BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1238_g2_i1 len=420 path=[1159:0-419]

Length=420
                                                                      Score     E

ref|XP_006420221.1|  hypothetical protein CICLE_v10006173mg             157   1e-45   
ref|XP_002285175.1|  PREDICTED: actin-depolymerizing factor             155   4e-45   Vitis vinifera
ref|XP_006489736.1|  PREDICTED: actin-depolymerizing factor-like        155   5e-45   
ref|XP_007035112.1|  Actin depolymerizing factor 6                      153   3e-44   
ref|XP_010023948.1|  PREDICTED: actin-depolymerizing factor             152   7e-44   
ref|XP_009776477.1|  PREDICTED: actin-depolymerizing factor             152   8e-44   
ref|NP_001268119.1|  actin-depolymerizing factor                        149   2e-42   
ref|XP_009603156.1|  PREDICTED: actin-depolymerizing factor             148   3e-42   
gb|KDO57601.1|  hypothetical protein CISIN_1g031876mg                   148   3e-42   
ref|XP_004247731.1|  PREDICTED: actin-depolymerizing factor-like        148   3e-42   
gb|AFK34925.1|  unknown                                                 147   4e-42   
gb|ABD66506.1|  actin depolymerizing factor 4                           147   5e-42   Gossypium hirsutum [American cotton]
gb|AFK34162.1|  unknown                                                 147   6e-42   
ref|XP_002300779.1|  actin-depolymerizing factor 6 family protein       147   6e-42   Populus trichocarpa [western balsam poplar]
ref|XP_010262315.1|  PREDICTED: actin-depolymerizing factor             146   2e-41   
ref|NP_001275618.1|  actin-depolymerizing factor-like                   146   2e-41   
emb|CDO99231.1|  unnamed protein product                                146   2e-41   
ref|XP_010111917.1|  Actin-depolymerizing factor 6                      145   3e-41   
ref|XP_006846833.1|  hypothetical protein AMTR_s00148p00101540          145   3e-41   
ref|XP_007223711.1|  hypothetical protein PRUPE_ppa013034mg             145   3e-41   
gb|ACH63222.1|  actin depolymerizing factor                             145   5e-41   Rheum australe [Himalayan rhubarb]
ref|XP_006351677.1|  PREDICTED: actin-depolymerizing factor-like        144   6e-41   
ref|XP_007050307.1|  Actin depolymerizing factor 6 isoform 1            144   7e-41   
ref|XP_010274770.1|  PREDICTED: actin-depolymerizing factor-like        144   9e-41   
gb|AAD23407.1|  actin depolymerizing factor                             143   2e-40   Populus tremula x Populus alba [gray poplar]
ref|XP_009773774.1|  PREDICTED: actin-depolymerizing factor             143   2e-40   
ref|NP_001239657.1|  uncharacterized protein LOC100819975               143   3e-40   
ref|XP_003527696.1|  PREDICTED: actin-depolymerizing factor-like        142   3e-40   
ref|XP_002879310.1|  hypothetical protein ARALYDRAFT_902145             142   4e-40   
ref|XP_011091316.1|  PREDICTED: actin-depolymerizing factor             142   4e-40   
ref|XP_004247519.1|  PREDICTED: actin-depolymerizing factor             142   4e-40   
gb|ADB85088.1|  actin-depolymerizing factor 6                           142   7e-40   
gb|KHN22266.1|  Actin-depolymerizing factor 6                           141   1e-39   
gb|KHG26345.1|  Actin-depolymerizing factor                             142   1e-39   
ref|XP_009392104.1|  PREDICTED: actin-depolymerizing factor             141   2e-39   
ref|XP_002524620.1|  actin depolymerizing factor, putative              141   2e-39   Ricinus communis
ref|XP_002307641.2|  hypothetical protein POPTR_0005s24520g             141   2e-39   Populus trichocarpa [western balsam poplar]
ref|XP_010906534.1|  PREDICTED: actin-depolymerizing factor             140   2e-39   
emb|CBI37111.3|  unnamed protein product                                141   2e-39   
ref|XP_009624038.1|  PREDICTED: actin-depolymerizing factor             140   2e-39   
ref|XP_006443848.1|  hypothetical protein CICLE_v10022720mg             140   2e-39   
ref|XP_010542738.1|  PREDICTED: actin-depolymerizing factor 6-like      140   3e-39   
gb|EYU18328.1|  hypothetical protein MIMGU_mgv1a015772mg                140   4e-39   
ref|XP_007162541.1|  hypothetical protein PHAVU_001G160700g             140   4e-39   
ref|XP_004296366.1|  PREDICTED: actin-depolymerizing factor 2-like      140   5e-39   
ref|XP_008787346.1|  PREDICTED: actin-depolymerizing factor-like ...    140   5e-39   
gb|KEH42769.1|  cofilin/actin-depolymerizing factor-like protein        140   5e-39   
ref|XP_008807637.1|  PREDICTED: actin-depolymerizing factor             140   5e-39   
ref|XP_010935897.1|  PREDICTED: actin-depolymerizing factor-like        139   7e-39   
emb|CDP10458.1|  unnamed protein product                                137   1e-38   
emb|CDY10786.1|  BnaA05g11500D                                          139   1e-38   
emb|CDY24750.1|  BnaC04g13550D                                          139   1e-38   
ref|XP_008793579.1|  PREDICTED: actin-depolymerizing factor 11 is...    138   2e-38   
ref|NP_001236003.1|  uncharacterized protein LOC100527688               138   2e-38   
ref|XP_010906282.1|  PREDICTED: actin-depolymerizing factor-like ...    137   2e-38   
ref|XP_006410251.1|  hypothetical protein EUTSA_v10017380mg             138   2e-38   
ref|XP_009144237.1|  PREDICTED: actin-depolymerizing factor 6           138   2e-38   
ref|XP_011083023.1|  PREDICTED: actin-depolymerizing factor-like        138   2e-38   
ref|XP_010906274.1|  PREDICTED: actin-depolymerizing factor-like ...    138   2e-38   
gb|ABK23520.1|  unknown                                                 138   2e-38   Picea sitchensis
ref|XP_008793580.1|  PREDICTED: actin-depolymerizing factor isofo...    137   2e-38   
gb|AFK45782.1|  unknown                                                 138   2e-38   
ref|XP_008235687.1|  PREDICTED: actin-depolymerizing factor             138   2e-38   
ref|XP_007201857.1|  hypothetical protein PRUPE_ppa012988mg             138   3e-38   
gb|AAM63510.1|  Actin-depolymerizing factor ADF-6                       138   3e-38   Arabidopsis thaliana [mouse-ear cress]
gb|AFK44387.1|  unknown                                                 137   3e-38   
gb|AFK44911.1|  unknown                                                 137   4e-38   
ref|XP_010037980.1|  PREDICTED: actin-depolymerizing factor             137   4e-38   
ref|NP_565719.1|  actin depolymerizing factor 6                         137   4e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010557114.1|  PREDICTED: actin-depolymerizing factor 6 iso...    137   4e-38   
ref|XP_011025987.1|  PREDICTED: actin-depolymerizing factor-like        137   5e-38   
ref|XP_008787347.1|  PREDICTED: actin-depolymerizing factor 11-li...    137   6e-38   
gb|ADE75680.1|  unknown                                                 136   1e-37   
ref|XP_008805218.1|  PREDICTED: actin-depolymerizing factor-like        136   1e-37   
ref|XP_004493773.1|  PREDICTED: actin-depolymerizing factor-like        136   2e-37   
ref|XP_009369488.1|  PREDICTED: actin-depolymerizing factor             136   2e-37   
ref|XP_009354940.1|  PREDICTED: actin-depolymerizing factor-like ...    136   2e-37   
ref|XP_008382869.1|  PREDICTED: actin-depolymerizing factor             136   2e-37   
ref|XP_006295186.1|  hypothetical protein CARUB_v10024267mg             135   2e-37   
gb|EYU17913.1|  hypothetical protein MIMGU_mgv1a015771mg                135   3e-37   
gb|KHN30569.1|  Actin-depolymerizing factor 6                           135   3e-37   
ref|NP_001236100.1|  uncharacterized protein LOC100500047               135   3e-37   
ref|XP_010557113.1|  PREDICTED: actin-depolymerizing factor isofo...    135   3e-37   
ref|XP_010555867.1|  PREDICTED: actin-depolymerizing factor 6-like      135   4e-37   
ref|XP_010671034.1|  PREDICTED: actin-depolymerizing factor-like        135   4e-37   
ref|XP_010414168.1|  PREDICTED: actin-depolymerizing factor 6           135   5e-37   
ref|NP_001235058.1|  uncharacterized protein LOC100305927               135   5e-37   
ref|XP_010469748.1|  PREDICTED: actin-depolymerizing factor 6-like      134   7e-37   
ref|XP_010510225.1|  PREDICTED: actin-depolymerizing factor 6-like      134   7e-37   
ref|XP_004495380.1|  PREDICTED: actin-depolymerizing factor-like        133   1e-36   
ref|XP_010920473.1|  PREDICTED: actin-depolymerizing factor-like        134   1e-36   
gb|AFK37313.1|  unknown                                                 132   1e-36   
gb|KFK31228.1|  hypothetical protein AALP_AA6G084900                    133   2e-36   
ref|XP_010104736.1|  Actin-depolymerizing factor                        134   2e-36   
gb|EPS67866.1|  hypothetical protein M569_06910                         132   3e-36   
gb|ABQ41942.1|  actin-depolymerizing factor A                           132   3e-36   Sonneratia alba
gb|ABQ41944.1|  actin-depolymerizing factor A                           131   3e-36   Sonneratia ovata
ref|XP_008356136.1|  PREDICTED: actin-depolymerizing factor isofo...    132   3e-36   
gb|ABQ41943.1|  actin-depolymerizing factor A                           131   3e-36   Sonneratia caseolaris
ref|XP_009354939.1|  PREDICTED: actin-depolymerizing factor-like ...    133   4e-36   
ref|XP_008356135.1|  PREDICTED: actin-depolymerizing factor isofo...    132   5e-36   
ref|XP_010652163.1|  PREDICTED: actin-depolymerizing factor isofo...    131   1e-35   
gb|KHG08366.1|  Actin-depolymerizing factor                             131   1e-35   
gb|KDP40330.1|  hypothetical protein JCGZ_02328                         130   1e-35   
ref|XP_010923770.1|  PREDICTED: actin-depolymerizing factor-like ...    130   2e-35   
gb|KDO60511.1|  hypothetical protein CISIN_1g032158mg                   129   4e-35   
ref|XP_009388500.1|  PREDICTED: actin-depolymerizing factor 11          129   6e-35   
ref|XP_004289936.1|  PREDICTED: actin-depolymerizing factor 6-lik...    129   1e-34   
ref|XP_009388955.1|  PREDICTED: actin-depolymerizing factor 11-like     129   1e-34   
ref|XP_009409826.1|  PREDICTED: actin-depolymerizing factor 11-like     127   1e-34   
gb|AEX97081.1|  actin depolymerizing factor                             128   2e-34   
ref|XP_009408567.1|  PREDICTED: actin-depolymerizing factor 11-like     128   2e-34   
ref|XP_002531528.1|  actin depolymerizing factor, putative              127   3e-34   Ricinus communis
gb|AAK49596.1|AF372880_1  At2g31200/F16D14.4                            127   3e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008787348.1|  PREDICTED: actin-depolymerizing factor-like ...    127   4e-34   
gb|AAF60173.1|AF236068_1  actin depolymerizing factor                   127   4e-34   Elaeis guineensis
gb|EPS70990.1|  hypothetical protein M569_03773                         127   4e-34   
ref|XP_010923771.1|  PREDICTED: actin-depolymerizing factor-like ...    126   5e-34   
dbj|BAG70999.1|  adf                                                    126   7e-34   Musa balbisiana [starchy banana]
ref|XP_007143869.1|  hypothetical protein PHAVU_007G108800g             126   9e-34   
ref|XP_004289934.1|  PREDICTED: actin-depolymerizing factor 6-lik...    126   1e-33   
gb|KHG14810.1|  Actin-depolymerizing factor 6                           125   2e-33   
gb|KHG14809.1|  Actin-depolymerizing factor 6                           126   3e-33   
ref|XP_008447430.1|  PREDICTED: actin-depolymerizing factor             124   7e-33   
ref|XP_004151983.1|  PREDICTED: actin-depolymerizing factor 6-lik...    123   1e-32   
ref|XP_010679250.1|  PREDICTED: actin-depolymerizing factor             122   2e-32   
ref|NP_001067327.1|  Os12g0628100                                       121   1e-31   Oryza sativa Japonica Group [Japonica rice]
gb|EEC69719.1|  hypothetical protein OsI_39206                          120   2e-31   Oryza sativa Indica Group [Indian rice]
gb|ABK23967.1|  unknown                                                 118   2e-30   Picea sitchensis
ref|XP_006664223.1|  PREDICTED: actin-depolymerizing factor 11-like     117   2e-30   
gb|ACG24914.1|  actin-depolymerizing factor 6                           117   2e-30   Zea mays [maize]
ref|NP_001148357.1|  actin-depolymerizing factor 6                      117   3e-30   Zea mays [maize]
ref|XP_003558421.1|  PREDICTED: actin-depolymerizing factor 2           117   4e-30   
ref|XP_002463796.1|  hypothetical protein SORBIDRAFT_01g006330          117   4e-30   Sorghum bicolor [broomcorn]
ref|XP_002969368.1|  hypothetical protein SELMODRAFT_146459             117   4e-30   
ref|XP_004168151.1|  PREDICTED: actin-depolymerizing factor 6-lik...    116   5e-30   
gb|EMS61987.1|  Actin-depolymerizing factor 2                           117   1e-29   
gb|AFW67457.1|  hypothetical protein ZEAMMB73_569048                    116   1e-29   
ref|XP_004981554.1|  PREDICTED: actin-depolymerizing factor 2-like      115   1e-29   
ref|NP_001051449.1|  Os03g0780400                                       115   1e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004147034.1|  PREDICTED: actin-depolymerizing factor 5-lik...    115   3e-29   
ref|XP_004158407.1|  PREDICTED: actin-depolymerizing factor 5-like      114   3e-29   
ref|XP_004147035.1|  PREDICTED: actin-depolymerizing factor 5-lik...    114   3e-29   
gb|EMT26595.1|  Actin-depolymerizing factor 10                          114   5e-29   
ref|XP_010548091.1|  PREDICTED: actin-depolymerizing factor 5           114   6e-29   
ref|XP_006650675.1|  PREDICTED: actin-depolymerizing factor 2-like      114   7e-29   
dbj|BAK02947.1|  predicted protein                                      113   8e-29   
ref|XP_004142080.1|  PREDICTED: actin-depolymerizing factor 1-like      113   1e-28   
ref|NP_001148661.1|  actin-depolymerizing factor 6                      113   1e-28   Zea mays [maize]
gb|ABD66507.1|  actin depolymerizing factor 5                           113   1e-28   Gossypium hirsutum [American cotton]
ref|XP_008447631.1|  PREDICTED: actin-depolymerizing factor 1-like      112   1e-28   
gb|EMS65284.1|  Actin-depolymerizing factor 10                          114   1e-28   
ref|XP_002465048.1|  hypothetical protein SORBIDRAFT_01g031270          113   2e-28   Sorghum bicolor [broomcorn]
ref|XP_010234923.1|  PREDICTED: actin-depolymerizing factor 10 is...    112   2e-28   
ref|XP_004983892.1|  PREDICTED: actin-depolymerizing factor 10-like     112   2e-28   
gb|AEJ88268.1|  putative actin-depolymerizing factor                    112   3e-28   
gb|ACB32233.1|  actin-depolymerizing factor 1                           112   3e-28   Solanum chacoense
ref|XP_006341057.1|  PREDICTED: actin-depolymerizing factor 1-like      112   3e-28   
ref|XP_003574212.1|  PREDICTED: actin-depolymerizing factor 10 is...    112   4e-28   
ref|XP_007200573.1|  hypothetical protein PRUPE_ppa013033mg             112   4e-28   
emb|CAJ38388.1|  actin-depolymerizing factor                            111   4e-28   Plantago major [cart-track plant]
gb|ABK26220.1|  unknown                                                 111   6e-28   Picea sitchensis
ref|XP_009586917.1|  PREDICTED: actin-depolymerizing factor 1           111   6e-28   
gb|ABK22764.1|  unknown                                                 111   6e-28   Picea sitchensis
ref|XP_009598852.1|  PREDICTED: actin-depolymerizing factor 5-like      111   6e-28   
gb|KHG01327.1|  Actin-depolymerizing factor 5 -like protein             111   6e-28   
gb|KEH30500.1|  cofilin/actin-depolymerizing factor-like protein        110   6e-28   
gb|KHG30750.1|  Actin-depolymerizing factor 5 -like protein             111   7e-28   
sp|Q9FVI2.1|ADF1_PETHY  RecName: Full=Actin-depolymerizing factor...    111   7e-28   Petunia x hybrida [garden petunia]
gb|ADV02778.1|  actin depolymerizing factor 1                           111   7e-28   
ref|XP_010246837.1|  PREDICTED: actin-depolymerizing factor 5-like      110   1e-27   
ref|XP_008680099.1|  PREDICTED: actin-depolymerizing factor isofo...    110   1e-27   
ref|XP_009350564.1|  PREDICTED: actin-depolymerizing factor 5           110   1e-27   
gb|KHG16525.1|  Actin-depolymerizing factor 5 -like protein             110   1e-27   
ref|NP_001151845.1|  actin-depolymerizing factor                        110   1e-27   Zea mays [maize]
ref|XP_004246462.1|  PREDICTED: actin-depolymerizing factor 1           110   2e-27   
gb|KEH30501.1|  cofilin/actin-depolymerizing factor-like protein        110   2e-27   
gb|ABK21557.1|  unknown                                                 110   2e-27   Picea sitchensis
gb|AAG13444.1|AC051634_25  putative actin depolymerizing factor         110   2e-27   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA45970.1|  TPA: hypothetical protein ZEAMMB73_645058              111   3e-27   
ref|XP_009789824.1|  PREDICTED: actin-depolymerizing factor 5-like      109   3e-27   
gb|EPS63340.1|  hypothetical protein M569_11446                         109   3e-27   
ref|XP_010266805.1|  PREDICTED: actin-depolymerizing factor 5-like      109   3e-27   
ref|XP_008372904.1|  PREDICTED: actin-depolymerizing factor 5-like      109   3e-27   
ref|XP_010669849.1|  PREDICTED: actin-depolymerizing factor 4-like      109   3e-27   
ref|NP_001065088.1|  Os10g0521100                                       109   3e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007041872.1|  Actin depolymerizing factor 5                      110   3e-27   
ref|XP_008804935.1|  PREDICTED: actin-depolymerizing factor isofo...    109   3e-27   
ref|XP_009353719.1|  PREDICTED: actin-depolymerizing factor 1-like      109   3e-27   
gb|AFK43299.1|  unknown                                                 110   4e-27   
ref|XP_009111466.1|  PREDICTED: actin-depolymerizing factor 8           109   4e-27   
ref|XP_006396264.1|  hypothetical protein EUTSA_v10029050mg             108   4e-27   
ref|XP_008385142.1|  PREDICTED: actin-depolymerizing factor 1-like      108   4e-27   
gb|KHN39884.1|  Actin-depolymerizing factor 5                           108   5e-27   
ref|NP_001236835.1|  uncharacterized protein LOC100526982               108   5e-27   
ref|XP_011094831.1|  PREDICTED: actin-depolymerizing factor 1 iso...    108   5e-27   
ref|XP_008788089.1|  PREDICTED: actin-depolymerizing factor 7-like      108   5e-27   
ref|XP_010053689.1|  PREDICTED: actin-depolymerizing factor             108   5e-27   
ref|XP_009358343.1|  PREDICTED: actin-depolymerizing factor 1-like      108   5e-27   
ref|XP_002273958.2|  PREDICTED: actin-depolymerizing factor 1-like      110   5e-27   Vitis vinifera
ref|XP_008357628.1|  PREDICTED: actin-depolymerizing factor 1-like      108   6e-27   
ref|XP_011094830.1|  PREDICTED: actin-depolymerizing factor 1 iso...    108   6e-27   
gb|AEZ00870.1|  putative actin depolymerizing factor protein            109   6e-27   
ref|XP_010028714.1|  PREDICTED: actin-depolymerizing factor 5           108   6e-27   
ref|XP_008385227.1|  PREDICTED: actin-depolymerizing factor 1-like      108   6e-27   
ref|XP_009421345.1|  PREDICTED: actin-depolymerizing factor 7-like      108   7e-27   
ref|XP_007131700.1|  hypothetical protein PHAVU_011G034600g             108   7e-27   
gb|KDP29633.1|  hypothetical protein JCGZ_18795                         108   8e-27   
gb|KHG06644.1|  Actin-depolymerizing factor 1                           108   8e-27   
ref|XP_002533101.1|  actin depolymerizing factor, putative              108   8e-27   Ricinus communis
gb|KHG23104.1|  Actin-depolymerizing factor 1                           108   9e-27   
gb|ABK94603.1|  unknown                                                 108   9e-27   Populus trichocarpa [western balsam poplar]
ref|XP_002277796.1|  PREDICTED: actin-depolymerizing factor 5           108   9e-27   Vitis vinifera
ref|XP_008438059.1|  PREDICTED: actin-depolymerizing factor 7-like      108   9e-27   
gb|EYU26572.1|  hypothetical protein MIMGU_mgv1a015955mg                108   1e-26   
gb|KCW49773.1|  hypothetical protein EUGRSUZ_K03264                     107   1e-26   
ref|XP_002311154.2|  hypothetical protein POPTR_0008s05210g             110   1e-26   Populus trichocarpa [western balsam poplar]
ref|XP_010479839.1|  PREDICTED: actin-depolymerizing factor 10          107   1e-26   
ref|XP_011077447.1|  PREDICTED: actin-depolymerizing factor 1-like      108   1e-26   
ref|XP_010503215.1|  PREDICTED: actin-depolymerizing factor 1-like      107   1e-26   
ref|XP_010514926.1|  PREDICTED: actin-depolymerizing factor 1           107   1e-26   
gb|AEG76940.1|  putative ADF                                            106   1e-26   
ref|XP_010253266.1|  PREDICTED: actin-depolymerizing factor 2           107   2e-26   
ref|XP_004249528.1|  PREDICTED: actin-depolymerizing factor 1-like      107   2e-26   
ref|XP_010669850.1|  PREDICTED: actin-depolymerizing factor 4           107   2e-26   
gb|AFK36072.1|  unknown                                                 108   2e-26   
ref|XP_007218574.1|  hypothetical protein PRUPE_ppa013108mg             107   2e-26   
ref|XP_008794195.1|  PREDICTED: actin-depolymerizing factor-like        107   2e-26   
ref|XP_009411533.1|  PREDICTED: actin-depolymerizing factor 1-like      108   2e-26   
ref|XP_006661967.1|  PREDICTED: actin-depolymerizing factor 10-like     107   2e-26   
ref|XP_011088592.1|  PREDICTED: actin-depolymerizing factor 5-like      107   2e-26   
gb|KCW88915.1|  hypothetical protein EUGRSUZ_A01245                     106   2e-26   
ref|XP_002298043.1|  actin-depolymerizing factor family protein         107   2e-26   Populus trichocarpa [western balsam poplar]
gb|KCW88917.1|  hypothetical protein EUGRSUZ_A01245                     106   2e-26   
ref|XP_011029243.1|  PREDICTED: actin-depolymerizing factor isofo...    107   2e-26   
ref|XP_004505784.1|  PREDICTED: LOW QUALITY PROTEIN: actin-depoly...    108   2e-26   
ref|XP_008776502.1|  PREDICTED: actin-depolymerizing factor 7           107   2e-26   
ref|XP_010535543.1|  PREDICTED: actin-depolymerizing factor 4           107   2e-26   
gb|ADI78873.1|  actin-depolymerizing factor                             107   2e-26   
ref|XP_007040194.1|  Actin depolymerizing factor 8                      107   3e-26   
gb|KCW88916.1|  hypothetical protein EUGRSUZ_A01245                     106   3e-26   
ref|XP_006422623.1|  hypothetical protein CICLE_v10029455mg             107   3e-26   
ref|XP_010922979.1|  PREDICTED: actin-depolymerizing factor 7-like      109   3e-26   
ref|XP_009389157.1|  PREDICTED: actin-depolymerizing factor 1-like      107   3e-26   
ref|XP_010529845.1|  PREDICTED: actin-depolymerizing factor 2-like      106   4e-26   
ref|XP_006384570.1|  hypothetical protein POPTR_0004s17950g             105   4e-26   
ref|XP_009420088.1|  PREDICTED: actin-depolymerizing factor 7-like      106   4e-26   
ref|XP_006846080.1|  hypothetical protein AMTR_s00012p00089320          106   4e-26   
ref|XP_007016496.1|  Actin depolymerizing factor 4                      106   4e-26   
ref|XP_010096647.1|  Actin-depolymerizing factor 2                      107   4e-26   
ref|XP_010544380.1|  PREDICTED: actin-depolymerizing factor 8 iso...    106   4e-26   
ref|XP_006418454.1|  hypothetical protein EUTSA_v10009057mg             106   4e-26   
ref|XP_008666907.1|  PREDICTED: actin-depolymerizing factor 2-like      106   5e-26   
ref|XP_004289861.1|  PREDICTED: actin-depolymerizing factor 5-like      106   5e-26   
ref|XP_006422622.1|  hypothetical protein CICLE_v10029455mg             107   5e-26   
ref|XP_011024249.1|  PREDICTED: actin-depolymerizing factor 1-lik...    105   5e-26   
ref|XP_009388628.1|  PREDICTED: actin-depolymerizing factor 7           106   5e-26   
ref|XP_010047513.1|  PREDICTED: actin-depolymerizing factor 2           106   5e-26   
ref|XP_003526978.1|  PREDICTED: actin-depolymerizing factor 5-like      106   5e-26   
ref|NP_001078247.1|  actin depolymerizing factor 1                      106   5e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010426028.1|  PREDICTED: actin-depolymerizing factor 1-like      106   5e-26   
ref|XP_006281292.1|  hypothetical protein CARUB_v10027342mg             106   5e-26   
ref|XP_009404611.1|  PREDICTED: actin-depolymerizing factor 7-like      106   5e-26   
ref|XP_002439159.1|  hypothetical protein SORBIDRAFT_09g001500          106   5e-26   Sorghum bicolor [broomcorn]
gb|ACU16423.1|  unknown                                                 106   6e-26   Glycine max [soybeans]
ref|XP_003637508.1|  Actin-depolymerizing factor                        106   6e-26   
ref|XP_002313717.1|  putative actin-depolymerizing factor family ...    106   6e-26   Populus trichocarpa [western balsam poplar]
ref|XP_006843593.1|  hypothetical protein AMTR_s00007p00126220          106   6e-26   
ref|XP_008244913.1|  PREDICTED: actin-depolymerizing factor 10          106   6e-26   
ref|XP_010260094.1|  PREDICTED: actin-depolymerizing factor 2-like      105   6e-26   
ref|XP_010427310.1|  PREDICTED: actin-depolymerizing factor 8           106   6e-26   
gb|KDP35600.1|  hypothetical protein JCGZ_09038                         105   6e-26   
ref|XP_004142738.1|  PREDICTED: actin-depolymerizing factor 2-like      105   7e-26   
ref|XP_010937681.1|  PREDICTED: actin-depolymerizing factor 7-like      105   7e-26   
ref|XP_011001977.1|  PREDICTED: actin-depolymerizing factor 5-like      105   7e-26   
ref|XP_002305510.1|  putative actin-depolymerizing factor family ...    105   7e-26   Populus trichocarpa [western balsam poplar]
gb|KDP29838.1|  hypothetical protein JCGZ_18413                         105   7e-26   
ref|XP_010090326.1|  Actin-depolymerizing factor 5                      105   7e-26   
ref|XP_010920670.1|  PREDICTED: actin-depolymerizing factor 7           105   8e-26   
ref|XP_004495011.1|  PREDICTED: actin-depolymerizing factor 2-like      105   8e-26   
ref|XP_006304638.1|  hypothetical protein CARUB_v10011760mg             105   8e-26   
ref|XP_008463478.1|  PREDICTED: actin-depolymerizing factor 2 iso...    105   8e-26   
emb|CDY51146.1|  BnaA09g51810D                                          110   8e-26   
gb|AFW74929.1|  hypothetical protein ZEAMMB73_452408                    104   8e-26   
ref|XP_002284292.1|  PREDICTED: actin-depolymerizing factor 2           105   9e-26   
emb|CDY07204.1|  BnaCnng02190D                                          108   9e-26   
ref|XP_008393892.1|  PREDICTED: actin-depolymerizing factor 1           105   9e-26   
sp|P30175.1|ADF_LILLO  RecName: Full=Actin-depolymerizing factor;...    105   1e-25   
ref|XP_007144457.1|  hypothetical protein PHAVU_007G157800g             105   1e-25   
ref|XP_006439576.1|  hypothetical protein CICLE_v10023304mg             105   1e-25   
gb|AFK48761.1|  unknown                                                 105   1e-25   
gb|KDO76170.1|  hypothetical protein CISIN_1g046281mg                   105   1e-25   
ref|XP_006339034.1|  PREDICTED: actin-depolymerizing factor 1-like      105   1e-25   
ref|NP_194289.2|  actin depolymerizing factor 7                         105   1e-25   
ref|NP_001131557.1|  hypothetical protein                               105   1e-25   
gb|KCW71635.1|  hypothetical protein EUGRSUZ_E00162                     105   1e-25   
emb|CDY38025.1|  BnaCnng08860D                                          106   1e-25   
ref|XP_002892045.1|  hypothetical protein ARALYDRAFT_887267             105   1e-25   
ref|XP_010544379.1|  PREDICTED: actin-depolymerizing factor 8 iso...    106   1e-25   
ref|XP_008647356.1|  PREDICTED: hypothetical protein isoform X1         105   1e-25   
ref|XP_010662752.1|  PREDICTED: actin-depolymerizing factor 1           105   2e-25   
ref|XP_004231029.1|  PREDICTED: actin-depolymerizing factor 5           105   2e-25   
ref|XP_006436042.1|  hypothetical protein CICLE_v10033029mg             104   2e-25   
ref|XP_006359679.1|  PREDICTED: actin-depolymerizing factor 5-like      105   2e-25   
ref|XP_009386059.1|  PREDICTED: actin-depolymerizing factor             104   2e-25   
ref|XP_009126640.1|  PREDICTED: actin-depolymerizing factor 4 iso...    104   2e-25   
gb|KFK30636.1|  hypothetical protein AALP_AA6G007700                    107   2e-25   
ref|XP_007206123.1|  hypothetical protein PRUPE_ppa013110mg             104   2e-25   
gb|KHN05922.1|  Actin-depolymerizing factor 2                           104   2e-25   
gb|KFK40074.1|  hypothetical protein AALP_AA3G326800                    104   2e-25   
ref|XP_006292022.1|  hypothetical protein CARUB_v10018211mg             104   2e-25   
gb|KGN56524.1|  hypothetical protein Csa_3G122480                       104   2e-25   
ref|XP_009118831.1|  PREDICTED: actin-depolymerizing factor 10 is...    104   2e-25   
ref|XP_006476590.1|  PREDICTED: actin-depolymerizing factor 1-like      104   2e-25   
ref|XP_002963013.1|  hypothetical protein SELMODRAFT_230142             104   2e-25   
gb|EPS69954.1|  hypothetical protein M569_04811                         105   2e-25   
ref|XP_009416252.1|  PREDICTED: actin-depolymerizing factor 7-like      104   2e-25   
ref|XP_010553292.1|  PREDICTED: actin-depolymerizing factor 1           104   2e-25   
ref|XP_008804936.1|  PREDICTED: zinc finger CCHC domain-containin...    108   2e-25   
ref|XP_010249803.1|  PREDICTED: actin-depolymerizing factor             104   2e-25   
ref|NP_001238519.1|  uncharacterized protein LOC100499953               104   3e-25   
gb|ACJ84058.1|  unknown                                                 104   3e-25   
dbj|BAJ93061.1|  predicted protein                                      104   3e-25   
ref|NP_567182.1|  actin depolymerizing factor 8                         104   3e-25   
gb|AFS49701.1|  actin-depolymerizing factor 7                           104   3e-25   
ref|XP_010456252.1|  PREDICTED: actin-depolymerizing factor 8-like      104   3e-25   
gb|KFK27528.1|  hypothetical protein AALP_AA8G395200                    103   3e-25   
ref|XP_009131961.1|  PREDICTED: actin-depolymerizing factor 4-like      103   3e-25   
ref|XP_007051847.1|  Actin depolymerizing factor 11                     103   4e-25   
emb|CBI31711.3|  unnamed protein product                                105   4e-25   
gb|KHN48988.1|  Actin-depolymerizing factor 2                           104   4e-25   
ref|XP_010419619.1|  PREDICTED: actin-depolymerizing factor 8-like      103   4e-25   
emb|CDY09242.1|  BnaA02g06680D                                          104   4e-25   
emb|CDP06641.1|  unnamed protein product                                104   4e-25   
ref|XP_006413292.1|  hypothetical protein EUTSA_v10026532mg             103   4e-25   
ref|XP_004240732.1|  PREDICTED: actin-depolymerizing factor 7           103   4e-25   
ref|XP_007218573.1|  hypothetical protein PRUPE_ppa013105mg             103   5e-25   
ref|XP_004960504.1|  PREDICTED: actin-depolymerizing factor 7-like      103   5e-25   
ref|XP_002528457.1|  actin depolymerizing factor, putative              103   5e-25   
ref|XP_010908104.1|  PREDICTED: zinc finger CCHC domain-containin...    107   6e-25   
ref|NP_851228.1|  actin depolymerizing factor 4                         103   6e-25   
ref|XP_006363318.1|  PREDICTED: actin-depolymerizing factor 7-like      103   6e-25   
ref|XP_002509779.1|  actin depolymerizing factor, putative              103   6e-25   
ref|XP_006298765.1|  hypothetical protein CARUB_v10014867mg             103   6e-25   
ref|XP_009406977.1|  PREDICTED: actin-depolymerizing factor 2 iso...    103   6e-25   
ref|XP_009406976.1|  PREDICTED: actin-depolymerizing factor 7 iso...    103   6e-25   
ref|XP_002271495.1|  PREDICTED: actin-depolymerizing factor 10          103   7e-25   
ref|XP_009109200.1|  PREDICTED: actin-depolymerizing factor-like        103   7e-25   
gb|AAD09110.1|  actin depolymerizing factor 4                           103   7e-25   
ref|XP_011016059.1|  PREDICTED: actin-depolymerizing factor 2-like      103   7e-25   
ref|XP_006490391.1|  PREDICTED: actin-depolymerizing factor 7-like      103   7e-25   
ref|XP_006590852.1|  PREDICTED: actin-depolymerizing factor 9-like      103   7e-25   
ref|XP_010455715.1|  PREDICTED: actin-depolymerizing factor 4           103   7e-25   
ref|XP_009591841.1|  PREDICTED: actin-depolymerizing factor 2-like      102   7e-25   
ref|XP_010909358.1|  PREDICTED: actin-depolymerizing factor 7-like      103   7e-25   
ref|NP_001047657.1|  Os02g0663800                                       103   7e-25   
ref|XP_002872934.1|  hypothetical protein ARALYDRAFT_490501             103   8e-25   
emb|CDX88731.1|  BnaA03g09180D                                          104   8e-25   
ref|XP_009414703.1|  PREDICTED: actin-depolymerizing factor-like        103   8e-25   
ref|XP_009119731.1|  PREDICTED: actin-depolymerizing factor 10-like     103   9e-25   
ref|XP_003569002.1|  PREDICTED: actin-depolymerizing factor 7           103   9e-25   
emb|CDO96927.1|  unnamed protein product                                103   9e-25   
ref|XP_010467395.1|  PREDICTED: actin-depolymerizing factor 5           103   9e-25   
ref|XP_002867603.1|  actin binding protein                              102   9e-25   
ref|XP_008681563.1|  PREDICTED: actin-depolymerizing factor 5 iso...    103   1e-24   
emb|CDY15154.1|  BnaC05g00330D                                          103   1e-24   
ref|XP_009337572.1|  PREDICTED: actin-depolymerizing factor 1-like      102   1e-24   
gb|EYU37940.1|  hypothetical protein MIMGU_mgv1a015861mg                102   1e-24   
gb|EMT12807.1|  Actin-depolymerizing factor 7                           104   1e-24   
gb|KCW46430.1|  hypothetical protein EUGRSUZ_K00262                     102   1e-24   
ref|XP_002884011.1|  hypothetical protein ARALYDRAFT_480552             102   1e-24   
ref|XP_006418975.1|  hypothetical protein EUTSA_v10002704mg             102   1e-24   
ref|XP_002299887.1|  hypothetical protein POPTR_0001s24330g             102   1e-24   
ref|XP_009419950.1|  PREDICTED: actin-depolymerizing factor 4           102   1e-24   
ref|XP_003611106.1|  Actin depolymerizing factor                        102   1e-24   
gb|ABD66504.1|  actin depolymerizing factor 8                           102   1e-24   
ref|XP_004294586.1|  PREDICTED: actin-depolymerizing factor 2-lik...    102   1e-24   
ref|XP_006285474.1|  hypothetical protein CARUB_v10006893mg             102   1e-24   
ref|NP_171680.1|  actin depolymerizing factor 11                        102   1e-24   
ref|XP_009593022.1|  PREDICTED: actin-depolymerizing factor 2-like      102   1e-24   
ref|XP_002314195.1|  actin-depolymerizing factor family protein         102   1e-24   
ref|XP_002303579.1|  actin-depolymerizing factor family protein         102   1e-24   
ref|XP_011080987.1|  PREDICTED: actin-depolymerizing factor-like        102   1e-24   
ref|XP_006418976.1|  hypothetical protein EUTSA_v10002704mg             102   1e-24   
ref|XP_003524462.1|  PREDICTED: actin-depolymerizing factor 7-like      103   1e-24   
gb|ABX79380.1|  actin-depolymerizing factor                             102   2e-24   
ref|XP_006843087.1|  hypothetical protein AMTR_s00140p00036970          102   2e-24   
gb|KFK26837.1|  hypothetical protein AALP_AA8G300400                    102   2e-24   
ref|XP_004294585.1|  PREDICTED: actin-depolymerizing factor 2-lik...    102   2e-24   
ref|XP_010543331.1|  PREDICTED: actin-depolymerizing factor 1-like      102   2e-24   
ref|XP_009127248.1|  PREDICTED: actin-depolymerizing factor 12          102   2e-24   
ref|XP_010433613.1|  PREDICTED: actin-depolymerizing factor 7-like      102   2e-24   
ref|XP_002865909.1|  hypothetical protein ARALYDRAFT_495305             102   2e-24   
ref|XP_009384093.1|  PREDICTED: actin-depolymerizing factor 1           102   2e-24   
gb|KHN26651.1|  Actin-depolymerizing factor 7                           102   2e-24   
ref|XP_009357677.1|  PREDICTED: actin-depolymerizing factor 1           102   2e-24   
ref|XP_008343560.1|  PREDICTED: actin-depolymerizing factor 1           102   2e-24   
ref|XP_006400899.1|  hypothetical protein EUTSA_v10014975mg             102   2e-24   
gb|ACR38016.1|  unknown                                                 102   2e-24   
ref|XP_008442569.1|  PREDICTED: actin-depolymerizing factor 2-like      102   2e-24   
ref|NP_001053519.1|  Os04g0555700                                       102   2e-24   
ref|XP_011046393.1|  PREDICTED: actin-depolymerizing factor 5           102   2e-24   
sp|Q0DLA3.2|ADF7_ORYSJ  RecName: Full=Actin-depolymerizing factor...    102   2e-24   
ref|NP_001054456.1|  Os05g0113400                                       102   2e-24   
gb|EYU32098.1|  hypothetical protein MIMGU_mgv1a026462mg                102   2e-24   
ref|XP_009132530.1|  PREDICTED: actin-depolymerizing factor 12-like     102   2e-24   
ref|XP_010672167.1|  PREDICTED: actin-depolymerizing factor 10          102   2e-24   
gb|KDO72931.1|  hypothetical protein CISIN_1g032504mg                   101   2e-24   
ref|XP_009118832.1|  PREDICTED: actin-depolymerizing factor 10 is...    102   2e-24   
ref|NP_190187.1|  actin depolymerizing factor 1                         102   2e-24   
ref|XP_011042674.1|  PREDICTED: actin-depolymerizing factor 2-lik...    102   2e-24   
ref|XP_009131962.1|  PREDICTED: actin-depolymerizing factor 3           102   2e-24   
ref|XP_010031001.1|  PREDICTED: actin-depolymerizing factor 2-like      102   3e-24   
ref|XP_002314194.1|  actin-depolymerizing factor 3 family protein       101   3e-24   
ref|XP_007143417.1|  hypothetical protein PHAVU_007G070500g             101   3e-24   
ref|XP_010933328.1|  PREDICTED: actin-depolymerizing factor 5           101   3e-24   
ref|XP_004953378.1|  PREDICTED: actin-depolymerizing factor 1-like      101   3e-24   
ref|XP_010444761.1|  PREDICTED: actin-depolymerizing factor 12-like     101   3e-24   
gb|KHG18554.1|  Actin-depolymerizing factor                             101   3e-24   
ref|XP_006653969.1|  PREDICTED: actin-depolymerizing factor 7-like      101   3e-24   
ref|XP_006424771.1|  hypothetical protein CICLE_v10029538mg             101   3e-24   
ref|XP_006424770.1|  hypothetical protein CICLE_v10029538mg             101   3e-24   
ref|XP_010448409.1|  PREDICTED: actin-depolymerizing factor 7           101   3e-24   
emb|CDX88730.1|  BnaA03g09190D                                          102   3e-24   
emb|CDX71068.1|  BnaC03g11520D                                          102   4e-24   
ref|XP_011000294.1|  PREDICTED: actin-depolymerizing factor 2-like      101   4e-24   
ref|XP_007137353.1|  hypothetical protein PHAVU_009G120100g             101   4e-24   
gb|ADV04049.1|  actin depolymerizing factor 4                           101   4e-24   
ref|XP_010516461.1|  PREDICTED: actin-depolymerizing factor 5-like      101   4e-24   
ref|XP_009600590.1|  PREDICTED: actin-depolymerizing factor 2           101   4e-24   
ref|NP_001148445.1|  actin-depolymerizing factor                        101   4e-24   
ref|XP_010482597.1|  PREDICTED: actin-depolymerizing factor 12          101   4e-24   
ref|XP_009106793.1|  PREDICTED: actin-depolymerizing factor 7           101   5e-24   
gb|EYU18949.1|  hypothetical protein MIMGU_mgv1a015984mg                101   5e-24   
ref|XP_009382377.1|  PREDICTED: actin-depolymerizing factor 1-like      100   5e-24   
ref|XP_008371032.1|  PREDICTED: actin-depolymerizing factor 1           101   5e-24   
ref|XP_011092897.1|  PREDICTED: actin-depolymerizing factor 5-like      101   5e-24   
emb|CDX89737.1|  BnaC03g46510D                                          101   5e-24   
ref|XP_002284029.1|  PREDICTED: actin-depolymerizing factor 2-lik...    101   5e-24   
ref|XP_010442763.1|  PREDICTED: actin-depolymerizing factor 12-like     100   5e-24   
ref|XP_004236758.1|  PREDICTED: actin-depolymerizing factor 2           101   6e-24   
ref|XP_006365713.1|  PREDICTED: actin-depolymerizing factor 2-like      100   6e-24   
ref|XP_009770352.1|  PREDICTED: actin-depolymerizing factor 7           100   6e-24   
ref|XP_009150048.1|  PREDICTED: actin-depolymerizing factor 2           100   6e-24   
gb|AAL91667.1|  pollen specific actin-depolymerizing factor 2           100   6e-24   
ref|XP_006656880.1|  PREDICTED: actin-depolymerizing factor 6-like      100   7e-24   
ref|XP_011027144.1|  PREDICTED: actin-depolymerizing factor 1-like      100   7e-24   
ref|XP_004496563.1|  PREDICTED: actin-depolymerizing factor 7-like      100   8e-24   
ref|XP_002316301.1|  actin-depolymerizing factor family protein         100   8e-24   
gb|KFK30133.1|  hypothetical protein AALP_AA7G221300                    100   8e-24   
emb|CDY72027.1|  BnaCnng75650D                                        99.8    8e-24   
ref|XP_002465572.1|  hypothetical protein SORBIDRAFT_01g041340          100   9e-24   
gb|KHN19998.1|  Actin-depolymerizing factor 5                           100   9e-24   
gb|KGN57376.1|  hypothetical protein Csa_3G182120                       100   9e-24   
ref|XP_010910598.1|  PREDICTED: actin-depolymerizing factor             101   1e-23   
ref|XP_002299888.1|  actin-depolymerizing factor family protein         100   1e-23   
gb|KGN58886.1|  hypothetical protein Csa_3G734880                       100   1e-23   
ref|XP_006445079.1|  hypothetical protein CICLE_v10023747mg             100   1e-23   
ref|XP_010555668.1|  PREDICTED: actin-depolymerizing factor 7           100   1e-23   
ref|XP_004172071.1|  PREDICTED: actin-depolymerizing factor 1-like      100   1e-23   
ref|XP_006401834.1|  hypothetical protein EUTSA_v10014982mg             100   1e-23   
ref|XP_002869114.1|  actin binding protein                              100   1e-23   
emb|CBI40336.3|  unnamed protein product                                102   1e-23   
ref|XP_010690383.1|  PREDICTED: actin-depolymerizing factor 5           100   1e-23   
ref|XP_009397611.1|  PREDICTED: actin-depolymerizing factor 1-like      100   1e-23   
gb|EYU36258.1|  hypothetical protein MIMGU_mgv1a015971mg                100   1e-23   
gb|AFK48601.1|  unknown                                                 100   1e-23   
ref|NP_001151716.1|  LOC100285352                                       100   1e-23   
ref|XP_008780996.1|  PREDICTED: actin-depolymerizing factor 5           100   1e-23   
ref|XP_001777224.1|  predicted protein                                  100   1e-23   
ref|NP_001049525.1|  Os03g0243100                                       100   2e-23   
gb|AEW90956.1|  actin depolymerizing factor 4-2                       99.8    2e-23   
gb|AFK35836.1|  unknown                                               99.8    2e-23   
gb|KFK27529.1|  hypothetical protein AALP_AA8G395300                  99.8    2e-23   
tpg|DAA45969.1|  TPA: hypothetical protein ZEAMMB73_645058            99.4    2e-23   
emb|CAL25339.1|  actin-depolymerizing factor                          99.8    2e-23   
ref|XP_007038697.1|  Actin depolymerizing factor 7                    99.4    2e-23   
ref|XP_003570044.1|  PREDICTED: actin-depolymerizing factor 1         99.8    2e-23   
ref|NP_001167686.1|  actin-depolymerizing factor 5                    99.8    2e-23   
ref|XP_004985039.1|  PREDICTED: actin-depolymerizing factor 5-like    99.8    2e-23   
ref|XP_007027090.1|  Actin depolymerizing factor 4 isoform 2            100   2e-23   
ref|XP_004137944.1|  PREDICTED: actin-depolymerizing factor 2-like      100   2e-23   
ref|XP_010530891.1|  PREDICTED: actin-depolymerizing factor 5-like    99.4    2e-23   
gb|AAR23800.1|  putative actin-depolymerizing factor 2                99.4    2e-23   
ref|NP_195223.2|  actin depolymerizing factor 9                       99.4    2e-23   
ref|XP_009767736.1|  PREDICTED: actin-depolymerizing factor 7-lik...  99.4    2e-23   
ref|NP_001105474.1|  actin-depolymerizing factor 3                    99.4    3e-23   
ref|XP_009120511.1|  PREDICTED: actin-depolymerizing factor 3-like    99.4    3e-23   
ref|XP_011084418.1|  PREDICTED: actin-depolymerizing factor 7         99.4    3e-23   
ref|XP_007158489.1|  hypothetical protein PHAVU_002G156700g           99.4    3e-23   
ref|XP_009136320.1|  PREDICTED: actin-depolymerizing factor 5         99.4    3e-23   
ref|XP_002448300.1|  hypothetical protein SORBIDRAFT_06g024870        99.4    3e-23   
gb|KGN50293.1|  hypothetical protein Csa_5G165880                     99.0    3e-23   
ref|XP_010910431.1|  PREDICTED: actin-depolymerizing factor-like      99.0    3e-23   
ref|XP_009599636.1|  PREDICTED: actin-depolymerizing factor 7         99.0    3e-23   
ref|NP_001148898.1|  actin-depolymerizing factor                      99.0    3e-23   
emb|CDX92721.1|  BnaC07g39790D                                          100   3e-23   
emb|CDX99133.1|  BnaA06g18240D                                        99.8    3e-23   
gb|ABD66505.1|  actin depolymerizing factor 3                         99.0    3e-23   
ref|XP_006647644.1|  PREDICTED: actin-depolymerizing factor 1-like    99.0    4e-23   



>ref|XP_006420221.1| hypothetical protein CICLE_v10006173mg [Citrus clementina]
 gb|ESR33461.1| hypothetical protein CICLE_v10006173mg [Citrus clementina]
 gb|KDO57599.1| hypothetical protein CISIN_1g031876mg [Citrus sinensis]
 gb|KDO57600.1| hypothetical protein CISIN_1g031876mg [Citrus sinensis]
Length=143

 Score =   157 bits (396),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  154  MSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDF  333
            MS RG NASSGMGVADHSKSTY+ELQRKKVHRYVIFKIDEKKKEVVVEKTGGPAESYDDF
Sbjct  1    MSFRGTNASSGMGVADHSKSTYLELQRKKVHRYVIFKIDEKKKEVVVEKTGGPAESYDDF  60

Query  334  TASLPENDCRYAVYDFDFVTSENCQKSKI  420
            TASLP+NDCRYAVYDFDFVTSENCQKSKI
Sbjct  61   TASLPDNDCRYAVYDFDFVTSENCQKSKI  89



>ref|XP_002285175.1| PREDICTED: actin-depolymerizing factor [Vitis vinifera]
 emb|CBI23641.3| unnamed protein product [Vitis vinifera]
Length=143

 Score =   155 bits (392),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  154  MSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDF  333
            MS RG+NASSGMGVADH K+TY+ELQRKKVHRYVIFKIDEKKKEVVVEKTGGPAESYDDF
Sbjct  1    MSFRGSNASSGMGVADHCKATYLELQRKKVHRYVIFKIDEKKKEVVVEKTGGPAESYDDF  60

Query  334  TASLPENDCRYAVYDFDFVTSENCQKSKI  420
            TASLPENDCRYA+YDFDFVTSENCQKSKI
Sbjct  61   TASLPENDCRYAIYDFDFVTSENCQKSKI  89



>ref|XP_006489736.1| PREDICTED: actin-depolymerizing factor-like [Citrus sinensis]
Length=143

 Score =   155 bits (392),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  154  MSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDF  333
            MS RG NASSGMGVADHSKSTY+ELQRKKVHRYVIFKIDEKKKEVVVEKTGGPAESY+DF
Sbjct  1    MSFRGTNASSGMGVADHSKSTYLELQRKKVHRYVIFKIDEKKKEVVVEKTGGPAESYEDF  60

Query  334  TASLPENDCRYAVYDFDFVTSENCQKSKI  420
            TASLP+NDCRYAVYDFDFVTSENCQKSKI
Sbjct  61   TASLPDNDCRYAVYDFDFVTSENCQKSKI  89



>ref|XP_007035112.1| Actin depolymerizing factor 6 [Theobroma cacao]
 gb|EOY06038.1| Actin depolymerizing factor 6 [Theobroma cacao]
Length=143

 Score =   153 bits (387),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  154  MSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDF  333
            M+ R ANASSGMGVA+HSKSTYMELQRKKV RYVIFKIDEKK EVVVEKTGGPAESYDDF
Sbjct  1    MAFRRANASSGMGVAEHSKSTYMELQRKKVFRYVIFKIDEKKNEVVVEKTGGPAESYDDF  60

Query  334  TASLPENDCRYAVYDFDFVTSENCQKSKI  420
            TAS+PENDCRYAVYDFDFVTSENCQKSKI
Sbjct  61   TASMPENDCRYAVYDFDFVTSENCQKSKI  89



>ref|XP_010023948.1| PREDICTED: actin-depolymerizing factor [Eucalyptus grandis]
 gb|KCW60341.1| hypothetical protein EUGRSUZ_H03058 [Eucalyptus grandis]
Length=143

 Score =   152 bits (384),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  154  MSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDF  333
            MS RG+NASSGMGVA+HSK+TY+ELQRKKVHRYVIFKIDEKKKEVVVEKTGGPAESY+DF
Sbjct  1    MSFRGSNASSGMGVAEHSKTTYLELQRKKVHRYVIFKIDEKKKEVVVEKTGGPAESYEDF  60

Query  334  TASLPENDCRYAVYDFDFVTSENCQKSKI  420
            T++LPENDCRYAVYDFDFVT+ENCQKSKI
Sbjct  61   TSALPENDCRYAVYDFDFVTAENCQKSKI  89



>ref|XP_009776477.1| PREDICTED: actin-depolymerizing factor [Nicotiana sylvestris]
Length=146

 Score =   152 bits (384),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 79/85 (93%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +1

Query  166  GANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASL  345
            G NASSGMG+ADHSK+TYMELQRKKVHRYVIFKIDEKK EVVVEKTGGPAESYDDFTA+L
Sbjct  8    GTNASSGMGIADHSKATYMELQRKKVHRYVIFKIDEKKNEVVVEKTGGPAESYDDFTAAL  67

Query  346  PENDCRYAVYDFDFVTSENCQKSKI  420
            PENDCRYAVYD+DFVTSENCQKSKI
Sbjct  68   PENDCRYAVYDYDFVTSENCQKSKI  92



>ref|NP_001268119.1| actin-depolymerizing factor [Vitis vinifera]
 sp|Q8SAG3.1|ADF_VITVI RecName: Full=Actin-depolymerizing factor; Short=ADF [Vitis vinifera]
 gb|AAL79826.1|AF440310_1 actin depolymerizing factor [Vitis vinifera]
Length=143

 Score =   149 bits (375),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  154  MSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDF  333
            MS RG NASSGMGVADHSK+T++EL+RKKVHRYVIFKIDEKKKEVVVEKTGGPAES+D+F
Sbjct  1    MSFRGLNASSGMGVADHSKNTFLELKRKKVHRYVIFKIDEKKKEVVVEKTGGPAESFDEF  60

Query  334  TASLPENDCRYAVYDFDFVTSENCQKSKI  420
             A+LPENDCRYAVYDFDFVTSENCQKSKI
Sbjct  61   AAALPENDCRYAVYDFDFVTSENCQKSKI  89



>ref|XP_009603156.1| PREDICTED: actin-depolymerizing factor [Nicotiana tomentosiformis]
Length=146

 Score =   148 bits (374),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +1

Query  166  GANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASL  345
            G NASSGMGVAD SK+TYMELQRKKVHRYVIFKIDEK  EVVVEKTGGP ESYDDFTA+L
Sbjct  8    GTNASSGMGVADQSKATYMELQRKKVHRYVIFKIDEKNNEVVVEKTGGPTESYDDFTAAL  67

Query  346  PENDCRYAVYDFDFVTSENCQKSKI  420
            PENDCRYAVYD+DFVTSENCQKSKI
Sbjct  68   PENDCRYAVYDYDFVTSENCQKSKI  92



>gb|KDO57601.1| hypothetical protein CISIN_1g031876mg [Citrus sinensis]
Length=151

 Score =   148 bits (374),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/83 (98%), Positives = 83/83 (100%), Gaps = 0/83 (0%)
 Frame = +1

Query  172  NASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPE  351
            NASSGMGVADHSKSTY+ELQRKKVHRYVIFKIDEKKKEVVVEKTGGPAESYDDFTASLP+
Sbjct  15   NASSGMGVADHSKSTYLELQRKKVHRYVIFKIDEKKKEVVVEKTGGPAESYDDFTASLPD  74

Query  352  NDCRYAVYDFDFVTSENCQKSKI  420
            NDCRYAVYDFDFVTSENCQKSKI
Sbjct  75   NDCRYAVYDFDFVTSENCQKSKI  97



>ref|XP_004247731.1| PREDICTED: actin-depolymerizing factor-like [Solanum lycopersicum]
Length=145

 Score =   148 bits (373),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +1

Query  163  RGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTAS  342
            RG NASSGMGVAD SK+TYMELQRKKVHRYVIF IDEKK EVVVEKTGGPAESYDDFTA+
Sbjct  6    RGTNASSGMGVADQSKATYMELQRKKVHRYVIFMIDEKKNEVVVEKTGGPAESYDDFTAA  65

Query  343  LPENDCRYAVYDFDFVTSENCQKSKI  420
            LPENDCRYAVYD+DFVTS+NCQKSKI
Sbjct  66   LPENDCRYAVYDYDFVTSDNCQKSKI  91



>gb|AFK34925.1| unknown [Lotus japonicus]
Length=146

 Score =   147 bits (372),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/92 (87%), Positives = 87/92 (95%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRG---ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            MS RG   ANASSGMGVADHSK+T+MEL++KKVHRYVIFK+DEKK+EVVVEKTGGPAESY
Sbjct  1    MSFRGFGRANASSGMGVADHSKNTFMELEQKKVHRYVIFKVDEKKREVVVEKTGGPAESY  60

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            DDF ASLPENDCRYAV+DFDFVTSENCQKSKI
Sbjct  61   DDFAASLPENDCRYAVFDFDFVTSENCQKSKI  92



>gb|ABD66506.1| actin depolymerizing factor 4 [Gossypium hirsutum]
Length=143

 Score =   147 bits (371),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +1

Query  154  MSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDF  333
            MS RG NASSGMGVA+HSKSTY+ELQRKKV RYVIFKIDEKKKEV+VEK GGP ESYDDF
Sbjct  1    MSFRGGNASSGMGVAEHSKSTYLELQRKKVFRYVIFKIDEKKKEVIVEKIGGPTESYDDF  60

Query  334  TASLPENDCRYAVYDFDFVTSENCQKSKI  420
             ASLPE+DCRYAVYDFDFVTSENCQKSKI
Sbjct  61   AASLPESDCRYAVYDFDFVTSENCQKSKI  89



>gb|AFK34162.1| unknown [Lotus japonicus]
Length=146

 Score =   147 bits (371),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 80/92 (87%), Positives = 87/92 (95%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRG---ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            MS RG   ANASSGMGVADHSK+T+MEL++KKVHRYVIFK+DEKK+EVVVEKTGGPAESY
Sbjct  1    MSFRGFGRANASSGMGVADHSKNTFMELKQKKVHRYVIFKVDEKKREVVVEKTGGPAESY  60

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            DDF ASLPENDCRYAV+DFDFVTSENCQKSKI
Sbjct  61   DDFAASLPENDCRYAVFDFDFVTSENCQKSKI  92



>ref|XP_002300779.1| actin-depolymerizing factor 6 family protein [Populus trichocarpa]
 ref|XP_011028797.1| PREDICTED: actin-depolymerizing factor [Populus euphratica]
 gb|ABK93374.1| unknown [Populus trichocarpa]
 gb|ABK94244.1| unknown [Populus trichocarpa]
 gb|EEE80052.1| actin-depolymerizing factor 6 family protein [Populus trichocarpa]
Length=146

 Score =   147 bits (371),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 83/92 (90%), Positives = 86/92 (93%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRGA---NASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            MS RGA   NASSGMGVADHSK  ++ELQRKKVHRYVIFKIDEKKKEVVVEKTGGPAESY
Sbjct  1    MSFRGASRPNASSGMGVADHSKIAFVELQRKKVHRYVIFKIDEKKKEVVVEKTGGPAESY  60

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            +DFTASLPENDCRYAVYDFDFVTSENCQKSKI
Sbjct  61   EDFTASLPENDCRYAVYDFDFVTSENCQKSKI  92



>ref|XP_010262315.1| PREDICTED: actin-depolymerizing factor [Nelumbo nucifera]
Length=145

 Score =   146 bits (369),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/85 (92%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +1

Query  166  GANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASL  345
            GANASSGMGVADHS++T++EL+RKKVHRYVIFKIDEKKKEVVVEKTGGPAESYDDF A+L
Sbjct  7    GANASSGMGVADHSRNTFLELKRKKVHRYVIFKIDEKKKEVVVEKTGGPAESYDDFIAAL  66

Query  346  PENDCRYAVYDFDFVTSENCQKSKI  420
            PENDCRYAVYDFDFVTSENCQKSKI
Sbjct  67   PENDCRYAVYDFDFVTSENCQKSKI  91



>ref|NP_001275618.1| actin-depolymerizing factor-like [Solanum tuberosum]
 dbj|BAC23034.1| actin depolymerizing factor 6 [Solanum tuberosum]
Length=145

 Score =   146 bits (368),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +1

Query  163  RGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTAS  342
            RG NASSGMGVAD SK+TYMELQRKKVHRYVIF IDEKK EVVVEKTGGPAESYDDFTA+
Sbjct  6    RGTNASSGMGVADQSKATYMELQRKKVHRYVIFMIDEKKNEVVVEKTGGPAESYDDFTAA  65

Query  343  LPENDCRYAVYDFDFVTSENCQKSKI  420
            LPENDCRYAVYD+DFVT +NCQKSKI
Sbjct  66   LPENDCRYAVYDYDFVTPDNCQKSKI  91



>emb|CDO99231.1| unnamed protein product [Coffea canephora]
Length=150

 Score =   146 bits (368),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +1

Query  160  SRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTA  339
            S+G NASSGMGVA+H KSTY+ELQRKKVHRYVIFKIDE KKEVVVEKTG P+ESY+DFTA
Sbjct  10   SKGPNASSGMGVAEHCKSTYLELQRKKVHRYVIFKIDEMKKEVVVEKTGSPSESYEDFTA  69

Query  340  SLPENDCRYAVYDFDFVTSENCQKSKI  420
            SLPENDCRYAVYDFD+VT+ENCQKSKI
Sbjct  70   SLPENDCRYAVYDFDYVTAENCQKSKI  96



>ref|XP_010111917.1| Actin-depolymerizing factor 6 [Morus notabilis]
 gb|EXC31951.1| Actin-depolymerizing factor 6 [Morus notabilis]
Length=140

 Score =   145 bits (367),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/83 (89%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = +1

Query  172  NASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPE  351
            NASSGMGVADH K+ +MELQRKKVHRYVIFK+DEKK+E++VEKTGGPAESYDDFTA+LPE
Sbjct  4    NASSGMGVADHGKNAFMELQRKKVHRYVIFKVDEKKREILVEKTGGPAESYDDFTAALPE  63

Query  352  NDCRYAVYDFDFVTSENCQKSKI  420
            NDCRYAVYDFDFVTSENCQKSKI
Sbjct  64   NDCRYAVYDFDFVTSENCQKSKI  86



>ref|XP_006846833.1| hypothetical protein AMTR_s00148p00101540 [Amborella trichopoda]
 gb|ERN08414.1| hypothetical protein AMTR_s00148p00101540 [Amborella trichopoda]
Length=143

 Score =   145 bits (367),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/89 (88%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  154  MSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDF  333
            MS R +NASSGMGVADH   T++EL+RKKVHRYVIFKIDEKKKEVVVEKTGGPAESYDDF
Sbjct  1    MSFRSSNASSGMGVADHCMHTFLELKRKKVHRYVIFKIDEKKKEVVVEKTGGPAESYDDF  60

Query  334  TASLPENDCRYAVYDFDFVTSENCQKSKI  420
            TA+LPENDCRYA+YDFDFVTSENCQKSKI
Sbjct  61   TAALPENDCRYAIYDFDFVTSENCQKSKI  89



>ref|XP_007223711.1| hypothetical protein PRUPE_ppa013034mg [Prunus persica]
 ref|XP_008224358.1| PREDICTED: actin-depolymerizing factor [Prunus mume]
 gb|EMJ24910.1| hypothetical protein PRUPE_ppa013034mg [Prunus persica]
Length=143

 Score =   145 bits (366),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  154  MSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDF  333
            M+ RG NASSGMGVA+H K+T++ELQRKK +RYVIFKIDEKKKEVVVEKTGGPAESYDDF
Sbjct  1    MAFRGGNASSGMGVAEHCKNTFLELQRKKAYRYVIFKIDEKKKEVVVEKTGGPAESYDDF  60

Query  334  TASLPENDCRYAVYDFDFVTSENCQKSKI  420
            TAS+PENDCRYA+YDFDFVTSENCQKSKI
Sbjct  61   TASMPENDCRYAIYDFDFVTSENCQKSKI  89



>gb|ACH63222.1| actin depolymerizing factor [Rheum australe]
Length=143

 Score =   145 bits (365),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  154  MSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDF  333
            MS RG+NA SGMGVA+HS  T+MEL+RKKVHRYVIFKIDEKK+EVVVEKTGGPAESY+DF
Sbjct  1    MSFRGSNALSGMGVAEHSLDTFMELKRKKVHRYVIFKIDEKKREVVVEKTGGPAESYEDF  60

Query  334  TASLPENDCRYAVYDFDFVTSENCQKSKI  420
             ++LPENDCRYAVYDFDFVTSENCQKSKI
Sbjct  61   ASALPENDCRYAVYDFDFVTSENCQKSKI  89



>ref|XP_006351677.1| PREDICTED: actin-depolymerizing factor-like [Solanum tuberosum]
Length=145

 Score =   144 bits (364),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 76/86 (88%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +1

Query  163  RGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTAS  342
            RG NASSGMGVADH K+ ++EL+RKKVHRYVIFKIDE KKEVVVEKTG PAES+DDFTAS
Sbjct  6    RGPNASSGMGVADHGKNAFLELKRKKVHRYVIFKIDEMKKEVVVEKTGSPAESFDDFTAS  65

Query  343  LPENDCRYAVYDFDFVTSENCQKSKI  420
            LPENDCRYAVYDFDFVTSENCQKSKI
Sbjct  66   LPENDCRYAVYDFDFVTSENCQKSKI  91



>ref|XP_007050307.1| Actin depolymerizing factor 6 isoform 1 [Theobroma cacao]
 ref|XP_007050308.1| Actin depolymerizing factor 6 isoform 1 [Theobroma cacao]
 gb|EOX94464.1| Actin depolymerizing factor 6 isoform 1 [Theobroma cacao]
 gb|EOX94465.1| Actin depolymerizing factor 6 isoform 1 [Theobroma cacao]
Length=146

 Score =   144 bits (364),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 85/92 (92%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRG---ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            MS RG    NA+SGMGVADHSK T++EL+RKKV+RYVIFKIDEKK+EVVVEKTGGP ESY
Sbjct  1    MSFRGLSRPNATSGMGVADHSKDTFLELKRKKVYRYVIFKIDEKKREVVVEKTGGPVESY  60

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            DDFTASLPENDCRYAVYDFDFVTSENCQKSKI
Sbjct  61   DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  92



>ref|XP_010274770.1| PREDICTED: actin-depolymerizing factor-like [Nelumbo nucifera]
Length=144

 Score =   144 bits (363),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 86/90 (96%), Gaps = 1/90 (1%)
 Frame = +1

Query  154  MSSRG-ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDD  330
            MS RG  NASSGMGVADHSKST++EL+RKK++RYVIFKIDEKKKEVVVEKTGGPAESYDD
Sbjct  1    MSFRGGVNASSGMGVADHSKSTFLELKRKKIYRYVIFKIDEKKKEVVVEKTGGPAESYDD  60

Query  331  FTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            F A+LPENDCRYAVYDFDFVTSENCQKSKI
Sbjct  61   FAAALPENDCRYAVYDFDFVTSENCQKSKI  90



>gb|AAD23407.1| actin depolymerizing factor [Populus tremula x Populus alba]
Length=138

 Score =   143 bits (360),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/83 (94%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = +1

Query  172  NASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPE  351
            NASSGMGVADHSK  ++ELQRKKVHRYVIFKIDEKKKEVVVEKTGGPAESY+DFTASLPE
Sbjct  2    NASSGMGVADHSKIAFVELQRKKVHRYVIFKIDEKKKEVVVEKTGGPAESYEDFTASLPE  61

Query  352  NDCRYAVYDFDFVTSENCQKSKI  420
            NDCRYAVYDFDFVTSENCQKSKI
Sbjct  62   NDCRYAVYDFDFVTSENCQKSKI  84



>ref|XP_009773774.1| PREDICTED: actin-depolymerizing factor [Nicotiana sylvestris]
Length=145

 Score =   143 bits (361),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +1

Query  163  RGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTAS  342
            RG NASSGMGVADH K+ ++EL+RKKVHRYVIFKIDEKKKEV+VEKTG PAE++DDFTAS
Sbjct  6    RGPNASSGMGVADHGKNAFLELKRKKVHRYVIFKIDEKKKEVIVEKTGSPAENFDDFTAS  65

Query  343  LPENDCRYAVYDFDFVTSENCQKSKI  420
            LPENDCRYAVYDFDFVTSENCQKSKI
Sbjct  66   LPENDCRYAVYDFDFVTSENCQKSKI  91



>ref|NP_001239657.1| uncharacterized protein LOC100819975 [Glycine max]
 gb|ACU19431.1| unknown [Glycine max]
 gb|KHN10737.1| Actin-depolymerizing factor 6 [Glycine soja]
Length=146

 Score =   143 bits (360),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 86/92 (93%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRG---ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            MS RG    NA+SGMGVADHSK+T+MEL++KKVHRYVIFK+DEKK+EVVVEKTGGPAESY
Sbjct  1    MSFRGLSRPNATSGMGVADHSKNTFMELKQKKVHRYVIFKVDEKKREVVVEKTGGPAESY  60

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            DDF ASLPENDCRYAV+D+DFVTSENCQKSKI
Sbjct  61   DDFAASLPENDCRYAVFDYDFVTSENCQKSKI  92



>ref|XP_003527696.1| PREDICTED: actin-depolymerizing factor-like [Glycine max]
Length=142

 Score =   142 bits (359),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
             NASSG+GVA+HS +T++ELQRKKVHRYVIFKIDEKKKEV+VEKTGGPAESYDDFTASLP
Sbjct  5    GNASSGIGVAEHSVNTFLELQRKKVHRYVIFKIDEKKKEVIVEKTGGPAESYDDFTASLP  64

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            ENDCRYAV+DFDFVTSENCQKSKI
Sbjct  65   ENDCRYAVFDFDFVTSENCQKSKI  88



>ref|XP_002879310.1| hypothetical protein ARALYDRAFT_902145 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55569.1| hypothetical protein ARALYDRAFT_902145 [Arabidopsis lyrata subsp. 
lyrata]
Length=146

 Score =   142 bits (359),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 82/92 (89%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRG---ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            MS RG    NA+SGMGVAD SK+T++ELQRKK HRYV+FKIDE KK+VVVEKTG PAESY
Sbjct  1    MSFRGLSRPNATSGMGVADQSKTTFLELQRKKTHRYVVFKIDESKKQVVVEKTGNPAESY  60

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            DDF ASLPENDCRYAVYDFDFVTSENCQKSKI
Sbjct  61   DDFLASLPENDCRYAVYDFDFVTSENCQKSKI  92



>ref|XP_011091316.1| PREDICTED: actin-depolymerizing factor [Sesamum indicum]
Length=145

 Score =   142 bits (359),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/85 (92%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +1

Query  166  GANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASL  345
            G NASSGMGVAD SK+TYMELQRKKV RYVIFKIDEKKKEVVVEKTG PAE+YDDFTASL
Sbjct  7    GTNASSGMGVADQSKTTYMELQRKKVFRYVIFKIDEKKKEVVVEKTGSPAENYDDFTASL  66

Query  346  PENDCRYAVYDFDFVTSENCQKSKI  420
            PENDCRYAVYDFD+VTSENCQKSKI
Sbjct  67   PENDCRYAVYDFDYVTSENCQKSKI  91



>ref|XP_004247519.1| PREDICTED: actin-depolymerizing factor [Solanum lycopersicum]
Length=145

 Score =   142 bits (359),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/86 (88%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +1

Query  163  RGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTAS  342
            RG NASSGMGVADH K+ ++EL+RKKVHRYVIFKIDEKKKEVVVEKTG PAE++DDFTAS
Sbjct  6    RGPNASSGMGVADHGKNAFLELKRKKVHRYVIFKIDEKKKEVVVEKTGSPAETFDDFTAS  65

Query  343  LPENDCRYAVYDFDFVTSENCQKSKI  420
            LPENDCRYAVYDFDFVTSENCQKSKI
Sbjct  66   LPENDCRYAVYDFDFVTSENCQKSKI  91



>gb|ADB85088.1| actin-depolymerizing factor 6 [Jatropha curcas]
 gb|KDP26540.1| hypothetical protein JCGZ_17698 [Jatropha curcas]
Length=146

 Score =   142 bits (358),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 85/92 (92%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRG---ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            MS RG    NA+SGMGVADHS +T++ELQRKKVHRYV+F+IDEKKKEVVVEKTGGPAESY
Sbjct  1    MSFRGLSRPNATSGMGVADHSINTFLELQRKKVHRYVVFRIDEKKKEVVVEKTGGPAESY  60

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            +DF ASLPENDCRYAVYDFDFVTSENCQKSKI
Sbjct  61   EDFAASLPENDCRYAVYDFDFVTSENCQKSKI  92



>gb|KHN22266.1| Actin-depolymerizing factor 6, partial [Glycine soja]
Length=137

 Score =   141 bits (356),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/83 (89%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +1

Query  172  NASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPE  351
            NASSG+GV++HS +T++ELQRKKVHRYVIFKIDEKKKEV+VEKTGGPAESYDDFTASLPE
Sbjct  1    NASSGIGVSEHSVNTFLELQRKKVHRYVIFKIDEKKKEVIVEKTGGPAESYDDFTASLPE  60

Query  352  NDCRYAVYDFDFVTSENCQKSKI  420
            NDCRYAV+DFDFVTSENCQKSKI
Sbjct  61   NDCRYAVFDFDFVTSENCQKSKI  83



>gb|KHG26345.1| Actin-depolymerizing factor [Gossypium arboreum]
Length=155

 Score =   142 bits (357),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
             NASSGMGVA+HSKSTY+ELQRKKV RYVIFKIDEKKKEV+VEKTGGP ESYDDF ASLP
Sbjct  18   GNASSGMGVAEHSKSTYLELQRKKVFRYVIFKIDEKKKEVIVEKTGGPTESYDDFAASLP  77

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            E+DCRYAVYDFDFVTSENCQKSKI
Sbjct  78   ESDCRYAVYDFDFVTSENCQKSKI  101



>ref|XP_009392104.1| PREDICTED: actin-depolymerizing factor [Musa acuminata subsp. 
malaccensis]
Length=143

 Score =   141 bits (355),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +1

Query  154  MSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDF  333
            MS R +NASSGMGV +HSKST++ELQRKKVHRYVIFKIDEKKKEVVVEKTG P ESYDDF
Sbjct  1    MSFRTSNASSGMGVDEHSKSTFLELQRKKVHRYVIFKIDEKKKEVVVEKTGAPGESYDDF  60

Query  334  TASLPENDCRYAVYDFDFVTSENCQKSKI  420
            TA+LPENDCRYA+YDFD+VT +NCQKSKI
Sbjct  61   TAALPENDCRYAIYDFDYVTEDNCQKSKI  89



>ref|XP_002524620.1| actin depolymerizing factor, putative [Ricinus communis]
 gb|EEF37828.1| actin depolymerizing factor, putative [Ricinus communis]
Length=146

 Score =   141 bits (355),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 85/92 (92%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRG---ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            MS RG    NA+SGMGVADHS +T++ELQRKKVHRYV+FKIDEKKKEVVVEKTGGPAESY
Sbjct  1    MSFRGISRPNATSGMGVADHSINTFLELQRKKVHRYVVFKIDEKKKEVVVEKTGGPAESY  60

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            +DF ASLP+NDCRYAVYDFDFVTSENCQKSKI
Sbjct  61   EDFAASLPDNDCRYAVYDFDFVTSENCQKSKI  92



>ref|XP_002307641.2| hypothetical protein POPTR_0005s24520g [Populus trichocarpa]
 gb|EEE94637.2| hypothetical protein POPTR_0005s24520g [Populus trichocarpa]
Length=146

 Score =   141 bits (355),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 84/92 (91%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRGA---NASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            M+ RGA   NASSGMGVADHSK+T++ELQRKK HRYVIFKI+EKK EVVVEKTG PAESY
Sbjct  1    MNFRGASRANASSGMGVADHSKNTFIELQRKKAHRYVIFKIEEKKMEVVVEKTGEPAESY  60

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            +DF ASLP+NDCRYAVYDFDFVTSENCQKSKI
Sbjct  61   EDFAASLPDNDCRYAVYDFDFVTSENCQKSKI  92



>ref|XP_010906534.1| PREDICTED: actin-depolymerizing factor [Elaeis guineensis]
 ref|XP_010906535.1| PREDICTED: actin-depolymerizing factor [Elaeis guineensis]
 ref|XP_010906536.1| PREDICTED: actin-depolymerizing factor [Elaeis guineensis]
Length=143

 Score =   140 bits (354),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +1

Query  154  MSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDF  333
            MS R ++ASSGMGVADHSK+T++EL+RKKVHRYVIFKIDEKKKEVVVEKTG P ESYDDF
Sbjct  1    MSFRMSSASSGMGVADHSKNTFLELKRKKVHRYVIFKIDEKKKEVVVEKTGAPGESYDDF  60

Query  334  TASLPENDCRYAVYDFDFVTSENCQKSKI  420
             A+LPENDCRYAVYDFDFVT ENCQKSKI
Sbjct  61   AAALPENDCRYAVYDFDFVTDENCQKSKI  89



>emb|CBI37111.3| unnamed protein product [Vitis vinifera]
Length=166

 Score =   141 bits (356),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/83 (90%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +1

Query  172  NASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPE  351
            NASSGMGVADHSK+T++EL+RKKVHRYVIFKIDEKKKEVVVEKTGGPAES+D+F A+LPE
Sbjct  30   NASSGMGVADHSKNTFLELKRKKVHRYVIFKIDEKKKEVVVEKTGGPAESFDEFAAALPE  89

Query  352  NDCRYAVYDFDFVTSENCQKSKI  420
            NDCRYAVYDFDFVTSENCQKSKI
Sbjct  90   NDCRYAVYDFDFVTSENCQKSKI  112



>ref|XP_009624038.1| PREDICTED: actin-depolymerizing factor [Nicotiana tomentosiformis]
Length=145

 Score =   140 bits (354),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +1

Query  163  RGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTAS  342
            RG NAS GMGVADH K+ ++EL+RKKVHRYVIFKIDEKKKEV+VEKTG PAE++DDFTAS
Sbjct  6    RGPNASFGMGVADHGKNAFLELKRKKVHRYVIFKIDEKKKEVIVEKTGSPAENFDDFTAS  65

Query  343  LPENDCRYAVYDFDFVTSENCQKSKI  420
            LPENDCRYAVYDFDFVTSENCQKSKI
Sbjct  66   LPENDCRYAVYDFDFVTSENCQKSKI  91



>ref|XP_006443848.1| hypothetical protein CICLE_v10022720mg [Citrus clementina]
 ref|XP_006479548.1| PREDICTED: actin-depolymerizing factor-like [Citrus sinensis]
 gb|ESR57088.1| hypothetical protein CICLE_v10022720mg [Citrus clementina]
 gb|KDO60510.1| hypothetical protein CISIN_1g032158mg [Citrus sinensis]
Length=146

 Score =   140 bits (354),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 84/92 (91%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRG---ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            MS RG    NA+SGMGVADHSK+ + ELQRKKVHRYVIFKIDEKKKEVVVEKTGGPAESY
Sbjct  1    MSFRGLSRPNATSGMGVADHSKNAFTELQRKKVHRYVIFKIDEKKKEVVVEKTGGPAESY  60

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            +DF A+LPENDCRYAVYDFD+VTSENCQKSKI
Sbjct  61   EDFAAALPENDCRYAVYDFDYVTSENCQKSKI  92



>ref|XP_010542738.1| PREDICTED: actin-depolymerizing factor 6-like [Tarenaya hassleriana]
Length=146

 Score =   140 bits (354),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 84/92 (91%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRG---ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            MS RG    NASSGMGV+DHSKST+ ELQRKKVHR+V+FKIDEKKKEVVVEKTG PAESY
Sbjct  1    MSFRGLSRPNASSGMGVSDHSKSTFQELQRKKVHRFVVFKIDEKKKEVVVEKTGRPAESY  60

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            DDF ASLPENDCRYAVYDFDFVTSENC+KSKI
Sbjct  61   DDFLASLPENDCRYAVYDFDFVTSENCRKSKI  92



>gb|EYU18328.1| hypothetical protein MIMGU_mgv1a015772mg [Erythranthe guttata]
Length=146

 Score =   140 bits (353),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +1

Query  166  GANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASL  345
            G NASSGMGVAD S  TY ELQRKKVHRYVIFKIDEKKKEVVVEKTGGPAESY+DFTASL
Sbjct  8    GTNASSGMGVADQSNITYTELQRKKVHRYVIFKIDEKKKEVVVEKTGGPAESYEDFTASL  67

Query  346  PENDCRYAVYDFDFVTSENCQKSKI  420
            PE+DCRYAVYDFD+VTSENCQKSKI
Sbjct  68   PESDCRYAVYDFDYVTSENCQKSKI  92



>ref|XP_007162541.1| hypothetical protein PHAVU_001G160700g [Phaseolus vulgaris]
 gb|ESW34535.1| hypothetical protein PHAVU_001G160700g [Phaseolus vulgaris]
Length=146

 Score =   140 bits (352),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 84/92 (91%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRG---ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            MS RG    NASSGMGVAD SK+T+MEL++KKVHRYVIFK+DEKK+EVVVEK GGPAESY
Sbjct  1    MSFRGLSRPNASSGMGVADDSKNTFMELKQKKVHRYVIFKVDEKKREVVVEKIGGPAESY  60

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            DDF ASLPENDCRYAV+DFDFVTSENCQKSKI
Sbjct  61   DDFAASLPENDCRYAVFDFDFVTSENCQKSKI  92



>ref|XP_004296366.1| PREDICTED: actin-depolymerizing factor 2-like [Fragaria vesca 
subsp. vesca]
Length=143

 Score =   140 bits (352),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  154  MSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDF  333
            M+ RG NASSGMGVA+  +ST++ELQRKK  RYV+FKIDEKKKEVVVEKTG PAESYDDF
Sbjct  1    MAFRGGNASSGMGVAEDCRSTFLELQRKKAFRYVVFKIDEKKKEVVVEKTGSPAESYDDF  60

Query  334  TASLPENDCRYAVYDFDFVTSENCQKSKI  420
            TASLPENDCRYA+YDFDFVTSENCQKSKI
Sbjct  61   TASLPENDCRYAIYDFDFVTSENCQKSKI  89



>ref|XP_008787346.1| PREDICTED: actin-depolymerizing factor-like isoform X1 [Phoenix 
dactylifera]
Length=149

 Score =   140 bits (352),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +1

Query  145  QKQMSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            QK +    +NA+SGMGVADH K T++ELQRKK HRYVIFKIDEK+KEVVV+KTGG  ESY
Sbjct  4    QKLIVLLKSNATSGMGVADHCKDTFLELQRKKTHRYVIFKIDEKRKEVVVDKTGGATESY  63

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            DDFTASLPENDCRYA+YDFDFVT ENCQKSKI
Sbjct  64   DDFTASLPENDCRYAIYDFDFVTDENCQKSKI  95



>gb|KEH42769.1| cofilin/actin-depolymerizing factor-like protein [Medicago truncatula]
Length=147

 Score =   140 bits (352),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 76/90 (84%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  QMSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDD  330
            +M   G NASSGMGVA+ S ST+ ELQRKKV+RYVIFKIDEKKKEVVVEKTGGP+ESYDD
Sbjct  4    RMGVGGGNASSGMGVAEQSVSTFQELQRKKVYRYVIFKIDEKKKEVVVEKTGGPSESYDD  63

Query  331  FTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            FTASLPENDCRYAV+DFDFVT+ENCQKSKI
Sbjct  64   FTASLPENDCRYAVFDFDFVTAENCQKSKI  93



>ref|XP_008807637.1| PREDICTED: actin-depolymerizing factor [Phoenix dactylifera]
Length=143

 Score =   140 bits (352),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +1

Query  154  MSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDF  333
            MS R ++ASSGMGVADHS++T++EL+RKKVHRYVIFKIDEKKKEVVVEKTG P ESYDDF
Sbjct  1    MSFRMSSASSGMGVADHSRTTFLELKRKKVHRYVIFKIDEKKKEVVVEKTGAPGESYDDF  60

Query  334  TASLPENDCRYAVYDFDFVTSENCQKSKI  420
             A+LPENDCRYA+YDFDFVT ENCQKSKI
Sbjct  61   AAALPENDCRYAIYDFDFVTDENCQKSKI  89



>ref|XP_010935897.1| PREDICTED: actin-depolymerizing factor-like [Elaeis guineensis]
Length=143

 Score =   139 bits (351),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +1

Query  154  MSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDF  333
            MS R ++ASSGMGVA+HSK+T++EL+RKKVHRYVIFKIDEKKKEVVVEKTG P ESYDDF
Sbjct  1    MSFRMSSASSGMGVAEHSKNTFLELKRKKVHRYVIFKIDEKKKEVVVEKTGAPGESYDDF  60

Query  334  TASLPENDCRYAVYDFDFVTSENCQKSKI  420
             A+LPENDCRYAVYDFDFVT ENCQKSKI
Sbjct  61   AAALPENDCRYAVYDFDFVTDENCQKSKI  89



>emb|CDP10458.1| unnamed protein product [Coffea canephora]
Length=104

 Score =   137 bits (346),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +1

Query  163  RGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTAS  342
            RG NA+SGMGVADHSK  ++EL+RKK +RYVIFKIDEKKKEVVVEKTG PAESY+DFTAS
Sbjct  6    RGQNATSGMGVADHSKDAFLELKRKKAYRYVIFKIDEKKKEVVVEKTGNPAESYEDFTAS  65

Query  343  LPENDCRYAVYDFDFVTSENCQKSKI  420
            +PENDCRYAVYDFDFVTSENCQKSKI
Sbjct  66   MPENDCRYAVYDFDFVTSENCQKSKI  91



>emb|CDY10786.1| BnaA05g11500D [Brassica napus]
Length=146

 Score =   139 bits (350),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 80/92 (87%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRG---ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            MS RG    NA+SGMGVAD SK+TY ELQRKK HRYV+FKIDE K +VVVEKTG PAESY
Sbjct  1    MSFRGLRKPNATSGMGVADQSKTTYHELQRKKTHRYVVFKIDELKNQVVVEKTGNPAESY  60

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            DDF ASLP+NDCRYAVYDFDFVT+ENCQKSKI
Sbjct  61   DDFLASLPDNDCRYAVYDFDFVTAENCQKSKI  92



>emb|CDY24750.1| BnaC04g13550D [Brassica napus]
Length=146

 Score =   139 bits (349),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 80/92 (87%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRG---ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            MS RG    NA+SGMGVAD SK+TY ELQRKK HRYV+FKIDE K +VVVEKTG PAESY
Sbjct  1    MSFRGLRKPNATSGMGVADQSKTTYHELQRKKTHRYVVFKIDELKNQVVVEKTGNPAESY  60

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            DDF ASLP+NDCRYAVYDFDFVT+ENCQKSKI
Sbjct  61   DDFLASLPDNDCRYAVYDFDFVTAENCQKSKI  92



>ref|XP_008793579.1| PREDICTED: actin-depolymerizing factor 11 isoform X1 [Phoenix 
dactylifera]
Length=145

 Score =   138 bits (348),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            +NASSGMGVADH K T++ELQRKK HRYVIFKIDEK+KEVVVEKTGG AESYDDF ASLP
Sbjct  8    SNASSGMGVADHCKDTFLELQRKKTHRYVIFKIDEKQKEVVVEKTGGAAESYDDFMASLP  67

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            ENDCRYAVYDFDFVT ENCQKSKI
Sbjct  68   ENDCRYAVYDFDFVTDENCQKSKI  91



>ref|NP_001236003.1| uncharacterized protein LOC100527688 [Glycine max]
 gb|ACU16832.1| unknown [Glycine max]
 gb|KHN02508.1| Actin-depolymerizing factor 6 [Glycine soja]
Length=146

 Score =   138 bits (348),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 85/92 (92%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRG---ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            MS RG    NASSGMGVADHSK+T+MEL++KKVHRY+IFK+DEKK+EVVVEKTG PAESY
Sbjct  1    MSFRGLSRPNASSGMGVADHSKNTFMELKQKKVHRYLIFKVDEKKREVVVEKTGDPAESY  60

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            +DF ASLPENDCRYAV+D+DFVTSENCQKSKI
Sbjct  61   EDFAASLPENDCRYAVFDYDFVTSENCQKSKI  92



>ref|XP_010906282.1| PREDICTED: actin-depolymerizing factor-like isoform X2 [Elaeis 
guineensis]
Length=116

 Score =   137 bits (346),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            +NASSGMGVADH K T+++LQRKK HRYVIFKI+EK+KEVVVEKTGGPAESYDDF ASLP
Sbjct  8    SNASSGMGVADHCKDTFLDLQRKKTHRYVIFKINEKQKEVVVEKTGGPAESYDDFMASLP  67

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            ENDCRYAVYDFDFVT ENCQKSKI
Sbjct  68   ENDCRYAVYDFDFVTDENCQKSKI  91



>ref|XP_006410251.1| hypothetical protein EUTSA_v10017380mg [Eutrema salsugineum]
 gb|ESQ51704.1| hypothetical protein EUTSA_v10017380mg [Eutrema salsugineum]
Length=146

 Score =   138 bits (348),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 81/92 (88%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRG---ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            M+ RG    NA+SGMGVAD SK+TY ELQRKK HRYV+FKIDE KKEVVVEKTG PAESY
Sbjct  1    MAFRGLSKPNATSGMGVADQSKTTYHELQRKKTHRYVVFKIDEAKKEVVVEKTGNPAESY  60

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            DDF ASLP+NDCRYAVYDFDFVTSENCQKSKI
Sbjct  61   DDFLASLPDNDCRYAVYDFDFVTSENCQKSKI  92



>ref|XP_009144237.1| PREDICTED: actin-depolymerizing factor 6 [Brassica rapa]
Length=146

 Score =   138 bits (348),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 79/92 (86%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRG---ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            MS RG    NA+SGMGVAD SK+TY ELQRKK HRYV+FKIDE K +VVVEKTG PAESY
Sbjct  1    MSFRGLRKPNATSGMGVADQSKTTYHELQRKKTHRYVVFKIDELKNQVVVEKTGNPAESY  60

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            DDF ASLP NDCRYAVYDFDFVT+ENCQKSKI
Sbjct  61   DDFLASLPANDCRYAVYDFDFVTAENCQKSKI  92



>ref|XP_011083023.1| PREDICTED: actin-depolymerizing factor-like [Sesamum indicum]
Length=145

 Score =   138 bits (348),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +1

Query  163  RGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTAS  342
            RG NASSGMG+ADHSK+T+MEL++KK HRYVIFKIDEKK EVVVEKTGG AE+YDDF  S
Sbjct  6    RGPNASSGMGMADHSKNTFMELKKKKAHRYVIFKIDEKKNEVVVEKTGGSAENYDDFAES  65

Query  343  LPENDCRYAVYDFDFVTSENCQKSKI  420
            LPE+DCRYAVYDFDFVTSENCQKSKI
Sbjct  66   LPEDDCRYAVYDFDFVTSENCQKSKI  91



>ref|XP_010906274.1| PREDICTED: actin-depolymerizing factor-like isoform X1 [Elaeis 
guineensis]
Length=145

 Score =   138 bits (348),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            +NASSGMGVADH K T+++LQRKK HRYVIFKI+EK+KEVVVEKTGGPAESYDDF ASLP
Sbjct  8    SNASSGMGVADHCKDTFLDLQRKKTHRYVIFKINEKQKEVVVEKTGGPAESYDDFMASLP  67

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            ENDCRYAVYDFDFVT ENCQKSKI
Sbjct  68   ENDCRYAVYDFDFVTDENCQKSKI  91



>gb|ABK23520.1| unknown [Picea sitchensis]
 gb|ABK26362.1| unknown [Picea sitchensis]
 gb|ABR17134.1| unknown [Picea sitchensis]
 gb|ACN39812.1| unknown [Picea sitchensis]
Length=143

 Score =   138 bits (347),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +1

Query  154  MSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDF  333
            MS R ++ASSGMGVAD  K  ++EL+RKK+HRYV+FKIDEK K+V+VEKTGGPAESYDDF
Sbjct  1    MSFRMSSASSGMGVADDCKHAFLELKRKKIHRYVVFKIDEKTKQVIVEKTGGPAESYDDF  60

Query  334  TASLPENDCRYAVYDFDFVTSENCQKSKI  420
            TA+LPENDCRYAVYDFDFVT ENCQKSKI
Sbjct  61   TAALPENDCRYAVYDFDFVTHENCQKSKI  89



>ref|XP_008793580.1| PREDICTED: actin-depolymerizing factor isoform X2 [Phoenix dactylifera]
Length=117

 Score =   137 bits (345),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            +NASSGMGVADH K T++ELQRKK HRYVIFKIDEK+KEVVVEKTGG AESYDDF ASLP
Sbjct  8    SNASSGMGVADHCKDTFLELQRKKTHRYVIFKIDEKQKEVVVEKTGGAAESYDDFMASLP  67

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            ENDCRYAVYDFDFVT ENCQKSKI
Sbjct  68   ENDCRYAVYDFDFVTDENCQKSKI  91



>gb|AFK45782.1| unknown [Medicago truncatula]
Length=147

 Score =   138 bits (347),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  QMSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDD  330
            +M   G N SSGMGVA+ S ST+ ELQRKKV+RYVIFKIDEKKKEVVVEKTGGP+ESYDD
Sbjct  4    RMGVGGGNTSSGMGVAEQSVSTFQELQRKKVYRYVIFKIDEKKKEVVVEKTGGPSESYDD  63

Query  331  FTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            FTASLPENDCRYAV+DFDFVT+ENCQKSKI
Sbjct  64   FTASLPENDCRYAVFDFDFVTAENCQKSKI  93



>ref|XP_008235687.1| PREDICTED: actin-depolymerizing factor [Prunus mume]
Length=146

 Score =   138 bits (347),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 81/92 (88%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRG---ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            MS RG    NAS  MGV+D SK T+MELQRKKVHRYVIFK+DEKK+EVVVEK GGPAESY
Sbjct  1    MSFRGLSRPNASCAMGVSDDSKKTFMELQRKKVHRYVIFKVDEKKREVVVEKIGGPAESY  60

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            DDF A+LPENDCRYAVYDFDFVTSENCQKSKI
Sbjct  61   DDFVAALPENDCRYAVYDFDFVTSENCQKSKI  92



>ref|XP_007201857.1| hypothetical protein PRUPE_ppa012988mg [Prunus persica]
 gb|EMJ03056.1| hypothetical protein PRUPE_ppa012988mg [Prunus persica]
Length=146

 Score =   138 bits (347),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 82/92 (89%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRG---ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            MS RG    NAS  MGV+D SK+T+MELQRKKVHRYVIFK+DEKK+EVVVEK GGPAESY
Sbjct  1    MSFRGLSRPNASCAMGVSDDSKNTFMELQRKKVHRYVIFKVDEKKREVVVEKIGGPAESY  60

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            DDF A+LPENDCRYAVYDFDFVTSENCQKSKI
Sbjct  61   DDFAAALPENDCRYAVYDFDFVTSENCQKSKI  92



>gb|AAM63510.1| Actin-depolymerizing factor ADF-6 [Arabidopsis thaliana]
Length=146

 Score =   138 bits (347),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 80/92 (87%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRG---ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            MS RG    NA SGMGVAD SK+T++ELQRKK HRYV+FKIDE KKEVVVEKTG P ESY
Sbjct  1    MSFRGLSRPNAISGMGVADESKTTFLELQRKKTHRYVVFKIDESKKEVVVEKTGNPTESY  60

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            DDF ASLP+NDCRYAVYDFDFVTSENCQKSKI
Sbjct  61   DDFLASLPDNDCRYAVYDFDFVTSENCQKSKI  92



>gb|AFK44387.1| unknown [Lotus japonicus]
Length=147

 Score =   137 bits (346),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  166  GANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASL  345
            G NASSGMGVA+ S ST++ELQ+KK+HRYVIFKIDE KKEVVVEKTG PAESY+DFTASL
Sbjct  9    GGNASSGMGVAEQSVSTFLELQKKKIHRYVIFKIDENKKEVVVEKTGSPAESYEDFTASL  68

Query  346  PENDCRYAVYDFDFVTSENCQKSKI  420
            PENDCRYAV+DFDFVT ENCQKSKI
Sbjct  69   PENDCRYAVFDFDFVTPENCQKSKI  93



>gb|AFK44911.1| unknown [Medicago truncatula]
 gb|KEH23922.1| cofilin/actin-depolymerizing factor-like protein [Medicago truncatula]
Length=146

 Score =   137 bits (346),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 85/92 (92%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRG---ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            MS RG    NASSGMGV D+SK+T+MEL++KKVHRYVIFK+DEKK+EVVVEKTGGPAESY
Sbjct  1    MSFRGLSRPNASSGMGVDDNSKNTFMELKQKKVHRYVIFKVDEKKREVVVEKTGGPAESY  60

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            DDF ASLP+NDCRYAV+DFDFVT+ENCQKSKI
Sbjct  61   DDFAASLPDNDCRYAVFDFDFVTAENCQKSKI  92



>ref|XP_010037980.1| PREDICTED: actin-depolymerizing factor [Eucalyptus grandis]
 gb|KCW49772.1| hypothetical protein EUGRSUZ_K03264 [Eucalyptus grandis]
Length=146

 Score =   137 bits (346),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 86/87 (99%), Gaps = 1/87 (1%)
 Frame = +1

Query  160  SRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTA  339
            SRG NA+SGMG++DHSKST+M+L+RK+VHRYVIF+IDEKKKEVVVEKTGGPAESY+DFTA
Sbjct  7    SRG-NATSGMGISDHSKSTFMDLKRKRVHRYVIFQIDEKKKEVVVEKTGGPAESYEDFTA  65

Query  340  SLPENDCRYAVYDFDFVTSENCQKSKI  420
            +LP+NDCRYAVYD+DFVTS+NCQKSKI
Sbjct  66   ALPQNDCRYAVYDYDFVTSDNCQKSKI  92



>ref|NP_565719.1| actin depolymerizing factor 6 [Arabidopsis thaliana]
 sp|Q9ZSK2.1|ADF6_ARATH RecName: Full=Actin-depolymerizing factor 6; Short=ADF-6; Short=AtADF6 
[Arabidopsis thaliana]
 gb|AAF01035.1|AF183576_1 actin depolymerizing factor 6 [Arabidopsis thaliana]
 gb|AAD09112.1| actin depolymerizing factor 6 [Arabidopsis thaliana]
 gb|AAD20665.2| actin depolymerizing factor 6 [Arabidopsis thaliana]
 gb|AEC08507.1| actin depolymerizing factor 6 [Arabidopsis thaliana]
Length=146

 Score =   137 bits (346),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 80/92 (87%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRG---ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            MS RG    NA SGMGVAD SK+T++ELQRKK HRYV+FKIDE KKEVVVEKTG P ESY
Sbjct  1    MSFRGLSRPNAISGMGVADESKTTFLELQRKKTHRYVVFKIDESKKEVVVEKTGNPTESY  60

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            DDF ASLP+NDCRYAVYDFDFVTSENCQKSKI
Sbjct  61   DDFLASLPDNDCRYAVYDFDFVTSENCQKSKI  92



>ref|XP_010557114.1| PREDICTED: actin-depolymerizing factor 6 isoform X2 [Tarenaya 
hassleriana]
Length=146

 Score =   137 bits (346),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 81/92 (88%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRG---ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            MS RG    NASSGMGVAD+SKS + ELQRKKVHRYV+FKIDE KKEVVVEKTG PAE+Y
Sbjct  1    MSFRGLSRPNASSGMGVADNSKSIFRELQRKKVHRYVVFKIDENKKEVVVEKTGSPAENY  60

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            DDF ASLPENDCRYAVYD+DFVT ENCQKSKI
Sbjct  61   DDFLASLPENDCRYAVYDYDFVTPENCQKSKI  92



>ref|XP_011025987.1| PREDICTED: actin-depolymerizing factor-like [Populus euphratica]
Length=146

 Score =   137 bits (345),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 84/92 (91%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRGA---NASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            M+ RGA   NASSG+GVADHSK+T++ELQRKKVHRYVIFKI+EKK EVVVEKTG P+ESY
Sbjct  1    MNFRGASRANASSGIGVADHSKNTFIELQRKKVHRYVIFKIEEKKMEVVVEKTGEPSESY  60

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            +DF ASLP+NDCRYAVYDFDFVT ENCQKSKI
Sbjct  61   EDFAASLPDNDCRYAVYDFDFVTFENCQKSKI  92



>ref|XP_008787347.1| PREDICTED: actin-depolymerizing factor 11-like isoform X2 [Phoenix 
dactylifera]
Length=145

 Score =   137 bits (345),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            +NA+SGMGVADH K T++ELQRKK HRYVIFKIDEK+KEVVV+KTGG  ESYDDFTASLP
Sbjct  8    SNATSGMGVADHCKDTFLELQRKKTHRYVIFKIDEKRKEVVVDKTGGATESYDDFTASLP  67

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            ENDCRYA+YDFDFVT ENCQKSKI
Sbjct  68   ENDCRYAIYDFDFVTDENCQKSKI  91



>gb|ADE75680.1| unknown [Picea sitchensis]
Length=143

 Score =   136 bits (343),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +1

Query  154  MSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDF  333
            MS + ++ASSGMGVAD  K  ++ELQRKKVHRY+IFKI+EK K+VVV+KTGGPAESY DF
Sbjct  1    MSFKLSSASSGMGVADECKKVFLELQRKKVHRYIIFKIEEKTKQVVVDKTGGPAESYSDF  60

Query  334  TASLPENDCRYAVYDFDFVTSENCQKSKI  420
             ASLPENDCRYAV+DFDFVTSENCQKSKI
Sbjct  61   AASLPENDCRYAVFDFDFVTSENCQKSKI  89



>ref|XP_008805218.1| PREDICTED: actin-depolymerizing factor-like [Phoenix dactylifera]
Length=143

 Score =   136 bits (342),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +1

Query  154  MSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDF  333
            MS R ++AS GMGVADHSK+ ++EL+RKKVHRYVIFKIDEKKKEVVVEKTG P ESYDDF
Sbjct  1    MSFRMSSASCGMGVADHSKNAFLELKRKKVHRYVIFKIDEKKKEVVVEKTGAPGESYDDF  60

Query  334  TASLPENDCRYAVYDFDFVTSENCQKSKI  420
             A+LPENDCRYA+YDFDFVT ENCQKSKI
Sbjct  61   AAALPENDCRYAIYDFDFVTDENCQKSKI  89



>ref|XP_004493773.1| PREDICTED: actin-depolymerizing factor-like [Cicer arietinum]
Length=146

 Score =   136 bits (342),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 83/92 (90%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRG---ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            MS RG    NASSGMGV ++SK+ +MEL+ KKVHRYVIFK+DEKK+EVVVEKTGGPAESY
Sbjct  1    MSFRGLSRPNASSGMGVDENSKNIFMELKTKKVHRYVIFKVDEKKREVVVEKTGGPAESY  60

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            DDF ASLPENDCRYAV+DFDFVTSENCQKSKI
Sbjct  61   DDFAASLPENDCRYAVFDFDFVTSENCQKSKI  92



>ref|XP_009369488.1| PREDICTED: actin-depolymerizing factor [Pyrus x bretschneideri]
Length=146

 Score =   136 bits (342),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 82/92 (89%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRG---ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            MS RG    NAS  MGV+D SK+T+MELQRKK+HRYVIFK+DEKK+EVVVEK GGPAESY
Sbjct  1    MSFRGLGRPNASCAMGVSDESKNTFMELQRKKLHRYVIFKVDEKKREVVVEKIGGPAESY  60

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            DDF A+LP+NDCRYAVYDFDFVTSENCQKSKI
Sbjct  61   DDFVAALPDNDCRYAVYDFDFVTSENCQKSKI  92



>ref|XP_009354940.1| PREDICTED: actin-depolymerizing factor-like isoform X2 [Pyrus 
x bretschneideri]
Length=149

 Score =   136 bits (342),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 82/92 (89%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRG---ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            MS RG    NAS  MGV+D SK+T+MELQRKKVHRYVIFK+DEKK+EVVVEK GGPAESY
Sbjct  4    MSLRGLSRPNASCAMGVSDESKNTFMELQRKKVHRYVIFKVDEKKREVVVEKIGGPAESY  63

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            DDF A+LP+NDCRYAVYDFDFVTS+NCQKSKI
Sbjct  64   DDFVAALPDNDCRYAVYDFDFVTSDNCQKSKI  95



>ref|XP_008382869.1| PREDICTED: actin-depolymerizing factor [Malus domestica]
Length=149

 Score =   136 bits (342),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 82/92 (89%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRG---ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            MS RG    NAS  MGV+D SK+T+MELQRKKVHRYVIFK++EKK+EVVVEK GGPAESY
Sbjct  4    MSFRGLSRPNASCAMGVSDESKNTFMELQRKKVHRYVIFKVEEKKREVVVEKIGGPAESY  63

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            DDF A+LP+NDCRYAVYDFDFVTSENCQKSKI
Sbjct  64   DDFVAALPDNDCRYAVYDFDFVTSENCQKSKI  95



>ref|XP_006295186.1| hypothetical protein CARUB_v10024267mg [Capsella rubella]
 ref|XP_006295187.1| hypothetical protein CARUB_v10024267mg [Capsella rubella]
 gb|EOA28084.1| hypothetical protein CARUB_v10024267mg [Capsella rubella]
 gb|EOA28085.1| hypothetical protein CARUB_v10024267mg [Capsella rubella]
Length=146

 Score =   135 bits (341),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +1

Query  172  NASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPE  351
            NA SGMGVAD SK+T+ ELQRKK HRYVIF+IDE K EVVVEKTG PAESYDDF A+LPE
Sbjct  10   NARSGMGVADQSKTTFHELQRKKTHRYVIFRIDESKNEVVVEKTGNPAESYDDFLAALPE  69

Query  352  NDCRYAVYDFDFVTSENCQKSKI  420
            NDCRYAVYDFDFVTSENCQKSKI
Sbjct  70   NDCRYAVYDFDFVTSENCQKSKI  92



>gb|EYU17913.1| hypothetical protein MIMGU_mgv1a015771mg [Erythranthe guttata]
Length=146

 Score =   135 bits (340),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +1

Query  172  NASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPE  351
            NASS MGVADHS++T++EL++KKVHRYVIFKIDEK+ EVVVEKTGGPAESY+DFT SLPE
Sbjct  10   NASSYMGVADHSRNTFLELKKKKVHRYVIFKIDEKQNEVVVEKTGGPAESYEDFTDSLPE  69

Query  352  NDCRYAVYDFDFVTSENCQKSKI  420
            +DCRYAVYDFDFVTSENCQKSKI
Sbjct  70   DDCRYAVYDFDFVTSENCQKSKI  92



>gb|KHN30569.1| Actin-depolymerizing factor 6 [Glycine soja]
Length=148

 Score =   135 bits (340),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/78 (94%), Positives = 77/78 (99%), Gaps = 0/78 (0%)
 Frame = +1

Query  187  MGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPENDCRY  366
            MGVA+HS ST++ELQRKKVHRYVIFKIDEKKKEVVVEKTGGPAESYDDFTASLPENDCRY
Sbjct  17   MGVAEHSVSTFLELQRKKVHRYVIFKIDEKKKEVVVEKTGGPAESYDDFTASLPENDCRY  76

Query  367  AVYDFDFVTSENCQKSKI  420
            AV+DFDFVTSENCQKSKI
Sbjct  77   AVFDFDFVTSENCQKSKI  94



>ref|NP_001236100.1| uncharacterized protein LOC100500047 [Glycine max]
 gb|ACU14747.1| unknown [Glycine max]
 gb|KHN05062.1| Actin-depolymerizing factor 6 [Glycine soja]
Length=148

 Score =   135 bits (340),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/78 (91%), Positives = 77/78 (99%), Gaps = 0/78 (0%)
 Frame = +1

Query  187  MGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPENDCRY  366
            MGVA+HS +T++ELQRKKVHRYVIFKIDEKKKEV+VEKTGGPAESYDDFTASLPENDCRY
Sbjct  17   MGVAEHSVNTFLELQRKKVHRYVIFKIDEKKKEVIVEKTGGPAESYDDFTASLPENDCRY  76

Query  367  AVYDFDFVTSENCQKSKI  420
            AV+DFDFVTSENCQKSKI
Sbjct  77   AVFDFDFVTSENCQKSKI  94



>ref|XP_010557113.1| PREDICTED: actin-depolymerizing factor isoform X1 [Tarenaya hassleriana]
Length=149

 Score =   135 bits (340),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/83 (87%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +1

Query  172  NASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPE  351
            NASSGMGVAD+SKS + ELQRKKVHRYV+FKIDE KKEVVVEKTG PAE+YDDF ASLPE
Sbjct  13   NASSGMGVADNSKSIFRELQRKKVHRYVVFKIDENKKEVVVEKTGSPAENYDDFLASLPE  72

Query  352  NDCRYAVYDFDFVTSENCQKSKI  420
            NDCRYAVYD+DFVT ENCQKSKI
Sbjct  73   NDCRYAVYDYDFVTPENCQKSKI  95



>ref|XP_010555867.1| PREDICTED: actin-depolymerizing factor 6-like [Tarenaya hassleriana]
Length=146

 Score =   135 bits (339),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 80/92 (87%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRG---ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            MS RG    NA+SGMGV+D SKSTYMELQRKK HRY++FKIDE KKEV+VEKTG  +ES+
Sbjct  1    MSFRGFSRPNAASGMGVSDQSKSTYMELQRKKGHRYIVFKIDENKKEVMVEKTGAASESF  60

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            DDF  SLPENDCRYAVYDFDFVTSENCQKSKI
Sbjct  61   DDFVGSLPENDCRYAVYDFDFVTSENCQKSKI  92



>ref|XP_010671034.1| PREDICTED: actin-depolymerizing factor-like [Beta vulgaris subsp. 
vulgaris]
Length=143

 Score =   135 bits (339),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +1

Query  154  MSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDF  333
            M+ RG NA SG+GVA+  K+ + ELQRKKVHRYV+FKIDEKKKEV VEKTGGPAESYDDF
Sbjct  1    MAFRGRNAQSGIGVAEQCKTIFTELQRKKVHRYVVFKIDEKKKEVSVEKTGGPAESYDDF  60

Query  334  TASLPENDCRYAVYDFDFVTSENCQKSKI  420
             ASLPE+DCRYAVYD+DFV +ENCQKSKI
Sbjct  61   LASLPESDCRYAVYDYDFVNAENCQKSKI  89



>ref|XP_010414168.1| PREDICTED: actin-depolymerizing factor 6 [Camelina sativa]
Length=146

 Score =   135 bits (339),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +1

Query  172  NASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPE  351
            NA SGMGVAD SK+T+ ELQRKK HRYV+FKIDE K EVVVEKTG PAESYDDF ASLP+
Sbjct  10   NARSGMGVADESKTTFHELQRKKTHRYVVFKIDESKNEVVVEKTGNPAESYDDFLASLPD  69

Query  352  NDCRYAVYDFDFVTSENCQKSKI  420
            NDCRYAVYDFDFVTSENCQKSKI
Sbjct  70   NDCRYAVYDFDFVTSENCQKSKI  92



>ref|NP_001235058.1| uncharacterized protein LOC100305927 [Glycine max]
 gb|ACU13847.1| unknown [Glycine max]
Length=148

 Score =   135 bits (339),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/78 (92%), Positives = 77/78 (99%), Gaps = 0/78 (0%)
 Frame = +1

Query  187  MGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPENDCRY  366
            MGVA+HS ST++ELQRKKVHRYVIFKIDEKKKEVVVEKTGGPAESYDDFTASLPENDCRY
Sbjct  17   MGVAEHSVSTFLELQRKKVHRYVIFKIDEKKKEVVVEKTGGPAESYDDFTASLPENDCRY  76

Query  367  AVYDFDFVTSENCQKSKI  420
            A++DFDFVTSENCQKSKI
Sbjct  77   AIFDFDFVTSENCQKSKI  94



>ref|XP_010469748.1| PREDICTED: actin-depolymerizing factor 6-like [Camelina sativa]
Length=146

 Score =   134 bits (338),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 78/92 (85%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRG---ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            MS RG    NA SGMGVAD SK+T+ ELQRKK HRYV+F+IDE K EVVVEKTG PAESY
Sbjct  1    MSFRGLSRPNARSGMGVADESKTTFHELQRKKTHRYVVFRIDESKNEVVVEKTGNPAESY  60

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            DDF  SLP+NDCRYAVYDFDFVTSENCQKSKI
Sbjct  61   DDFLGSLPDNDCRYAVYDFDFVTSENCQKSKI  92



>ref|XP_010510225.1| PREDICTED: actin-depolymerizing factor 6-like [Camelina sativa]
Length=146

 Score =   134 bits (337),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +1

Query  172  NASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPE  351
            NA SGMGVAD SK+T+ ELQRKK HRYV+F+IDE K EVVVEKTG PAESYDDF ASLP+
Sbjct  10   NARSGMGVADESKTTFHELQRKKTHRYVVFRIDESKNEVVVEKTGNPAESYDDFLASLPD  69

Query  352  NDCRYAVYDFDFVTSENCQKSKI  420
            NDCRYAVYDFDFVTSENCQKSKI
Sbjct  70   NDCRYAVYDFDFVTSENCQKSKI  92



>ref|XP_004495380.1| PREDICTED: actin-depolymerizing factor-like [Cicer arietinum]
Length=132

 Score =   133 bits (335),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/78 (91%), Positives = 76/78 (97%), Gaps = 0/78 (0%)
 Frame = +1

Query  187  MGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPENDCRY  366
            MGVA+HS ST+ ELQRKKVHRYVIFKIDEKK+EVVVEKTGGPAESYDDFTASLPENDCRY
Sbjct  1    MGVAEHSVSTFQELQRKKVHRYVIFKIDEKKQEVVVEKTGGPAESYDDFTASLPENDCRY  60

Query  367  AVYDFDFVTSENCQKSKI  420
            AV+DFDFVT+ENCQKSKI
Sbjct  61   AVFDFDFVTAENCQKSKI  78



>ref|XP_010920473.1| PREDICTED: actin-depolymerizing factor-like [Elaeis guineensis]
 ref|XP_010920474.1| PREDICTED: actin-depolymerizing factor-like [Elaeis guineensis]
Length=148

 Score =   134 bits (336),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/83 (88%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +1

Query  172  NASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPE  351
            NASSGMGVAD SKST++EL+RKKVHRYVIF IDEKKKEVVVEKTGGP ESYDDFTA+LP 
Sbjct  12   NASSGMGVADDSKSTFLELKRKKVHRYVIFMIDEKKKEVVVEKTGGPGESYDDFTAALPV  71

Query  352  NDCRYAVYDFDFVTSENCQKSKI  420
            NDCRYAVYDFDFVT +NCQKSKI
Sbjct  72   NDCRYAVYDFDFVTEDNCQKSKI  94



>gb|AFK37313.1| unknown [Lotus japonicus]
Length=112

 Score =   132 bits (333),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 79/86 (92%), Gaps = 1/86 (1%)
 Frame = +1

Query  166  GANASSGMGVADHSKSTYMELQRKK-VHRYVIFKIDekkkevvvekTGGPAESYDDFTAS  342
            G NASSGMGVA+ S ST++ELQ+KK +HRYVIFKIDE KKEVVVEKTG PAESY+DFTAS
Sbjct  9    GGNASSGMGVAEQSVSTFLELQKKKKIHRYVIFKIDENKKEVVVEKTGSPAESYEDFTAS  68

Query  343  LPENDCRYAVYDFDFVTSENCQKSKI  420
            LPENDCRYAV+DFDFVT ENCQKSKI
Sbjct  69   LPENDCRYAVFDFDFVTPENCQKSKI  94



>gb|KFK31228.1| hypothetical protein AALP_AA6G084900 [Arabis alpina]
Length=146

 Score =   133 bits (334),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 78/92 (85%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRG---ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            MS RG    NA+SGMGVA+ SK+ Y ELQRKK HRYV+FKIDE K EVVVEK+G P ESY
Sbjct  1    MSFRGLSKPNATSGMGVAEESKTKYHELQRKKTHRYVVFKIDESKNEVVVEKSGNPTESY  60

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            DDF ASLP+NDCRYAVYDFDFVTSENCQKSKI
Sbjct  61   DDFLASLPDNDCRYAVYDFDFVTSENCQKSKI  92



>ref|XP_010104736.1| Actin-depolymerizing factor [Morus notabilis]
 gb|EXC01786.1| Actin-depolymerizing factor [Morus notabilis]
Length=178

 Score =   134 bits (336),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/78 (92%), Positives = 76/78 (97%), Gaps = 0/78 (0%)
 Frame = +1

Query  187  MGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPENDCRY  366
            MGVADHSKST++ELQRKKV RYVIFKIDEKKKEV+VEKTGGPAES+DDF ASLPENDCRY
Sbjct  1    MGVADHSKSTFLELQRKKVFRYVIFKIDEKKKEVMVEKTGGPAESFDDFAASLPENDCRY  60

Query  367  AVYDFDFVTSENCQKSKI  420
            AVYDFDFVTSENCQKSKI
Sbjct  61   AVYDFDFVTSENCQKSKI  78



>gb|EPS67866.1| hypothetical protein M569_06910, partial [Genlisea aurea]
Length=137

 Score =   132 bits (333),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/83 (87%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +1

Query  172  NASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPE  351
            N  SGM VAD S++T+MELQRKKVHRYVIFKIDEKKKEVVVEKTG P E+YDDFT SLPE
Sbjct  1    NILSGMAVADQSRTTFMELQRKKVHRYVIFKIDEKKKEVVVEKTGDPTENYDDFTTSLPE  60

Query  352  NDCRYAVYDFDFVTSENCQKSKI  420
            NDCRYAVYDFDFVTSENCQKSKI
Sbjct  61   NDCRYAVYDFDFVTSENCQKSKI  83



>gb|ABQ41942.1| actin-depolymerizing factor A [Sonneratia alba]
Length=114

 Score =   132 bits (331),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/76 (92%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +1

Query  193  VADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPENDCRYAV  372
            VADHSKSTY+ELQRKKVHRY+IF+IDEKKKEV+VEKTGGP+ESY DFTASLPENDCRYAV
Sbjct  1    VADHSKSTYLELQRKKVHRYIIFRIDEKKKEVLVEKTGGPSESYADFTASLPENDCRYAV  60

Query  373  YDFDFVTSENCQKSKI  420
            YDFDFVTSENCQKSKI
Sbjct  61   YDFDFVTSENCQKSKI  76



>gb|ABQ41944.1| actin-depolymerizing factor A [Sonneratia ovata]
Length=114

 Score =   131 bits (330),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/76 (92%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +1

Query  193  VADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPENDCRYAV  372
            VADHSKSTY+ELQRKKVHRY+IF+IDEKKKEV+VEKTGGP+ESY DFTASLPENDCRYAV
Sbjct  1    VADHSKSTYLELQRKKVHRYIIFRIDEKKKEVLVEKTGGPSESYADFTASLPENDCRYAV  60

Query  373  YDFDFVTSENCQKSKI  420
            YDFDFVTSENCQKSKI
Sbjct  61   YDFDFVTSENCQKSKI  76



>ref|XP_008356136.1| PREDICTED: actin-depolymerizing factor isoform X2 [Malus domestica]
Length=149

 Score =   132 bits (333),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +1

Query  172  NASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPE  351
            NAS  MGV+D SK+T+MELQRKK HRYVIFK+DEKK+EVVVEK GGPAESYDDF A+LP+
Sbjct  13   NASCAMGVSDESKNTFMELQRKKXHRYVIFKVDEKKREVVVEKIGGPAESYDDFVAALPD  72

Query  352  NDCRYAVYDFDFVTSENCQKSKI  420
            NDCRYAVYDFDFVTSENCQKSKI
Sbjct  73   NDCRYAVYDFDFVTSENCQKSKI  95



>gb|ABQ41943.1| actin-depolymerizing factor A [Sonneratia caseolaris]
 gb|ABQ41945.1| actin-depolymerizing factor A [Sonneratia apetala]
Length=114

 Score =   131 bits (330),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/76 (92%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +1

Query  193  VADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPENDCRYAV  372
            VADHSKSTY+ELQRKKVHRY+IF+IDEKKKEV+VEKTGGP+ESY DFTASLPENDCRYAV
Sbjct  1    VADHSKSTYLELQRKKVHRYIIFRIDEKKKEVLVEKTGGPSESYADFTASLPENDCRYAV  60

Query  373  YDFDFVTSENCQKSKI  420
            YDFDFVTSENCQKSKI
Sbjct  61   YDFDFVTSENCQKSKI  76



>ref|XP_009354939.1| PREDICTED: actin-depolymerizing factor-like isoform X1 [Pyrus 
x bretschneideri]
Length=157

 Score =   133 bits (334),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +1

Query  172  NASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPE  351
            NAS  MGV+D SK+T+MELQRKKVHRYVIFK+DEKK+EVVVEK GGPAESYDDF A+LP+
Sbjct  21   NASCAMGVSDESKNTFMELQRKKVHRYVIFKVDEKKREVVVEKIGGPAESYDDFVAALPD  80

Query  352  NDCRYAVYDFDFVTSENCQKSKI  420
            NDCRYAVYDFDFVTS+NCQKSKI
Sbjct  81   NDCRYAVYDFDFVTSDNCQKSKI  103



>ref|XP_008356135.1| PREDICTED: actin-depolymerizing factor isoform X1 [Malus domestica]
Length=157

 Score =   132 bits (333),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +1

Query  172  NASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPE  351
            NAS  MGV+D SK+T+MELQRKK HRYVIFK+DEKK+EVVVEK GGPAESYDDF A+LP+
Sbjct  21   NASCAMGVSDESKNTFMELQRKKXHRYVIFKVDEKKREVVVEKIGGPAESYDDFVAALPD  80

Query  352  NDCRYAVYDFDFVTSENCQKSKI  420
            NDCRYAVYDFDFVTSENCQKSKI
Sbjct  81   NDCRYAVYDFDFVTSENCQKSKI  103



>ref|XP_010652163.1| PREDICTED: actin-depolymerizing factor isoform X1 [Vitis vinifera]
Length=132

 Score =   131 bits (329),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/78 (90%), Positives = 77/78 (99%), Gaps = 0/78 (0%)
 Frame = +1

Query  187  MGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPENDCRY  366
            MGVADHSK+T++EL+RKKVHRYVIFKIDEKKKEVVVEKTGGPAES+D+F A+LPENDCRY
Sbjct  1    MGVADHSKNTFLELKRKKVHRYVIFKIDEKKKEVVVEKTGGPAESFDEFAAALPENDCRY  60

Query  367  AVYDFDFVTSENCQKSKI  420
            AVYDFDFVTSENCQKSKI
Sbjct  61   AVYDFDFVTSENCQKSKI  78



>gb|KHG08366.1| Actin-depolymerizing factor [Gossypium arboreum]
 gb|KHG11571.1| Actin-depolymerizing factor [Gossypium arboreum]
Length=132

 Score =   131 bits (329),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/78 (91%), Positives = 76/78 (97%), Gaps = 0/78 (0%)
 Frame = +1

Query  187  MGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPENDCRY  366
            MGVADHSKSTY+ELQRKKV RYV+FKI+EKKKEVVVEKTGGP+E+YDD TASLPENDCRY
Sbjct  1    MGVADHSKSTYLELQRKKVFRYVVFKINEKKKEVVVEKTGGPSENYDDLTASLPENDCRY  60

Query  367  AVYDFDFVTSENCQKSKI  420
            AVYDFDFVTSENCQKSKI
Sbjct  61   AVYDFDFVTSENCQKSKI  78



>gb|KDP40330.1| hypothetical protein JCGZ_02328 [Jatropha curcas]
Length=132

 Score =   130 bits (328),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/78 (88%), Positives = 76/78 (97%), Gaps = 0/78 (0%)
 Frame = +1

Query  187  MGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPENDCRY  366
            MGVA+H+KSTY+ELQRKK +R+VIFKIDE KKEVVVEKTGGPAESYDD+TASLPENDCRY
Sbjct  1    MGVAEHTKSTYLELQRKKAYRFVIFKIDENKKEVVVEKTGGPAESYDDYTASLPENDCRY  60

Query  367  AVYDFDFVTSENCQKSKI  420
            AVYDFDFVTS+NCQKSKI
Sbjct  61   AVYDFDFVTSDNCQKSKI  78



>ref|XP_010923770.1| PREDICTED: actin-depolymerizing factor-like isoform X1 [Elaeis 
guineensis]
Length=145

 Score =   130 bits (327),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +1

Query  184  GMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPENDCR  363
            GMGVADH K T++ELQRKK HRYVIFKIDEK+KEVVV+KTGG AESYDDF ASLPENDCR
Sbjct  13   GMGVADHCKDTFLELQRKKTHRYVIFKIDEKRKEVVVDKTGGAAESYDDFMASLPENDCR  72

Query  364  YAVYDFDFVTSENCQKSKI  420
            YA+YDFDFVT ENCQKSKI
Sbjct  73   YAIYDFDFVTDENCQKSKI  91



>gb|KDO60511.1| hypothetical protein CISIN_1g032158mg [Citrus sinensis]
Length=132

 Score =   129 bits (325),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/78 (90%), Positives = 75/78 (96%), Gaps = 0/78 (0%)
 Frame = +1

Query  187  MGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPENDCRY  366
            MGVADHSK+ + ELQRKKVHRYVIFKIDEKKKEVVVEKTGGPAESY+DF A+LPENDCRY
Sbjct  1    MGVADHSKNAFTELQRKKVHRYVIFKIDEKKKEVVVEKTGGPAESYEDFAAALPENDCRY  60

Query  367  AVYDFDFVTSENCQKSKI  420
            AVYDFD+VTSENCQKSKI
Sbjct  61   AVYDFDYVTSENCQKSKI  78



>ref|XP_009388500.1| PREDICTED: actin-depolymerizing factor 11 [Musa acuminata subsp. 
malaccensis]
Length=145

 Score =   129 bits (324),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +1

Query  166  GANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASL  345
             +NASSGMGVA+  +  ++ELQRKK HRYVIFKIDEK+K+V+VEKTGG  ESYDDF ASL
Sbjct  7    SSNASSGMGVAEDCRDIFLELQRKKTHRYVIFKIDEKQKQVIVEKTGGATESYDDFLASL  66

Query  346  PENDCRYAVYDFDFVTSENCQKSKI  420
            PENDCRYAVYDFDFVT ENCQKSKI
Sbjct  67   PENDCRYAVYDFDFVTEENCQKSKI  91



>ref|XP_004289936.1| PREDICTED: actin-depolymerizing factor 6-like isoform 3 [Fragaria 
vesca subsp. vesca]
Length=148

 Score =   129 bits (323),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 80/92 (87%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRG---ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            MS RG    NAS  M  A+ SK+++MELQRKKVHRYVIFK+DEKK+EVVVEK GGPAESY
Sbjct  3    MSFRGLSRPNASCAMAAAEDSKNSFMELQRKKVHRYVIFKVDEKKREVVVEKIGGPAESY  62

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            +DF A+LPENDCR+AVYDFDFVTS+NCQKSKI
Sbjct  63   EDFVAALPENDCRFAVYDFDFVTSDNCQKSKI  94



>ref|XP_009388955.1| PREDICTED: actin-depolymerizing factor 11-like [Musa acuminata 
subsp. malaccensis]
Length=145

 Score =   129 bits (323),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            +NASSGMGVAD  K  ++ELQRKK HRYV+FKIDEK+KEV+VEK GG  ESYDDF ASLP
Sbjct  8    SNASSGMGVADDCKHIFLELQRKKTHRYVVFKIDEKRKEVIVEKIGGATESYDDFMASLP  67

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            ENDCRYA+YDFDFVT ENCQKSKI
Sbjct  68   ENDCRYAIYDFDFVTEENCQKSKI  91



>ref|XP_009409826.1| PREDICTED: actin-depolymerizing factor 11-like [Musa acuminata 
subsp. malaccensis]
Length=96

 Score =   127 bits (318),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            +NASSGMGVA+  + T++ELQRKK HRYVIFKIDEK+K+V+VEKTG   ESYDDF ASLP
Sbjct  8    SNASSGMGVAEDCRDTFVELQRKKTHRYVIFKIDEKRKQVIVEKTGDATESYDDFMASLP  67

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            ENDCRYAVYDFDFVT ENCQKSKI
Sbjct  68   ENDCRYAVYDFDFVTEENCQKSKI  91



>gb|AEX97081.1| actin depolymerizing factor [Malus domestica]
Length=146

 Score =   128 bits (321),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +1

Query  172  NASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPE  351
            NAS  MGV+D SK+T+MEL RKKVHR VIFK+DE K+EVVVEK GGPAESYDDF A+LP+
Sbjct  10   NASCAMGVSDESKNTFMELHRKKVHRNVIFKVDENKREVVVEKIGGPAESYDDFVAALPD  69

Query  352  NDCRYAVYDFDFVTSENCQKSKI  420
            NDCRYAVYDFDFVTSENCQ+SKI
Sbjct  70   NDCRYAVYDFDFVTSENCQQSKI  92



>ref|XP_009408567.1| PREDICTED: actin-depolymerizing factor 11-like [Musa acuminata 
subsp. malaccensis]
Length=145

 Score =   128 bits (321),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            +NASSGMGVAD  K  ++ELQRKK HRYVIFKI+EK+KEV+VEK GG  ESYDDF ASLP
Sbjct  8    SNASSGMGVADDCKDIFLELQRKKTHRYVIFKINEKQKEVIVEKIGGATESYDDFVASLP  67

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            ENDCRYAVYDFDFVT ENCQKSKI
Sbjct  68   ENDCRYAVYDFDFVTEENCQKSKI  91



>ref|XP_002531528.1| actin depolymerizing factor, putative [Ricinus communis]
 gb|EEF30847.1| actin depolymerizing factor, putative [Ricinus communis]
Length=140

 Score =   127 bits (320),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +1

Query  184  GMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPENDCR  363
            G+ V DHSKST++ELQRKKVHRYVIFKID+K+ EVVVEKTGG AESY DF+ASLPENDCR
Sbjct  8    GLSVGDHSKSTFVELQRKKVHRYVIFKIDDKRNEVVVEKTGGTAESYGDFSASLPENDCR  67

Query  364  YAVYDFDFVTSENCQKSKI  420
            YAVYDFDFVTS+NCQKSKI
Sbjct  68   YAVYDFDFVTSDNCQKSKI  86



>gb|AAK49596.1|AF372880_1 At2g31200/F16D14.4 [Arabidopsis thaliana]
 gb|AAL15349.1| At2g31200/F16D14.4 [Arabidopsis thaliana]
Length=132

 Score =   127 bits (319),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +1

Query  187  MGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPENDCRY  366
            MGVAD SK+T++ELQRKK HRYV+FKIDE KKEVVVEKTG P ESYDDF ASLP+NDCRY
Sbjct  1    MGVADESKTTFLELQRKKTHRYVVFKIDESKKEVVVEKTGNPTESYDDFLASLPDNDCRY  60

Query  367  AVYDFDFVTSENCQKSKI  420
            AVYDFDFVTSENCQKSKI
Sbjct  61   AVYDFDFVTSENCQKSKI  78



>ref|XP_008787348.1| PREDICTED: actin-depolymerizing factor-like isoform X3 [Phoenix 
dactylifera]
Length=132

 Score =   127 bits (318),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +1

Query  187  MGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPENDCRY  366
            MGVADH K T++ELQRKK HRYVIFKIDEK+KEVVV+KTGG  ESYDDFTASLPENDCRY
Sbjct  1    MGVADHCKDTFLELQRKKTHRYVIFKIDEKRKEVVVDKTGGATESYDDFTASLPENDCRY  60

Query  367  AVYDFDFVTSENCQKSKI  420
            A+YDFDFVT ENCQKSKI
Sbjct  61   AIYDFDFVTDENCQKSKI  78



>gb|AAF60173.1|AF236068_1 actin depolymerizing factor [Elaeis guineensis]
Length=140

 Score =   127 bits (318),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +1

Query  181  SGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPENDC  360
            SGMGVAD SKST++EL+RKKVHRYVIF IDEKKKEVVVEKTGGP ESYDDFTA+LP NDC
Sbjct  4    SGMGVADDSKSTFLELKRKKVHRYVIFMIDEKKKEVVVEKTGGPGESYDDFTAALPVNDC  63

Query  361  RYAVYDFDFVTSENCQKSKI  420
            RYAVYDFDFVT +NCQKSKI
Sbjct  64   RYAVYDFDFVTEDNCQKSKI  83



>gb|EPS70990.1| hypothetical protein M569_03773, partial [Genlisea aurea]
Length=134

 Score =   127 bits (318),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +1

Query  181  SGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPENDC  360
            SGMGVADHSK+T+MELQRKKVHRYVIFKIDE KKEV+VEKTG P+ +Y+DF +SLPE+DC
Sbjct  1    SGMGVADHSKTTFMELQRKKVHRYVIFKIDESKKEVIVEKTGSPSLNYEDFRSSLPEDDC  60

Query  361  RYAVYDFDFVTSENCQKSKI  420
            RYAVYDFD+VT ENCQKSKI
Sbjct  61   RYAVYDFDYVTPENCQKSKI  80



>ref|XP_010923771.1| PREDICTED: actin-depolymerizing factor-like isoform X2 [Elaeis 
guineensis]
Length=132

 Score =   126 bits (317),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +1

Query  187  MGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPENDCRY  366
            MGVADH K T++ELQRKK HRYVIFKIDEK+KEVVV+KTGG AESYDDF ASLPENDCRY
Sbjct  1    MGVADHCKDTFLELQRKKTHRYVIFKIDEKRKEVVVDKTGGAAESYDDFMASLPENDCRY  60

Query  367  AVYDFDFVTSENCQKSKI  420
            A+YDFDFVT ENCQKSKI
Sbjct  61   AIYDFDFVTDENCQKSKI  78



>dbj|BAG70999.1| adf [Musa balbisiana]
 dbj|BAG70989.1| adf [Musa balbisiana]
Length=132

 Score =   126 bits (316),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +1

Query  187  MGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPENDCRY  366
            MGV +HSKST++ELQRKKVHRYVIFKIDEKKKEVVVEKTG P ESYDDFTASLPENDCRY
Sbjct  1    MGVDEHSKSTFLELQRKKVHRYVIFKIDEKKKEVVVEKTGAPGESYDDFTASLPENDCRY  60

Query  367  AVYDFDFVTSENCQKSKI  420
            A+YDFD+VT +NCQKSKI
Sbjct  61   AIYDFDYVTEDNCQKSKI  78



>ref|XP_007143869.1| hypothetical protein PHAVU_007G108800g [Phaseolus vulgaris]
 gb|ESW15863.1| hypothetical protein PHAVU_007G108800g [Phaseolus vulgaris]
Length=147

 Score =   126 bits (317),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  193  VADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPENDCRYAV  372
            V +HS +T++ELQRKKVHRYV+FKIDEKK+EVVVEKTGGPAESYDDFTASLPE+DCRYAV
Sbjct  18   VDEHSVNTFLELQRKKVHRYVVFKIDEKKQEVVVEKTGGPAESYDDFTASLPESDCRYAV  77

Query  373  YDFDFVTSENCQKSKI  420
            YDFDFVTSENCQKSKI
Sbjct  78   YDFDFVTSENCQKSKI  93



>ref|XP_004289934.1| PREDICTED: actin-depolymerizing factor 6-like isoform 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_004289935.1| PREDICTED: actin-depolymerizing factor 6-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=158

 Score =   126 bits (316),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +1

Query  172  NASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPE  351
            NAS  M  A+ SK+++MELQRKKVHRYVIFK+DEKK+EVVVEK GGPAESY+DF A+LPE
Sbjct  22   NASCAMAAAEDSKNSFMELQRKKVHRYVIFKVDEKKREVVVEKIGGPAESYEDFVAALPE  81

Query  352  NDCRYAVYDFDFVTSENCQKSKI  420
            NDCR+AVYDFDFVTS+NCQKSKI
Sbjct  82   NDCRFAVYDFDFVTSDNCQKSKI  104



>gb|KHG14810.1| Actin-depolymerizing factor 6 [Gossypium arboreum]
Length=146

 Score =   125 bits (315),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +1

Query  172  NASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPE  351
            NA+SGM  A H+K T++EL+RKK++RY++F+IDEKK++VVVEKTG PAE+YDDFTASLPE
Sbjct  10   NATSGMCAAGHAKDTFLELKRKKIYRYLVFRIDEKKRKVVVEKTGDPAETYDDFTASLPE  69

Query  352  NDCRYAVYDFDFVTSENCQKSKI  420
            NDCRYAVYDFDFVTS+NCQKSKI
Sbjct  70   NDCRYAVYDFDFVTSDNCQKSKI  92



>gb|KHG14809.1| Actin-depolymerizing factor 6 [Gossypium arboreum]
Length=183

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +1

Query  172  NASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPE  351
            NA+SGM  A H+K T++EL+RKK++RY++F+IDEKK++VVVEKTG PAE+YDDFTASLPE
Sbjct  47   NATSGMCAAGHAKDTFLELKRKKIYRYLVFRIDEKKRKVVVEKTGDPAETYDDFTASLPE  106

Query  352  NDCRYAVYDFDFVTSENCQKSKI  420
            NDCRYAVYDFDFVTS+NCQKSKI
Sbjct  107  NDCRYAVYDFDFVTSDNCQKSKI  129



>ref|XP_008447430.1| PREDICTED: actin-depolymerizing factor [Cucumis melo]
 ref|XP_008447431.1| PREDICTED: actin-depolymerizing factor [Cucumis melo]
Length=146

 Score =   124 bits (311),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 79/92 (86%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRG---ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            MS RG    N  S MGV +H+K T+ ELQRKK++RYVIFK+DEKK+EVVV+K G PAESY
Sbjct  1    MSFRGLRRQNTLSAMGVNEHTKKTFSELQRKKMYRYVIFKVDEKKREVVVDKIGNPAESY  60

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            +DFTA+LP+NDCRYAVYDFDFVTS+NCQKSKI
Sbjct  61   EDFTAALPDNDCRYAVYDFDFVTSDNCQKSKI  92



>ref|XP_004151983.1| PREDICTED: actin-depolymerizing factor 6-like isoform 1 [Cucumis 
sativus]
 ref|XP_004151984.1| PREDICTED: actin-depolymerizing factor 6-like isoform 2 [Cucumis 
sativus]
 ref|XP_004168148.1| PREDICTED: actin-depolymerizing factor 6-like isoform 1 [Cucumis 
sativus]
 ref|XP_004168149.1| PREDICTED: actin-depolymerizing factor 6-like isoform 2 [Cucumis 
sativus]
 ref|XP_004168150.1| PREDICTED: actin-depolymerizing factor 6-like isoform 3 [Cucumis 
sativus]
 gb|KGN57913.1| hypothetical protein Csa_3G389830 [Cucumis sativus]
Length=146

 Score =   123 bits (309),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 79/92 (86%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  MSSRG---ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            MS RG    N  S MGV +H+K T+ ELQRKK++RYVIF++DEKK+EVVV+K G PAESY
Sbjct  1    MSFRGLRRQNTLSAMGVNEHTKKTFSELQRKKMYRYVIFRVDEKKREVVVDKIGNPAESY  60

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            +DFTA+LP+NDCRYAVYDFDFVTS+NCQKSKI
Sbjct  61   EDFTAALPDNDCRYAVYDFDFVTSDNCQKSKI  92



>ref|XP_010679250.1| PREDICTED: actin-depolymerizing factor [Beta vulgaris subsp. 
vulgaris]
Length=143

 Score =   122 bits (307),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +1

Query  154  MSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDF  333
            MS R +N+ SG+ +AD SK  ++EL+RKK HRYV+FKIDEKKKEVVVEKTG PAESYDDF
Sbjct  1    MSFRRSNSMSGLSIADQSKKAFLELKRKKDHRYVVFKIDEKKKEVVVEKTGTPAESYDDF  60

Query  334  TASLPENDCRYAVYDFDFVTSENCQKSKI  420
             A LP NDCRYAVYD+DFVTS+NCQKSKI
Sbjct  61   LAVLPGNDCRYAVYDYDFVTSDNCQKSKI  89



>ref|NP_001067327.1| Os12g0628100 [Oryza sativa Japonica Group]
 sp|Q2QLT8.1|ADF11_ORYSJ RecName: Full=Actin-depolymerizing factor 11; Short=ADF-11; Short=OsADF11 
[Oryza sativa Japonica Group]
 gb|ABA99516.1| Actin-depolymerizing factor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF30346.1| Os12g0628100 [Oryza sativa Japonica Group]
 gb|EAZ21297.1| hypothetical protein OsJ_36950 [Oryza sativa Japonica Group]
 dbj|BAH00342.1| unnamed protein product [Oryza sativa Japonica Group]
Length=145

 Score =   121 bits (303),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANASSG+GVA   K T++ELQRKK HRYVIFKID+K KEVVVEKTG   ES+DDF  SLP
Sbjct  8    ANASSGIGVAAECKQTFLELQRKKSHRYVIFKIDDKCKEVVVEKTGSSTESFDDFMDSLP  67

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            E+DCRYA+YDFDFVT ENCQKSKI
Sbjct  68   ESDCRYAIYDFDFVTEENCQKSKI  91



>gb|EEC69719.1| hypothetical protein OsI_39206 [Oryza sativa Indica Group]
Length=145

 Score =   120 bits (301),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANASSG+GVA   K T++ELQRKK HRYVIFKID+K KEVVV+KTG   ES+DDF  SLP
Sbjct  8    ANASSGIGVAAECKQTFLELQRKKSHRYVIFKIDDKCKEVVVDKTGSSTESFDDFMDSLP  67

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            E+DCRYA+YDFDFVT ENCQKSKI
Sbjct  68   ESDCRYAIYDFDFVTEENCQKSKI  91



>gb|ABK23967.1| unknown [Picea sitchensis]
Length=143

 Score =   118 bits (295),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  ASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPEN  354
            A++GMGV+D   S + EL+RKK HRY++FKIDEK K+V+V+KTGG AESYDDFTASLP+N
Sbjct  8    ATTGMGVSDECLSLFQELKRKKAHRYIVFKIDEKSKKVLVDKTGGAAESYDDFTASLPDN  67

Query  355  DCRYAVYDFDFVTSENCQKSKI  420
            DCRYAV+DFD+VT +NCQKSKI
Sbjct  68   DCRYAVFDFDYVTVDNCQKSKI  89



>ref|XP_006664223.1| PREDICTED: actin-depolymerizing factor 11-like [Oryza brachyantha]
Length=145

 Score =   117 bits (294),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANASSG+GVA   + T++ELQRKK HRYV+FKID+K KEVVV+K G   ES+DDF  SLP
Sbjct  8    ANASSGIGVAAECRQTFLELQRKKAHRYVVFKIDDKGKEVVVDKAGAATESFDDFIDSLP  67

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            E DCRYA+YDFDFVT ENCQKSKI
Sbjct  68   EADCRYAIYDFDFVTQENCQKSKI  91



>gb|ACG24914.1| actin-depolymerizing factor 6 [Zea mays]
Length=145

 Score =   117 bits (294),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 75/89 (84%), Gaps = 1/89 (1%)
 Frame = +1

Query  154  MSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDF  333
            M SR +NASSGMGVA + + T++ELQ KK  RYVIFKI+EK+K+VVVEKTG   ESYDDF
Sbjct  4    MRSR-SNASSGMGVAPNIRETFVELQMKKTFRYVIFKIEEKQKQVVVEKTGATTESYDDF  62

Query  334  TASLPENDCRYAVYDFDFVTSENCQKSKI  420
             ASLPENDCRYA+YDFDFVT EN QKSKI
Sbjct  63   LASLPENDCRYALYDFDFVTGENVQKSKI  91



>ref|NP_001148357.1| actin-depolymerizing factor 6 [Zea mays]
 gb|ACF85483.1| unknown [Zea mays]
 gb|ACG24829.1| actin-depolymerizing factor 6 [Zea mays]
 gb|ACG31055.1| actin-depolymerizing factor 6 [Zea mays]
 gb|AFW67459.1| actin-depolymerizing factor 6 [Zea mays]
Length=145

 Score =   117 bits (293),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 75/89 (84%), Gaps = 1/89 (1%)
 Frame = +1

Query  154  MSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDF  333
            M SR +NASSGMGVA + + T++ELQ KK  RYVIFKI+EK+K+VVVEKTG   ESYDDF
Sbjct  4    MRSR-SNASSGMGVAPNIRETFVELQMKKAFRYVIFKIEEKQKQVVVEKTGATTESYDDF  62

Query  334  TASLPENDCRYAVYDFDFVTSENCQKSKI  420
             ASLPENDCRYA+YDFDFVT EN QKSKI
Sbjct  63   LASLPENDCRYALYDFDFVTGENVQKSKI  91



>ref|XP_003558421.1| PREDICTED: actin-depolymerizing factor 2 [Brachypodium distachyon]
Length=145

 Score =   117 bits (292),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  166  GANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASL  345
             +NASSGMGVA + + T++ELQ KK  RYVIFKI+EK+K+V+VEKTG   ESYDDF ASL
Sbjct  7    SSNASSGMGVAPNIRETFLELQMKKAFRYVIFKIEEKQKQVIVEKTGATTESYDDFLASL  66

Query  346  PENDCRYAVYDFDFVTSENCQKSKI  420
            PENDCRYA+YDFDFVT EN QKSKI
Sbjct  67   PENDCRYALYDFDFVTGENVQKSKI  91



>ref|XP_002463796.1| hypothetical protein SORBIDRAFT_01g006330 [Sorghum bicolor]
 gb|EER90794.1| hypothetical protein SORBIDRAFT_01g006330 [Sorghum bicolor]
Length=145

 Score =   117 bits (292),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            +NASSGMGVA + + T++ELQ KK +RYVIFKI+EK+K+VVVEKTG   ESYDDF ASLP
Sbjct  8    SNASSGMGVAPNIRETFVELQMKKAYRYVIFKIEEKQKQVVVEKTGATTESYDDFLASLP  67

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            ENDCRYA+YDFDFVT EN QKSKI
Sbjct  68   ENDCRYALYDFDFVTGENVQKSKI  91



>ref|XP_002969368.1| hypothetical protein SELMODRAFT_146459 [Selaginella moellendorffii]
 ref|XP_002970699.1| hypothetical protein SELMODRAFT_270871 [Selaginella moellendorffii]
 gb|EFJ28025.1| hypothetical protein SELMODRAFT_270871 [Selaginella moellendorffii]
 gb|EFJ29456.1| hypothetical protein SELMODRAFT_146459 [Selaginella moellendorffii]
Length=144

 Score =   117 bits (292),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SG+ V D  K  +MEL+RKK HRYV+FKIDEK ++VVVEK GGP ESY+ FTASLP
Sbjct  2    ANAASGIAVHDDCKLKFMELKRKKTHRYVVFKIDEKAQQVVVEKLGGPDESYEAFTASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            ENDCRYAVYDFDFVT +NC KSKI
Sbjct  62   ENDCRYAVYDFDFVTDDNCPKSKI  85



>ref|XP_004168151.1| PREDICTED: actin-depolymerizing factor 6-like isoform 4 [Cucumis 
sativus]
Length=132

 Score =   116 bits (290),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +1

Query  187  MGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPENDCRY  366
            MGV +H+K T+ ELQRKK++RYVIF++DEKK+EVVV+K G PAESY+DFTA+LP+NDCRY
Sbjct  1    MGVNEHTKKTFSELQRKKMYRYVIFRVDEKKREVVVDKIGNPAESYEDFTAALPDNDCRY  60

Query  367  AVYDFDFVTSENCQKSKI  420
            AVYDFDFVTS+NCQKSKI
Sbjct  61   AVYDFDFVTSDNCQKSKI  78



>gb|EMS61987.1| Actin-depolymerizing factor 2 [Triticum urartu]
Length=178

 Score =   117 bits (292),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 82/113 (73%), Gaps = 4/113 (4%)
 Frame = +1

Query  91   VLPLSCLKSLFCASDFR*QKQ---MSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIF  261
            V PL    +L  A  +R  K+   +  R +NASSGMGVA   + T++ELQ KK  RYVIF
Sbjct  13   VGPLPA-PTLLTAGRYRKDKKGRGLRRRTSNASSGMGVAPDIRETFLELQMKKAFRYVIF  71

Query  262  KIDekkkevvvekTGGPAESYDDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            KI+EK+K+VVVEKTG   ESYDDF A LPENDCRYA+YDFDFVT EN QKSKI
Sbjct  72   KIEEKQKQVVVEKTGATTESYDDFLACLPENDCRYALYDFDFVTGENVQKSKI  124



>gb|AFW67457.1| hypothetical protein ZEAMMB73_569048, partial [Zea mays]
Length=154

 Score =   116 bits (290),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 75/89 (84%), Gaps = 1/89 (1%)
 Frame = +1

Query  154  MSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDF  333
            M SR +NASSGMGVA + + T++ELQ KK  RYVIFKI+EK+K+VVVEKTG   ESYDDF
Sbjct  62   MRSR-SNASSGMGVAPNIRETFVELQMKKAFRYVIFKIEEKQKQVVVEKTGATTESYDDF  120

Query  334  TASLPENDCRYAVYDFDFVTSENCQKSKI  420
             ASLPENDCRYA+YDFDFVT EN QKSKI
Sbjct  121  LASLPENDCRYALYDFDFVTGENVQKSKI  149



>ref|XP_004981554.1| PREDICTED: actin-depolymerizing factor 2-like [Setaria italica]
Length=145

 Score =   115 bits (289),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            +NASSGMGVA + + T++ELQ KK  RYVIFKI+EK+K+VVVEKTG   ESYDDF ASLP
Sbjct  8    SNASSGMGVAPNIRETFVELQMKKAFRYVIFKIEEKQKQVVVEKTGATTESYDDFLASLP  67

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            ENDCRYA+YDFDFVT EN QKSKI
Sbjct  68   ENDCRYALYDFDFVTGENVQKSKI  91



>ref|NP_001051449.1| Os03g0780400 [Oryza sativa Japonica Group]
 sp|Q9AY76.1|ADF2_ORYSJ RecName: Full=Actin-depolymerizing factor 2; Short=ADF-2; Short=OsADF2 
[Oryza sativa Japonica Group]
 gb|AAK09235.1|AC084320_22 putative actin-depolymerizing factor [Oryza sativa Japonica Group]
 gb|ABF99174.1| Actin-depolymerizing factor 6, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13363.1| Os03g0780400 [Oryza sativa Japonica Group]
 dbj|BAG93319.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76270.1| hypothetical protein OsI_13741 [Oryza sativa Indica Group]
 gb|EEE60036.1| hypothetical protein OsJ_12808 [Oryza sativa Japonica Group]
Length=145

 Score =   115 bits (289),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            +NASSGMGVA   + T++ELQ KK  RYVIFKI+EK+K+VVVEKTG   ESYDDF ASLP
Sbjct  8    SNASSGMGVAPDIRDTFLELQMKKAFRYVIFKIEEKQKQVVVEKTGATTESYDDFLASLP  67

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            ENDCRYA+YDFDFVT EN QKSKI
Sbjct  68   ENDCRYALYDFDFVTGENVQKSKI  91



>ref|XP_004147034.1| PREDICTED: actin-depolymerizing factor 5-like isoform 1 [Cucumis 
sativus]
Length=168

 Score =   115 bits (288),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +1

Query  172  NASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPE  351
             A++GM V+D  K+++ME++ KKVHRY++FKIDE  + V V+K GGPAESYDD TASLP 
Sbjct  32   QATTGMWVSDECKNSFMEMKWKKVHRYIVFKIDEGSRLVTVDKVGGPAESYDDLTASLPN  91

Query  352  NDCRYAVYDFDFVTSENCQKSKI  420
            +DCRYAV+DFDFVT +NC+KSKI
Sbjct  92   DDCRYAVFDFDFVTVDNCRKSKI  114



>ref|XP_004158407.1| PREDICTED: actin-depolymerizing factor 5-like, partial [Cucumis 
sativus]
Length=142

 Score =   114 bits (286),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  ASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPEN  354
            A++GM V+D  K+++ME++ KKVHRY++FKIDE  + V V+K GGPAESYDD TASLP +
Sbjct  8    ATTGMWVSDECKNSFMEMKWKKVHRYIVFKIDEGSRLVTVDKVGGPAESYDDLTASLPND  67

Query  355  DCRYAVYDFDFVTSENCQKSKI  420
            DCRYAV+DFDFVT +NC+KSKI
Sbjct  68   DCRYAVFDFDFVTVDNCRKSKI  89



>ref|XP_004147035.1| PREDICTED: actin-depolymerizing factor 5-like isoform 2 [Cucumis 
sativus]
 ref|XP_008457680.1| PREDICTED: actin-depolymerizing factor 5-like [Cucumis melo]
 gb|KGN61924.1| hypothetical protein Csa_2G270170 [Cucumis sativus]
Length=143

 Score =   114 bits (286),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  ASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPEN  354
            A++GM V+D  K+++ME++ KKVHRY++FKIDE  + V V+K GGPAESYDD TASLP +
Sbjct  8    ATTGMWVSDECKNSFMEMKWKKVHRYIVFKIDEGSRLVTVDKVGGPAESYDDLTASLPND  67

Query  355  DCRYAVYDFDFVTSENCQKSKI  420
            DCRYAV+DFDFVT +NC+KSKI
Sbjct  68   DCRYAVFDFDFVTVDNCRKSKI  89



>gb|EMT26595.1| Actin-depolymerizing factor 10 [Aegilops tauschii]
Length=155

 Score =   114 bits (285),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +1

Query  166  GANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASL  345
            G N+ + + V + SKS +MEL+R+KVHRYVIFKID+  +EVVVEKTG P ESYDDFTASL
Sbjct  15   GGNSPAWIDVPERSKSAFMELKRRKVHRYVIFKIDDITEEVVVEKTGAPGESYDDFTASL  74

Query  346  PENDCRYAVYDFDFVTSENCQKSKI  420
            P +DCRYAVYD DFV+ +NC KSKI
Sbjct  75   PVDDCRYAVYDLDFVSDDNCHKSKI  99



>ref|XP_010548091.1| PREDICTED: actin-depolymerizing factor 5 [Tarenaya hassleriana]
Length=143

 Score =   114 bits (284),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  ASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPEN  354
            A++GM VA+ SK ++ME++ KKVHRY++FKIDE  + V V+K GG  ESYDD TASLPE+
Sbjct  8    ATTGMWVAEESKRSFMEMKWKKVHRYIVFKIDEISRLVTVDKVGGAGESYDDLTASLPED  67

Query  355  DCRYAVYDFDFVTSENCQKSKI  420
            DCR+AV+DFDFVT++NC+KSKI
Sbjct  68   DCRFAVFDFDFVTADNCRKSKI  89



>ref|XP_006650675.1| PREDICTED: actin-depolymerizing factor 2-like [Oryza brachyantha]
Length=145

 Score =   114 bits (284),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            +NASSGMGVA   ++T++ELQ KK  RYVIFKI+EK+K+VVVEKTG   ESYDDF A LP
Sbjct  8    SNASSGMGVAPDIRNTFLELQMKKAFRYVIFKIEEKQKQVVVEKTGATTESYDDFLACLP  67

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            ENDCRYA+YDFDFVT EN QKSKI
Sbjct  68   ENDCRYALYDFDFVTGENVQKSKI  91



>dbj|BAK02947.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT00264.1| Actin-depolymerizing factor 2 [Aegilops tauschii]
 gb|AIT97055.1| actin-depolymerizing factor 6 [Triticum aestivum]
Length=145

 Score =   113 bits (283),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +1

Query  166  GANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASL  345
             +NASSGMGVA   + T++ELQ KK  RYVIFKI+EK+K+VVVEKTG   ESYDDF A L
Sbjct  7    SSNASSGMGVAPDIRETFLELQMKKAFRYVIFKIEEKQKQVVVEKTGATTESYDDFLACL  66

Query  346  PENDCRYAVYDFDFVTSENCQKSKI  420
            PENDCRYA+YDFDFVT EN QKSKI
Sbjct  67   PENDCRYALYDFDFVTGENVQKSKI  91



>ref|XP_004142080.1| PREDICTED: actin-depolymerizing factor 1-like [Cucumis sativus]
 ref|XP_004169676.1| PREDICTED: actin-depolymerizing factor 1-like [Cucumis sativus]
 gb|KGN54230.1| hypothetical protein Csa_4G294380 [Cucumis sativus]
Length=139

 Score =   113 bits (282),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ HR+++FKI+EK K+VVVEK GGP++SY+DF ASLP
Sbjct  2    ANAASGMAVNDECKLKFLELKSKRTHRFIVFKIEEKLKQVVVEKLGGPSQSYEDFAASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             N+CRYAVYDFDFVT ENCQKS+I
Sbjct  62   ANECRYAVYDFDFVTEENCQKSRI  85



>ref|NP_001148661.1| actin-depolymerizing factor 6 [Zea mays]
 gb|ACG32422.1| actin-depolymerizing factor 6 [Zea mays]
Length=143

 Score =   113 bits (282),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 71/89 (80%), Gaps = 3/89 (3%)
 Frame = +1

Query  154  MSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDF  333
            M SR +NASSGMGVA + + T++ELQ KK  RYVIFKI+EK+K+V    TG   ESYDDF
Sbjct  4    MRSR-SNASSGMGVAPNIRETFVELQMKKTFRYVIFKIEEKQKQVEK--TGATTESYDDF  60

Query  334  TASLPENDCRYAVYDFDFVTSENCQKSKI  420
             ASLPENDCRYA+YDFDFVT EN QKSKI
Sbjct  61   LASLPENDCRYALYDFDFVTGENVQKSKI  89



>gb|ABD66507.1| actin depolymerizing factor 5 [Gossypium hirsutum]
Length=141

 Score =   113 bits (282),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  ASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPEN  354
            A++GM VAD  K+++ME++ KKVHRY++FKIDEK K V V+K GG  ESYDDFTASLP +
Sbjct  6    ATTGMWVADECKNSFMEMKWKKVHRYIVFKIDEKSKLVTVDKVGGAGESYDDFTASLPTD  65

Query  355  DCRYAVYDFDFVTSENCQKSKI  420
            DCRYAV+DFDFVT +NC+KSKI
Sbjct  66   DCRYAVFDFDFVTVDNCRKSKI  87



>ref|XP_008447631.1| PREDICTED: actin-depolymerizing factor 1-like [Cucumis melo]
Length=139

 Score =   112 bits (281),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ HR+++FKI+EK K+VVVEK GGP++SY+DF ASLP
Sbjct  2    ANAASGMAVNDECKLKFLELKSKRTHRFIVFKIEEKLKQVVVEKLGGPSQSYEDFAASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             N+CRYAVYDFDFVT ENCQKS+I
Sbjct  62   ANECRYAVYDFDFVTEENCQKSRI  85



>gb|EMS65284.1| Actin-depolymerizing factor 10 [Triticum urartu]
Length=172

 Score =   114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +1

Query  166  GANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASL  345
            G N+ + + V + SKS +MEL+R+KVHRYVIFKID+  +EVVVEKTG P ESYDDFTASL
Sbjct  10   GGNSPAWIDVPERSKSAFMELKRRKVHRYVIFKIDDSTEEVVVEKTGAPGESYDDFTASL  69

Query  346  PENDCRYAVYDFDFVTSENCQKSKI  420
            P +DCRYAVYD DFV+ +NC+KSKI
Sbjct  70   PVDDCRYAVYDLDFVSDDNCRKSKI  94



>ref|XP_002465048.1| hypothetical protein SORBIDRAFT_01g031270 [Sorghum bicolor]
 gb|EER92046.1| hypothetical protein SORBIDRAFT_01g031270 [Sorghum bicolor]
Length=153

 Score =   113 bits (282),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  166  GANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASL  345
            G  + + + V + SKS +MEL+R+KVHRYVIFKID++++E+VVEKTG P ESYDDFTASL
Sbjct  13   GGGSPAWIDVPERSKSAFMELKRRKVHRYVIFKIDDRREEIVVEKTGAPGESYDDFTASL  72

Query  346  PENDCRYAVYDFDFVTSENCQKSKI  420
            P +DCRYAVYD DFV+ +NC+KSKI
Sbjct  73   PADDCRYAVYDLDFVSDDNCRKSKI  97



>ref|XP_010234923.1| PREDICTED: actin-depolymerizing factor 10 isoform X2 [Brachypodium 
distachyon]
Length=150

 Score =   112 bits (281),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +1

Query  154  MSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDF  333
            ++  G  + + + V + SKS +MEL+R+KVHRYVIFKID++++EVVVEKTG P ESYDDF
Sbjct  6    LTLMGGGSRAWVDVPERSKSAFMELKRRKVHRYVIFKIDDRREEVVVEKTGAPGESYDDF  65

Query  334  TASLPENDCRYAVYDFDFVTSENCQKSKI  420
            TASLP +DCRYAVYD DFV+ +NC+KSKI
Sbjct  66   TASLPADDCRYAVYDLDFVSDDNCRKSKI  94



>ref|XP_004983892.1| PREDICTED: actin-depolymerizing factor 10-like [Setaria italica]
Length=150

 Score =   112 bits (281),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  166  GANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASL  345
            G  + + + V + SKS +MEL+R+KVHRYVIFKID++++E+VVEKTG P ESYDDFTASL
Sbjct  10   GGGSPAWIDVPERSKSAFMELKRRKVHRYVIFKIDDRREEIVVEKTGSPGESYDDFTASL  69

Query  346  PENDCRYAVYDFDFVTSENCQKSKI  420
            P +DCRYAVYD DFV+ +NC+KSKI
Sbjct  70   PADDCRYAVYDLDFVSDDNCRKSKI  94



>gb|AEJ88268.1| putative actin-depolymerizing factor [Wolffia arrhiza]
Length=139

 Score =   112 bits (279),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ HR+++FKIDEK+K+V+VEK G PA +Y+DF ASLP
Sbjct  2    ANAASGMAVNDDCKLKFLELKAKRTHRFIVFKIDEKQKQVIVEKIGEPALTYEDFAASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            +N+CRYA+YDFDFVTSENCQKSKI
Sbjct  62   DNECRYAIYDFDFVTSENCQKSKI  85



>gb|ACB32233.1| actin-depolymerizing factor 1 [Solanum chacoense]
Length=139

 Score =   112 bits (279),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ HR+++FKI+EK+K+VVVEK G PA+SY+DFTA LP
Sbjct  2    ANAASGMAVHDDCKLRFLELKAKRTHRFIVFKIEEKQKQVVVEKVGEPAQSYEDFTACLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            +N+CRYAVYDFDFVT+ENCQKS+I
Sbjct  62   DNECRYAVYDFDFVTAENCQKSRI  85



>ref|XP_006341057.1| PREDICTED: actin-depolymerizing factor 1-like [Solanum tuberosum]
Length=139

 Score =   112 bits (279),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ HR+++FKI+EK+K+VVVEK G PA+SY+DFTA LP
Sbjct  2    ANAASGMAVHDDCKLRFLELKAKRTHRFIVFKIEEKQKQVVVEKVGEPAQSYEDFTACLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            +N+CRYAVYDFDFVT+ENCQKS+I
Sbjct  62   DNECRYAVYDFDFVTAENCQKSRI  85



>ref|XP_003574212.1| PREDICTED: actin-depolymerizing factor 10 isoform X1 [Brachypodium 
distachyon]
Length=157

 Score =   112 bits (280),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  166  GANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASL  345
            G  + + + V + SKS +MEL+R+KVHRYVIFKID++++EVVVEKTG P ESYDDFTASL
Sbjct  17   GGGSRAWVDVPERSKSAFMELKRRKVHRYVIFKIDDRREEVVVEKTGAPGESYDDFTASL  76

Query  346  PENDCRYAVYDFDFVTSENCQKSKI  420
            P +DCRYAVYD DFV+ +NC+KSKI
Sbjct  77   PADDCRYAVYDLDFVSDDNCRKSKI  101



>ref|XP_007200573.1| hypothetical protein PRUPE_ppa013033mg [Prunus persica]
 ref|XP_008236001.1| PREDICTED: actin-depolymerizing factor 5 [Prunus mume]
 gb|EMJ01772.1| hypothetical protein PRUPE_ppa013033mg [Prunus persica]
Length=143

 Score =   112 bits (279),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  ASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPEN  354
            A++GM V D  KS++ME++ KKVHRY++FKIDE  + V V+K GGP ESYDD  ASLP++
Sbjct  8    ATTGMWVTDECKSSFMEMKWKKVHRYIVFKIDEGSRLVTVDKVGGPGESYDDLAASLPKD  67

Query  355  DCRYAVYDFDFVTSENCQKSKI  420
            DCRYAV+DFDFVT +NC+KSK+
Sbjct  68   DCRYAVFDFDFVTVDNCRKSKL  89



>emb|CAJ38388.1| actin-depolymerizing factor [Plantago major]
Length=139

 Score =   111 bits (278),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA SGM V D  K  ++EL+ K+ HR+V+FKI+EK+K+VVVEK G PAE+Y+DF ASLP
Sbjct  2    ANAVSGMAVHDDCKLRFLELKAKRTHRFVVFKIEEKQKQVVVEKVGEPAETYEDFAASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            EN+CRY VYDFDFVT+ENCQKS+I
Sbjct  62   ENECRYGVYDFDFVTAENCQKSRI  85



>gb|ABK26220.1| unknown [Picea sitchensis]
Length=139

 Score =   111 bits (277),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V +  K  ++EL+ K+ HR++ FKIDEK +++ V+K G P ++YDDFTASLP
Sbjct  2    ANAASGMAVDNECKIKFLELKSKRTHRFITFKIDEKLQQITVDKIGNPGQTYDDFTASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            E +CRYAVYDFDFVT ENCQKSKI
Sbjct  62   EKECRYAVYDFDFVTEENCQKSKI  85



>ref|XP_009586917.1| PREDICTED: actin-depolymerizing factor 1 [Nicotiana tomentosiformis]
 ref|XP_009774799.1| PREDICTED: actin-depolymerizing factor 1 [Nicotiana sylvestris]
Length=139

 Score =   111 bits (277),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ HR+++FKI+EK+K+VVVEK G P ESY+DF ASLP
Sbjct  2    ANAASGMAVHDDCKLRFLELKAKRTHRFIVFKIEEKQKQVVVEKVGEPTESYEDFAASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            +N+CRYAVYDFDFVT+ENCQKS+I
Sbjct  62   DNECRYAVYDFDFVTAENCQKSRI  85



>gb|ABK22764.1| unknown [Picea sitchensis]
 gb|ABK23401.1| unknown [Picea sitchensis]
 gb|ABK26122.1| unknown [Picea sitchensis]
 gb|ABR17611.1| unknown [Picea sitchensis]
 gb|ACN40120.1| unknown [Picea sitchensis]
Length=139

 Score =   111 bits (277),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V +  K  ++EL+ K+ HR++ FKIDEK +++ V+K G P ++YDDFTASLP
Sbjct  2    ANAASGMAVDNECKIKFLELKSKRTHRFITFKIDEKLQQITVDKIGNPGQTYDDFTASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            E +CRYAVYDFDFVT ENCQKSKI
Sbjct  62   EKECRYAVYDFDFVTEENCQKSKI  85



>ref|XP_009598852.1| PREDICTED: actin-depolymerizing factor 5-like [Nicotiana tomentosiformis]
Length=143

 Score =   111 bits (277),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  ASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPEN  354
            A++GM V D  K++YME++ KKVHRY+++KIDEK + V V+K GGPAE+Y+DF A+LP++
Sbjct  8    ATTGMWVTDECKNSYMEMKWKKVHRYIVYKIDEKSRLVTVDKVGGPAENYEDFAAALPKD  67

Query  355  DCRYAVYDFDFVTSENCQKSKI  420
            DCRYAV+DFDFVT +NC+KSKI
Sbjct  68   DCRYAVFDFDFVTVDNCRKSKI  89



>gb|KHG01327.1| Actin-depolymerizing factor 5 -like protein [Gossypium arboreum]
Length=143

 Score =   111 bits (277),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  ASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPEN  354
            A++GM VAD  K+++ME++ KKVHRY++FKIDEK K V V+K GG  ESYDDF ASLP +
Sbjct  8    ATTGMWVADECKNSFMEMKWKKVHRYIVFKIDEKSKLVTVDKVGGAGESYDDFAASLPTD  67

Query  355  DCRYAVYDFDFVTSENCQKSKI  420
            DCRYAV+DFDFVT +NC+KSKI
Sbjct  68   DCRYAVFDFDFVTVDNCRKSKI  89



>gb|KEH30500.1| cofilin/actin-depolymerizing factor-like protein [Medicago truncatula]
Length=109

 Score =   110 bits (275),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  ASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPEN  354
            A++GM V D  K+++ME++ KKVHRY++FKIDEK + V V+K GGP E+YDD  ASLP +
Sbjct  8    ATTGMWVTDECKNSFMEMKWKKVHRYIVFKIDEKTRLVTVDKVGGPGENYDDLAASLPND  67

Query  355  DCRYAVYDFDFVTSENCQKSKI  420
            DCRYAV+DFDFVT +NC+KSKI
Sbjct  68   DCRYAVFDFDFVTVDNCRKSKI  89



>gb|KHG30750.1| Actin-depolymerizing factor 5 -like protein [Gossypium arboreum]
Length=143

 Score =   111 bits (277),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  ASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPEN  354
            A++GM V D  K+++ME++ KKVHRY++FKIDEK + V V+K GGP ESYDD  ASLP +
Sbjct  8    ATTGMWVTDECKNSFMEMKWKKVHRYIVFKIDEKSRLVTVDKVGGPGESYDDLAASLPTD  67

Query  355  DCRYAVYDFDFVTSENCQKSKI  420
            DCRYAV+DFDFVT +NC+KSKI
Sbjct  68   DCRYAVFDFDFVTVDNCRKSKI  89



>sp|Q9FVI2.1|ADF1_PETHY RecName: Full=Actin-depolymerizing factor 1; Short=ADF-1 [Petunia 
x hybrida]
 gb|AAG16973.1|AF183903_1 actin-depolymerizing factor 1 [Petunia x hybrida]
 gb|AAK72617.1| actin-depolymerizing factor 1 [Petunia x hybrida]
Length=139

 Score =   111 bits (277),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ HR++++KI+EK+K+VVVEK G P ESY+DF ASLP
Sbjct  2    ANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVVVEKIGEPTESYEDFAASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            EN+CRYAVYDFDFVT+ENCQKS+I
Sbjct  62   ENECRYAVYDFDFVTAENCQKSRI  85



>gb|ADV02778.1| actin depolymerizing factor 1 [Ipomoea batatas]
Length=139

 Score =   111 bits (277),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ HR+++FKI+EK+K+V+VEK G PA SY+DFTASLP
Sbjct  2    ANAASGMAVHDDCKLRFLELKAKRTHRFIVFKIEEKQKQVIVEKVGEPARSYEDFTASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             ++CRYAVYDFDFVT+ENCQKSKI
Sbjct  62   TDECRYAVYDFDFVTAENCQKSKI  85



>ref|XP_010246837.1| PREDICTED: actin-depolymerizing factor 5-like [Nelumbo nucifera]
Length=144

 Score =   110 bits (276),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  ASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPEN  354
            A++GM V D  ++++M L+ KKVHRY++FKIDE+ + V V+K GGPAESYDD  ASLP++
Sbjct  8    ATTGMWVTDECRNSFMALKWKKVHRYIVFKIDERSRLVTVDKVGGPAESYDDMAASLPDD  67

Query  355  DCRYAVYDFDFVTSENCQKSKI  420
            DCRYAV+DFDFVT +NC+KSKI
Sbjct  68   DCRYAVFDFDFVTVDNCRKSKI  89



>ref|XP_008680099.1| PREDICTED: actin-depolymerizing factor isoform X1 [Zea mays]
Length=150

 Score =   110 bits (276),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +1

Query  154  MSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDF  333
             ++ G  + + + V + SKS +MEL+R+KVHRYVIFKID+ ++EVVV+K G P ESYDDF
Sbjct  6    FAAMGGGSPAWIDVPERSKSAFMELKRRKVHRYVIFKIDDSREEVVVDKIGAPGESYDDF  65

Query  334  TASLPENDCRYAVYDFDFVTSENCQKSKI  420
            TASLP +DCRYAVYD DFV+ +NC+KSKI
Sbjct  66   TASLPTDDCRYAVYDLDFVSDDNCRKSKI  94



>ref|XP_009350564.1| PREDICTED: actin-depolymerizing factor 5 [Pyrus x bretschneideri]
Length=143

 Score =   110 bits (276),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  ASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPEN  354
            A++GM V D  K ++ME++ KKVHRY++FKIDE  + V V+K GGPAE+YDD  ASLP++
Sbjct  8    ATTGMWVTDECKKSFMEMKWKKVHRYIVFKIDEGSRLVTVDKVGGPAENYDDLAASLPKD  67

Query  355  DCRYAVYDFDFVTSENCQKSKI  420
            DCRYAV+DFDFVT +NC+KSK+
Sbjct  68   DCRYAVFDFDFVTVDNCRKSKL  89



>gb|KHG16525.1| Actin-depolymerizing factor 5 -like protein [Gossypium arboreum]
Length=143

 Score =   110 bits (275),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  ASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPEN  354
            A++GM V D  K+++ME++ KKVHRY++FKIDEK + V V+K GGP ESYDD TASLP +
Sbjct  8    ATTGMWVTDDCKNSFMEMKWKKVHRYIVFKIDEKSRRVTVDKVGGPGESYDDLTASLPID  67

Query  355  DCRYAVYDFDFVTSENCQKSKI  420
            DCRYAV+DFDFVT +NC+KSK+
Sbjct  68   DCRYAVFDFDFVTVDNCRKSKL  89



>ref|NP_001151845.1| actin-depolymerizing factor [Zea mays]
 gb|ACG44571.1| actin-depolymerizing factor [Zea mays]
 tpg|DAA45971.1| TPA: actin-depolymerizing factor [Zea mays]
Length=153

 Score =   110 bits (276),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +1

Query  166  GANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASL  345
            G  + + + V + SKS +MEL+R+KVHRYVIFKID+ ++EVVV+K G P ESYDDFTASL
Sbjct  13   GGGSPAWIDVPERSKSAFMELKRRKVHRYVIFKIDDSREEVVVDKIGAPGESYDDFTASL  72

Query  346  PENDCRYAVYDFDFVTSENCQKSKI  420
            P +DCRYAVYD DFV+ +NC+KSKI
Sbjct  73   PTDDCRYAVYDLDFVSDDNCRKSKI  97



>ref|XP_004246462.1| PREDICTED: actin-depolymerizing factor 1 [Solanum lycopersicum]
Length=139

 Score =   110 bits (274),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ HR+++FKI+EK+K+VVVEK G PA+ Y+DFTA LP
Sbjct  2    ANAASGMAVHDDCKLRFLELKAKRTHRFIVFKIEEKQKQVVVEKVGEPAQGYEDFTACLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            +N+CRYAVYDFDFVT+ENCQKS+I
Sbjct  62   DNECRYAVYDFDFVTAENCQKSRI  85



>gb|KEH30501.1| cofilin/actin-depolymerizing factor-like protein [Medicago truncatula]
Length=143

 Score =   110 bits (274),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  ASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPEN  354
            A++GM V D  K+++ME++ KKVHRY++FKIDEK + V V+K GGP E+YDD  ASLP +
Sbjct  8    ATTGMWVTDECKNSFMEMKWKKVHRYIVFKIDEKTRLVTVDKVGGPGENYDDLAASLPND  67

Query  355  DCRYAVYDFDFVTSENCQKSKI  420
            DCRYAV+DFDFVT +NC+KSKI
Sbjct  68   DCRYAVFDFDFVTVDNCRKSKI  89



>gb|ABK21557.1| unknown [Picea sitchensis]
Length=166

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V +  K  ++EL+ K+ HR++ FKIDEK +++ V+K G P ++YDDFTASLP
Sbjct  2    ANAASGMAVDNECKIKFLELKSKRTHRFITFKIDEKLQQITVDKIGNPGQTYDDFTASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            E +CRYAVYDFDFVT ENCQKSKI
Sbjct  62   EKECRYAVYDFDFVTEENCQKSKI  85



>gb|AAG13444.1|AC051634_25 putative actin depolymerizing factor [Oryza sativa Japonica Group]
 gb|AAM92296.1| putative actin depolymerizing factor [Oryza sativa Japonica Group]
 gb|EAY79238.1| hypothetical protein OsI_34355 [Oryza sativa Indica Group]
Length=153

 Score =   110 bits (274),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +1

Query  166  GANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASL  345
            G  + + + V + SKS + EL+R+KVHRYVIFKID++++E+VVEKTG P ESYDDFTASL
Sbjct  13   GGGSPAWIEVPEKSKSAFWELKRRKVHRYVIFKIDDRREEIVVEKTGAPGESYDDFTASL  72

Query  346  PENDCRYAVYDFDFVTSENCQKSKI  420
            P +DCRYAVYD DFV+ +NC+KSKI
Sbjct  73   PADDCRYAVYDLDFVSDDNCRKSKI  97



>tpg|DAA45970.1| TPA: hypothetical protein ZEAMMB73_645058 [Zea mays]
Length=191

 Score =   111 bits (277),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +1

Query  154  MSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDF  333
             ++ G  + + + V + SKS +MEL+R+KVHRYVIFKID+ ++EVVV+K G P ESYDDF
Sbjct  47   FAAMGGGSPAWIDVPERSKSAFMELKRRKVHRYVIFKIDDSREEVVVDKIGAPGESYDDF  106

Query  334  TASLPENDCRYAVYDFDFVTSENCQKSKI  420
            TASLP +DCRYAVYD DFV+ +NC+KSKI
Sbjct  107  TASLPTDDCRYAVYDLDFVSDDNCRKSKI  135



>ref|XP_009789824.1| PREDICTED: actin-depolymerizing factor 5-like [Nicotiana sylvestris]
Length=143

 Score =   109 bits (273),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  ASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPEN  354
            A++GM V D  K++YME++ KKVHRY+++KIDEK + V V+K GGP E+Y+DF A+LP++
Sbjct  8    ATTGMWVTDECKNSYMEMKWKKVHRYIVYKIDEKSRLVTVDKVGGPGENYEDFAAALPKD  67

Query  355  DCRYAVYDFDFVTSENCQKSKI  420
            DCRYAV+DFDFVT +NC+KSKI
Sbjct  68   DCRYAVFDFDFVTVDNCRKSKI  89



>gb|EPS63340.1| hypothetical protein M569_11446, partial [Genlisea aurea]
Length=138

 Score =   109 bits (273),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ +R++IFKI++K+K+VVVEK G PA+ Y+DFTASLP
Sbjct  1    ANAASGMAVHDECKLRFLELKAKRTYRFIIFKIEDKQKQVVVEKVGDPAQGYEDFTASLP  60

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             N+CRYAVYDFDFVT+ENCQKS+I
Sbjct  61   ANECRYAVYDFDFVTAENCQKSRI  84



>ref|XP_010266805.1| PREDICTED: actin-depolymerizing factor 5-like [Nelumbo nucifera]
Length=144

 Score =   109 bits (273),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  ASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPEN  354
            A++GM V D  + ++M L+ KKVHRY++FKIDE+ + V V+K GGPAESYDD  ASLP +
Sbjct  8    ATTGMWVTDECRDSFMALKWKKVHRYIVFKIDERSRLVTVDKVGGPAESYDDMAASLPND  67

Query  355  DCRYAVYDFDFVTSENCQKSKI  420
            DCRYAV+DFDFVT +NC+KSKI
Sbjct  68   DCRYAVFDFDFVTVDNCRKSKI  89



>ref|XP_008372904.1| PREDICTED: actin-depolymerizing factor 5-like [Malus domestica]
Length=143

 Score =   109 bits (273),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  ASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPEN  354
            A++GM V D  K+++ME++ KKVHRY++FKIDE+ + V V+K GGP E+YDD  ASLP++
Sbjct  8    ATTGMWVTDECKNSFMEMKWKKVHRYIVFKIDEESRLVTVDKVGGPGENYDDLAASLPKD  67

Query  355  DCRYAVYDFDFVTSENCQKSKI  420
            DCRYAV+DFDFVT +NC+KSK+
Sbjct  68   DCRYAVFDFDFVTVDNCRKSKL  89



>ref|XP_010669849.1| PREDICTED: actin-depolymerizing factor 4-like [Beta vulgaris 
subsp. vulgaris]
Length=139

 Score =   109 bits (272),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ +R++IFKI+EK+K+V+VEK G P+ESY+DFTAS+P
Sbjct  2    ANAASGMAVDDQCKLKFLELKTKRTYRFIIFKIEEKQKQVIVEKVGEPSESYEDFTASIP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             ++CRYAVYDFDFVT+ENCQKS+I
Sbjct  62   ADECRYAVYDFDFVTAENCQKSRI  85



>ref|NP_001065088.1| Os10g0521100 [Oryza sativa Japonica Group]
 sp|Q337A5.1|ADF10_ORYSJ RecName: Full=Actin-depolymerizing factor 10; Short=ADF-10; Short=OsADF10 
[Oryza sativa Japonica Group]
 gb|ABB47897.1| Actin-depolymerizing factor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27002.1| Os10g0521100 [Oryza sativa Japonica Group]
 dbj|BAG88993.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00635.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51279.1| hypothetical protein OsJ_32187 [Oryza sativa Japonica Group]
Length=151

 Score =   109 bits (273),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +1

Query  166  GANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASL  345
            G  + + + V + SKS + EL+R+KVHRYVIFKID++++E+VVEKTG P ESYDDFTASL
Sbjct  11   GGGSPAWIEVPEKSKSAFWELKRRKVHRYVIFKIDDRREEIVVEKTGAPGESYDDFTASL  70

Query  346  PENDCRYAVYDFDFVTSENCQKSKI  420
            P +DCRYAVYD DFV+ +NC+KSKI
Sbjct  71   PADDCRYAVYDLDFVSDDNCRKSKI  95



>ref|XP_007041872.1| Actin depolymerizing factor 5 [Theobroma cacao]
 gb|EOX97703.1| Actin depolymerizing factor 5 [Theobroma cacao]
Length=187

 Score =   110 bits (276),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  ASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPEN  354
            A++GM V D  K+++ME++ KKVHRY++FKIDEK + V V+K GGP ESYDD  ASLP +
Sbjct  52   ATTGMWVTDECKNSFMEMKWKKVHRYIVFKIDEKSRLVTVDKVGGPGESYDDLAASLPTD  111

Query  355  DCRYAVYDFDFVTSENCQKSKI  420
            DCRYAV+DFDFVT +NC+KSKI
Sbjct  112  DCRYAVFDFDFVTVDNCRKSKI  133



>ref|XP_008804935.1| PREDICTED: actin-depolymerizing factor isoform X2 [Phoenix dactylifera]
Length=139

 Score =   109 bits (272),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            AN++SGM V D  K  ++EL+ K+  R++IFKIDEK ++V VEK G P ESYDDFTASLP
Sbjct  2    ANSASGMAVNDECKLKFLELKAKRNFRFIIFKIDEKIQQVSVEKLGQPDESYDDFTASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             N+CRYAV+DFDFVT ENCQKSKI
Sbjct  62   ANECRYAVFDFDFVTDENCQKSKI  85



>ref|XP_009353719.1| PREDICTED: actin-depolymerizing factor 1-like [Pyrus x bretschneideri]
 ref|XP_009338379.1| PREDICTED: actin-depolymerizing factor 1-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009338380.1| PREDICTED: actin-depolymerizing factor 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=139

 Score =   109 bits (272),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SG  V D  K  ++EL+ K+ +R+++FKIDEKK EV+VEK G PAESY+DFTA+LP
Sbjct  2    ANAASGFAVDDDCKLKFLELKAKRTYRFIVFKIDEKKNEVIVEKLGEPAESYEDFTANLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            +N+CRYAVYDFDFVT+ENCQKS+I
Sbjct  62   DNECRYAVYDFDFVTAENCQKSRI  85



>gb|AFK43299.1| unknown [Medicago truncatula]
Length=173

 Score =   110 bits (274),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  ASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPEN  354
            A++GM V D  K+++ME++ KKVHRY++FKIDEK + V V+K GGP E+YDD  ASLP +
Sbjct  8    ATTGMWVTDECKNSFMEMKWKKVHRYIVFKIDEKTRLVTVDKVGGPGENYDDLAASLPND  67

Query  355  DCRYAVYDFDFVTSENCQKSKI  420
            DCRYAV+DFDFVT +NC+KSKI
Sbjct  68   DCRYAVFDFDFVTVDNCRKSKI  89



>ref|XP_009111466.1| PREDICTED: actin-depolymerizing factor 8 [Brassica rapa]
Length=139

 Score =   109 bits (272),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            AN++SGM V D  K  +MEL+ K+ +RY++FKIDEK +EV +EK G P E+YDDFT S+P
Sbjct  2    ANSASGMHVNDECKVKFMELKAKRTYRYIVFKIDEKAQEVQIEKLGNPQETYDDFTNSIP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            EN+CRYA+YDFDF T +NCQKSKI
Sbjct  62   ENECRYAIYDFDFTTEDNCQKSKI  85



>ref|XP_006396264.1| hypothetical protein EUTSA_v10029050mg [Eutrema salsugineum]
 gb|ESQ37717.1| hypothetical protein EUTSA_v10029050mg [Eutrema salsugineum]
Length=141

 Score =   108 bits (271),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            AN++SGM V+D  K  ++EL+ K+ +R+++FKIDE  ++V +EK G P E+YDDFT S+P
Sbjct  4    ANSASGMNVSDECKLKFLELKAKRTYRFIVFKIDENAQQVQIEKLGNPEETYDDFTNSIP  63

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            EN+CRYAVYDFDF T +NCQKSKI
Sbjct  64   ENECRYAVYDFDFTTEDNCQKSKI  87



>ref|XP_008385142.1| PREDICTED: actin-depolymerizing factor 1-like [Malus domestica]
Length=132

 Score =   108 bits (271),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SG  V D  K  ++EL+ K+ +R+++FKIDEKK EV+VEK G PAESY+DFTA+LP
Sbjct  2    ANAASGFXVDDDCKLKFLELKAKRTYRFIVFKIDEKKNEVIVEKLGXPAESYEDFTANLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            +N+CRYAVYDFDFVT+ENCQKS+I
Sbjct  62   DNECRYAVYDFDFVTAENCQKSRI  85



>gb|KHN39884.1| Actin-depolymerizing factor 5 [Glycine soja]
Length=143

 Score =   108 bits (271),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  ASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPEN  354
            A++GM V D  K+++ME++ KKVHRY++FKIDEK + V V+K GGP ESY D  ASLP++
Sbjct  8    ATTGMWVTDECKNSFMEMKWKKVHRYIVFKIDEKSRLVTVDKVGGPGESYGDLAASLPDD  67

Query  355  DCRYAVYDFDFVTSENCQKSKI  420
            DCRYAV+DFDFVT +NC+KSKI
Sbjct  68   DCRYAVFDFDFVTVDNCRKSKI  89



>ref|NP_001236835.1| uncharacterized protein LOC100526982 [Glycine max]
 gb|ACU16018.1| unknown [Glycine max]
 gb|KHN05406.1| Actin-depolymerizing factor 5 [Glycine soja]
Length=143

 Score =   108 bits (271),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  ASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPEN  354
            A++GM V D  K+++ME++ KKVHRY++FKIDEK + V V+K GGP ESY D  ASLP++
Sbjct  8    ATTGMWVTDECKNSFMEMKWKKVHRYIVFKIDEKSRLVTVDKVGGPGESYGDLAASLPDD  67

Query  355  DCRYAVYDFDFVTSENCQKSKI  420
            DCRYAV+DFDFVT +NC+KSKI
Sbjct  68   DCRYAVFDFDFVTVDNCRKSKI  89



>ref|XP_011094831.1| PREDICTED: actin-depolymerizing factor 1 isoform X2 [Sesamum 
indicum]
Length=139

 Score =   108 bits (271),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ HR+++FKI+EK+K+VVVEK G P ++YDDFTASLP
Sbjct  2    ANAASGMAVHDDCKLRFLELKAKRTHRFIVFKIEEKQKQVVVEKVGEPTQNYDDFTASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             ++CRYAVYDFDFVT+ENCQKS+I
Sbjct  62   VDECRYAVYDFDFVTAENCQKSRI  85



>ref|XP_008788089.1| PREDICTED: actin-depolymerizing factor 7-like [Phoenix dactylifera]
Length=139

 Score =   108 bits (271),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ HR++IFKIDEK K+V+VEK G P  SY+DFTA+LP
Sbjct  2    ANAASGMAVNDDCKLKFLELKAKRTHRFIIFKIDEKLKQVIVEKVGEPTMSYEDFTAALP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             ++CRYA+YDFDFVT ENCQKSKI
Sbjct  62   ADECRYAIYDFDFVTEENCQKSKI  85



>ref|XP_010053689.1| PREDICTED: actin-depolymerizing factor [Eucalyptus grandis]
 gb|KCW78051.1| hypothetical protein EUGRSUZ_D02275 [Eucalyptus grandis]
Length=139

 Score =   108 bits (271),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            AN++SGM V D  K  ++EL+ K+ HR+++FKIDEK ++V VEK G P E+YDDFTA +P
Sbjct  2    ANSASGMAVNDECKLKFLELKAKRNHRFIVFKIDEKIQQVSVEKVGSPEETYDDFTACMP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             N+CRYAV+DFDF+T ENCQKSKI
Sbjct  62   ANECRYAVFDFDFITDENCQKSKI  85



>ref|XP_009358343.1| PREDICTED: actin-depolymerizing factor 1-like [Pyrus x bretschneideri]
Length=139

 Score =   108 bits (271),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SG  V D  K  ++EL+ K+ +R+++FKIDEKK EV+VEK G PAESY+DFTA+LP
Sbjct  2    ANAASGFAVNDDCKLKFLELKAKRTYRFIVFKIDEKKNEVIVEKLGQPAESYEDFTANLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            +N+CRYAVYDFDFVT ENCQKS+I
Sbjct  62   DNECRYAVYDFDFVTVENCQKSRI  85



>ref|XP_002273958.2| PREDICTED: actin-depolymerizing factor 1-like [Vitis vinifera]
 emb|CBI32606.3| unnamed protein product [Vitis vinifera]
Length=189

 Score =   110 bits (274),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +1

Query  157  SSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFT  336
            +++ ANA+SGM V D  K  ++EL+ K+ +R+++FKI+EK+K+VVVEK G PA+SY+DFT
Sbjct  48   TAKMANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPAQSYEDFT  107

Query  337  ASLPENDCRYAVYDFDFVTSENCQKSKI  420
            ASLP ++CRYAVYDFDFVT ENCQKS+I
Sbjct  108  ASLPADECRYAVYDFDFVTEENCQKSRI  135



>ref|XP_008357628.1| PREDICTED: actin-depolymerizing factor 1-like [Malus domestica]
Length=139

 Score =   108 bits (270),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SG  V D  K  ++EL+ K+ +R+++FKIDEKK EV+VEK G PAESY+DFTA+LP
Sbjct  2    ANAASGFAVNDDCKLKFLELKAKRTYRFIVFKIDEKKNEVIVEKLGEPAESYEDFTANLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            +N+CRYAVYDFDFVT ENCQKS+I
Sbjct  62   DNECRYAVYDFDFVTVENCQKSRI  85



>ref|XP_011094830.1| PREDICTED: actin-depolymerizing factor 1 isoform X1 [Sesamum 
indicum]
Length=150

 Score =   108 bits (271),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ HR+++FKI+EK+K+VVVEK G P ++YDDFTASLP
Sbjct  13   ANAASGMAVHDDCKLRFLELKAKRTHRFIVFKIEEKQKQVVVEKVGEPTQNYDDFTASLP  72

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             ++CRYAVYDFDFVT+ENCQKS+I
Sbjct  73   VDECRYAVYDFDFVTAENCQKSRI  96



>gb|AEZ00870.1| putative actin depolymerizing factor protein, partial [Elaeis 
guineensis]
Length=179

 Score =   109 bits (273),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ HRY+IFKIDEK K+V+VEK G P  SY+DFTA+LP
Sbjct  42   ANAASGMAVNDDCKLKFLELKAKRTHRYIIFKIDEKLKQVIVEKVGEPTLSYEDFTAALP  101

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             ++CRYA+YDFDFVT ENCQKSKI
Sbjct  102  ADECRYAIYDFDFVTEENCQKSKI  125



>ref|XP_010028714.1| PREDICTED: actin-depolymerizing factor 5 [Eucalyptus grandis]
 gb|KCW55508.1| hypothetical protein EUGRSUZ_I01401 [Eucalyptus grandis]
Length=143

 Score =   108 bits (271),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  ASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPEN  354
            A++GM VAD  KS++ME++ KKVHR+++FKIDEK + V V+K GGP E +D+  ASLP +
Sbjct  8    ATTGMWVADECKSSFMEMKWKKVHRFIVFKIDEKSRLVTVDKVGGPGEGFDELAASLPND  67

Query  355  DCRYAVYDFDFVTSENCQKSKI  420
            DCRYAV+DFDFVT +NC+KSKI
Sbjct  68   DCRYAVFDFDFVTVDNCRKSKI  89



>ref|XP_008385227.1| PREDICTED: actin-depolymerizing factor 1-like, partial [Malus 
domestica]
Length=147

 Score =   108 bits (271),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SG  V D  K  ++EL+ K+ +R+++FKIDEKK EV+VEK G PAESY+DFTA+LP
Sbjct  10   ANAASGFXVDDDCKLKFLELKAKRTYRFIVFKIDEKKNEVIVEKLGXPAESYEDFTANLP  69

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            +N+CRYAVYDFDFVT+ENCQKS+I
Sbjct  70   DNECRYAVYDFDFVTAENCQKSRI  93



>ref|XP_009421345.1| PREDICTED: actin-depolymerizing factor 7-like [Musa acuminata 
subsp. malaccensis]
Length=139

 Score =   108 bits (270),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ +R+++FKIDEK K+V+VE  G P  +YDDFTASLP
Sbjct  2    ANAASGMAVNDDCKLKFLELKAKRTYRFIVFKIDEKLKQVIVETLGEPNLTYDDFTASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             N+CRYA+YDFDFVT ENCQKSKI
Sbjct  62   TNECRYAIYDFDFVTEENCQKSKI  85



>ref|XP_007131700.1| hypothetical protein PHAVU_011G034600g [Phaseolus vulgaris]
 gb|ESW03694.1| hypothetical protein PHAVU_011G034600g [Phaseolus vulgaris]
Length=143

 Score =   108 bits (270),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  ASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPEN  354
            A++GM V D  K+++ME++ KKVHRY++FKIDEK + V V+K GGP ESY D  ASLP +
Sbjct  8    ATTGMWVTDECKNSFMEMKWKKVHRYIVFKIDEKSRLVTVDKVGGPGESYGDLAASLPND  67

Query  355  DCRYAVYDFDFVTSENCQKSKI  420
            DCRYAV+DFDFVT +NC+KSKI
Sbjct  68   DCRYAVFDFDFVTVDNCRKSKI  89



>gb|KDP29633.1| hypothetical protein JCGZ_18795 [Jatropha curcas]
Length=143

 Score =   108 bits (270),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  ASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPEN  354
            A++GM V D  K+++ME++ KKVHR+++FKIDEK + V V+K GGP E YD+  ASLP++
Sbjct  8    ATTGMWVTDECKNSFMEMKWKKVHRFIVFKIDEKSRLVTVDKVGGPGEGYDELAASLPDD  67

Query  355  DCRYAVYDFDFVTSENCQKSKI  420
            DCRYAVYDFDFVT +NC+KSKI
Sbjct  68   DCRYAVYDFDFVTVDNCRKSKI  89



>gb|KHG06644.1| Actin-depolymerizing factor 1 [Gossypium arboreum]
Length=139

 Score =   108 bits (270),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ +R+++FKI+EK+K+VVVEK G P++SYDDFTASLP
Sbjct  2    ANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKLGEPSQSYDDFTASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             ++CRYAVYDFDFVT+ENCQKS+I
Sbjct  62   ADECRYAVYDFDFVTAENCQKSRI  85



>ref|XP_002533101.1| actin depolymerizing factor, putative [Ricinus communis]
 gb|EEF29273.1| actin depolymerizing factor, putative [Ricinus communis]
Length=139

 Score =   108 bits (269),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ +R+++FKI+EK+K+V+VEK G PA+SY+DFTASLP
Sbjct  2    ANAASGMAVHDDCKLRFLELKAKRTYRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             ++CRYAVYDFDFVT+ENCQKS+I
Sbjct  62   ADECRYAVYDFDFVTAENCQKSRI  85



>gb|KHG23104.1| Actin-depolymerizing factor 1 [Gossypium arboreum]
Length=139

 Score =   108 bits (269),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ +RY++FKI+EK+K+VVVEK G P++SYDDFT+SLP
Sbjct  2    ANAASGMAVHDDCKLKFLELKAKRTYRYIVFKIEEKQKQVVVEKLGEPSQSYDDFTSSLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             ++CRYAVYDFDFVT+ENCQKS+I
Sbjct  62   ADECRYAVYDFDFVTAENCQKSRI  85



>gb|ABK94603.1| unknown [Populus trichocarpa]
Length=139

 Score =   108 bits (269),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ HR+++FKI+EK+K+V+VEK G P +SY+DFTASLP
Sbjct  2    ANAASGMAVHDDCKLKFLELKAKRTHRFIVFKIEEKQKQVIVEKLGKPTDSYEDFTASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             N+CRYAVYDFD+VT ENCQKS+I
Sbjct  62   ANECRYAVYDFDYVTDENCQKSRI  85



>ref|XP_002277796.1| PREDICTED: actin-depolymerizing factor 5 [Vitis vinifera]
 emb|CBI37889.3| unnamed protein product [Vitis vinifera]
Length=143

 Score =   108 bits (270),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  ASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPEN  354
            A++GM V D  K+++ME++ KKVHRY++FKIDE  K V V+K GGP E YD+  ASLP +
Sbjct  8    ATTGMWVTDECKNSFMEMKWKKVHRYIVFKIDEGSKLVTVDKVGGPGEGYDELAASLPTD  67

Query  355  DCRYAVYDFDFVTSENCQKSKI  420
            DCRYAV+DFDFVT++NC+KSKI
Sbjct  68   DCRYAVFDFDFVTNDNCRKSKI  89



>ref|XP_008438059.1| PREDICTED: actin-depolymerizing factor 7-like [Cucumis melo]
Length=139

 Score =   108 bits (269),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            AN+SSGM V D  K  +++L+ K+ +R+++FKI+EK ++V VEK GGP E+YDDFTAS+P
Sbjct  2    ANSSSGMAVHDECKLKFLDLKAKRKYRFIVFKIEEKMQQVTVEKVGGPDETYDDFTASIP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             N+CRYAVYDFDF T ENCQKSKI
Sbjct  62   ANECRYAVYDFDFTTEENCQKSKI  85



>gb|EYU26572.1| hypothetical protein MIMGU_mgv1a015955mg [Erythranthe guttata]
Length=139

 Score =   108 bits (269),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ HR+++FKI+EK+K+V+VEK G P ESY+DFTASLP
Sbjct  2    ANAASGMAVHDDCKLRFLELKAKRSHRFIVFKIEEKQKQVIVEKVGEPNESYEDFTASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             ++CRY VYDFDFVT+ENCQKSKI
Sbjct  62   ADECRYTVYDFDFVTAENCQKSKI  85



>gb|KCW49773.1| hypothetical protein EUGRSUZ_K03264 [Eucalyptus grandis]
Length=121

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 67/67 (100%), Gaps = 0/67 (0%)
 Frame = +1

Query  220  MELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPENDCRYAVYDFDFVTSE  399
            M+L+RK+VHRYVIF+IDEKKKEVVVEKTGGPAESY+DFTA+LP+NDCRYAVYD+DFVTS+
Sbjct  1    MDLKRKRVHRYVIFQIDEKKKEVVVEKTGGPAESYEDFTAALPQNDCRYAVYDYDFVTSD  60

Query  400  NCQKSKI  420
            NCQKSKI
Sbjct  61   NCQKSKI  67



>ref|XP_002311154.2| hypothetical protein POPTR_0008s05210g [Populus trichocarpa]
 gb|EEE88521.2| hypothetical protein POPTR_0008s05210g [Populus trichocarpa]
Length=218

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  QMSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDD  330
            Q   + ANA+SGM V D  K  ++EL+ K+ HR+++FKI+EK+K+V+VEK G P +SY+D
Sbjct  75   QNREKMANAASGMAVHDDCKLKFLELKAKRTHRFIVFKIEEKQKQVIVEKLGKPTDSYED  134

Query  331  FTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            FTASLP N+CRYAVYDFD+VT ENCQKS+I
Sbjct  135  FTASLPANECRYAVYDFDYVTDENCQKSRI  164



>ref|XP_010479839.1| PREDICTED: actin-depolymerizing factor 10 [Camelina sativa]
 ref|XP_010457085.1| PREDICTED: actin-depolymerizing factor 10 [Camelina sativa]
 ref|XP_010474795.1| PREDICTED: actin-depolymerizing factor 10 [Camelina sativa]
Length=140

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            AN++SGM V+D  K  ++EL+ K+ +RY+IFKIDEK ++V+++K G P E+YDDFT S+P
Sbjct  2    ANSASGMHVSDECKLKFLELKAKRNYRYIIFKIDEKAQQVMIDKLGNPEETYDDFTGSIP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            E++CRYAVYDFDF T ENCQKSKI
Sbjct  62   EDECRYAVYDFDFTTPENCQKSKI  85



>ref|XP_011077447.1| PREDICTED: actin-depolymerizing factor 1-like [Sesamum indicum]
Length=173

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ +R++IFKI+EK+K+VVVEK G P +SYDDFTASLP
Sbjct  36   ANAASGMAVHDDCKLRFLELKAKRTYRFIIFKIEEKQKQVVVEKVGEPTQSYDDFTASLP  95

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             ++CRYAVYDFDFVT+ENCQKS+I
Sbjct  96   VDECRYAVYDFDFVTAENCQKSRI  119



>ref|XP_010503215.1| PREDICTED: actin-depolymerizing factor 1-like [Camelina sativa]
Length=139

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  +MEL+ K+ HR++++KI+EK K+VVVEK G P ++YDDF ASLP
Sbjct  2    ANAASGMAVHDDCKLRFMELKAKRTHRFIVYKIEEKLKQVVVEKVGEPIQTYDDFAASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             ++CRYA+YDFDFVT+ENCQKSKI
Sbjct  62   ADECRYAIYDFDFVTAENCQKSKI  85



>ref|XP_010514926.1| PREDICTED: actin-depolymerizing factor 1 [Camelina sativa]
Length=139

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  +MEL+ K+ HR++++KI+EK+K+VVVEK G P ++YDDF ASLP
Sbjct  2    ANAASGMAVHDDCKLRFMELKAKRTHRFIVYKIEEKQKQVVVEKVGEPIQTYDDFAASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             ++CRYA+YDFDFVT+ENCQKSKI
Sbjct  62   ADECRYAIYDFDFVTAENCQKSKI  85



>gb|AEG76940.1| putative ADF, partial [Fragaria x ananassa]
 gb|AEG76941.1| putative ADF, partial [Fragaria x ananassa]
Length=95

 Score =   106 bits (264),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  ASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPEN  354
            A++GM V D  K+++ME++ KKV RY+++KIDE  + V V+K GGP ESYDD  ASLP++
Sbjct  8    ATTGMWVTDECKNSFMEMKWKKVARYIVYKIDEGSRLVTVDKVGGPGESYDDLAASLPKD  67

Query  355  DCRYAVYDFDFVTSENCQKSKI  420
            DCRYAV+DFDFVT +NC+KSKI
Sbjct  68   DCRYAVFDFDFVTVDNCKKSKI  89



>ref|XP_010253266.1| PREDICTED: actin-depolymerizing factor 2 [Nelumbo nucifera]
Length=139

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ +R+++FKI+EK+K+VVVEK G P ESY+DFTASLP
Sbjct  2    ANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTESYEDFTASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             ++CRYAVYDFDFVT ENCQKS+I
Sbjct  62   ADECRYAVYDFDFVTEENCQKSRI  85



>ref|XP_004249528.1| PREDICTED: actin-depolymerizing factor 1-like [Solanum lycopersicum]
Length=139

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K T++EL+ K+ HR+++FKI+EK+K+VVVEK G P +SY+DF  SLP
Sbjct  2    ANAASGMAVHDDCKLTFLELKTKRTHRFIVFKIEEKQKQVVVEKVGEPTQSYEDFAESLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             ++CRYAVYDFDFVT ENCQKS+I
Sbjct  62   ADECRYAVYDFDFVTEENCQKSRI  85



>ref|XP_010669850.1| PREDICTED: actin-depolymerizing factor 4 [Beta vulgaris subsp. 
vulgaris]
Length=139

 Score =   107 bits (267),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ +R++IFKI+EK+K+V+VEK G P+ESY+DF AS+P
Sbjct  2    ANAASGMAVDDQCKLKFLELKTKRTYRFIIFKIEEKQKQVIVEKVGEPSESYEDFAASIP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             ++CRYAVYDFDFVT+ENCQKS+I
Sbjct  62   ADECRYAVYDFDFVTAENCQKSRI  85



>gb|AFK36072.1| unknown [Lotus japonicus]
Length=173

 Score =   108 bits (270),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = +1

Query  145  QKQMSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            Q  M+     A++GM V D  K+++ME++ KKVHRY++FKIDE+ + V V+K GGP ESY
Sbjct  28   QITMAMAFKMATTGMWVTDECKNSFMEMKWKKVHRYIVFKIDERSRLVTVDKVGGPGESY  87

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
             D  ASLP +DCRYAV+DFDFVT +NC+KSKI
Sbjct  88   ADLAASLPGDDCRYAVFDFDFVTVDNCRKSKI  119



>ref|XP_007218574.1| hypothetical protein PRUPE_ppa013108mg [Prunus persica]
 gb|EMJ19773.1| hypothetical protein PRUPE_ppa013108mg [Prunus persica]
Length=139

 Score =   107 bits (267),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            AN++SGM V D  K  ++EL+ K+ HR+++FKI+EK ++V+VEK GGP ESYDDF AS+P
Sbjct  2    ANSASGMAVHDDCKLKFLELKAKRNHRFIVFKIEEKIQQVIVEKVGGPDESYDDFAASMP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             ++CRYAVYDFDF T+ENCQKSKI
Sbjct  62   ADECRYAVYDFDFTTNENCQKSKI  85



>ref|XP_008794195.1| PREDICTED: actin-depolymerizing factor-like [Phoenix dactylifera]
Length=139

 Score =   107 bits (267),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            AN++SGM V D  K  ++EL+ K+  R++IFKIDEK ++V VEK G P ESYDDFTASLP
Sbjct  2    ANSASGMAVNDECKLKFLELKTKRNFRFIIFKIDEKIQQVSVEKLGQPDESYDDFTASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             ++CRYAV+DFDFVT ENCQKSKI
Sbjct  62   ADECRYAVFDFDFVTDENCQKSKI  85



>ref|XP_009411533.1| PREDICTED: actin-depolymerizing factor 1-like [Musa acuminata 
subsp. malaccensis]
Length=169

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 79/118 (67%), Gaps = 11/118 (9%)
 Frame = +1

Query  67   IFFPCISCVLPLSCLKSLFCASDFR*QKQMSSRGANASSGMGVADHSKSTYMELQRKKVH  246
            + F CIS    +   K LF               ANA+SGM V+D  K  ++EL+ K+  
Sbjct  9    VLFNCISSGKSMFLFKLLFILE-----------YANAASGMAVSDECKLKFLELKAKRNF  57

Query  247  RYVIFKIDekkkevvvekTGGPAESYDDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            R+++FKIDE+ ++V+V+K G P ESYDDFTASLP ++CRYAV+DFDFVT ENCQKSKI
Sbjct  58   RFIVFKIDERIQQVMVDKLGQPDESYDDFTASLPADECRYAVFDFDFVTDENCQKSKI  115



>ref|XP_006661967.1| PREDICTED: actin-depolymerizing factor 10-like [Oryza brachyantha]
Length=151

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +1

Query  166  GANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASL  345
            G  + + + V + SKS ++EL+R+KVHRYVIFKID++++E+VVEKTG P ESY DFTASL
Sbjct  11   GGGSPAWVEVPEKSKSAFLELKRRKVHRYVIFKIDDRREEIVVEKTGAPGESYADFTASL  70

Query  346  PENDCRYAVYDFDFVTSENCQKSKI  420
            P +DCRYAVYD DFV+ +NC+KSKI
Sbjct  71   PADDCRYAVYDLDFVSDDNCRKSKI  95



>ref|XP_011088592.1| PREDICTED: actin-depolymerizing factor 5-like [Sesamum indicum]
Length=143

 Score =   107 bits (267),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  ASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPEN  354
            A +GM V +  K+++ME++ KK+HRY++FKIDE  K + V+K GGP E YDD  A+LPE+
Sbjct  8    AVTGMWVTEECKNSFMEMKWKKIHRYIVFKIDEGSKLLTVDKVGGPGEGYDDLAAALPED  67

Query  355  DCRYAVYDFDFVTSENCQKSKI  420
            DCRYAV+DFDFVT +NC+KSKI
Sbjct  68   DCRYAVFDFDFVTVDNCRKSKI  89



>gb|KCW88915.1| hypothetical protein EUGRSUZ_A01245 [Eucalyptus grandis]
Length=113

 Score =   106 bits (265),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ +R+++FKI+EK+K+VVVEK G P +SY+DFTASLP
Sbjct  2    ANAASGMAVHDDCKLRFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTQSYEDFTASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             ++CRYAVYDFDFVT ENCQKS+I
Sbjct  62   ADECRYAVYDFDFVTEENCQKSRI  85



>ref|XP_002298043.1| actin-depolymerizing factor family protein [Populus trichocarpa]
 ref|XP_011029242.1| PREDICTED: actin-depolymerizing factor isoform X1 [Populus euphratica]
 gb|EEE82848.1| actin-depolymerizing factor family protein [Populus trichocarpa]
Length=141

 Score =   107 bits (267),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            AN++SGM V D  K  +MEL+ K+ HR+++FKI+EK ++VVVE  G P +SYDDFTASLP
Sbjct  4    ANSASGMAVDDECKLRFMELKAKRSHRFIVFKIEEKIQQVVVETLGEPQQSYDDFTASLP  63

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             N+CRYAVYDFDF T EN QKSKI
Sbjct  64   ANECRYAVYDFDFTTDENVQKSKI  87



>gb|KCW88917.1| hypothetical protein EUGRSUZ_A01245 [Eucalyptus grandis]
Length=114

 Score =   106 bits (265),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ +R+++FKI+EK+K+VVVEK G P +SY+DFTASLP
Sbjct  2    ANAASGMAVHDDCKLRFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTQSYEDFTASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             ++CRYAVYDFDFVT ENCQKS+I
Sbjct  62   ADECRYAVYDFDFVTEENCQKSRI  85



>ref|XP_011029243.1| PREDICTED: actin-depolymerizing factor isoform X2 [Populus euphratica]
Length=139

 Score =   107 bits (266),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            AN++SGM V D  K  +MEL+ K+ HR+++FKI+EK ++VVVE  G P +SYDDFTASLP
Sbjct  2    ANSASGMAVDDECKLRFMELKAKRSHRFIVFKIEEKIQQVVVETLGEPQQSYDDFTASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             N+CRYAVYDFDF T EN QKSKI
Sbjct  62   ANECRYAVYDFDFTTDENVQKSKI  85



>ref|XP_004505784.1| PREDICTED: LOW QUALITY PROTEIN: actin-depolymerizing factor 5-like 
[Cicer arietinum]
Length=178

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  ASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPEN  354
            A++GM V +  K+++ME++ KKVHRY++FKIDE+ + V V+K GGP E+YDD  ASLP +
Sbjct  8    ATTGMWVTEECKNSFMEMKWKKVHRYIVFKIDERSRLVTVDKVGGPGENYDDLAASLPND  67

Query  355  DCRYAVYDFDFVTSENCQKSKI  420
            DCRYAV+DFDFVT +NC+KSKI
Sbjct  68   DCRYAVFDFDFVTVDNCRKSKI  89



>ref|XP_008776502.1| PREDICTED: actin-depolymerizing factor 7 [Phoenix dactylifera]
Length=139

 Score =   107 bits (266),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ +R++IFKI+EK K+V+VEK G P  SY+DFTA+LP
Sbjct  2    ANAASGMAVNDDCKLKFLELKAKRTYRFIIFKIEEKLKQVIVEKLGEPTLSYEDFTAALP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             N+CRYAVYDFDFVT ENCQKSKI
Sbjct  62   ANECRYAVYDFDFVTEENCQKSKI  85



>ref|XP_010535543.1| PREDICTED: actin-depolymerizing factor 4 [Tarenaya hassleriana]
Length=139

 Score =   107 bits (266),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ +R++++KI+E++K+V+VEK G PA++Y+DFTASLP
Sbjct  2    ANAASGMAVHDDCKLRFLELKAKRTYRFIVYKIEEQQKQVIVEKVGEPAQTYEDFTASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             N+CRYA++DFDFVT+ENCQKSKI
Sbjct  62   ANECRYAIFDFDFVTAENCQKSKI  85



>gb|ADI78873.1| actin-depolymerizing factor [Hevea brasiliensis]
Length=139

 Score =   107 bits (266),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ +RY++FKI+EK K+V+VEK G P +SY+DFTASLP
Sbjct  2    ANAASGMAVHDDCKLRFLELKAKRTYRYIVFKIEEKAKQVIVEKLGEPTQSYEDFTASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             ++CRYAVYDFDFVT ENCQKS+I
Sbjct  62   ADECRYAVYDFDFVTEENCQKSRI  85



>ref|XP_007040194.1| Actin depolymerizing factor 8 [Theobroma cacao]
 gb|EOY24695.1| Actin depolymerizing factor 8 [Theobroma cacao]
Length=139

 Score =   107 bits (266),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            AN++SGM V D  K  ++EL+ K+ +R+++FKI+EK ++VVVEK GGP++SYDD +ASLP
Sbjct  2    ANSASGMAVNDECKRKFLELKAKRSYRFIVFKIEEKIQQVVVEKLGGPSDSYDDLSASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             N+CRYAVYDFDF T ENCQKSKI
Sbjct  62   ANECRYAVYDFDFTTDENCQKSKI  85



>gb|KCW88916.1| hypothetical protein EUGRSUZ_A01245 [Eucalyptus grandis]
Length=108

 Score =   106 bits (264),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ +R+++FKI+EK+K+VVVEK G P +SY+DFTASLP
Sbjct  2    ANAASGMAVHDDCKLRFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTQSYEDFTASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             ++CRYAVYDFDFVT ENCQKS+I
Sbjct  62   ADECRYAVYDFDFVTEENCQKSRI  85



>ref|XP_006422623.1| hypothetical protein CICLE_v10029455mg [Citrus clementina]
 ref|XP_006486758.1| PREDICTED: actin-depolymerizing factor 5-like [Citrus sinensis]
 gb|ESR35863.1| hypothetical protein CICLE_v10029455mg [Citrus clementina]
 gb|KDO68020.1| hypothetical protein CISIN_1g031424mg [Citrus sinensis]
Length=143

 Score =   107 bits (266),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  ASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPEN  354
            A++GM VAD  K+++ME++ KKVHRY++FKIDEK K V V+K GG  E Y+D  ASLP++
Sbjct  8    ATTGMWVADECKNSFMEMKWKKVHRYIVFKIDEKSKLVTVDKVGGAGEGYEDLAASLPDD  67

Query  355  DCRYAVYDFDFVTSENCQKSKI  420
            DCRYAV+DFDFVT +NC+KSKI
Sbjct  68   DCRYAVFDFDFVTVDNCRKSKI  89



>ref|XP_010922979.1| PREDICTED: actin-depolymerizing factor 7-like [Elaeis guineensis]
Length=256

 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ HRY+IFKIDEK K+V+VEK G P  SY+DFTA+LP
Sbjct  119  ANAASGMAVNDDCKLKFLELKAKRTHRYIIFKIDEKLKQVIVEKVGEPTLSYEDFTAALP  178

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             ++CRYA+YDFDFVT ENCQKSKI
Sbjct  179  ADECRYAIYDFDFVTEENCQKSKI  202



>ref|XP_009389157.1| PREDICTED: actin-depolymerizing factor 1-like [Musa acuminata 
subsp. malaccensis]
Length=143

 Score =   107 bits (266),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            AN++SGM V+D  K  ++EL+ K+  R+++FKI+EK ++V VE+ G P ESYDD TASLP
Sbjct  6    ANSASGMAVSDECKLKFLELKAKRNFRFIVFKIEEKIQQVKVERLGQPGESYDDLTASLP  65

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
            ++DCRYAV+DFDF+T ENCQKSKI
Sbjct  66   DDDCRYAVFDFDFITDENCQKSKI  89



>ref|XP_010529845.1| PREDICTED: actin-depolymerizing factor 2-like [Tarenaya hassleriana]
Length=139

 Score =   106 bits (265),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA SGM V D  K  ++EL+ K+ +R+++FKI+EK+K+V+VEK G P++SY+DFTASLP
Sbjct  2    ANAVSGMAVHDECKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPSQSYEDFTASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             ++CRYAVYDFDFVT+ENCQKS+I
Sbjct  62   ADECRYAVYDFDFVTAENCQKSRI  85



>ref|XP_006384570.1| hypothetical protein POPTR_0004s17950g [Populus trichocarpa]
 gb|ABK92528.1| unknown [Populus trichocarpa]
 gb|ERP62367.1| hypothetical protein POPTR_0004s17950g [Populus trichocarpa]
Length=109

 Score =   105 bits (263),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  ASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLPEN  354
            A++GM V D  K+++ E++ +KVHRY++FKIDEK + V V+K GGP E YDD  ASLP++
Sbjct  8    ATTGMWVTDECKNSFHEMKWRKVHRYIVFKIDEKSRLVTVDKVGGPGEGYDDLAASLPDD  67

Query  355  DCRYAVYDFDFVTSENCQKSKI  420
            DCRYAV+DFDFVT +NC+KSKI
Sbjct  68   DCRYAVFDFDFVTVDNCRKSKI  89



>ref|XP_009420088.1| PREDICTED: actin-depolymerizing factor 7-like [Musa acuminata 
subsp. malaccensis]
Length=139

 Score =   106 bits (265),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ +R+++FKIDEK K+V+VEK G P   YDDF ASLP
Sbjct  2    ANAASGMAVNDDCKLKFLELKAKRTYRFIVFKIDEKLKQVIVEKVGEPTLGYDDFAASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             N+CRYA+YDFDFVT ENCQKSKI
Sbjct  62   NNECRYAIYDFDFVTEENCQKSKI  85



>ref|XP_006846080.1| hypothetical protein AMTR_s00012p00089320 [Amborella trichopoda]
 gb|ERN07755.1| hypothetical protein AMTR_s00012p00089320 [Amborella trichopoda]
Length=139

 Score =   106 bits (265),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ +RYV+FKI+EK K+V+VEK G P + Y+ FTASLP
Sbjct  2    ANAASGMAVNDECKLKFLELKAKRTYRYVVFKIEEKLKQVIVEKLGEPTDGYEAFTASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             N+CRYAVYDFDFVT ENCQKSKI
Sbjct  62   ANECRYAVYDFDFVTEENCQKSKI  85



>ref|XP_007016496.1| Actin depolymerizing factor 4 [Theobroma cacao]
 gb|EOY34115.1| Actin depolymerizing factor 4 [Theobroma cacao]
Length=139

 Score =   106 bits (265),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  169  ANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESYDDFTASLP  348
            ANA+SGM V D  K  ++EL+ K+ +R+++FKI+EK+K+VVVEK G P +SY+DFTASLP
Sbjct  2    ANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKLGEPTQSYEDFTASLP  61

Query  349  ENDCRYAVYDFDFVTSENCQKSKI  420
             ++CRYAVYDFDFVT+ENCQKS+I
Sbjct  62   ADECRYAVYDFDFVTAENCQKSRI  85



>ref|XP_010096647.1| Actin-depolymerizing factor 2 [Morus notabilis]
 gb|EXB65315.1| Actin-depolymerizing factor 2 [Morus notabilis]
Length=159

 Score =   107 bits (266),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +1

Query  145  QKQMSSRGANASSGMGVADHSKSTYMELQRKKVHRYVIFKIDekkkevvvekTGGPAESY  324
            Q Q S   ANA+SGM V D  K  ++EL+ K+ +R+++FKI+EK+K+V+VEK G P +SY
Sbjct  14   QSQPSDGSANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPTQSY  73

Query  325  DDFTASLPENDCRYAVYDFDFVTSENCQKSKI  420
            +DFTASLP+N+CRYAVYD+DF+T EN QKSKI
Sbjct  74   EDFTASLPDNECRYAVYDYDFITEENVQKSKI  105



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 513297653190