct  192  IWVYIC  197



>dbj|BAK03411.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88533.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=448

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 37/72 (51%), Positives = 46/72 (64%), Gaps = 1/72 (1%)
 Frame = -1

Query  242  NATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffff  63
            N T  IS  PDEY+L F NC PE  V+M V T+MYN N +G KD+L  GQ  +P I+ FF
Sbjct  131  NKTFPISH-PDEYSLFFANCAPETAVTMEVRTDMYNTNLDGSKDYLSVGQAPVPTIYAFF  189

Query  62   FSVYLCFLAVWV  27
               Y+ FLA W+
Sbjct  190  ALGYVAFLAGWL  201



>ref|XP_010558306.1| PREDICTED: protein GPR107 isoform X1 [Tarenaya hassleriana]
Length=430

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            P  ++L F NC PE  VSM V T MYN++  G KD+LP+G T+LP ++FFFF  Y  FL 
Sbjct  132  PSGHSLFFANCAPETRVSMEVRTAMYNLDAKGSKDYLPSGLTRLPGLYFFFFLCYWAFLC  191

Query  35   VWVSVC  18
            +WV +C
Sbjct  192  IWVYIC  197



>ref|XP_003564559.1| PREDICTED: protein GPR107-like [Brachypodium distachyon]
Length=446

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 51/87 (59%), Gaps = 1/87 (1%)
 Frame = -1

Query  263  LSPVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQL  84
            L    ++  T  IS  PDEY L F NC P+  V+M V T+MYN N +G KD+L  GQ  +
Sbjct  122  LDASGNYKHTFPISH-PDEYTLFFANCAPQTSVTMGVRTDMYNTNLDGTKDYLSVGQAPV  180

Query  83   PMIffffFSVYLCFLAVWVSVCVKQSE  3
            P I+ FF   Y+ FLAVW+ V +  + 
Sbjct  181  PTIYAFFAFGYVVFLAVWLYVTLYHNR  207



>ref|XP_006858265.1| hypothetical protein AMTR_s00062p00210470 [Amborella trichopoda]
 gb|ERN19732.1| hypothetical protein AMTR_s00062p00210470 [Amborella trichopoda]
Length=453

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 51/81 (63%), Gaps = 1/81 (1%)
 Frame = -1

Query  251  SSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIf  72
            S+ + +L ISE PDEYNLIF NC     ++M V    YN+  +G+K++L  GQ QLP ++
Sbjct  128  SAKSISLSISE-PDEYNLIFANCLSPLEITMNVKIVAYNLGKDGKKEYLSQGQGQLPTLY  186

Query  71   fffFSVYLCFLAVWVSVCVKQ  9
            F F  VY     +WVS+CV +
Sbjct  187  FIFSVVYFLLFLLWVSLCVMK  207



>dbj|BAJ85112.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score = 69.7 bits (169),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            PDEY+  F NC PE  VSM V TEMYN N +G KD+LP GQ  +P I+ FF   Y  FLA
Sbjct  148  PDEYSPYFANCAPESLVSMNVRTEMYNANPDGSKDYLPVGQAPVPAIYGFFAFGYAAFLA  207

Query  35   VW  30
             W
Sbjct  208  GW  209



>ref|XP_003580105.1| PREDICTED: protein GPR107-like [Brachypodium distachyon]
Length=449

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = -1

Query  212  DEYNLIFGNCQPEFHVSMRVFTEMYNVN--GNGEKDFLPAGQTQLPMIffffFSVYLCFL  39
            D+Y ++F +CQ    V+M V TEMYN+   G+G +++LP G   LP IF    +VY  F+
Sbjct  139  DQYTVLFSSCQDGVEVTMDVRTEMYNIRRPGSGGREYLPVGLLPLPGIFAAASAVYFAFM  198

Query  38   AVWVSVCVKQ  9
            A WV VCVKQ
Sbjct  199  AAWVFVCVKQ  208



>ref|XP_010922440.1| PREDICTED: protein GPR107-like [Elaeis guineensis]
 ref|XP_010922441.1| PREDICTED: protein GPR107-like [Elaeis guineensis]
 ref|XP_010922443.1| PREDICTED: protein GPR107-like [Elaeis guineensis]
Length=444

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = -1

Query  218  EPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFL  39
             PDEY+L F NC PE  VSM V T MYN   +G  D+L  GQ+ +P ++FFF   Y+ FL
Sbjct  134  HPDEYSLYFANCNPESQVSMAVRTVMYNARPDGTPDYLSVGQSPVPSLYFFFALAYVAFL  193

Query  38   AVWVSVCVKQSE  3
            AVW+  C+ ++ 
Sbjct  194  AVWIYFCLLKNR  205



>gb|EMT18499.1| hypothetical protein F775_26439 [Aegilops tauschii]
Length=509

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 46/72 (64%), Gaps = 1/72 (1%)
 Frame = -1

Query  242  NATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffff  63
            N T  +S  PDEY+L F NC PE  V+M V T+MYN N +G KD+L  GQ  +P I+ FF
Sbjct  192  NKTFPVSH-PDEYSLFFANCAPETAVTMEVRTDMYNTNPDGSKDYLSVGQAPVPTIYAFF  250

Query  62   FSVYLCFLAVWV  27
               Y+ FLA W+
Sbjct  251  ALGYVAFLAGWL  262



>ref|XP_009341747.1| PREDICTED: protein GPR107 [Pyrus x bretschneideri]
Length=438

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P++S   +  +S  P+EY+L F NC P+  VSM V TE+YN++ +G +D+L AG T LP 
Sbjct  117  PLASFEHSYPVSA-PNEYSLFFANCAPDTTVSMLVRTEVYNLDPDGSRDYLSAGLTHLPS  175

Query  77   IffffFSVYLCFLAVWVSVC  18
            +F  FF  YL F+  WV +C
Sbjct  176  LFSVFFVAYLVFVGFWVYLC  195



>emb|CDP06670.1| unnamed protein product [Coffea canephora]
Length=437

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 44/69 (64%), Gaps = 1/69 (1%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGE-KDFLPAGQTQLPMIffffFSVYLCFL  39
            P+EY L F NC PE  VSM V TE+YN++  G  KD+L AG TQLP ++F F  +Y  FL
Sbjct  128  PNEYTLFFANCAPESKVSMAVRTELYNLDNMGRVKDYLSAGLTQLPALYFTFSMIYFGFL  187

Query  38   AVWVSVCVK  12
              W+  C K
Sbjct  188  GFWMYYCCK  196



>ref|XP_011007322.1| PREDICTED: protein GPR107-like [Populus euphratica]
Length=442

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P+SS N +  ++  P+EY+L F NC     VSM V T++YN++ +G KD+L AG TQLP 
Sbjct  121  PLSSFNQSYPVTA-PNEYSLFFANCAHGTLVSMSVKTQVYNLDRDGSKDYLSAGLTQLPS  179

Query  77   IffffFSVYLCFLAVWVSVC  18
            +FF +F  Y  FL +W+ VC
Sbjct  180  LFFLYFLAYAAFLGLWIYVC  199



>ref|XP_003554340.1| PREDICTED: protein GPR107-like isoform 2 [Glycine max]
 gb|KHN02396.1| Protein GPR107-like protein [Glycine soja]
Length=442

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 52/79 (66%), Gaps = 1/79 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P +S N +  ++  P+EY+L F NC PE  VSM + TE YN++ +  +D+L AGQT LP 
Sbjct  121  PFASFNRSYPVTS-PNEYSLFFANCAPETSVSMSLHTESYNLDSDSSRDYLSAGQTHLPS  179

Query  77   IffffFSVYLCFLAVWVSV  21
            ++F FF  YL F ++W+ +
Sbjct  180  LYFLFFLTYLSFFSLWLYI  198



>dbj|BAK08179.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08239.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=454

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = -1

Query  218  EPDEYNLIFGNCQPEFHVSMRVFTEMYNV-NGNGEKDFLPAGQTQLPMIffffFSVYLCF  42
            + D+Y ++F +CQ    V+M V TEMYNV    G++++LP G   LP IF    +VY  F
Sbjct  143  DADQYTVLFSSCQDGVEVTMDVRTEMYNVPRPGGDREYLPVGLLPLPGIFASSSAVYFTF  202

Query  41   LAVWVSVCVKQ  9
            LA WV VC+KQ
Sbjct  203  LAAWVFVCIKQ  213



>ref|XP_008345481.1| PREDICTED: LOW QUALITY PROTEIN: protein GPR107-like, partial 
[Malus domestica]
Length=437

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P +S N +  +S  P+EY+L F NC PE  VSM V TE+YN++ +G  D+L AG T LP 
Sbjct  116  PQASFNHSYPVSA-PNEYSLFFANCVPETTVSMIVRTEVYNLDLDGSHDYLSAGLTNLPS  174

Query  77   IffffFSVYLCFLAVWVSVC  18
            +F  F   YL F+  WV +C
Sbjct  175  LFSVFXLAYLVFVGFWVYLC  194



>gb|EPS69713.1| hypothetical protein M569_05049, partial [Genlisea aurea]
Length=423

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 53/86 (62%), Gaps = 2/86 (2%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNG-EKDFLPAGQTQLP  81
            P S  N +  ++  P+EY+L F NC PE  VSM V T +YN++G+G E DFL AG TQLP
Sbjct  101  PASWFNLSYPVTS-PNEYSLFFANCVPESKVSMDVSTVLYNLDGSGKEMDFLSAGLTQLP  159

Query  80   MIffffFSVYLCFLAVWVSVCVKQSE  3
             ++F F  +Y+ F   W+  C +  +
Sbjct  160  SLYFCFSVLYVAFFGYWIYFCFQNKK  185



>ref|XP_006287780.1| hypothetical protein CARUB_v10000990mg [Capsella rubella]
 gb|EOA20678.1| hypothetical protein CARUB_v10000990mg [Capsella rubella]
Length=436

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            P EY+L F NC PE  VSM++ TEMYN + +G K +LP G TQLP ++ FF   YL FL 
Sbjct  125  PSEYSLFFVNCVPESTVSMKIRTEMYNQDSDGSKVYLPPGSTQLPGLYLFFSLCYLTFLG  184

Query  35   VWV  27
            +W+
Sbjct  185  LWL  187



>ref|XP_009340899.1| PREDICTED: protein GPR107-like [Pyrus x bretschneideri]
Length=438

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLA  36
            P+EY+L F NC PE  VSM V TE+YN++ +G  D+L AG T LP +F  FF  YL F+ 
Sbjct  130  PNEYSLFFANCVPETTVSMIVRTEVYNLDPDGSHDYLSAGLTNLPSLFSVFFLAYLVFVG  189

Query  35   VWVSVC  18
             WV +C
Sbjct  190  FWVYLC  195



>ref|XP_009420074.1| PREDICTED: protein GPR107-like [Musa acuminata subsp. malaccensis]
 ref|XP_009420075.1| PREDICTED: protein GPR107-like [Musa acuminata subsp. malaccensis]
Length=451

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 53/81 (65%), Gaps = 3/81 (4%)
 Frame = -1

Query  263  LSPVSS--HNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQT  90
            LSP SS   N +  +S  PDEY+L F NC PE  VSM VFTEMYN   +G +DFL  GQ+
Sbjct  125  LSPGSSVALNRSFPVSL-PDEYSLFFANCAPETAVSMSVFTEMYNARPDGSRDFLSVGQS  183

Query  89   QLPMIffffFSVYLCFLAVWV  27
             +P ++ FF + Y+ F AVW+
Sbjct  184  PVPSLYTFFAAAYIAFFAVWI  204



>ref|XP_002452464.1| hypothetical protein SORBIDRAFT_04g026230 [Sorghum bicolor]
 gb|EES05440.1| hypothetical protein SORBIDRAFT_04g026230 [Sorghum bicolor]
Length=473

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 36/86 (42%), Positives = 47/86 (55%), Gaps = 10/86 (12%)
 Frame = -1

Query  236  TLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNV--------NGNGE--KDFLPAGQTQ  87
            T V  + PD Y ++F NCQ    V+M V TEMYN+        +G G   +D+LP G   
Sbjct  148  TTVTIDYPDAYAVVFSNCQGGVEVTMDVRTEMYNLRRDDDASSSGGGMMIRDYLPVGLQP  207

Query  86   LPMIffffFSVYLCFLAVWVSVCVKQ  9
            LP I+    +VYL FLA WV  C +Q
Sbjct  208  LPGIYAGVAAVYLAFLAAWVWTCARQ  233



>ref|NP_001055767.1| Os05g0462500 [Oryza sativa Japonica Group]
 gb|AAT39188.1| putative lung seven transmembrane receptor 1 [Oryza sativa Japonica 
Group]
 dbj|BAF17681.1| Os05g0462500 [Oryza sativa Japonica Group]
 gb|EEE63998.1| hypothetical protein OsJ_18827 [Oryza sativa Japonica Group]
Length=458

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -1

Query  245  HNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMI  75
            +N T  ++  PDEY+L F NC PE  V+MRV TEMYN N +G  D+LP GQ  +P I
Sbjct  138  YNKTFPVTH-PDEYSLYFANCAPESLVTMRVRTEMYNGNADGSVDYLPVGQAPVPAI  193



>gb|EAY98335.1| hypothetical protein OsI_20245 [Oryza sativa Indica Group]
Length=458

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -1

Query  245  HNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMI  75
            +N T  ++  PDEY+L F NC PE  V+MRV TEMYN N +G  D+LP GQ  +P I
Sbjct  138  YNKTFPVTH-PDEYSLYFANCAPESLVTMRVRTEMYNGNADGSVDYLPVGQAPVPAI  193



>gb|EPS70872.1| seven transmembrane receptor [Genlisea aurea]
Length=435

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 34/86 (40%), Positives = 48/86 (56%), Gaps = 2/86 (2%)
 Frame = -1

Query  260  SPVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNG--EKDFLPAGQTQ  87
            SP +S    L      D+Y L+F NC P+  VSM V + MYN+ G+G   +D+L AG+T 
Sbjct  109  SPTASAFDYLYTETNADQYTLVFANCVPQLKVSMDVRSAMYNLEGSGSDRRDYLSAGKTV  168

Query  86   LPMIffffFSVYLCFLAVWVSVCVKQ  9
            LP ++F    VY      W+SV  K+
Sbjct  169  LPRVYFLLSMVYFALGFTWISVLYKK  194



>ref|XP_009130750.1| PREDICTED: protein GPR107-like [Brassica rapa]
Length=413

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 42/72 (58%), Gaps = 0/72 (0%)
 Frame = -1

Query  218  EPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFL  39
             P  Y+L F NC P   VSM+  TEMYN+N NG K++LP G TQLP +F  F   +    
Sbjct  106  SPGLYSLFFANCVPGTKVSMKFKTEMYNLNPNGSKNYLPPGSTQLPGLFLVFSLCHFTLF  165

Query  38   AVWVSVCVKQSE  3
             +WV +C  + +
Sbjct  166  GLWVYLCYNKKQ  177



>ref|XP_002870983.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47242.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=434

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 48/83 (58%), Gaps = 4/83 (5%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMY---NVNGNGEKDFLPAGQTQ  87
            P S  N + +I+  P +Y+L F NC PE  VSM+V  E+Y   + NG+  KD+L AG TQ
Sbjct  117  PRSQFNKSYLITS-PSDYSLFFANCVPETRVSMKVRAEIYHNLDPNGSNSKDYLLAGSTQ  175

Query  86   LPMIffffFSVYLCFLAVWVSVC  18
            LP ++  F   YL FL  W   C
Sbjct  176  LPGLYLVFSLCYLSFLCFWFCFC  198



>gb|KEH35147.1| lung seven transmembrane receptor family protein [Medicago truncatula]
Length=437

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 35/78 (45%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = -1

Query  236  TLVISEEPDEYNLIFGNCQPE-FHVSMRVFTEMYNVNGNGE-KDFLPAGQTQLPMIffff  63
            TL    + D+YNL+F NC P+   VSM V + MYN++G    +D+L AG+T LP ++F F
Sbjct  119  TLYNETDSDQYNLVFANCHPQQLKVSMDVNSAMYNLDGKSHVRDYLSAGRTILPRVYFVF  178

Query  62   FSVYLCFLAVWVSVCVKQ  9
              VY    AVW+SV  K+
Sbjct  179  SLVYFTLAAVWISVLYKK  196



>ref|XP_010086763.1| hypothetical protein L484_005732 [Morus notabilis]
 gb|EXB23442.1| hypothetical protein L484_005732 [Morus notabilis]
Length=432

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 46/72 (64%), Gaps = 1/72 (1%)
 Frame = -1

Query  215  PDEYNLIFGNCQPE-FHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFL  39
            P+EY+L F NC P    V+M V TE++N + +G KDFL AG TQLP +FFFF  VY  FL
Sbjct  123  PNEYSLFFANCAPAGTAVTMDVLTEVFNYDRDGSKDFLSAGLTQLPSLFFFFSLVYFGFL  182

Query  38   AVWVSVCVKQSE  3
             +W+ + +    
Sbjct  183  GLWIYILLSNKR  194



>gb|EPS67071.1| hypothetical protein M569_07703, partial [Genlisea aurea]
Length=431

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 54/85 (64%), Gaps = 1/85 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P SS N++  + +   EY+L+F NC  E  VSM V TE+YN++ + ++++L  G TQLP 
Sbjct  107  PYSSFNSSYSV-KSAGEYSLVFANCARESKVSMEVITEVYNLDDSMKENYLSVGLTQLPS  165

Query  77   IffffFSVYLCFLAVWVSVCVKQSE  3
            ++FFF  +Y  FL  W+  C + ++
Sbjct  166  LYFFFTVLYFTFLGYWIHFCYQNAK  190



>ref|XP_004976173.1| PREDICTED: protein GPR107-like [Setaria italica]
Length=451

 Score = 63.9 bits (154),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 32/85 (38%), Positives = 48/85 (56%), Gaps = 1/85 (1%)
 Frame = -1

Query  263  LSPVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQL  84
            ++P  +   +L I  + D+Y ++F +CQ    V+M V TEM+NV  +G K++LP G   L
Sbjct  127  IAPDGTGKGSLTIDAD-DQYTVLFSSCQEGVEVTMEVRTEMFNVRRSGAKEYLPVGLLPL  185

Query  83   PMIffffFSVYLCFLAVWVSVCVKQ  9
            P IF     V+  FL  W+ VC K 
Sbjct  186  PGIFAAASVVHFVFLGGWLFVCAKH  210



>ref|NP_195883.1| Lung seven transmembrane receptor family protein [Arabidopsis 
thaliana]
 emb|CAB86000.1| putative protein [Arabidopsis thaliana]
 dbj|BAC41862.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63427.1| At5g02630 [Arabidopsis thaliana]
 gb|AED90500.1| Lung seven transmembrane receptor family protein [Arabidopsis 
thaliana]
Length=428

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 44/67 (66%), Gaps = 1/67 (1%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMY-NVNGNGEKDFLPAGQTQLPMIffffFSVYLCFL  39
            P++Y+L F NC PE  VSM+V TE+Y ++  NG +D+L AG  QLP ++  FF  YL FL
Sbjct  126  PNDYSLFFANCVPETRVSMKVHTEIYHDLYPNGSRDYLLAGSAQLPGLYLVFFLCYLSFL  185

Query  38   AVWVSVC  18
              W+  C
Sbjct  186  CFWLCFC  192



>ref|XP_006352298.1| PREDICTED: protein GPR107-like [Solanum tuberosum]
Length=441

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = -1

Query  236  TLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVN-GNGEKDFLPAGQTQLPMIffffF  60
            TL +  + D+Y+L+F NC P+  VSM V + MYN++  +G +D+L AG+  LP I+F F 
Sbjct  124  TLFVETDSDQYSLVFANCCPQLKVSMTVRSAMYNLDPKSGNRDYLSAGKAILPRIYFVFS  183

Query  59   SVYLCFLAVWVSVCVKQ  9
             VY C    W+ +  K+
Sbjct  184  LVYFCLCIFWIFLLFKK  200



>ref|XP_003625548.1| Protein GPR107 [Medicago truncatula]
 gb|AES81766.1| lung seven transmembrane receptor family protein [Medicago truncatula]
Length=444

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 39/80 (49%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P +S N +  ++  P+EY+L F NC PE  VSM V TE++N++ +G KD+L AGQTQLP 
Sbjct  123  PSASFNRSYPVTT-PNEYSLFFANCAPETSVSMFVLTEIFNLDADGSKDYLSAGQTQLPS  181

Query  77   IffffFSVYLCFLAVWVSVC  18
            +FF FF  YL F   W+  C
Sbjct  182  LFFLFFLAYLTFFVFWIYTC  201



>ref|XP_007151967.1| hypothetical protein PHAVU_004G090500g [Phaseolus vulgaris]
 gb|ESW23961.1| hypothetical protein PHAVU_004G090500g [Phaseolus vulgaris]
Length=439

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 46/72 (64%), Gaps = 2/72 (3%)
 Frame = -1

Query  218  EPDEYNLIFGNCQPE-FHVSMRVFTEMYNVNGNGE-KDFLPAGQTQLPMIffffFSVYLC  45
            + D+YNL+F NC P+   VSM V + MYN++G    +D+L AG+T LP ++F    VY  
Sbjct  127  DADQYNLVFANCHPQQLKVSMDVKSAMYNLDGTSNARDYLSAGRTILPKVYFVLSLVYFA  186

Query  44   FLAVWVSVCVKQ  9
              A+W+SV  K+
Sbjct  187  LAALWISVLYKK  198



>ref|XP_006652496.1| PREDICTED: protein GPR107-like [Oryza brachyantha]
Length=443

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 2/85 (2%)
 Frame = -1

Query  263  LSPVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQL  84
            ++P  +   ++ I ++ D+Y ++F +CQ    V+M V TEMYNV G G +++LP G   L
Sbjct  120  IAPDGNGKGSVTIDDD-DQYTVLFSSCQDGVEVTMDVRTEMYNVRG-GAREYLPVGLLPL  177

Query  83   PMIffffFSVYLCFLAVWVSVCVKQ  9
            P IF    +VY  FL  W   C + 
Sbjct  178  PGIFAAASAVYFAFLCAWAWACARH  202



>ref|XP_010039089.1| PREDICTED: protein GPR107-like [Eucalyptus grandis]
 gb|KCW48965.1| hypothetical protein EUGRSUZ_K02574 [Eucalyptus grandis]
Length=427

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 34/81 (42%), Positives = 46/81 (57%), Gaps = 1/81 (1%)
 Frame = -1

Query  257  PVSSH-NATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLP  81
            P+ SH   T  ++     Y L F NC PE  VSM V TE+YN++ +G K++LP GQ+ L 
Sbjct  112  PLRSHFKRTYPVTYPSGYYFLFFANCHPEVRVSMNVHTELYNLDLDGSKNYLPLGQSTLI  171

Query  80   MIffffFSVYLCFLAVWVSVC  18
             +F  F   Y   LA+WV  C
Sbjct  172  PLFVAFSLAYFFVLALWVYYC  192



>ref|XP_004502059.1| PREDICTED: protein GPR107-like [Cicer arietinum]
Length=436

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 34/78 (44%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = -1

Query  236  TLVISEEPDEYNLIFGNCQPE-FHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPMIffff  63
            TL    + D+YNL+F NC P+   V+M V + MYN++G N  +D+L AG+T LP ++F F
Sbjct  118  TLYNETDADQYNLVFANCHPQQLKVTMDVESAMYNLDGKNNVRDYLSAGRTILPRVYFLF  177

Query  62   FSVYLCFLAVWVSVCVKQ  9
              VY     VW+SV  K+
Sbjct  178  SLVYFTLAVVWISVLYKK  195



>ref|XP_002518919.1| lung seven transmembrane receptor, putative [Ricinus communis]
 gb|EEF43452.1| lung seven transmembrane receptor, putative [Ricinus communis]
Length=432

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = -1

Query  236  TLVISE-EPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffF  60
            ++V SE + D+Y L+F NC     VSM V + MYN+  NG +D+L AG+T LP ++F   
Sbjct  115  SVVTSENDADQYTLVFANCLNSVKVSMDVKSTMYNIERNGNRDYLSAGKTILPRVYFLLS  174

Query  59   SVYLCFLAVWVSVCVKQ  9
             VY     +W+ V  K+
Sbjct  175  IVYFVMAGLWIHVLYKK  191



>ref|XP_010037886.1| PREDICTED: protein GPR107-like [Eucalyptus grandis]
Length=449

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 1/80 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P +S N +  +   P+EY+L F NC     VSM+V TE++N+  +  KD+L AG TQLP 
Sbjct  128  PHASFNKSYAVVY-PNEYSLAFANCLAGASVSMKVRTELFNLEAHDSKDYLSAGLTQLPS  186

Query  77   IffffFSVYLCFLAVWVSVC  18
            ++F F   Y  FL  W+  C
Sbjct  187  LYFVFSLCYFGFLGFWIYYC  206



>gb|KCW49664.1| hypothetical protein EUGRSUZ_K03178 [Eucalyptus grandis]
Length=439

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 1/80 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            P +S N +  +   P+EY+L F NC     VSM+V TE++N+  +  KD+L AG TQLP 
Sbjct  118  PHASFNKSYAVVY-PNEYSLAFANCLAGASVSMKVRTELFNLEAHDSKDYLSAGLTQLPS  176

Query  77   IffffFSVYLCFLAVWVSVC  18
            ++F F   Y  FL  W+  C
Sbjct  177  LYFVFSLCYFGFLGFWIYYC  196



>ref|XP_003542153.1| PREDICTED: protein GPR107-like [Glycine max]
 gb|KHN47939.1| Protein GPR107-like protein [Glycine soja]
Length=443

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 48/72 (67%), Gaps = 2/72 (3%)
 Frame = -1

Query  218  EPDEYNLIFGNCQ-PEFHVSMRVFTEMYNVNGNGE-KDFLPAGQTQLPMIffffFSVYLC  45
            + D+YNL+F NC  P+  V+M V + MYN++G  + +D+L AG+T LP ++F F  VY  
Sbjct  131  DADQYNLVFANCHSPQLKVTMDVKSAMYNLDGKSDVRDYLSAGRTILPRVYFLFSLVYFT  190

Query  44   FLAVWVSVCVKQ  9
              A+W+SV  K+
Sbjct  191  LAALWISVLYKK  202



>ref|XP_008448554.1| PREDICTED: protein GPR107 [Cucumis melo]
 gb|ADN33938.1| seven transmembrane receptor [Cucumis melo subsp. melo]
Length=439

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 31/71 (44%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = -1

Query  218  EPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPMIffffFSVYLCF  42
            + D+Y L+F NC  +F VSM V + MYN+ G N  +D+L AG+T LP I+F F  +Y   
Sbjct  128  DADQYTLVFANCLQQFKVSMDVQSAMYNLEGKNARRDYLSAGKTILPRIYFVFSLIYFSL  187

Query  41   LAVWVSVCVKQ  9
              VW+ V  K+
Sbjct  188  AVVWIHVLYKK  198



>ref|NP_001053272.1| Os04g0508600 [Oryza sativa Japonica Group]
 emb|CAE04732.1| OSJNBa0043L24.20 [Oryza sativa Japonica Group]
 dbj|BAF15186.1| Os04g0508600 [Oryza sativa Japonica Group]
 emb|CAH67567.1| OSIGBa0101P20.10 [Oryza sativa Indica Group]
 gb|EAY94800.1| hypothetical protein OsI_16583 [Oryza sativa Indica Group]
 gb|EAZ31301.1| hypothetical protein OsJ_15412 [Oryza sativa Japonica Group]
Length=450

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 48/88 (55%), Gaps = 4/88 (5%)
 Frame = -1

Query  263  LSPVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNV---NGNGEKDFLPAGQ  93
            ++P  +   ++ I ++ D+Y ++F +CQ    V+M V TEMYNV    G G +++LP G 
Sbjct  123  IAPDGNGKGSVTIDDD-DQYTVLFSSCQDGVEVTMEVRTEMYNVRPGGGRGVREYLPVGL  181

Query  92   TQLPMIffffFSVYLCFLAVWVSVCVKQ  9
              LP IF    +VY  FL  W   C + 
Sbjct  182  LPLPGIFAAASAVYFVFLGAWAWACARH  209



>ref|XP_009773796.1| PREDICTED: protein GPR107-like [Nicotiana sylvestris]
Length=440

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 48/86 (56%), Gaps = 1/86 (1%)
 Frame = -1

Query  263  LSPVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVN-GNGEKDFLPAGQTQ  87
            L P +    T     + +++ L+F NC P   +SM V + MYN N  NG+ DFL AG+T 
Sbjct  114  LQPSARQFTTSFTVSDANQFTLVFANCMPNLVISMNVHSVMYNFNPKNGQLDFLSAGKTA  173

Query  86   LPMIffffFSVYLCFLAVWVSVCVKQ  9
            LPMI+F FF VY+     WV    K+
Sbjct  174  LPMIYFLFFIVYVLMGVFWVLTLYKK  199



>ref|XP_006350720.1| PREDICTED: protein GPR107-like [Solanum tuberosum]
Length=434

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 34/80 (43%), Positives = 46/80 (58%), Gaps = 1/80 (1%)
 Frame = -1

Query  263  LSPVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVN-GNGEKDFLPAGQTQ  87
            L P +   +T  I  + +++ L F NC P   VSM V + MYN N   GE DFL  G+T 
Sbjct  108  LEPSTREFSTSFIVPDANQFTLAFANCMPNLEVSMNVHSVMYNFNPKTGELDFLSTGKTA  167

Query  86   LPMIffffFSVYLCFLAVWV  27
            LP+I+  FF VY+   AVW+
Sbjct  168  LPVIYLLFFIVYVLLGAVWI  187



>ref|XP_009625570.1| PREDICTED: protein GPR107-like [Nicotiana tomentosiformis]
Length=437

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = -1

Query  236  TLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPMIffffF  60
            TL +  + D+Y+L+F NC P+  V+M V + MYN++  +G +DFL AG+  LP I+F F 
Sbjct  121  TLFVETDADQYSLVFANCCPQLKVTMSVRSAMYNLDAKSGNRDFLSAGKAILPRIYFLFS  180

Query  59   SVYLCFLAVWVSVCVKQ  9
             VY      W+ V  K+
Sbjct  181  LVYFSLAIFWIFVLYKK  197



>ref|XP_004244659.2| PREDICTED: protein GPR107-like [Solanum lycopersicum]
Length=441

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 29/77 (38%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = -1

Query  236  TLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPMIffffF  60
            TL +  + D+Y+L+F NC P+  V+M V + MYN++  +G +D+L  G+  LP I+F F 
Sbjct  124  TLFVETDSDQYSLVFANCCPQLKVTMTVRSAMYNLDAKSGNRDYLSTGKAILPRIYFAFS  183

Query  59   SVYLCFLAVWVSVCVKQ  9
             VY C    W+ +  K+
Sbjct  184  LVYFCLCIFWIFLLFKK  200



>ref|XP_001759185.1| predicted protein [Physcomitrella patens]
 gb|EDQ75869.1| predicted protein [Physcomitrella patens]
Length=432

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 35/72 (49%), Positives = 46/72 (64%), Gaps = 2/72 (3%)
 Frame = -1

Query  218  EPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFL  39
            + +EY+L F NC  +  VSM V T MYNV  NG +DFLP GQT LP ++F FF + +  L
Sbjct  124  QSNEYSLFFENCV-KTEVSMEVVTSMYNVE-NGFRDFLPVGQTVLPRMYFLFFLINVALL  181

Query  38   AVWVSVCVKQSE  3
             +W+ VC  Q E
Sbjct  182  GIWIYVCWAQKE  193



>ref|NP_001152348.1| protein GPR107 precursor [Zea mays]
 gb|ACG47160.1| protein GPR107 precursor [Zea mays]
Length=449

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 50/87 (57%), Gaps = 1/87 (1%)
 Frame = -1

Query  263  LSPVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQL  84
            ++P  +   +L I  + D+Y ++F +CQ    V+M V TEMYN+  +G +++LP G   L
Sbjct  125  VAPDGTGRGSLTIDSD-DQYTVLFSSCQEGVEVTMDVRTEMYNLRRSGTREYLPVGLLPL  183

Query  83   PMIffffFSVYLCFLAVWVSVCVKQSE  3
            P IF    +V+  FL  WV VCVK   
Sbjct  184  PWIFAAAAAVHFAFLGTWVVVCVKHRR  210



>ref|XP_009406962.1| PREDICTED: protein GPR107-like [Musa acuminata subsp. malaccensis]
Length=439

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 1/84 (1%)
 Frame = -1

Query  263  LSPVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQL  84
            LS   S N T +I+  PDEY L F NC P   VSM V T MYN   +G  D+L  GQ+ +
Sbjct  116  LSRAHSFNDTFLITH-PDEYGLFFANCAPGAVVSMSVHTGMYNSRSDGTPDYLSVGQSAV  174

Query  83   PMIffffFSVYLCFLAVWVSVCVK  12
            P ++ FF   Y   LA W+ +C +
Sbjct  175  PSLYTFFAVAYFAALAAWIYICFR  198



>ref|XP_009105371.1| PREDICTED: protein GPR107-like [Brassica rapa]
 emb|CDX96037.1| BnaA07g26940D [Brassica napus]
Length=436

 Score = 61.2 bits (147),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = -1

Query  251  SSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPMI  75
            +S  +T+    + D+Y+L+F NC  +  VSM V + MYN+ G NG +D+L AG+T LP +
Sbjct  114  NSSFSTVFSENDADQYSLVFANCLRDVKVSMDVRSAMYNLEGKNGGRDYLSAGRTVLPKV  173

Query  74   ffffFSVYLCFLAVWVSVCVKQ  9
            +F F  +Y    A W+ V  K+
Sbjct  174  YFLFSIIYFSLAATWIYVLYKK  195



>gb|ABR17223.1| unknown [Picea sitchensis]
Length=445

 Score = 61.2 bits (147),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = -1

Query  218  EPDEYNLIFGNCQPEFHVSMRVFTEMYNVN--GNGEKDFLPAGQTQLPMIffffFSVYLC  45
            E ++Y L+F NC P+  VSM V T +YN+   G+G KD+L AG+T LP ++F    +Y+ 
Sbjct  133  EANQYTLVFANCIPDVVVSMDVKTVIYNLEGAGDGTKDYLSAGETLLPKLYFSLSLIYVV  192

Query  44   FLAVWVSVCVK  12
               VW+ V V+
Sbjct  193  LAGVWIFVVVR  203



>ref|XP_009784262.1| PREDICTED: protein GPR107-like [Nicotiana sylvestris]
Length=437

 Score = 61.2 bits (147),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 30/77 (39%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = -1

Query  236  TLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPMIffffF  60
            TL +  + D+Y+L+F NC P+  V+M V + MYN++  +G +D+L AG+  LP I+F F 
Sbjct  121  TLFVETDADQYSLVFANCCPQLKVTMSVRSAMYNLDSKSGNRDYLSAGKAILPRIYFLFS  180

Query  59   SVYLCFLAVWVSVCVKQ  9
             VY   +  W+ V  K+
Sbjct  181  LVYFSLVIFWIFVLYKK  197



>ref|XP_009396863.1| PREDICTED: protein GPR107-like [Musa acuminata subsp. malaccensis]
Length=452

 Score = 61.2 bits (147),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 50/84 (60%), Gaps = 2/84 (2%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFH-VSMRVFTEMYNVNGNGEKDFLPAGQTQLP  81
            P  ++N +  +++ PDEY+L F NC  +   VSM V TEMYN   +G  D+L  GQ+ +P
Sbjct  129  PAGAYNHSFNVTQ-PDEYSLYFANCASDAAAVSMSVRTEMYNARSDGSPDYLSVGQSPVP  187

Query  80   MIffffFSVYLCFLAVWVSVCVKQ  9
             ++ FF   Y  FL +W+ + + Q
Sbjct  188  SLYTFFAVAYAVFLGLWIYLTLFQ  211



>emb|CDP12235.1| unnamed protein product [Coffea canephora]
Length=440

 Score = 61.2 bits (147),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVN---GNGEKDFLPAGQTQLPMIffffFSVYLC  45
            PD+Y+L+F +C P   VSM++ + MYN+     +  +D+L AG+T LP I+F F  VY  
Sbjct  128  PDQYSLVFASCLPNLRVSMKIHSAMYNLQPGPDSNRRDYLSAGKTPLPTIYFLFSLVYFA  187

Query  44   FLAVWVSVCVKQ  9
              A+W+ V  K+
Sbjct  188  LAALWIHVLYKK  199



>ref|XP_008663377.1| PREDICTED: protein GPR107-like [Zea mays]
 gb|AFW58810.1| putative lung seven transmembrane receptor family protein [Zea 
mays]
Length=450

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 33/85 (39%), Positives = 50/85 (59%), Gaps = 1/85 (1%)
 Frame = -1

Query  263  LSPVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQL  84
            ++P  +   +L I  + D+Y ++F +CQ    V+M V TEMYN+  +G +++LP G   L
Sbjct  126  VAPDGTGRGSLTIDSD-DQYTVLFSSCQEGVEVTMEVRTEMYNLRRSGAREYLPVGLLPL  184

Query  83   PMIffffFSVYLCFLAVWVSVCVKQ  9
            P IF    +V+  FL  WV VCVK 
Sbjct  185  PWIFAAAAAVHFAFLGTWVLVCVKH  209



>ref|XP_009104916.1| PREDICTED: protein GPR107-like [Brassica rapa]
Length=437

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = -1

Query  251  SSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPMI  75
            +S  +T+    + D+Y+L+F NC  +  VSM V + MYN+ G +G +D+L AG+T LP +
Sbjct  115  NSSFSTVFTENDADQYSLVFANCLQQVKVSMDVRSAMYNLEGKSGGRDYLSAGRTVLPKV  174

Query  74   ffffFSVYLCFLAVWVSVCVKQ  9
            +F F  +Y    A W+ V  K+
Sbjct  175  YFLFSVIYFSLAATWIYVLFKK  196



>emb|CDX68314.1| BnaA07g23540D [Brassica napus]
Length=437

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = -1

Query  251  SSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPMI  75
            +S  +T+    + D+Y+L+F NC  +  VSM V + MYN+ G +G +D+L AG+T LP +
Sbjct  115  NSSFSTVFTENDADQYSLVFANCLQQVKVSMDVRSAMYNLEGKSGGRDYLSAGRTVLPKV  174

Query  74   ffffFSVYLCFLAVWVSVCVKQ  9
            +F F  +Y    A W+ V  K+
Sbjct  175  YFLFSVIYFSLAATWIYVLFKK  196



>ref|XP_011069685.1| PREDICTED: protein GPR107-like [Sesamum indicum]
Length=437

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 50/86 (58%), Gaps = 2/86 (2%)
 Frame = -1

Query  260  SPVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG--NGEKDFLPAGQTQ  87
            +P +S    L    + ++Y L+F NC P+  VSM V + MYN+ G  +  +D+L  G+T 
Sbjct  111  NPTTSEFNFLYPETDANQYTLVFANCLPQLKVSMNVRSAMYNLEGGKSNRRDYLSIGKTV  170

Query  86   LPMIffffFSVYLCFLAVWVSVCVKQ  9
            LP ++F F  VY    AVW+++  K+
Sbjct  171  LPRVYFLFSLVYFILAAVWINILYKK  196



>ref|XP_009624831.1| PREDICTED: protein GPR107-like [Nicotiana tomentosiformis]
Length=440

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = -1

Query  263  LSPVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVN-GNGEKDFLPAGQTQ  87
            L P +    T     + +++ L+F NC P   +SM V + MYN N  +G+ DFL AG+T 
Sbjct  114  LQPSARQFTTSFSVSDANQFTLVFANCMPNLVISMNVHSVMYNFNPKSGQLDFLSAGKTA  173

Query  86   LPMIffffFSVYLCFLAVWVSVCVKQ  9
            LPMI+F FF VY+   A WV    K+
Sbjct  174  LPMIYFLFFIVYVLMGAFWVLTLYKK  199



>tpg|DAA37003.1| TPA: putative lung seven transmembrane receptor family protein 
[Zea mays]
Length=449

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 33/85 (39%), Positives = 50/85 (59%), Gaps = 1/85 (1%)
 Frame = -1

Query  263  LSPVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQL  84
            ++P  +   +L I  + D+Y ++F +CQ    V+M V TEMYN+  +G +++LP G   L
Sbjct  125  VAPDGTGRGSLTIDSD-DQYTVLFSSCQEGVEVTMDVRTEMYNLRRSGTREYLPVGLLPL  183

Query  83   PMIffffFSVYLCFLAVWVSVCVKQ  9
            P IF    +V+  FL  WV VCVK 
Sbjct  184  PWIFAAAAAVHFAFLGTWVVVCVKH  208



>emb|CDY49209.1| BnaCnng16980D [Brassica napus]
Length=436

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 49/78 (63%), Gaps = 1/78 (1%)
 Frame = -1

Query  239  ATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPMIffff  63
            +T+    + D+Y+L+F NC  +  V+M V + MYN+ G +G +D+L AG+T LP ++F F
Sbjct  118  STVFTENDADQYSLVFANCLQQVKVTMDVRSAMYNLEGKSGGRDYLSAGRTVLPKVYFLF  177

Query  62   FSVYLCFLAVWVSVCVKQ  9
              +Y    A W+ V +K+
Sbjct  178  SVIYFSLAATWIYVLLKK  195



>ref|XP_003518627.1| PREDICTED: protein GPR107-like [Glycine max]
 gb|KHN47228.1| Protein GPR107-like protein [Glycine soja]
Length=441

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/74 (41%), Positives = 46/74 (62%), Gaps = 2/74 (3%)
 Frame = -1

Query  218  EPDEYNLIFGNCQ-PEFHVSMRVFTEMYNVNGNGE-KDFLPAGQTQLPMIffffFSVYLC  45
            + D+YNL+F NC   +  V+M V + MYN+ GN   +D+L AG+T LP ++  F  VY  
Sbjct  129  DADQYNLVFANCHWQQLKVTMDVKSAMYNLEGNSNVRDYLSAGRTILPRVYLLFSLVYFA  188

Query  44   FLAVWVSVCVKQSE  3
              A+W+SV  K+ +
Sbjct  189  LAALWISVLYKKRQ  202



>ref|NP_199024.1| lung seven transmembrane receptor family protein [Arabidopsis 
thaliana]
 dbj|BAB08442.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL24328.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM13262.1| unknown protein [Arabidopsis thaliana]
 gb|AED94766.1| lung seven transmembrane receptor family protein [Arabidopsis 
thaliana]
Length=439

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 48/81 (59%), Gaps = 1/81 (1%)
 Frame = -1

Query  248  SHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPMIf  72
            S  +T+    + D+Y+L+F NC  +  +SM V + MYN+ G  G +D+L AG+T LP ++
Sbjct  118  SRFSTVFTENDADQYSLVFANCLQQVKISMDVRSAMYNLEGKKGGRDYLSAGRTVLPKVY  177

Query  71   fffFSVYLCFLAVWVSVCVKQ  9
            F F  +Y    A W+ V  K+
Sbjct  178  FLFSVIYFSLAATWIYVLYKK  198



>ref|XP_002870592.1| hypothetical protein ARALYDRAFT_915976 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46851.1| hypothetical protein ARALYDRAFT_915976 [Arabidopsis lyrata subsp. 
lyrata]
Length=438

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = -1

Query  248  SHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPMIf  72
            S  +T+    + D+Y+L+F NC  +  +SM V + MYN+ G  G +D+L AG+T LP ++
Sbjct  117  SRFSTVFTENDADQYSLVFANCLQQVEISMDVRSAMYNLEGKKGGRDYLSAGRTVLPKVY  176

Query  71   fffFSVYLCFLAVWVSVCVKQ  9
            FFF  +Y    A W+ V  K+
Sbjct  177  FFFSVIYFSLAATWIYVLYKK  197



>ref|XP_002446769.1| hypothetical protein SORBIDRAFT_06g022100 [Sorghum bicolor]
 gb|EES11097.1| hypothetical protein SORBIDRAFT_06g022100 [Sorghum bicolor]
Length=450

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/85 (38%), Positives = 50/85 (59%), Gaps = 1/85 (1%)
 Frame = -1

Query  263  LSPVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQL  84
            ++P  +   +L I  + D+Y ++F +CQ    V+M V TEMYN+  +G +++LP G   L
Sbjct  126  VAPDGTGRGSLTIDSD-DQYTVLFSSCQEGVEVTMEVKTEMYNLRRSGAREYLPVGLLPL  184

Query  83   PMIffffFSVYLCFLAVWVSVCVKQ  9
            P IF    +V+  FL  WV +CVK 
Sbjct  185  PWIFAAAAAVHFAFLGTWVLICVKH  209



>gb|AAM63843.1| unknown [Arabidopsis thaliana]
Length=439

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 48/81 (59%), Gaps = 1/81 (1%)
 Frame = -1

Query  248  SHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPMIf  72
            S  +T+    + D+Y+L+F NC  +  +SM V + MYN+ G  G +D+L AG+T LP ++
Sbjct  118  SKFSTVFTENDADQYSLVFANCLQQVKISMDVRSAMYNLEGKKGGRDYLSAGRTVLPKVY  177

Query  71   fffFSVYLCFLAVWVSVCVKQ  9
            F F  +Y    A W+ V  K+
Sbjct  178  FLFSVIYFSLAATWIYVLYKK  198



>ref|XP_006282859.1| hypothetical protein CARUB_v10006835mg [Capsella rubella]
 gb|EOA15757.1| hypothetical protein CARUB_v10006835mg [Capsella rubella]
Length=438

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = -1

Query  248  SHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPMIf  72
            S  +T+    + D+Y+L+F NC  +  +SM V + MYN+ G  G +D+L AG+T LP ++
Sbjct  117  SSFSTVFTENDADQYSLVFANCLQQVKISMDVRSAMYNLEGKKGGRDYLSAGRTVLPKVY  176

Query  71   fffFSVYLCFLAVWVSVCVKQ  9
            FFF  +Y    A W+ V  K+
Sbjct  177  FFFSVIYFSLAATWIYVLYKK  197



>gb|KDP25212.1| hypothetical protein JCGZ_20368 [Jatropha curcas]
Length=434

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = -1

Query  242  NATLVISE-EPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIfff  66
            N T++  E + D++ L+F NC     VSM V + MYN+  NG +D+L AG+T LP ++F 
Sbjct  115  NFTVIFLENDADQHTLVFANCLSSVKVSMDVKSAMYNLERNGNRDYLSAGKTILPRVYFL  174

Query  65   fFSVYLCFLAVWVSVCVKQ  9
            F  +Y     +W+ V  K+
Sbjct  175  FSLIYFILAGLWIHVLYKK  193



>ref|XP_010490727.1| PREDICTED: protein GPR107 isoform X1 [Camelina sativa]
Length=421

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = -1

Query  209  EYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLAVW  30
            EY++ F +C P+  VSM++  EMYN++ NG K +LP G TQLP ++ FF   YL F  +W
Sbjct  127  EYSIFFASCVPDTTVSMKIKMEMYNLDPNGSKIYLPPGLTQLPGLYLFFSLCYLTFFGLW  186

Query  29   V  27
            +
Sbjct  187  L  187



>ref|XP_010267415.1| PREDICTED: protein GPR107-like [Nelumbo nucifera]
Length=441

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 29/71 (41%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = -1

Query  218  EPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPMIffffFSVYLCF  42
            E +++ L+F NC  +  +SM V + MYN++G +G +D+L AG T LP ++F FF VY C 
Sbjct  130  EANQFTLVFANCLQQLQISMDVRSAMYNLDGKSGRRDYLSAGVTILPRVYFLFFLVYFCL  189

Query  41   LAVWVSVCVKQ  9
              +W+ V  K+
Sbjct  190  AGLWIYVLYKK  200



>ref|XP_006405277.1| hypothetical protein EUTSA_v10028347mg [Eutrema salsugineum]
 gb|ESQ46730.1| hypothetical protein EUTSA_v10028347mg [Eutrema salsugineum]
Length=442

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)
 Frame = -1

Query  239  ATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPMIffff  63
            +T+    + D+Y+L+F NC  +  VSM V + MYN+ G  G +D+L AG+T LP ++F F
Sbjct  124  STVFTENDADQYSLVFANCLQQVKVSMDVRSAMYNLEGKKGGRDYLSAGRTVLPKVYFLF  183

Query  62   FSVYLCFLAVWVSVCVKQ  9
              +Y    A W+ V  ++
Sbjct  184  SVIYFSLAATWIYVLYRK  201



>ref|XP_007039375.1| Lung seven transmembrane receptor family protein [Theobroma cacao]
 gb|EOY23876.1| Lung seven transmembrane receptor family protein [Theobroma cacao]
Length=436

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 50/86 (58%), Gaps = 2/86 (2%)
 Frame = -1

Query  263  LSPVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQ  87
            L+ +SS + T+    + D+Y L+F NC  +  VSM V + MYN++G    +D+L AG+T 
Sbjct  111  LNRISSFD-TVYQENDADQYTLVFANCLSQIKVSMNVRSAMYNLDGKKNRRDYLSAGKTI  169

Query  86   LPMIffffFSVYLCFLAVWVSVCVKQ  9
            LP ++F    VY     +W+ V  K+
Sbjct  170  LPRVYFLLSLVYFTLAGIWIYVLYKK  195



>emb|CDY01901.1| BnaC06g29410D [Brassica napus]
Length=506

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 48/78 (62%), Gaps = 1/78 (1%)
 Frame = -1

Query  239  ATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPMIffff  63
            +T+    + D+Y+L+F NC  +  V+M V + MYN+ G NG +D+L AG+T LP ++F F
Sbjct  188  STVFSENDADQYSLVFANCLQQVKVTMDVRSAMYNLEGKNGGRDYLSAGRTVLPKVYFLF  247

Query  62   FSVYLCFLAVWVSVCVKQ  9
              +Y    A W+ V  ++
Sbjct  248  SIIYFSLAATWIYVLYRK  265



>ref|XP_011070390.1| PREDICTED: protein GPR107-like [Sesamum indicum]
Length=437

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 45/72 (63%), Gaps = 2/72 (3%)
 Frame = -1

Query  218  EPDEYNLIFGNCQPEFHVSMRVFTEMYNV-NGNG-EKDFLPAGQTQLPMIffffFSVYLC  45
            + D+Y L+F NC P+  VSM V + MYN+ +GN   +D+L AG+T LP  FF F  +Y  
Sbjct  125  DADQYTLVFANCLPQLKVSMSVRSAMYNLEDGNSNRRDYLSAGKTVLPRAFFLFSIIYFV  184

Query  44   FLAVWVSVCVKQ  9
               VWV+V  K+
Sbjct  185  LAVVWVNVLYKK  196



>gb|KGN55664.1| hypothetical protein Csa_3G002830 [Cucumis sativus]
Length=429

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 29/71 (41%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = -1

Query  218  EPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPMIffffFSVYLCF  42
            + D+Y L+F NC  +  VSM V + MYN+ G N  +D+L AG+T LP I+F F  +Y   
Sbjct  118  DADQYTLVFANCLQQVKVSMDVQSAMYNLEGKNARRDYLSAGKTILPRIYFVFSLIYFSL  177

Query  41   LAVWVSVCVKQ  9
              +W+ V  K+
Sbjct  178  AVIWIHVLYKK  188



>ref|XP_004159716.1| PREDICTED: protein GPR107-like [Cucumis sativus]
Length=439

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 29/71 (41%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = -1

Query  218  EPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPMIffffFSVYLCF  42
            + D+Y L+F NC  +  VSM V + MYN+ G N  +D+L AG+T LP I+F F  +Y   
Sbjct  128  DADQYTLVFANCLQQVKVSMDVQSAMYNLEGKNARRDYLSAGKTILPRIYFVFSLIYFSL  187

Query  41   LAVWVSVCVKQ  9
              +W+ V  K+
Sbjct  188  AVIWIHVLYKK  198



>emb|CDX80833.1| BnaC03g00870D [Brassica napus]
Length=355

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMI  75
            P  Y+L F NC P   VSM+  TEMYN++ NG K +LPAG TQLP I
Sbjct  107  PGLYSLFFANCGPGAKVSMKFQTEMYNLDPNGLKSYLPAGSTQLPGI  153



>ref|XP_004146137.1| PREDICTED: protein GPR107-like [Cucumis sativus]
Length=439

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 29/71 (41%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = -1

Query  218  EPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPMIffffFSVYLCF  42
            + D+Y L+F NC  +  VSM V + MYN+ G N  +D+L AG+T LP I+F F  +Y   
Sbjct  128  DADQYTLVFANCLQQVKVSMDVQSAMYNLEGKNARRDYLSAGKTILPRIYFVFSLIYFSL  187

Query  41   LAVWVSVCVKQ  9
              +W+ V  K+
Sbjct  188  AVIWIHVLYKK  198



>ref|XP_004235013.1| PREDICTED: protein GPR107-like [Solanum lycopersicum]
Length=440

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 34/86 (40%), Positives = 48/86 (56%), Gaps = 1/86 (1%)
 Frame = -1

Query  263  LSPVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVN-GNGEKDFLPAGQTQ  87
            L P +    T     + +++ L+F NC P   VSM V + MYN N  +G+ DFL AG+T 
Sbjct  114  LQPSARQFTTSFSVSDANQFTLVFANCMPNLVVSMNVHSVMYNFNPKSGQLDFLSAGKTA  173

Query  86   LPMIffffFSVYLCFLAVWVSVCVKQ  9
            LP I++ FF VY+   A WV    K+
Sbjct  174  LPAIYYLFFVVYVLMGAFWVFALYKK  199



>ref|XP_010447100.1| PREDICTED: protein GPR107-like isoform X1 [Camelina sativa]
Length=439

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 48/78 (62%), Gaps = 1/78 (1%)
 Frame = -1

Query  239  ATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPMIffff  63
            +T+    + D+Y+L+F NC  +  +SM V + MYN+ G  G +D+L AG+T LP ++FFF
Sbjct  121  STVFTENDADQYSLVFANCLQQVKISMDVRSAMYNLEGKKGGRDYLSAGRTVLPKVYFFF  180

Query  62   FSVYLCFLAVWVSVCVKQ  9
              +Y    A W+ +  K+
Sbjct  181  SVIYFSLAATWIYLLYKK  198



>ref|XP_010441394.1| PREDICTED: protein GPR107-like [Camelina sativa]
Length=439

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 48/78 (62%), Gaps = 1/78 (1%)
 Frame = -1

Query  239  ATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPMIffff  63
            +T+    + D+Y+L+F NC  +  +SM V + MYN+ G  G +D+L AG+T LP ++FFF
Sbjct  121  STVFTENDADQYSLVFANCLQQVKISMDVRSAMYNLEGKKGGRDYLSAGRTVLPKVYFFF  180

Query  62   FSVYLCFLAVWVSVCVKQ  9
              +Y    A W+ +  K+
Sbjct  181  SVIYFSLAATWIYLLYKK  198



>ref|XP_010447108.1| PREDICTED: protein GPR107-like isoform X2 [Camelina sativa]
 ref|XP_010436171.1| PREDICTED: protein GPR107-like [Camelina sativa]
Length=439

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 48/78 (62%), Gaps = 1/78 (1%)
 Frame = -1

Query  239  ATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPMIffff  63
            +T+    + D+Y+L+F NC  +  +SM V + MYN+ G  G +D+L AG+T LP ++FFF
Sbjct  121  STVFTENDADQYSLVFANCLQQVKISMDVRSAMYNLEGKKGGRDYLSAGRTVLPKVYFFF  180

Query  62   FSVYLCFLAVWVSVCVKQ  9
              +Y    A W+ +  K+
Sbjct  181  SVIYFSLAATWIYLLYKK  198



>ref|XP_002299422.1| hypothetical protein POPTR_0001s11440g [Populus trichocarpa]
 gb|EEE84227.1| hypothetical protein POPTR_0001s11440g [Populus trichocarpa]
Length=436

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 30/86 (35%), Positives = 47/86 (55%), Gaps = 8/86 (9%)
 Frame = -1

Query  263  LSPVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGE-KDFLPAGQTQ  87
            LS   +HN       + D+Y L+F NC     VSM V + MYN++  G+ +D+L AG+T 
Sbjct  117  LSKTLTHN-------DADQYTLVFANCLTSLKVSMDVKSAMYNLDKGGKARDYLSAGKTM  169

Query  86   LPMIffffFSVYLCFLAVWVSVCVKQ  9
            LP +++    +Y     VW+ V  K+
Sbjct  170  LPRVYYLLSLIYFGLAGVWIYVLYKK  195



>ref|XP_009399989.1| PREDICTED: protein GPR107-like [Musa acuminata subsp. malaccensis]
Length=447

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 48/86 (56%), Gaps = 2/86 (2%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQP-EFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLP  81
            P  + N +  +S  PDEY+L F NC P    V+M V TE YN   +G +D+L  G++ +P
Sbjct  124  PGGAFNNSFAVSH-PDEYSLYFANCGPGAAAVTMSVRTETYNTRPDGSRDYLSVGKSPVP  182

Query  80   MIffffFSVYLCFLAVWVSVCVKQSE  3
             ++ FF   Y  FL  W+ + + Q+ 
Sbjct  183  SLYTFFAVTYAVFLGAWIYLTLFQNR  208



>ref|XP_004309534.1| PREDICTED: protein GPR107-like [Fragaria vesca subsp. vesca]
Length=437

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 30/79 (38%), Positives = 46/79 (58%), Gaps = 2/79 (3%)
 Frame = -1

Query  239  ATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNG--EKDFLPAGQTQLPMIfff  66
            +T+    + D+Y L+F NC     VSM V + MYN+ G     +D+L AG+T LP I+F 
Sbjct  118  STVFQETDADQYTLLFANCLAPLRVSMEVKSVMYNLEGKSSDRRDYLSAGKTILPRIYFV  177

Query  65   fFSVYLCFLAVWVSVCVKQ  9
            F   Y+  + +W+SV  K+
Sbjct  178  FSLAYIVLVGLWISVLYKK  196



>ref|XP_011022403.1| PREDICTED: protein GPR107 [Populus euphratica]
Length=436

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/80 (33%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = -1

Query  245  HNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGE-KDFLPAGQTQLPMIff  69
            +++ +V   + D+Y L+F NC     VSM V + MYN++  G+ +D+L AG+T LP +++
Sbjct  116  NHSKIVTQNDADQYTLVFANCLTSLKVSMDVKSVMYNLDRGGKVRDYLSAGKTILPRVYY  175

Query  68   ffFSVYLCFLAVWVSVCVKQ  9
                +Y   + VW+ V  ++
Sbjct  176  LLSLIYFGLVGVWIYVLYRK  195



>ref|XP_010666150.1| PREDICTED: protein GPR107-like [Beta vulgaris subsp. vulgaris]
Length=452

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 48/80 (60%), Gaps = 3/80 (4%)
 Frame = -1

Query  254  VSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGE--KDFLPAGQTQLP  81
            ++  N +L IS+ P+ Y L+F NC P  H+SM + + MYN+ G     +D+L AG++ LP
Sbjct  129  LTHFNLSLQISD-PNLYTLVFANCIPNLHISMDLVSSMYNLEGRSSIIRDYLSAGKSNLP  187

Query  80   MIffffFSVYLCFLAVWVSV  21
             I+F F  +Y     +W+ V
Sbjct  188  SIYFHFALIYFTLNLIWLYV  207



>ref|XP_010676916.1| PREDICTED: protein GPR107 [Beta vulgaris subsp. vulgaris]
Length=440

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/79 (41%), Positives = 47/79 (59%), Gaps = 2/79 (3%)
 Frame = -1

Query  239  ATLVISEEPDEYNLIFGNCQPE-FHVSMRVFTEMYNVNGNGE-KDFLPAGQTQLPMIfff  66
             +L +  + D+Y L+F NC PE   VSM + + MYN++G    +D+L AG+T LP I+FF
Sbjct  121  GSLFVETDSDQYTLVFANCYPENLLVSMNIRSAMYNLDGKSRTRDYLSAGRTILPRIYFF  180

Query  65   fFSVYLCFLAVWVSVCVKQ  9
            F  +Y      WV V  K+
Sbjct  181  FSVIYFAMSVFWVFVLYKK  199



>ref|XP_002303695.1| hypothetical protein POPTR_0003s14750g [Populus trichocarpa]
 gb|EEE78674.1| hypothetical protein POPTR_0003s14750g [Populus trichocarpa]
Length=436

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 46/78 (59%), Gaps = 1/78 (1%)
 Frame = -1

Query  239  ATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGE-KDFLPAGQTQLPMIffff  63
            + +V   + D+Y L+F NC     VSM V + MYN++  G+ +D+L AG+T LP +++  
Sbjct  118  SKIVTQNDADQYTLVFANCLTSLKVSMDVKSVMYNLDRGGKVRDYLSAGKTILPRVYYLL  177

Query  62   FSVYLCFLAVWVSVCVKQ  9
              +Y   + VW+ V  ++
Sbjct  178  SLIYFGLVGVWIYVLYRK  195



>ref|XP_006439214.1| hypothetical protein CICLE_v10020208mg [Citrus clementina]
 gb|ESR52454.1| hypothetical protein CICLE_v10020208mg [Citrus clementina]
Length=434

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/81 (36%), Positives = 47/81 (58%), Gaps = 1/81 (1%)
 Frame = -1

Query  248  SHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPMIf  72
            S  +T+    + D+Y L+F NC  +  VSM V + MYN+ G +  +D+L AG+T LP I+
Sbjct  113  SEYSTIYSENDADQYTLVFANCLQQLKVSMDVRSAMYNLEGRSNNRDYLSAGKTILPRIY  172

Query  71   fffFSVYLCFLAVWVSVCVKQ  9
            F F  +Y     +W+ V  ++
Sbjct  173  FLFSLIYFILAGLWIHVLYRK  193



>gb|KDO76745.1| hypothetical protein CISIN_1g013899mg [Citrus sinensis]
Length=434

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/81 (36%), Positives = 47/81 (58%), Gaps = 1/81 (1%)
 Frame = -1

Query  248  SHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPMIf  72
            S  +T+    + D+Y L+F NC  +  VSM V + MYN+ G +  +D+L AG+T LP I+
Sbjct  113  SEYSTIYSENDADQYTLVFANCLQQLKVSMDVRSAMYNLEGRSNNRDYLSAGKTILPRIY  172

Query  71   fffFSVYLCFLAVWVSVCVKQ  9
            F F  +Y     +W+ V  ++
Sbjct  173  FLFSLIYFILAGLWIHVLYRK  193



>gb|EYU45253.1| hypothetical protein MIMGU_mgv1a003877mg [Erythranthe guttata]
Length=558

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 43/70 (61%), Gaps = 2/70 (3%)
 Frame = -1

Query  212  DEYNLIFGNCQPEFHVSMRVFTEMYNVNG--NGEKDFLPAGQTQLPMIffffFSVYLCFL  39
            D+Y L+F NC  +  VSM V + MYN+    +  +D+L AG+T LP ++F F  VY    
Sbjct  248  DQYTLVFANCLSQLKVSMNVRSAMYNLEDGKSNRRDYLSAGKTALPKLYFLFSVVYFSIA  307

Query  38   AVWVSVCVKQ  9
            A+W+S+  K+
Sbjct  308  ALWISILYKK  317



>emb|CDP05000.1| unnamed protein product [Coffea canephora]
Length=445

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 48/75 (64%), Gaps = 2/75 (3%)
 Frame = -1

Query  248  SHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVN-GNGEKDFLPAGQTQLPMIf  72
            S  A++ +S+  + + L+F NC P+  VSM V + MYN N   G+ DFL AG+T LP+++
Sbjct  125  SFEASVKVSD-ANLFTLLFSNCLPDLEVSMDVHSVMYNFNPKTGQLDFLSAGKTCLPLVY  183

Query  71   fffFSVYLCFLAVWV  27
            F FF  YL   AVWV
Sbjct  184  FLFFLAYLAMAAVWV  198



>ref|XP_006476279.1| PREDICTED: protein GPR107-like [Citrus sinensis]
Length=436

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 29/81 (36%), Positives = 46/81 (57%), Gaps = 1/81 (1%)
 Frame = -1

Query  248  SHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPMIf  72
            S   T+    + D+Y L+F NC  +  VSM V + MYN+ G +  +D+L AG+T LP I+
Sbjct  115  SEYNTIYSENDADQYTLVFANCLQQLKVSMDVRSAMYNLEGRSNNRDYLSAGKTILPRIY  174

Query  71   fffFSVYLCFLAVWVSVCVKQ  9
            F F  +Y     +W+ V  ++
Sbjct  175  FLFSLIYFTLAGLWIHVLYRK  195



>ref|XP_007209144.1| hypothetical protein PRUPE_ppa005847mg [Prunus persica]
 gb|EMJ10343.1| hypothetical protein PRUPE_ppa005847mg [Prunus persica]
Length=440

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 33/81 (41%), Positives = 48/81 (59%), Gaps = 2/81 (2%)
 Frame = -1

Query  245  HNATLVISE-EPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGN-GEKDFLPAGQTQLPMIf  72
            H  + V SE + D+Y L+F NC  +  VSM V + MYN+ G    +D+L AG+T LP ++
Sbjct  119  HEFSTVFSETDADQYTLLFANCLQQVKVSMDVKSAMYNLEGKENRRDYLSAGKTILPRVY  178

Query  71   fffFSVYLCFLAVWVSVCVKQ  9
            FFF  VY     +W+ V  K+
Sbjct  179  FFFSLVYAALAGLWIFVLYKK  199



>ref|XP_001772011.1| predicted protein [Physcomitrella patens]
 gb|EDQ63092.1| predicted protein [Physcomitrella patens]
Length=412

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 41/72 (57%), Gaps = 2/72 (3%)
 Frame = -1

Query  218  EPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFL  39
            + +EY L F NC     VSM V T MYNV  NG +DFLP GQT LP ++F FF   +  L
Sbjct  104  QSNEYTLFFENCVKT-EVSMEVKTSMYNVE-NGYRDFLPVGQTVLPRMYFLFFLANVALL  161

Query  38   AVWVSVCVKQSE  3
              W+  C  Q E
Sbjct  162  GTWIYACWAQKE  173



>gb|KFK24720.1| hypothetical protein AALP_AA8G015900 [Arabis alpina]
Length=427

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = -1

Query  215  PDEYNLIFGNCQPEFHVSMRVFTEMYNVN-GNGEKDFLPAGQTQLPMIffffFSVYLCFL  39
            P++Y + F NC PE  VSM + TE+YN++  NG KD+L  G TQLP ++F F   YL F 
Sbjct  123  PNDYLIFFANCVPESKVSMNIKTELYNLDPTNGSKDYLSTGLTQLPGLYFIFSICYLSFF  182

Query  38   AV  33
             +
Sbjct  183  TL  184



>ref|XP_002279642.1| PREDICTED: protein GPR107 [Vitis vinifera]
Length=440

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/71 (37%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = -1

Query  218  EPDEYNLIFGNCQPEFHVSMRVFTEMYNV-NGNGEKDFLPAGQTQLPMIffffFSVYLCF  42
            + D++ L+F NC  +  +SM V + MYN+ + NG +D+L AG+  LP ++F F  +Y   
Sbjct  129  DADQFTLVFANCLQQVQISMNVRSVMYNLEDKNGRRDYLSAGKAVLPRVYFLFSLIYFGM  188

Query  41   LAVWVSVCVKQ  9
             A+W+ V  K+
Sbjct  189  AAIWIRVLHKK  199



>ref|XP_010251927.1| PREDICTED: protein GPR107-like [Nelumbo nucifera]
Length=440

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 51/82 (62%), Gaps = 2/82 (2%)
 Frame = -1

Query  248  SHNATLVISE-EPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPMI  75
            + N  +V +E E +++ L+F NC  +  +SM + + MYN++G +G +D+L AG + LP +
Sbjct  118  AKNFGVVFTENEANQFTLVFANCLQQLQISMDIRSAMYNLDGRSGRRDYLSAGNSILPRV  177

Query  74   ffffFSVYLCFLAVWVSVCVKQ  9
            +F FF VY     +W+ V  K+
Sbjct  178  YFLFFLVYFSLAGLWIYVLYKK  199



>gb|KHN05945.1| Protein GPR107-like protein, partial [Glycine soja]
Length=368

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = -1

Query  212  DEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFL  39
            DEY+L F NC PE  VSM + TE +N+N +  +++L +G T LP + F F   Y  F 
Sbjct  69   DEYSLFFANCVPESSVSMEIHTEFFNLNRDASRNYLSSGHTNLPSLLFLFSFAYFSFF  126



>ref|XP_003536969.1| PREDICTED: protein GPR107-like [Glycine max]
Length=426

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = -1

Query  212  DEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFL  39
            DEY+L F NC PE  VSM + TE +N+N +  +++L +G T LP + F F   Y  F 
Sbjct  127  DEYSLFFANCVPESSVSMEIHTEFFNLNRDASRNYLSSGHTNLPSLLFLFSFAYFSFF  184



>ref|XP_006347499.1| PREDICTED: protein GPR107-like [Solanum tuberosum]
Length=440

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/71 (41%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = -1

Query  218  EPDEYNLIFGNCQPEFHVSMRVFTEMYNVN-GNGEKDFLPAGQTQLPMIffffFSVYLCF  42
            + +++ L+F NC P   +SM V + MYN N   G+ DFL AG+T LP I++ FF VY+  
Sbjct  129  DANQFTLVFANCMPNLVISMNVHSVMYNFNPKGGQLDFLSAGKTALPAIYYLFFVVYVLM  188

Query  41   LAVWVSVCVKQ  9
             + WV    K+
Sbjct  189  GSFWVFALYKK  199



>ref|XP_008374157.1| PREDICTED: protein GPR107-like [Malus domestica]
Length=356

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/79 (37%), Positives = 43/79 (54%), Gaps = 2/79 (3%)
 Frame = -1

Query  239  ATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG--NGEKDFLPAGQTQLPMIfff  66
            +T+    + D+Y L+F NC     VSM V +  YN+ G  N  +D+L AG+T LP ++F 
Sbjct  120  STVFSETDADQYTLLFANCLQPLKVSMDVKSAAYNLEGKTNDRRDYLSAGKTILPRVYFL  179

Query  65   fFSVYLCFLAVWVSVCVKQ  9
               VY     +WV V  K+
Sbjct  180  LSLVYASLAGLWVFVLYKK  198



>ref|XP_008775764.1| PREDICTED: protein GPR107-like [Phoenix dactylifera]
Length=453

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 45/84 (54%), Gaps = 1/84 (1%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLP  81
            P SS    +    EP +Y L+F NC P   VSM V + MYNV+   G + +L  G   LP
Sbjct  129  PRSSAFGAVFSQSEPGQYTLVFANCLPRLRVSMSVRSAMYNVDPRTGRRAYLSVGAAALP  188

Query  80   MIffffFSVYLCFLAVWVSVCVKQ  9
            +I+F  F  Y    A WV+V +++
Sbjct  189  LIYFLLFLAYAALAAGWVAVLLRK  212



>ref|XP_008356560.1| PREDICTED: protein GPR107-like [Malus domestica]
Length=439

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 29/79 (37%), Positives = 43/79 (54%), Gaps = 2/79 (3%)
 Frame = -1

Query  239  ATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG--NGEKDFLPAGQTQLPMIfff  66
            +T+    + D+Y L+F NC     VSM V +  YN+ G  N  +D+L AG+T LP ++F 
Sbjct  120  STVFSETDADQYTLLFANCLQPLKVSMDVKSAAYNLEGKTNDRRDYLSAGKTILPRVYFL  179

Query  65   fFSVYLCFLAVWVSVCVKQ  9
               VY     +WV V  K+
Sbjct  180  LSLVYASLAGLWVFVLYKK  198



>ref|XP_006656603.1| PREDICTED: protein GPR107-like, partial [Oryza brachyantha]
Length=404

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 34/83 (41%), Positives = 47/83 (57%), Gaps = 2/83 (2%)
 Frame = -1

Query  251  SSHNATLVISEEPDEYNLIFGNC-QPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPM  78
            SS  +T     EP +Y L+F NC      VSM V + MYNV+   GE+ +L AG T LP 
Sbjct  81   SSSFSTAFRVSEPGQYTLVFANCLGGGLKVSMDVRSAMYNVDPPTGERSYLSAGATALPT  140

Query  77   IffffFSVYLCFLAVWVSVCVKQ  9
            IF FF  VY    A W+++ +++
Sbjct  141  IFGFFGVVYAALAAGWIAILLRK  163



>ref|XP_009360196.1| PREDICTED: protein GPR107 [Pyrus x bretschneideri]
Length=439

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 29/79 (37%), Positives = 43/79 (54%), Gaps = 2/79 (3%)
 Frame = -1

Query  239  ATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG--NGEKDFLPAGQTQLPMIfff  66
            +T+    + D+Y L+F NC     VSM V +  YN+ G  N  +D+L AG+T LP ++F 
Sbjct  120  STVFSETDADQYTLLFANCLQPLKVSMDVKSAAYNLEGKNNDRRDYLSAGKTILPRVYFL  179

Query  65   fFSVYLCFLAVWVSVCVKQ  9
               VY     +WV V  K+
Sbjct  180  LSLVYASLAGLWVFVLYKK  198



>ref|XP_008239261.1| PREDICTED: protein GPR107-like [Prunus mume]
 ref|XP_008246069.1| PREDICTED: protein GPR107-like [Prunus mume]
Length=440

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 46/78 (59%), Gaps = 1/78 (1%)
 Frame = -1

Query  239  ATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGN-GEKDFLPAGQTQLPMIffff  63
            +T+    + D+Y L+F NC  +  VSM V + MYN+ G    +D+L AG+T LP ++FFF
Sbjct  122  STVFSETDADQYMLLFANCLQQVKVSMDVKSAMYNLEGKENRRDYLSAGKTILPRVYFFF  181

Query  62   FSVYLCFLAVWVSVCVKQ  9
              VY     +W+ V  K+
Sbjct  182  SLVYAALAGLWIFVLYKK  199



>ref|XP_005649187.1| hypothetical protein COCSUDRAFT_53024 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24643.1| hypothetical protein COCSUDRAFT_53024 [Coccomyxa subellipsoidea 
C-169]
Length=414

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 30/85 (35%), Positives = 45/85 (53%), Gaps = 0/85 (0%)
 Frame = -1

Query  263  LSPVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQL  84
            L+ +S+  A L+      E++L + NCQ    VS  +   +YNV GNG KDFL  G+  L
Sbjct  94   LTQLSARLADLIKDYRGGEFSLFYANCQKLAVVSFDIRVALYNVRGNGIKDFLSVGEDML  153

Query  83   PMIffffFSVYLCFLAVWVSVCVKQ  9
            P +F   F ++    A+W  V  +Q
Sbjct  154  PTVFMIMFVLFSVAAALWGMVLFRQ  178



>ref|XP_001763158.1| predicted protein [Physcomitrella patens]
 gb|EDQ72035.1| predicted protein [Physcomitrella patens]
Length=431

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 42/69 (61%), Gaps = 2/69 (3%)
 Frame = -1

Query  209  EYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLAVW  30
            EY+  F NC     +SM V T MYNV  +G KDFLP GQT LP+++F FF   +  L +W
Sbjct  126  EYSFFFINCVGS-EISMDVRTSMYNVE-DGLKDFLPIGQTVLPLMYFMFFLCNVSLLGIW  183

Query  29   VSVCVKQSE  3
            V +C  Q +
Sbjct  184  VYICWSQRQ  192



>ref|XP_006846584.1| hypothetical protein AMTR_s00018p00254770 [Amborella trichopoda]
 gb|ERN08259.1| hypothetical protein AMTR_s00018p00254770 [Amborella trichopoda]
Length=443

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 30/77 (39%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = -1

Query  236  TLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVN-GNGEKDFLPAGQTQLPMIffffF  60
            TL    + +++ L+F NC P   +SM V + MYNV+   G +++L AG+T LP IFFF F
Sbjct  129  TLFSQSDANQFTLVFANCIPGLGISMDVRSAMYNVDPKTGARNYLSAGETPLPRIFFFLF  188

Query  59   SVYLCFLAVWVSVCVKQ  9
              Y     +W+ V +K+
Sbjct  189  LAYFGLSGLWIHVLLKK  205



>ref|XP_010100208.1| hypothetical protein L484_015353 [Morus notabilis]
 gb|EXB81879.1| hypothetical protein L484_015353 [Morus notabilis]
Length=411

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 29/83 (35%), Positives = 46/83 (55%), Gaps = 1/83 (1%)
 Frame = -1

Query  254  VSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPM  78
            +     T+    + D+Y L+F NC     VSM V + MYN++G N  +D+L  G+T LP 
Sbjct  117  IQKTTGTVYNETDADQYMLLFANCIQGVKVSMDVRSAMYNLDGKNNVRDYLSTGKTVLPR  176

Query  77   IffffFSVYLCFLAVWVSVCVKQ  9
            ++FFF  +Y     +W+ V  K+
Sbjct  177  VYFFFSLIYFSLAGLWIDVLYKK  199



>ref|XP_010490728.1| PREDICTED: protein GPR107 isoform X2 [Camelina sativa]
Length=384

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  209  EYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAGQTQLPM  78
            EY++ F +C P+  VSM++  EMYN++ NG K +LP G TQLP+
Sbjct  127  EYSIFFASCVPDTTVSMKIKMEMYNLDPNGSKIYLPPGLTQLPV  170



>gb|ABR17381.1| unknown [Picea sitchensis]
Length=436

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = -1

Query  218  EPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPMIffffFSVYLCF  42
            + ++Y LIF NC  +  VSM +   MYN+ G +  +++LPAGQ  LP ++F FF +Y   
Sbjct  126  DSNQYILIFANCIADLQVSMTMKAVMYNLEGESNSRNYLPAGQKMLPRLYFGFFVIYATL  185

Query  41   LAVWVSVCVK  12
              VW  V VK
Sbjct  186  AGVWSYVSVK  195



>ref|XP_008392135.1| PREDICTED: protein GPR107 [Malus domestica]
 ref|XP_008367377.1| PREDICTED: protein GPR107-like [Malus domestica]
Length=441

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/75 (39%), Positives = 42/75 (56%), Gaps = 2/75 (3%)
 Frame = -1

Query  239  ATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNG--NGEKDFLPAGQTQLPMIfff  66
            +T+    + D+Y L+F NC     VSM V +  YN+ G  N  +D+L AG+T LP ++F 
Sbjct  122  STVFSETDADQYTLLFANCLQPLKVSMDVKSAAYNLEGRKNDRRDYLSAGKTILPSVYFL  181

Query  65   fFSVYLCFLAVWVSV  21
            F  VY     +WV V
Sbjct  182  FSLVYASLAGLWVFV  196



>ref|NP_001056698.1| Os06g0132100 [Oryza sativa Japonica Group]
 dbj|BAA84809.1| putative lung seven transmembrane receptor 1 [Oryza sativa Japonica 
Group]
 dbj|BAB19371.1| putative lung seven transmembrane receptor 1 [Oryza sativa Japonica 
Group]
 gb|AAO33145.1| unknown [Oryza sativa Japonica Group]
 dbj|BAF18612.1| Os06g0132100 [Oryza sativa Japonica Group]
 gb|EAY99527.1| hypothetical protein OsI_21496 [Oryza sativa Indica Group]
 gb|EAZ35718.1| hypothetical protein OsJ_20008 [Oryza sativa Japonica Group]
 dbj|BAG93178.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94490.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97242.1| unnamed protein product [Oryza sativa Japonica Group]
Length=454

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 33/83 (40%), Positives = 46/83 (55%), Gaps = 2/83 (2%)
 Frame = -1

Query  251  SSHNATLVISEEPDEYNLIFGNC-QPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPM  78
            SS  +T     EP +Y L+F NC      VSM V + MYNV+   GE+ +L AG T LP 
Sbjct  131  SSSFSTAFPVSEPGQYTLVFANCLGGGLKVSMDVRSAMYNVDPPTGERSYLSAGATALPT  190

Query  77   IffffFSVYLCFLAVWVSVCVKQ  9
            IF FF   Y    A W+++ +++
Sbjct  191  IFGFFGVAYAALAAGWIAILLRK  213



>ref|XP_010056015.1| PREDICTED: protein GPR107 [Eucalyptus grandis]
 gb|KCW72581.1| hypothetical protein EUGRSUZ_E01051 [Eucalyptus grandis]
Length=436

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 45/74 (61%), Gaps = 3/74 (4%)
 Frame = -1

Query  221  EEPDEYNLIFGNC--QPEFHVSMRVFTEMYNVNG-NGEKDFLPAGQTQLPMIffffFSVY  51
            ++ ++Y L+F NC  + +  VSM V +  YN++G +G +D+L AG+T LP ++F F  +Y
Sbjct  122  DDANQYALVFANCLQEQQLRVSMDVRSATYNLDGKSGRRDYLSAGKTVLPRVYFLFSLIY  181

Query  50   LCFLAVWVSVCVKQ  9
                 +WV    K+
Sbjct  182  FVLAGLWVYFLYKK  195



>gb|AFG50463.1| hypothetical protein UMN_737_01, partial [Pinus taeda]
 gb|AFG50465.1| hypothetical protein UMN_737_01, partial [Pinus taeda]
 gb|AFG50466.1| hypothetical protein UMN_737_01, partial [Pinus taeda]
 gb|AFG50467.1| hypothetical protein UMN_737_01, partial [Pinus taeda]
 gb|AFG50468.1| hypothetical protein UMN_737_01, partial [Pinus taeda]
 gb|AFG50469.1| hypothetical protein UMN_737_01, partial [Pinus taeda]
 gb|AFG50470.1| hypothetical protein UMN_737_01, partial [Pinus taeda]
 gb|AFG50471.1| hypothetical protein UMN_737_01, partial [Pinus taeda]
 gb|AFG50474.1| hypothetical protein UMN_737_01, partial [Pinus taeda]
 gb|AFG50475.1| hypothetical protein UMN_737_01, partial [Pinus taeda]
 gb|AFG50477.1| hypothetical protein UMN_737_01, partial [Pinus taeda]
 gb|AFG50478.1| hypothetical protein UMN_737_01, partial [Pinus taeda]
 gb|AFG50479.1| hypothetical protein UMN_737_01, partial [Pinus taeda]
Length=133

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 1/54 (2%)
 Frame = -1

Query  170  HVSMRVFTEMYNVNGNGE-KDFLPAGQTQLPMIffffFSVYLCFLAVWVSVCVK  12
             VSM V T MYN+ G+ + KD+L  GQT LP ++F FF +Y     VWV VCVK
Sbjct  2    QVSMNVKTAMYNLEGDSDIKDYLSVGQTLLPKLYFSFFVIYATLAGVWVFVCVK  55



>gb|AEW09224.1| hypothetical protein UMN_737_01, partial [Pinus radiata]
 gb|AFG50464.1| hypothetical protein UMN_737_01, partial [Pinus taeda]
 gb|AFG50472.1| hypothetical protein UMN_737_01, partial [Pinus taeda]
 gb|AFG50473.1| hypothetical protein UMN_737_01, partial [Pinus taeda]
 gb|AFG50476.1| hypothetical protein UMN_737_01, partial [Pinus taeda]
Length=133

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 1/54 (2%)
 Frame = -1

Query  170  HVSMRVFTEMYNVNGNGE-KDFLPAGQTQLPMIffffFSVYLCFLAVWVSVCVK  12
             VSM V T MYN+ G+ + KD+L  GQT LP ++F FF +Y     VWV VCVK
Sbjct  2    QVSMNVKTAMYNLEGDSDIKDYLSVGQTVLPKLYFSFFVIYATLAGVWVFVCVK  55



>ref|XP_003557135.1| PREDICTED: protein GPR107 [Brachypodium distachyon]
Length=454

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/84 (36%), Positives = 47/84 (56%), Gaps = 4/84 (5%)
 Frame = -1

Query  251  SSHNATLVISEEPDEYNLIFGNC--QPEFHVSMRVFTEMYNVN-GNGEKDFLPAGQTQLP  81
            SS +    +SE P +Y L+F NC    +  +SM V + MYNV+   G++ +L  G   LP
Sbjct  131  SSFSVAFRVSE-PGQYTLVFANCLNGGDLKISMDVSSAMYNVDPATGQRAYLSVGAAALP  189

Query  80   MIffffFSVYLCFLAVWVSVCVKQ  9
             I+F F   Y   +A WVS+ +++
Sbjct  190  SIYFLFCLAYAALVAAWVSILLRK  213



>gb|AEW09225.1| hypothetical protein UMN_737_01, partial [Pinus lambertiana]
Length=133

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 1/54 (2%)
 Frame = -1

Query  170  HVSMRVFTEMYNVNGNGE-KDFLPAGQTQLPMIffffFSVYLCFLAVWVSVCVK  12
             VSM V T MYN+ G+ + KD+L  GQT LP ++F FF +Y     VWV VCVK
Sbjct  2    QVSMNVKTTMYNLEGDSDIKDYLSVGQTVLPKLYFGFFVIYATLAGVWVFVCVK  55



>gb|AFW86007.1| putative lung seven transmembrane receptor family protein [Zea 
mays]
Length=410

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 31/83 (37%), Positives = 44/83 (53%), Gaps = 2/83 (2%)
 Frame = -1

Query  251  SSHNATLVISEEPDEYNLIFGNC-QPEFHVSMRVFTEMYNVN-GNGEKDFLPAGQTQLPM  78
            SS  +T     EP +Y L+F NC      V M V + MYNV+   GE+ +L AG + LP 
Sbjct  139  SSSFSTAFRVSEPGQYTLVFANCLGGGLKVDMDVRSAMYNVDPATGERQYLSAGASALPS  198

Query  77   IffffFSVYLCFLAVWVSVCVKQ  9
             +F F   Y    A WVS+ +++
Sbjct  199  FYFLFCLAYAGLAAAWVSILLRK  221



>ref|NP_001141351.1| uncharacterized protein LOC100273442 precursor [Zea mays]
 gb|ACF86147.1| unknown [Zea mays]
Length=462

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 31/83 (37%), Positives = 44/83 (53%), Gaps = 2/83 (2%)
 Frame = -1

Query  251  SSHNATLVISEEPDEYNLIFGNC-QPEFHVSMRVFTEMYNVN-GNGEKDFLPAGQTQLPM  78
            SS  +T     EP +Y L+F NC      V M V + MYNV+   GE+ +L AG + LP 
Sbjct  139  SSSFSTAFRVSEPGQYTLVFANCLGGGLKVDMDVRSAMYNVDPATGERQYLSAGASALPS  198

Query  77   IffffFSVYLCFLAVWVSVCVKQ  9
             +F F   Y    A WVS+ +++
Sbjct  199  FYFLFCLAYAGLAAAWVSILLRK  221



>gb|AGV54552.1| protein GPR107-like isoform 1 [Phaseolus vulgaris]
Length=444

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 35/54 (65%), Gaps = 1/54 (2%)
 Frame = -1

Query  257  PVSSHNATLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNVNGNGEKDFLPAG  96
            P +S N T  ++   +EY+L F NC PE  VSM V TE+YN++ +  +D+L AG
Sbjct  118  PAASINRTFPVTI-ANEYSLFFANCAPETSVSMAVHTELYNLDPDTSRDYLSAG  170



>gb|AFW86008.1| putative lung seven transmembrane receptor family protein [Zea 
mays]
Length=924

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 31/83 (37%), Positives = 44/83 (53%), Gaps = 2/83 (2%)
 Frame = -1

Query  251  SSHNATLVISEEPDEYNLIFGNC-QPEFHVSMRVFTEMYNVN-GNGEKDFLPAGQTQLPM  78
            SS  +T     EP +Y L+F NC      V M V + MYNV+   GE+ +L AG + LP 
Sbjct  139  SSSFSTAFRVSEPGQYTLVFANCLGGGLKVDMDVRSAMYNVDPATGERQYLSAGASALPS  198

Query  77   IffffFSVYLCFLAVWVSVCVKQ  9
             +F F   Y    A WVS+ +++
Sbjct  199  FYFLFCLAYAGLAAAWVSILLRK  221


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 31/83 (37%), Positives = 44/83 (53%), Gaps = 2/83 (2%)
 Frame = -1

Query  251  SSHNATLVISEEPDEYNLIFGNC-QPEFHVSMRVFTEMYNVN-GNGEKDFLPAGQTQLPM  78
            SS  +T     EP +Y L+F NC      V M V + MYNV+   GE+ +L AG + LP 
Sbjct  601  SSSFSTAFRVSEPGQYTLVFANCLGGGLKVDMDVRSAMYNVDPATGERQYLSAGASALPS  660

Query  77   IffffFSVYLCFLAVWVSVCVKQ  9
             +F F   Y    A WVS+ +++
Sbjct  661  FYFLFCLAYAGLAAAWVSILLRK  683



>ref|XP_010533538.1| PREDICTED: protein GPR107 [Tarenaya hassleriana]
Length=436

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 30/77 (39%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = -1

Query  236  TLVISEEPDEYNLIFGNCQPEFHVSMRVFTEMYNV-NGNGEKDFLPAGQTQLPMIffffF  60
            T+    + D+Y+L+F NC  +  VSM V + MYN+   +G +D+L AG+T LP ++FFFF
Sbjct  119  TVFTENDADQYSLVFANCLQQVKVSMDVRSAMYNLEKKSGRRDYLSAGKTGLPKVYFFFF  178

Query  59   SVYLCFLAVWVSVCVKQ  9
             VY      W+ V  ++
Sbjct  179  LVYFFLAGTWIYVLYRK  195



>emb|CBI32653.3| unnamed protein product [Vitis vinifera]
Length=514

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = -1

Query  170  HVSMRVFTEMYNVNGNGEKDFLPAGQTQLPMIffffFSVYLCFLAVWVSVCVK  12
             V+M V T +YN++    KD+L AGQTQLP ++F F   Y  FL  W+  C +
Sbjct  201  QVTMSVRTTVYNIDNGKTKDYLSAGQTQLPALYFLFSLAYFAFLVFWIHTCYR  253



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 523274929020