BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1227_g1_i1 len=1562 path=[1540:0-1561]

Length=1562
                                                                      Score     E

ref|XP_009800227.1|  PREDICTED: caffeoylshikimate esterase-like         483   6e-165   
ref|XP_009587884.1|  PREDICTED: caffeoylshikimate esterase-like         480   7e-164   
ref|XP_004233162.1|  PREDICTED: caffeoylshikimate esterase-like         462   9e-157   
emb|CAN63634.1|  hypothetical protein VITISV_009388                     445   5e-150   Vitis vinifera
ref|XP_002263371.1|  PREDICTED: caffeoylshikimate esterase-like         444   8e-150   Vitis vinifera
emb|CDP17301.1|  unnamed protein product                                439   7e-148   
ref|XP_010251778.1|  PREDICTED: caffeoylshikimate esterase-like         427   7e-143   
ref|XP_010245789.1|  PREDICTED: caffeoylshikimate esterase-like         415   2e-138   
ref|XP_011096881.1|  PREDICTED: caffeoylshikimate esterase-like         407   1e-135   
ref|XP_002300571.2|  hypothetical protein POPTR_0001s47090g             396   5e-131   Populus trichocarpa [western balsam poplar]
ref|XP_006448890.1|  hypothetical protein CICLE_v10017467mg             392   2e-129   
ref|XP_011039896.1|  PREDICTED: caffeoylshikimate esterase-like         389   1e-127   
ref|XP_008441075.1|  PREDICTED: caffeoylshikimate esterase-like         381   4e-125   
ref|XP_008794508.1|  PREDICTED: caffeoylshikimate esterase-like         380   7e-125   
ref|XP_006448889.1|  hypothetical protein CICLE_v10015863mg             379   2e-124   
gb|KGN49464.1|  hypothetical protein Csa_6G525500                       379   4e-124   
ref|XP_004158692.1|  PREDICTED: monoglyceride lipase-like               378   5e-124   
gb|EYU19116.1|  hypothetical protein MIMGU_mgv1a027063mg                366   2e-119   
gb|EPS70994.1|  hypothetical protein M569_03765                         365   4e-119   
ref|XP_010923690.1|  PREDICTED: caffeoylshikimate esterase-like         358   3e-116   
gb|KDP34930.1|  hypothetical protein JCGZ_09218                         339   4e-109   
ref|XP_002523188.1|  conserved hypothetical protein                     331   4e-106   Ricinus communis
ref|XP_004307391.1|  PREDICTED: monoglyceride lipase-like               312   2e-98    
ref|XP_006854516.1|  hypothetical protein AMTR_s00175p00065840          307   2e-96    
ref|XP_010534286.1|  PREDICTED: caffeoylshikimate esterase-like i...    305   2e-95    
ref|XP_010524322.1|  PREDICTED: caffeoylshikimate esterase              303   4e-95    
ref|XP_011040996.1|  PREDICTED: caffeoylshikimate esterase              303   9e-95    
ref|XP_008446889.1|  PREDICTED: caffeoylshikimate esterase-like         303   1e-94    
ref|XP_006436421.1|  hypothetical protein CICLE_v10033579mg             303   2e-94    
gb|KDP44357.1|  hypothetical protein JCGZ_20037                         302   2e-94    
ref|XP_004157524.1|  PREDICTED: monoglyceride lipase-like               302   2e-94    
ref|XP_004142429.1|  PREDICTED: monoglyceride lipase-like               302   3e-94    
ref|NP_197002.1|  esterase/lipase/thioesterase family protein           300   1e-93    Arabidopsis thaliana [mouse-ear cress]
gb|AGV54710.1|  monoglyceride lipase                                    300   2e-93    
ref|XP_009120902.1|  PREDICTED: caffeoylshikimate esterase-like         299   4e-93    
ref|XP_002871641.1|  esterase/lipase/thioesterase family protein        298   4e-93    
ref|XP_007143700.1|  hypothetical protein PHAVU_007G094400g             298   4e-93    
ref|XP_009779135.1|  PREDICTED: caffeoylshikimate esterase              298   6e-93    
ref|XP_007009827.1|  Alpha/beta-Hydrolases superfamily protein          298   6e-93    
emb|CDX92543.1|  BnaA10g15820D                                          298   6e-93    
ref|XP_003536355.1|  PREDICTED: caffeoylshikimate esterase-like         298   8e-93    
ref|XP_010492319.1|  PREDICTED: caffeoylshikimate esterase-like         298   9e-93    
ref|XP_010420143.1|  PREDICTED: caffeoylshikimate esterase-like         298   9e-93    
ref|XP_006400484.1|  hypothetical protein EUTSA_v10014061mg             297   2e-92    
gb|EYU39580.1|  hypothetical protein MIMGU_mgv1a009732mg                296   4e-92    
ref|XP_004134900.1|  PREDICTED: monoglyceride lipase-like               294   5e-92    
ref|XP_006288192.1|  hypothetical protein CARUB_v10001430mg             295   7e-92    
gb|KDO44719.1|  hypothetical protein CISIN_1g035721mg                   294   1e-91    
ref|XP_009392259.1|  PREDICTED: caffeoylshikimate esterase-like         295   1e-91    
ref|XP_003591911.1|  Monoglyceride lipase                               295   2e-91    
ref|XP_006400019.1|  hypothetical protein EUTSA_v10014122mg             294   2e-91    
ref|XP_002274887.1|  PREDICTED: caffeoylshikimate esterase              294   3e-91    Vitis vinifera
ref|XP_010067299.1|  PREDICTED: caffeoylshikimate esterase              293   5e-91    
emb|CDY13986.1|  BnaC09g38400D                                          293   6e-91    
ref|XP_007218284.1|  hypothetical protein PRUPE_ppa008391mg             293   1e-90    
emb|CDY44908.1|  BnaA02g04130D                                          293   1e-90    
ref|XP_010492984.1|  PREDICTED: caffeoylshikimate esterase-like         292   2e-90    
ref|XP_010253670.1|  PREDICTED: caffeoylshikimate esterase-like         292   2e-90    
ref|XP_008367428.1|  PREDICTED: caffeoylshikimate esterase-like         291   2e-90    
gb|KFK26173.1|  hypothetical protein AALP_AA8G212300                    291   3e-90    
ref|XP_008347481.1|  PREDICTED: caffeoylshikimate esterase-like         291   3e-90    
ref|XP_010099613.1|  hypothetical protein L484_013404                   291   3e-90    
ref|XP_011084365.1|  PREDICTED: caffeoylshikimate esterase              291   3e-90    
ref|XP_009126022.1|  PREDICTED: caffeoylshikimate esterase              291   3e-90    
ref|XP_009611906.1|  PREDICTED: caffeoylshikimate esterase              291   3e-90    
ref|XP_009345381.1|  PREDICTED: caffeoylshikimate esterase              291   4e-90    
emb|CDP04353.1|  unnamed protein product                                291   4e-90    
ref|XP_010420728.1|  PREDICTED: caffeoylshikimate esterase-like         291   6e-90    
ref|XP_009126352.1|  PREDICTED: caffeoylshikimate esterase-like         290   7e-90    
emb|CDX85571.1|  BnaA02g02420D                                          290   7e-90    
ref|XP_009349702.1|  PREDICTED: caffeoylshikimate esterase-like         290   9e-90    
gb|KFK26175.1|  hypothetical protein AALP_AA8G212500                    290   1e-89    
emb|CDY69863.1|  BnaCnng65700D                                          290   1e-89    
ref|XP_002311094.2|  esterase/lipase/thioesterase family protein        290   1e-89    Populus trichocarpa [western balsam poplar]
ref|XP_010454199.1|  PREDICTED: caffeoylshikimate esterase-like i...    289   2e-89    
ref|XP_009344755.1|  PREDICTED: caffeoylshikimate esterase-like         289   2e-89    
ref|XP_011031746.1|  PREDICTED: caffeoylshikimate esterase-like         289   3e-89    
ref|XP_002316366.1|  esterase/lipase/thioesterase family protein        288   4e-89    Populus trichocarpa [western balsam poplar]
ref|NP_197430.1|  esterase/lipase/thioesterase family protein           288   4e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008776344.1|  PREDICTED: caffeoylshikimate esterase              289   5e-89    
ref|XP_010679109.1|  PREDICTED: caffeoylshikimate esterase-like         287   9e-89    
ref|XP_009616354.1|  PREDICTED: caffeoylshikimate esterase-like         287   1e-88    
ref|XP_010558754.1|  PREDICTED: caffeoylshikimate esterase-like         286   2e-88    
ref|XP_002871877.1|  esterase/lipase/thioesterase family protein        286   3e-88    
ref|NP_001042883.1|  Os01g0317800                                       285   6e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004496283.1|  PREDICTED: monoglyceride lipase-like               284   1e-87    
ref|XP_006345805.1|  PREDICTED: caffeoylshikimate esterase-like         285   1e-87    
emb|CDP04355.1|  unnamed protein product                                285   1e-87    
gb|EPS74573.1|  hypothetical protein M569_00182                         282   7e-87    
ref|XP_004239680.1|  PREDICTED: caffeoylshikimate esterase              283   7e-87    
gb|KFK25736.1|  hypothetical protein AALP_AA8G152900                    281   2e-86    
ref|XP_006377960.1|  hypothetical protein POPTR_0011s16720g             278   3e-86    
ref|XP_010932980.1|  PREDICTED: caffeoylshikimate esterase-like         279   3e-85    
emb|CDX91009.1|  BnaC02g05880D                                          295   4e-85    
gb|EAY73742.1|  hypothetical protein OsI_01616                          276   1e-84    Oryza sativa Indica Group [Indian rice]
dbj|BAK08241.1|  predicted protein                                      277   1e-84    
ref|XP_003567617.1|  PREDICTED: caffeoylshikimate esterase-like         276   1e-84    
ref|XP_006845999.1|  hypothetical protein AMTR_s00155p00055670          273   3e-83    
emb|CAN82378.1|  hypothetical protein VITISV_036229                     291   4e-83    Vitis vinifera
ref|XP_001772196.1|  predicted protein                                  265   6e-80    
ref|XP_002455554.1|  hypothetical protein SORBIDRAFT_03g013040          262   5e-79    Sorghum bicolor [broomcorn]
tpg|DAA54424.1|  TPA: hypothetical protein ZEAMMB73_151003              262   7e-79    
ref|XP_002990215.1|  hypothetical protein SELMODRAFT_447944             256   6e-77    
ref|XP_001752999.1|  predicted protein                                  256   9e-77    
ref|XP_002992473.1|  hypothetical protein SELMODRAFT_186777             255   2e-76    
ref|XP_002529580.1|  Monoglyceride lipase, putative                     225   4e-65    Ricinus communis
ref|XP_009381885.1|  PREDICTED: caffeoylshikimate esterase-like         219   9e-65    
gb|ABR18313.1|  unknown                                                 213   4e-60    Picea sitchensis
gb|KFK43401.1|  hypothetical protein AALP_AA1G121200                    212   5e-60    
gb|KDP20918.1|  hypothetical protein JCGZ_21389                         210   2e-59    
emb|CDO99600.1|  unnamed protein product                                209   4e-59    
ref|XP_002889847.1|  hydrolase, alpha/beta fold family protein          208   2e-58    
ref|XP_010686578.1|  PREDICTED: caffeoylshikimate esterase              207   2e-58    
ref|XP_006343251.1|  PREDICTED: caffeoylshikimate esterase-like i...    208   2e-58    
ref|XP_010533890.1|  PREDICTED: caffeoylshikimate esterase              208   2e-58    
ref|XP_004234129.1|  PREDICTED: caffeoylshikimate esterase              207   2e-58    
ref|XP_010475999.1|  PREDICTED: caffeoylshikimate esterase-like         206   6e-58    
ref|XP_009610353.1|  PREDICTED: caffeoylshikimate esterase              206   7e-58    
ref|NP_172576.1|  alpha/beta-hydrolase-like protein                     206   1e-57    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001130084.1|  hypothetical protein                               206   2e-57    Zea mays [maize]
ref|XP_009782580.1|  PREDICTED: caffeoylshikimate esterase              205   2e-57    
ref|XP_011096267.1|  PREDICTED: caffeoylshikimate esterase              204   4e-57    
ref|XP_010492320.1|  PREDICTED: caffeoylshikimate esterase-like         204   5e-57    
ref|XP_010458490.1|  PREDICTED: caffeoylshikimate esterase-like         204   6e-57    
ref|XP_006303706.1|  hypothetical protein CARUB_v10011807mg             202   3e-56    
ref|XP_006467849.1|  PREDICTED: caffeoylshikimate esterase-like         201   6e-56    
ref|XP_002463034.1|  hypothetical protein SORBIDRAFT_02g036570          201   7e-56    Sorghum bicolor [broomcorn]
ref|XP_001760039.1|  predicted protein                                  201   1e-55    
ref|XP_006449284.1|  hypothetical protein CICLE_v10017806mg             201   1e-55    
ref|XP_002521403.1|  Monoglyceride lipase, putative                     200   2e-55    Ricinus communis
ref|XP_011043243.1|  PREDICTED: caffeoylshikimate esterase              200   2e-55    
ref|XP_007025720.1|  Alpha/beta-Hydrolases superfamily protein          199   3e-55    
ref|XP_009780674.1|  PREDICTED: caffeoylshikimate esterase-like i...    199   3e-55    
ref|XP_006417390.1|  hypothetical protein EUTSA_v10010022mg             200   7e-55    
ref|XP_010278298.1|  PREDICTED: caffeoylshikimate esterase              199   8e-55    
ref|XP_002316636.1|  hydrolase family protein                           196   4e-54    Populus trichocarpa [western balsam poplar]
ref|XP_003634858.1|  PREDICTED: caffeoylshikimate esterase              195   7e-54    
ref|NP_001060014.1|  Os07g0565700                                       196   7e-54    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004958048.1|  PREDICTED: monoglyceride lipase-like               194   5e-53    
ref|XP_010107055.1|  hypothetical protein L484_002466                   193   5e-53    
ref|XP_004146590.1|  PREDICTED: monoglyceride lipase-like               193   5e-53    
ref|XP_006846763.1|  hypothetical protein AMTR_s00148p00014950          189   2e-52    
ref|XP_007025719.1|  Alpha/beta-Hydrolases superfamily protein          191   2e-52    
ref|XP_007159280.1|  hypothetical protein PHAVU_002G224700g             191   3e-52    
ref|XP_008809309.1|  PREDICTED: caffeoylshikimate esterase              191   3e-52    
ref|XP_004505004.1|  PREDICTED: monoglyceride lipase-like               191   6e-52    
ref|XP_008442222.1|  PREDICTED: caffeoylshikimate esterase              190   8e-52    
emb|CDY20979.1|  BnaA08g25460D                                          190   9e-52    
gb|EYU27946.1|  hypothetical protein MIMGU_mgv1a026912mg                190   1e-51    
ref|XP_008224992.1|  PREDICTED: caffeoylshikimate esterase              189   2e-51    
ref|XP_007211531.1|  hypothetical protein PRUPE_ppa008252mg             189   2e-51    
ref|XP_008383790.1|  PREDICTED: caffeoylshikimate esterase-like         189   2e-51    
ref|XP_010905633.1|  PREDICTED: caffeoylshikimate esterase              188   4e-51    
gb|AFK35254.1|  unknown                                                 188   4e-51    
emb|CDY20587.1|  BnaC08g14710D                                          187   7e-51    
ref|XP_009123831.1|  PREDICTED: caffeoylshikimate esterase              187   7e-51    
ref|XP_009418746.1|  PREDICTED: caffeoylshikimate esterase              187   2e-50    
ref|NP_001240171.1|  uncharacterized protein LOC100793956               186   2e-50    
ref|XP_010229642.1|  PREDICTED: LOW QUALITY PROTEIN: caffeoylshik...    190   4e-50    
dbj|BAJ89543.1|  predicted protein                                      186   6e-50    
ref|XP_006841721.1|  hypothetical protein AMTR_s00003p00257040          185   6e-50    
dbj|BAJ99600.1|  predicted protein                                      186   7e-50    
ref|XP_006485838.1|  PREDICTED: caffeoylshikimate esterase-like         177   3e-48    
ref|XP_010253357.1|  PREDICTED: caffeoylshikimate esterase-like         174   7e-46    
ref|XP_007142700.1|  hypothetical protein PHAVU_007G009500g             174   7e-46    
ref|XP_006292693.1|  hypothetical protein CARUB_v10018939mg             173   1e-45    
ref|XP_006403485.1|  hypothetical protein EUTSA_v10010979mg             172   2e-45    
gb|KDP32952.1|  hypothetical protein JCGZ_12983                         174   2e-45    
ref|XP_003591520.1|  Monoglyceride lipase                               172   5e-45    
gb|KFK36834.1|  hypothetical protein AALP_AA4G177300                    171   7e-45    
ref|XP_002876286.1|  esterase/lipase/thioesterase family protein        171   8e-45    
ref|XP_011097201.1|  PREDICTED: caffeoylshikimate esterase isofor...    171   1e-44    
ref|XP_011097199.1|  PREDICTED: caffeoylshikimate esterase isofor...    171   2e-44    
ref|XP_004963835.1|  PREDICTED: monoglyceride lipase-like               170   4e-44    
gb|ACJ85425.1|  unknown                                                 167   4e-44    Medicago truncatula
ref|XP_010504364.1|  PREDICTED: caffeoylshikimate esterase-like         169   4e-44    
ref|XP_006411166.1|  hypothetical protein EUTSA_v10016977mg             169   5e-44    
ref|XP_002977997.1|  hypothetical protein SELMODRAFT_14581              167   7e-44    
ref|NP_191078.1|  alpha/beta-Hydrolases superfamily protein             168   8e-44    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002966752.1|  hypothetical protein SELMODRAFT_85161              170   9e-44    
ref|XP_006383452.1|  hypothetical protein POPTR_0005s15640g             170   1e-43    
gb|ABK24479.1|  unknown                                                 169   1e-43    Picea sitchensis
gb|ABK25268.1|  unknown                                                 169   1e-43    Picea sitchensis
ref|XP_004307458.1|  PREDICTED: monoglyceride lipase-like isoform 1     167   1e-43    
ref|XP_010908885.1|  PREDICTED: caffeoylshikimate esterase-like i...    167   2e-43    
ref|XP_004307459.1|  PREDICTED: monoglyceride lipase-like isoform 2     167   2e-43    
ref|XP_010517285.1|  PREDICTED: caffeoylshikimate esterase-like         167   2e-43    
gb|KFK34770.1|  hypothetical protein AALP_AA5G191400                    167   2e-43    
ref|XP_010505610.1|  PREDICTED: caffeoylshikimate esterase-like         167   2e-43    
ref|XP_010517284.1|  PREDICTED: caffeoylshikimate esterase-like         167   2e-43    
ref|XP_008368665.1|  PREDICTED: caffeoylshikimate esterase-like         167   4e-43    
ref|XP_003579070.1|  PREDICTED: caffeoylshikimate esterase-like         167   4e-43    
ref|XP_003635228.1|  PREDICTED: caffeoylshikimate esterase isofor...    166   5e-43    
ref|XP_001765950.1|  predicted protein                                  167   5e-43    
ref|XP_008244512.1|  PREDICTED: caffeoylshikimate esterase              167   5e-43    
ref|XP_002282295.1|  PREDICTED: caffeoylshikimate esterase isofor...    166   6e-43    Vitis vinifera
ref|XP_007009573.1|  Alpha/beta-Hydrolases superfamily protein          166   8e-43    
ref|XP_009387315.1|  PREDICTED: caffeoylshikimate esterase-like i...    166   1e-42    
ref|XP_009420077.1|  PREDICTED: caffeoylshikimate esterase-like         165   1e-42    
ref|XP_010516079.1|  PREDICTED: caffeoylshikimate esterase-like         165   1e-42    
ref|XP_009758203.1|  PREDICTED: caffeoylshikimate esterase-like         166   1e-42    
gb|EYU44635.1|  hypothetical protein MIMGU_mgv1a021899mg                165   2e-42    
ref|XP_011082467.1|  PREDICTED: caffeoylshikimate esterase-like         165   2e-42    
ref|XP_002521224.1|  Monoglyceride lipase, putative                     166   2e-42    Ricinus communis
ref|XP_004238932.1|  PREDICTED: caffeoylshikimate esterase              166   2e-42    
ref|XP_006294629.1|  hypothetical protein CARUB_v10023666mg             164   2e-42    
ref|XP_008783604.1|  PREDICTED: caffeoylshikimate esterase-like         165   2e-42    
ref|XP_010505609.1|  PREDICTED: caffeoylshikimate esterase-like         164   2e-42    
ref|XP_010263962.1|  PREDICTED: caffeoylshikimate esterase isofor...    165   2e-42    
gb|KFK35464.1|  hypothetical protein AALP_AA5G287400                    165   3e-42    
ref|XP_010922433.1|  PREDICTED: caffeoylshikimate esterase-like i...    164   3e-42    
ref|XP_007216459.1|  hypothetical protein PRUPE_ppa023287mg             164   3e-42    
ref|XP_010509020.1|  PREDICTED: caffeoylshikimate esterase-like         163   4e-42    
ref|XP_010545011.1|  PREDICTED: caffeoylshikimate esterase isofor...    165   4e-42    
ref|XP_006344132.1|  PREDICTED: caffeoylshikimate esterase-like         165   5e-42    
ref|XP_010263959.1|  PREDICTED: caffeoylshikimate esterase isofor...    165   5e-42    
ref|XP_008797826.1|  PREDICTED: caffeoylshikimate esterase-like i...    164   5e-42    
ref|XP_009357817.1|  PREDICTED: caffeoylshikimate esterase-like i...    165   5e-42    
ref|XP_004291688.1|  PREDICTED: monoglyceride lipase-like               164   7e-42    
ref|XP_009387314.1|  PREDICTED: caffeoylshikimate esterase-like i...    165   8e-42    
ref|XP_010069910.1|  PREDICTED: caffeoylshikimate esterase              164   9e-42    
ref|XP_009613832.1|  PREDICTED: caffeoylshikimate esterase isofor...    164   9e-42    
ref|XP_010427279.1|  PREDICTED: caffeoylshikimate esterase-like         162   9e-42    
ref|XP_010916379.1|  PREDICTED: caffeoylshikimate esterase-like i...    163   1e-41    
ref|XP_010520167.1|  PREDICTED: caffeoylshikimate esterase-like i...    162   1e-41    
ref|NP_001242740.1|  uncharacterized protein LOC100819669               164   1e-41    
ref|XP_001768097.1|  predicted protein                                  162   1e-41    
ref|XP_008784749.1|  PREDICTED: caffeoylshikimate esterase-like i...    163   1e-41    
ref|XP_004495953.1|  PREDICTED: monoglyceride lipase-like isoform X1    162   1e-41    
ref|XP_010506801.1|  PREDICTED: caffeoylshikimate esterase-like i...    163   1e-41    
ref|XP_011070793.1|  PREDICTED: caffeoylshikimate esterase              164   1e-41    
ref|XP_010678840.1|  PREDICTED: caffeoylshikimate esterase-like i...    162   2e-41    
ref|XP_006479967.1|  PREDICTED: caffeoylshikimate esterase-like         163   2e-41    
emb|CDY40205.1|  BnaA09g34870D                                          161   2e-41    
ref|XP_008776304.1|  PREDICTED: caffeoylshikimate esterase-like         162   2e-41    
emb|CDX73397.1|  BnaC08g26060D                                          161   2e-41    
ref|XP_006444359.1|  hypothetical protein CICLE_v10020811mg             162   2e-41    
ref|XP_003592661.1|  Monoglyceride lipase                               162   2e-41    
ref|XP_008797823.1|  PREDICTED: caffeoylshikimate esterase-like i...    164   2e-41    
ref|XP_002879794.1|  predicted protein                                  161   2e-41    
ref|XP_009116220.1|  PREDICTED: caffeoylshikimate esterase              161   2e-41    
ref|XP_010921664.1|  PREDICTED: caffeoylshikimate esterase-like i...    162   3e-41    
ref|XP_008459474.1|  PREDICTED: caffeoylshikimate esterase isofor...    162   3e-41    
ref|XP_006291395.1|  hypothetical protein CARUB_v10017533mg             162   3e-41    
ref|XP_004247416.1|  PREDICTED: caffeoylshikimate esterase isofor...    162   3e-41    
ref|XP_010506800.1|  PREDICTED: caffeoylshikimate esterase-like i...    162   3e-41    
gb|KDO67800.1|  hypothetical protein CISIN_1g021023mg                   161   3e-41    
ref|XP_009407468.1|  PREDICTED: caffeoylshikimate esterase-like         161   3e-41    
emb|CDP00629.1|  unnamed protein product                                163   3e-41    
ref|XP_009407471.1|  PREDICTED: caffeoylshikimate esterase-like i...    160   3e-41    
gb|KHN11412.1|  Monoglyceride lipase                                    163   3e-41    
ref|XP_009335684.1|  PREDICTED: caffeoylshikimate esterase-like         162   4e-41    
ref|XP_004288899.1|  PREDICTED: monoglyceride lipase-like               160   4e-41    
ref|XP_003567198.1|  PREDICTED: caffeoylshikimate esterase-like         161   4e-41    
gb|EAY86137.1|  hypothetical protein OsI_07510                          161   4e-41    Oryza sativa Indica Group [Indian rice]
ref|XP_011079657.1|  PREDICTED: caffeoylshikimate esterase-like         161   5e-41    
ref|XP_009342658.1|  PREDICTED: caffeoylshikimate esterase-like i...    160   5e-41    
ref|XP_002880317.1|  esterase/lipase/thioesterase family protein        161   5e-41    
ref|XP_004497316.1|  PREDICTED: monoglyceride lipase-like               160   5e-41    
ref|XP_009344903.1|  PREDICTED: caffeoylshikimate esterase-like         160   5e-41    
ref|XP_001760395.1|  predicted protein                                  161   5e-41    
ref|XP_006436130.1|  hypothetical protein CICLE_v10032149mg             160   6e-41    
ref|XP_002439655.1|  hypothetical protein SORBIDRAFT_09g018060          161   6e-41    Sorghum bicolor [broomcorn]
ref|XP_009342659.1|  PREDICTED: caffeoylshikimate esterase-like i...    161   6e-41    
gb|AES62911.2|  monoglyceride lipase, putative                          161   6e-41    
ref|XP_010509021.1|  PREDICTED: caffeoylshikimate esterase-like         160   6e-41    
ref|XP_010916377.1|  PREDICTED: caffeoylshikimate esterase-like i...    162   7e-41    
ref|XP_009141804.1|  PREDICTED: LOW QUALITY PROTEIN: caffeoylshik...    160   7e-41    
ref|NP_566106.1|  alpha/beta-Hydrolases superfamily protein             161   7e-41    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006665022.1|  PREDICTED: caffeoylshikimate esterase-like         159   8e-41    
ref|XP_010518470.1|  PREDICTED: caffeoylshikimate esterase-like         161   8e-41    
ref|XP_009335916.1|  PREDICTED: caffeoylshikimate esterase-like         160   8e-41    
ref|NP_565903.1|  alpha/beta-Hydrolases superfamily protein             160   9e-41    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006843203.1|  hypothetical protein AMTR_s00146p00105370          160   9e-41    
ref|XP_008459473.1|  PREDICTED: caffeoylshikimate esterase isofor...    162   9e-41    
ref|XP_009357648.1|  PREDICTED: caffeoylshikimate esterase-like         160   9e-41    
ref|XP_003592660.1|  Monoglyceride lipase                               161   1e-40    
ref|XP_009335738.1|  PREDICTED: caffeoylshikimate esterase-like         160   1e-40    
gb|EYU46661.1|  hypothetical protein MIMGU_mgv1a009192mg                160   1e-40    
ref|XP_006605398.1|  PREDICTED: uncharacterized protein LOC100819...    161   1e-40    
ref|XP_010509018.1|  PREDICTED: caffeoylshikimate esterase-like i...    159   1e-40    
ref|XP_010509019.1|  PREDICTED: caffeoylshikimate esterase-like i...    159   1e-40    
gb|KEH44506.1|  alpha/beta fold hydrolase                               159   1e-40    
ref|XP_006359844.1|  PREDICTED: caffeoylshikimate esterase-like         160   1e-40    
emb|CDY07651.1|  BnaA03g18600D                                          160   1e-40    
ref|XP_010507868.1|  PREDICTED: caffeoylshikimate esterase-like         160   2e-40    
ref|XP_006855557.1|  hypothetical protein AMTR_s00057p00221720          159   2e-40    
gb|KEH44505.1|  alpha/beta fold hydrolase                               159   2e-40    
ref|XP_010505612.1|  PREDICTED: caffeoylshikimate esterase-like i...    159   2e-40    
ref|XP_002268904.1|  PREDICTED: caffeoylshikimate esterase              160   2e-40    
emb|CDY24963.1|  BnaC03g22090D                                          159   2e-40    
ref|XP_009412536.1|  PREDICTED: caffeoylshikimate esterase-like         159   2e-40    
ref|XP_010505611.1|  PREDICTED: caffeoylshikimate esterase-like i...    159   2e-40    
ref|NP_001065222.1|  Os11g0100600                                       159   2e-40    
ref|XP_009381093.1|  PREDICTED: caffeoylshikimate esterase-like i...    159   2e-40    
ref|XP_008381270.1|  PREDICTED: caffeoylshikimate esterase              160   2e-40    
emb|CDX83323.1|  BnaA03g21830D                                          159   2e-40    
ref|NP_850316.1|  alpha/beta-Hydrolases superfamily protein             159   2e-40    
emb|CDP17128.1|  unnamed protein product                                159   2e-40    
ref|XP_010061885.1|  PREDICTED: caffeoylshikimate esterase isofor...    159   2e-40    
ref|NP_191845.2|  alpha/beta-Hydrolases superfamily protein             159   3e-40    
ref|XP_010678842.1|  PREDICTED: caffeoylshikimate esterase-like i...    159   3e-40    
ref|XP_008454334.1|  PREDICTED: caffeoylshikimate esterase isofor...    159   3e-40    
ref|XP_008233545.1|  PREDICTED: caffeoylshikimate esterase-like         158   3e-40    
ref|XP_004147709.1|  PREDICTED: monoglyceride lipase-like               158   3e-40    
emb|CDX95729.1|  BnaC03g26100D                                          159   3e-40    
emb|CDP19954.1|  unnamed protein product                                159   3e-40    
ref|XP_010922429.1|  PREDICTED: caffeoylshikimate esterase-like         159   3e-40    
ref|XP_004962320.1|  PREDICTED: putative monoglyceride lipase-lik...    159   3e-40    
ref|XP_007218703.1|  hypothetical protein PRUPE_ppa008890mg             158   3e-40    
ref|XP_006397959.1|  hypothetical protein EUTSA_v10001520mg             159   3e-40    
gb|KHG06576.1|  Monoglyceride lipase                                    159   3e-40    
ref|XP_009625969.1|  PREDICTED: caffeoylshikimate esterase              160   4e-40    
ref|XP_008784748.1|  PREDICTED: caffeoylshikimate esterase-like i...    159   4e-40    
ref|XP_004236766.1|  PREDICTED: caffeoylshikimate esterase              158   4e-40    
ref|XP_008358150.1|  PREDICTED: caffeoylshikimate esterase-like         160   4e-40    
ref|XP_002878482.1|  predicted protein                                  159   4e-40    
ref|XP_006361389.1|  PREDICTED: caffeoylshikimate esterase-like         157   5e-40    
ref|XP_010099653.1|  hypothetical protein L484_003175                   158   6e-40    
ref|XP_009777258.1|  PREDICTED: caffeoylshikimate esterase              158   6e-40    
ref|XP_004141507.1|  PREDICTED: monoglyceride lipase-like               158   6e-40    
ref|XP_008235097.1|  PREDICTED: caffeoylshikimate esterase isofor...    158   7e-40    
gb|EYU34400.1|  hypothetical protein MIMGU_mgv1a009566mg                158   7e-40    
ref|XP_004152363.1|  PREDICTED: monoglyceride lipase-like               158   8e-40    
ref|XP_010520168.1|  PREDICTED: caffeoylshikimate esterase-like i...    156   8e-40    
ref|XP_009139193.1|  PREDICTED: caffeoylshikimate esterase              157   8e-40    
gb|ACN40719.1|  unknown                                                 157   8e-40    
gb|ABK24677.1|  unknown                                                 157   8e-40    
gb|ABK22850.1|  unknown                                                 157   9e-40    
ref|XP_009418374.1|  PREDICTED: caffeoylshikimate esterase-like         157   9e-40    
ref|XP_010096682.1|  hypothetical protein L484_025431                   158   9e-40    
ref|NP_001055317.1|  Os05g0363100                                       158   9e-40    
ref|XP_010922434.1|  PREDICTED: caffeoylshikimate esterase-like i...    157   9e-40    
ref|XP_009622601.1|  PREDICTED: caffeoylshikimate esterase-like         157   1e-39    
gb|KFK36835.1|  hypothetical protein AALP_AA4G177600                    157   1e-39    
ref|XP_009348815.1|  PREDICTED: caffeoylshikimate esterase-like         157   1e-39    
ref|XP_008654363.1|  PREDICTED: uncharacterized protein LOC100193...    157   1e-39    
ref|XP_010916378.1|  PREDICTED: caffeoylshikimate esterase-like i...    159   1e-39    
ref|XP_010517294.1|  PREDICTED: caffeoylshikimate esterase-like i...    157   1e-39    
ref|XP_010517292.1|  PREDICTED: caffeoylshikimate esterase-like i...    157   1e-39    
ref|XP_009593524.1|  PREDICTED: caffeoylshikimate esterase              157   1e-39    
ref|XP_003566330.1|  PREDICTED: caffeoylshikimate esterase              157   1e-39    
ref|XP_009133363.1|  PREDICTED: caffeoylshikimate esterase-like         156   1e-39    
ref|XP_010326576.1|  PREDICTED: caffeoylshikimate esterase isofor...    157   1e-39    
ref|XP_010678841.1|  PREDICTED: caffeoylshikimate esterase-like i...    157   2e-39    
ref|XP_006402334.1|  hypothetical protein EUTSA_v10006073mg             157   2e-39    
gb|EEE63431.1|  hypothetical protein OsJ_18244                          157   2e-39    
emb|CDP11605.1|  unnamed protein product                                157   2e-39    
ref|XP_007009570.1|  Alpha/beta-Hydrolases superfamily protein          156   2e-39    
ref|XP_010413226.1|  PREDICTED: caffeoylshikimate esterase-like         157   2e-39    
ref|XP_001756198.1|  predicted protein                                  156   2e-39    
emb|CDX76667.1|  BnaC08g32530D                                          157   2e-39    
ref|XP_009414895.1|  PREDICTED: caffeoylshikimate esterase-like i...    157   2e-39    
ref|XP_010512681.1|  PREDICTED: caffeoylshikimate esterase-like i...    157   2e-39    
gb|KCW58427.1|  hypothetical protein EUGRSUZ_H01110                     157   2e-39    
ref|XP_006411167.1|  hypothetical protein EUTSA_v10016835mg             157   2e-39    
gb|EEC71757.1|  hypothetical protein OsI_04349                          155   2e-39    
ref|XP_004156887.1|  PREDICTED: monoglyceride lipase-like               157   3e-39    
ref|XP_006341666.1|  PREDICTED: caffeoylshikimate esterase-like         156   3e-39    
ref|XP_010545010.1|  PREDICTED: caffeoylshikimate esterase isofor...    157   3e-39    
ref|XP_006430776.1|  hypothetical protein CICLE_v10012092mg             156   3e-39    
ref|XP_009133821.1|  PREDICTED: caffeoylshikimate esterase              156   4e-39    
ref|XP_009803215.1|  PREDICTED: caffeoylshikimate esterase              157   4e-39    
ref|XP_010554568.1|  PREDICTED: caffeoylshikimate esterase              155   4e-39    
ref|XP_010907498.1|  PREDICTED: caffeoylshikimate esterase-like i...    156   4e-39    
dbj|BAJ98949.1|  predicted protein                                      156   4e-39    
ref|XP_010254283.1|  PREDICTED: caffeoylshikimate esterase              155   5e-39    
ref|XP_010271585.1|  PREDICTED: caffeoylshikimate esterase-like         156   5e-39    
gb|EEC79070.1|  hypothetical protein OsI_19653                          155   5e-39    
gb|EEC70515.1|  hypothetical protein OsI_01618                          153   5e-39    
ref|XP_010908886.1|  PREDICTED: caffeoylshikimate esterase-like i...    154   6e-39    
ref|XP_009141803.1|  PREDICTED: caffeoylshikimate esterase isofor...    154   6e-39    
ref|XP_004497084.1|  PREDICTED: monoglyceride lipase-like               156   6e-39    
ref|XP_008386696.1|  PREDICTED: LOW QUALITY PROTEIN: caffeoylshik...    155   6e-39    
ref|XP_010259541.1|  PREDICTED: caffeoylshikimate esterase-like i...    155   6e-39    
ref|XP_002879795.1|  esterase/lipase/thioesterase family protein        154   6e-39    
ref|XP_006662165.1|  PREDICTED: caffeoylshikimate esterase-like         156   7e-39    
emb|CDM84872.1|  unnamed protein product                                160   7e-39    
gb|KFK37501.1|  hypothetical protein AALP_AA4G265600                    155   7e-39    
ref|XP_003567610.1|  PREDICTED: caffeoylshikimate esterase-like         155   8e-39    
ref|XP_010428821.1|  PREDICTED: caffeoylshikimate esterase-like         156   8e-39    
ref|XP_009356853.1|  PREDICTED: caffeoylshikimate esterase-like         156   8e-39    
ref|XP_011020624.1|  PREDICTED: caffeoylshikimate esterase-like         154   8e-39    
gb|KHF98544.1|  Monoglyceride lipase                                    154   8e-39    
ref|XP_007199970.1|  hypothetical protein PRUPE_ppa025987mg             155   8e-39    
gb|KDO59012.1|  hypothetical protein CISIN_1g018984mg                   155   8e-39    
ref|XP_006482252.1|  PREDICTED: caffeoylshikimate esterase-like         155   8e-39    
gb|AAM60954.1|  lysophospholipase isolog, putative                      156   8e-39    
gb|EPS73059.1|  hypothetical protein M569_01697                         154   8e-39    
ref|XP_010684530.1|  PREDICTED: caffeoylshikimate esterase              155   8e-39    
emb|CBI18753.3|  unnamed protein product                                155   9e-39    
ref|NP_177867.1|  alpha/beta-hydrolase-like protein                     155   9e-39    
ref|XP_009775188.1|  PREDICTED: caffeoylshikimate esterase-like         154   9e-39    
gb|EMS59411.1|  hypothetical protein TRIUR3_33748                       154   1e-38    
ref|XP_010416687.1|  PREDICTED: caffeoylshikimate esterase-like         155   1e-38    
emb|CDX93264.1|  BnaC04g46320D                                          154   1e-38    
ref|XP_006346908.1|  PREDICTED: caffeoylshikimate esterase-like i...    154   1e-38    
gb|EMT11916.1|  hypothetical protein F775_10120                         154   1e-38    
ref|XP_008447481.1|  PREDICTED: caffeoylshikimate esterase              154   1e-38    
ref|XP_006842295.1|  hypothetical protein AMTR_s00079p00105260          155   1e-38    
ref|XP_009116949.1|  PREDICTED: caffeoylshikimate esterase-like i...    154   1e-38    
gb|KHG02209.1|  Monoglyceride lipase                                    154   1e-38    
ref|XP_010925265.1|  PREDICTED: caffeoylshikimate esterase-like         154   1e-38    
ref|XP_009762778.1|  PREDICTED: caffeoylshikimate esterase-like         154   1e-38    
ref|XP_008783602.1|  PREDICTED: caffeoylshikimate esterase-like i...    154   1e-38    
ref|XP_008362696.1|  PREDICTED: caffeoylshikimate esterase-like         154   1e-38    
ref|XP_006294630.1|  hypothetical protein CARUB_v10023668mg             154   1e-38    
ref|XP_010468913.1|  PREDICTED: caffeoylshikimate esterase-like         154   1e-38    
ref|XP_009138711.1|  PREDICTED: caffeoylshikimate esterase              154   2e-38    
ref|XP_010479797.1|  PREDICTED: caffeoylshikimate esterase-like         154   2e-38    
ref|XP_006606554.1|  PREDICTED: caffeoylshikimate esterase-like i...    153   2e-38    
dbj|BAK01593.1|  predicted protein                                      154   2e-38    
ref|XP_006606553.1|  PREDICTED: caffeoylshikimate esterase-like i...    154   2e-38    
ref|XP_002442631.1|  hypothetical protein SORBIDRAFT_08g000200          154   2e-38    
ref|XP_009348816.1|  PREDICTED: caffeoylshikimate esterase-like         154   2e-38    
gb|EMT01159.1|  hypothetical protein F775_29144                         155   2e-38    
gb|KDP46119.1|  hypothetical protein JCGZ_06630                         153   2e-38    
ref|NP_181474.2|  alpha/beta-Hydrolases superfamily protein             153   2e-38    
emb|CDX76116.1|  BnaA04g03800D                                          154   2e-38    
ref|XP_004507903.1|  PREDICTED: monoglyceride lipase-like isoform X1    153   2e-38    
emb|CDX89152.1|  BnaA04g00340D                                          154   2e-38    
ref|XP_008785454.1|  PREDICTED: caffeoylshikimate esterase-like         154   2e-38    
gb|AAK43921.1|AF370602_1  putative phospholipase                        153   2e-38    
ref|XP_004494377.1|  PREDICTED: monoglyceride lipase-like isoform X1    154   2e-38    
ref|XP_002302714.1|  hypothetical protein POPTR_0002s20550g             154   2e-38    
ref|XP_011027095.1|  PREDICTED: caffeoylshikimate esterase-like         153   2e-38    
ref|XP_002464773.1|  hypothetical protein SORBIDRAFT_01g026550          154   2e-38    
ref|XP_007163115.1|  hypothetical protein PHAVU_001G207500g             154   2e-38    
ref|NP_001064121.2|  Os10g0135600                                       154   3e-38    
ref|XP_003636966.1|  Monoglyceride lipase                               154   3e-38    
ref|XP_008235096.1|  PREDICTED: caffeoylshikimate esterase isofor...    154   3e-38    
emb|CDY27476.1|  BnaC04g51170D                                          154   3e-38    
gb|EYU29987.1|  hypothetical protein MIMGU_mgv1a007855mg                154   3e-38    
ref|XP_002982491.1|  hypothetical protein SELMODRAFT_155184             152   3e-38    
ref|XP_006850643.1|  hypothetical protein AMTR_s00034p00202150          152   3e-38    
emb|CDY55538.1|  BnaA04g29600D                                          153   3e-38    
ref|XP_002981014.1|  hypothetical protein SELMODRAFT_113971             152   3e-38    
ref|XP_010907499.1|  PREDICTED: caffeoylshikimate esterase-like i...    153   3e-38    
ref|XP_002879793.1|  hydrolase, alpha/beta fold family protein          152   4e-38    
ref|XP_004147998.1|  PREDICTED: monoglyceride lipase-like               152   4e-38    
gb|EYU29988.1|  hypothetical protein MIMGU_mgv1a007855mg                154   4e-38    
ref|XP_008440696.1|  PREDICTED: caffeoylshikimate esterase-like         152   4e-38    
ref|NP_001136742.1|  uncharacterized protein LOC100216883               153   4e-38    
ref|XP_003516824.1|  PREDICTED: caffeoylshikimate esterase-like i...    154   4e-38    
ref|XP_004235722.1|  PREDICTED: caffeoylshikimate esterase              152   4e-38    
ref|XP_010521005.1|  PREDICTED: caffeoylshikimate esterase-like         152   4e-38    
ref|XP_004166692.1|  PREDICTED: monoglyceride lipase-like               152   4e-38    
gb|KFK34769.1|  hypothetical protein AALP_AA5G191300                    152   4e-38    
dbj|BAJ99202.1|  predicted protein                                      152   5e-38    
ref|XP_009618376.1|  PREDICTED: caffeoylshikimate esterase-like         153   5e-38    
ref|XP_006346915.1|  PREDICTED: caffeoylshikimate esterase-like         153   6e-38    
ref|XP_010061884.1|  PREDICTED: caffeoylshikimate esterase isofor...    153   6e-38    
ref|XP_010471936.1|  PREDICTED: caffeoylshikimate esterase-like         154   6e-38    
gb|AES82137.2|  alpha/beta hydrolase family protein                     152   6e-38    
ref|XP_003636968.1|  Monoglyceride lipase                               153   6e-38    
ref|XP_006346909.1|  PREDICTED: caffeoylshikimate esterase-like i...    151   6e-38    
emb|CDO98101.1|  unnamed protein product                                152   7e-38    
ref|XP_008803549.1|  PREDICTED: caffeoylshikimate esterase-like i...    152   7e-38    
gb|KFK35771.1|  hypothetical protein AALP_AA4G034000                    152   7e-38    
ref|XP_002871702.1|  hydrolase, alpha/beta fold family protein          152   7e-38    
ref|XP_010052355.1|  PREDICTED: caffeoylshikimate esterase              152   7e-38    
ref|XP_001784080.1|  predicted protein                                  152   8e-38    
ref|XP_006346910.1|  PREDICTED: caffeoylshikimate esterase-like i...    150   9e-38    
ref|XP_009613845.1|  PREDICTED: caffeoylshikimate esterase isofor...    152   9e-38    
ref|XP_010520169.1|  PREDICTED: caffeoylshikimate esterase-like i...    150   9e-38    
gb|ABR16349.1|  unknown                                                 151   9e-38    
ref|XP_010681610.1|  PREDICTED: caffeoylshikimate esterase isofor...    153   1e-37    
ref|XP_003575457.1|  PREDICTED: caffeoylshikimate esterase-like         151   1e-37    
ref|XP_004233490.1|  PREDICTED: caffeoylshikimate esterase              152   1e-37    
ref|XP_011009442.1|  PREDICTED: caffeoylshikimate esterase-like         151   1e-37    
ref|XP_010681611.1|  PREDICTED: caffeoylshikimate esterase isofor...    153   1e-37    
ref|XP_004516669.1|  PREDICTED: monoglyceride lipase-like isoform X1    151   1e-37    
gb|ACL52687.1|  unknown                                                 150   1e-37    
ref|NP_568327.1|  hydrolase, alpha/beta fold family protein             152   1e-37    
ref|XP_010519340.1|  PREDICTED: caffeoylshikimate esterase-like i...    150   2e-37    
emb|CDP20138.1|  unnamed protein product                                152   2e-37    
ref|XP_002450081.1|  hypothetical protein SORBIDRAFT_05g000200          151   2e-37    
ref|XP_010554569.1|  PREDICTED: caffeoylshikimate esterase              150   2e-37    
emb|CDY38348.1|  BnaA02g18410D                                          152   2e-37    
ref|XP_011033533.1|  PREDICTED: caffeoylshikimate esterase-like         151   2e-37    
ref|XP_010519341.1|  PREDICTED: caffeoylshikimate esterase-like i...    150   2e-37    
ref|XP_008674851.1|  PREDICTED: caffeoylshikimate esterase-like i...    150   2e-37    
ref|XP_010909636.1|  PREDICTED: caffeoylshikimate esterase-like         151   2e-37    
ref|XP_010660426.1|  PREDICTED: caffeoylshikimate esterase              154   2e-37    
ref|XP_009141806.1|  PREDICTED: caffeoylshikimate esterase-like i...    150   2e-37    
ref|NP_001130575.1|  uncharacterized protein LOC100191674               149   2e-37    
ref|XP_009141805.1|  PREDICTED: caffeoylshikimate esterase-like i...    150   2e-37    
ref|NP_001119234.1|  hydrolase, alpha/beta fold family protein          151   2e-37    
gb|EMT18373.1|  hypothetical protein F775_12761                         150   2e-37    
ref|XP_002316320.1|  hydrolase family protein                           150   2e-37    
emb|CDY07008.1|  BnaA04g23070D                                          150   2e-37    
ref|XP_008803546.1|  PREDICTED: caffeoylshikimate esterase isofor...    152   2e-37    
gb|EMS63168.1|  hypothetical protein TRIUR3_26183                       154   3e-37    
ref|XP_010500894.1|  PREDICTED: caffeoylshikimate esterase              150   3e-37    
ref|XP_007153388.1|  hypothetical protein PHAVU_003G030900g             152   3e-37    
gb|EEC66535.1|  hypothetical protein OsI_32679                          151   3e-37    
ref|XP_006465405.1|  PREDICTED: caffeoylshikimate esterase-like         150   3e-37    
ref|XP_001767063.1|  predicted protein                                  150   3e-37    
ref|XP_007142918.1|  hypothetical protein PHAVU_007G028000g             152   3e-37    
emb|CDY40890.1|  BnaCnng09810D                                          151   3e-37    



>ref|XP_009800227.1| PREDICTED: caffeoylshikimate esterase-like [Nicotiana sylvestris]
Length=319

 Score =   483 bits (1242),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 233/318 (73%), Positives = 271/318 (85%), Gaps = 0/318 (0%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M+HPIFQANE SPYGDL+REEFYK+  I+HKE F+LN+   KI+TQSWQ +S ++ RG+V
Sbjct  1     MSHPIFQANENSPYGDLTREEFYKQQKIMHKESFMLNKQNMKIYTQSWQSESSNQLRGLV  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              MIHGYTSESSWLFELNAVAMAK G FV A+DL GHGYSEG  G+IP I P+V DCI   
Sbjct  61    GMIHGYTSESSWLFELNAVAMAKAGFFVCALDLQGHGYSEGSPGYIPSIQPLVEDCIQYF  120

Query  1001  DSARAHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEF  822
             DSARA+HPKLPAFLYGESLGGAIA LICL Q  +W GL+LSGPMCGVSKKYKP+WPLE+ 
Sbjct  121   DSARANHPKLPAFLYGESLGGAIATLICLRQNTIWKGLVLSGPMCGVSKKYKPVWPLEKL  180

Query  821   LPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYI  642
             LPLAAF AP+WRI+ TKPP  +SY+E  K+K+V+KSPNR  +++PPAATALELLKVC+YI
Sbjct  181   LPLAAFVAPSWRIVITKPPGSKSYKEGWKRKMVSKSPNRVASQKPPAATALELLKVCEYI  240

Query  641   QNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESVE  462
             Q N HELEVPLLILQGGDDKVCD  A   V++SA SKDKT+KIF GMWHQLIGEPNESVE
Sbjct  241   QRNSHELEVPLLILQGGDDKVCDPEAATLVYESAGSKDKTMKIFPGMWHQLIGEPNESVE  300

Query  461   LVFNTTLSWIQMRANLAR  408
             LVFNT LSW+++RA+LA+
Sbjct  301   LVFNTMLSWLEVRADLAK  318



>ref|XP_009587884.1| PREDICTED: caffeoylshikimate esterase-like [Nicotiana tomentosiformis]
Length=319

 Score =   480 bits (1235),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 233/318 (73%), Positives = 270/318 (85%), Gaps = 0/318 (0%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M+HPIFQANE SPYGDL REEFYK+  I+HKE F+LN+   KIFTQSWQ +S ++ RG+V
Sbjct  1     MSHPIFQANENSPYGDLPREEFYKQQKIMHKESFMLNKQNMKIFTQSWQPESSNQLRGLV  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              MIHGYTSESSWLFELNAV MAK G FV A+DL GHGYSEG  G+IP I P+V DCI   
Sbjct  61    GMIHGYTSESSWLFELNAVTMAKAGFFVCALDLQGHGYSEGSPGYIPSIQPLVEDCIQYF  120

Query  1001  DSARAHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEF  822
             DSARA+HPKLPAFLYGESLGGAIA LICL QK VW GL+LSGPMCGVSKKYKP+WPLE+ 
Sbjct  121   DSARANHPKLPAFLYGESLGGAIATLICLRQKTVWKGLVLSGPMCGVSKKYKPVWPLEKL  180

Query  821   LPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYI  642
             LPLAAF AP+WRI+ TKPP  +SY+E  K+K+V+KSPN   +++PPAATALELLKVC+YI
Sbjct  181   LPLAAFVAPSWRIVITKPPGSKSYKEGWKRKMVSKSPNHMASQKPPAATALELLKVCEYI  240

Query  641   QNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESVE  462
             Q N HELEVPLLILQGGDDKVCD  A + V+++A SKDKT+KIF GMWHQLIGEPNESVE
Sbjct  241   QRNSHELEVPLLILQGGDDKVCDPEAAQLVYETAGSKDKTMKIFPGMWHQLIGEPNESVE  300

Query  461   LVFNTTLSWIQMRANLAR  408
             LVFNT LSW+++RA+LA+
Sbjct  301   LVFNTMLSWLEVRADLAK  318



>ref|XP_004233162.1| PREDICTED: caffeoylshikimate esterase-like [Solanum lycopersicum]
Length=344

 Score =   462 bits (1190),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 225/318 (71%), Positives = 269/318 (85%), Gaps = 0/318 (0%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M+HPIFQ+NE SPYG+L+REEFYK+H I+HK+ F+LN+   KIFTQSWQ +S ++ RG+V
Sbjct  26    MSHPIFQSNENSPYGNLTREEFYKQHKIMHKQSFMLNKQNMKIFTQSWQPESSNQLRGLV  85

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              MIHGYTSESSWLFELNAVAM K G FV ++DL GHGYSEG  G+IP I P+V DCI   
Sbjct  86    GMIHGYTSESSWLFELNAVAMVKAGFFVCSLDLQGHGYSEGSPGYIPCIQPLVQDCIQYF  145

Query  1001  DSARAHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEF  822
             DSARA HP LPAFLYGESLGGAI+ LICL QK+VWNGL+LSGPM GVSKKY+P+WPLE+ 
Sbjct  146   DSARADHPNLPAFLYGESLGGAISTLICLRQKNVWNGLMLSGPMFGVSKKYRPVWPLEKL  205

Query  821   LPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYI  642
             LPLAAF AP+WRI+ TKPP+  SY+E  K+K+++KSPNR  +E+PPAATALELLKVC+YI
Sbjct  206   LPLAAFIAPSWRIVITKPPASISYKEEWKRKIISKSPNRLASEKPPAATALELLKVCEYI  265

Query  641   QNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESVE  462
             Q N HEL+VPLLILQGG+DKVCD  A K V+KSA SKDK + I+  MWHQLIGEPNESVE
Sbjct  266   QRNSHELQVPLLILQGGEDKVCDPEAAKLVYKSAGSKDKAINIYPEMWHQLIGEPNESVE  325

Query  461   LVFNTTLSWIQMRANLAR  408
             LVFNT LSW+++RA+LA+
Sbjct  326   LVFNTMLSWLEVRADLAK  343



>emb|CAN63634.1| hypothetical protein VITISV_009388 [Vitis vinifera]
Length=328

 Score =   445 bits (1144),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 216/320 (68%), Positives = 259/320 (81%), Gaps = 0/320 (0%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             MAHP+ QANE SP+G+L+REEFYKKHH++H+EGF+LN    KIFTQSW  DS  +P+G+V
Sbjct  1     MAHPVHQANENSPFGNLTREEFYKKHHVLHQEGFMLNSQNLKIFTQSWCPDSTLQPKGLV  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              M+HGYTSESSWLF L AVA+AK G FVYA+DL GHGYSEG  GHIP I P+V DCI   
Sbjct  61    AMVHGYTSESSWLFGLTAVAIAKAGFFVYALDLQGHGYSEGLPGHIPDIQPIVRDCIQYF  120

Query  1001  DSARAHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEF  822
             DSARA+HPKLPAFLYGESLGGAI IL+CL Q+  WNGLIL+G MCGVS K+KP+WPLE+ 
Sbjct  121   DSARANHPKLPAFLYGESLGGAITILLCLKQECKWNGLILNGAMCGVSAKFKPVWPLEKL  180

Query  821   LPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYI  642
             LP+AAFFAPNWRI+ +KP + +SY+E  K+KLVAKSPNR  + +PPAATALE L+VC YI
Sbjct  181   LPVAAFFAPNWRIVISKPLASKSYKEEWKRKLVAKSPNRXASGKPPAATALEFLRVCDYI  240

Query  641   QNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESVE  462
               +CHELEVP+L++ G DD VC  ++ + V++ AASKDKTL IF GMWHQLIGEP E VE
Sbjct  241   SRHCHELEVPMLVVHGEDDMVCAXDSARTVYELAASKDKTLNIFPGMWHQLIGEPKEGVE  300

Query  461   LVFNTTLSWIQMRANLARAH  402
             LVF T LSWI  RA  A+A+
Sbjct  301   LVFGTILSWIGSRAEKAKAN  320



>ref|XP_002263371.1| PREDICTED: caffeoylshikimate esterase-like [Vitis vinifera]
Length=328

 Score =   444 bits (1142),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 215/320 (67%), Positives = 259/320 (81%), Gaps = 0/320 (0%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             MAHP+ QANE SP+G+L+REEFYKKHH++H+EGF+LN    KIFTQSW  DS  +P+G+V
Sbjct  1     MAHPVHQANENSPFGNLTREEFYKKHHVLHQEGFMLNSQNLKIFTQSWCPDSTLQPKGLV  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              M+HGYTSESSWLF L AVA+AK G  VYA+DL GHGYSEG  GHIP I P+V DCI   
Sbjct  61    AMVHGYTSESSWLFGLTAVAIAKAGFLVYALDLQGHGYSEGLPGHIPDIQPIVRDCIQYF  120

Query  1001  DSARAHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEF  822
             DSARA+HPKLPAFLYGESLGGAIAIL+CL Q+  WNGLIL+G MCGVS K+KP+WPLE+ 
Sbjct  121   DSARANHPKLPAFLYGESLGGAIAILLCLKQECKWNGLILNGAMCGVSAKFKPVWPLEKL  180

Query  821   LPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYI  642
             LP+AAFFAPNWRI+ +KP + +SY+E  K+KLVAKSPNR  + +PPAATALE L+VC YI
Sbjct  181   LPVAAFFAPNWRIVISKPLASKSYKEEWKRKLVAKSPNRRASGKPPAATALEFLRVCDYI  240

Query  641   QNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESVE  462
               +CHELEVP+L++ G DD VC  ++ + V++ AASKDKTL IF GMWHQLIGEP E VE
Sbjct  241   SRHCHELEVPMLVVHGEDDMVCASDSARTVYELAASKDKTLNIFPGMWHQLIGEPKEGVE  300

Query  461   LVFNTTLSWIQMRANLARAH  402
             LVF T L+WI  RA  A+A+
Sbjct  301   LVFGTILTWIDSRAEKAKAN  320



>emb|CDP17301.1| unnamed protein product [Coffea canephora]
Length=322

 Score =   439 bits (1129),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 221/315 (70%), Positives = 256/315 (81%), Gaps = 0/315 (0%)
 Frame = -1

Query  1358  AHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVC  1179
             +HPI QANE SPYGDL+REEFYKKH I+HKE F+LN+   KIFTQSWQ DS    +G+V 
Sbjct  4     SHPIHQANENSPYGDLTREEFYKKHQILHKESFMLNKKSMKIFTQSWQPDSTARLKGLVG  63

Query  1178  MIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLD  999
             MIHGY+SESSWLFELNAVA+AK G FV A+DL GHGYSEG  G I     +V DCIL  +
Sbjct  64    MIHGYSSESSWLFELNAVAIAKAGYFVCALDLEGHGYSEGLPGQISNFQFLVSDCILFFN  123

Query  998   SARAHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFL  819
             SARA HPKLPAFLYGES+GGAIAILI L Q++ WNG++LSGPMCGVS K+KP+WPLE+ L
Sbjct  124   SARAEHPKLPAFLYGESMGGAIAILIGLRQRNEWNGIVLSGPMCGVSNKFKPLWPLEKLL  183

Query  818   PLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQ  639
             P+AAF AP+WRI F KPP+R SY+E  KK+LVAKSPNR  + +PPA TA EL+K C YIQ
Sbjct  184   PVAAFIAPSWRITFMKPPARGSYKEAWKKQLVAKSPNRPSSGKPPAITAQELMKTCSYIQ  243

Query  638   NNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESVEL  459
               CHELEVPLLIL G DD++CD  A K VF+SAASKDKTLKIFAGM HQLIGEPNESVEL
Sbjct  244   RKCHELEVPLLILHGEDDRICDPEAAKFVFESAASKDKTLKIFAGMRHQLIGEPNESVEL  303

Query  458   VFNTTLSWIQMRANL  414
             +F T +SWI++RA L
Sbjct  304   IFGTVISWIEVRAEL  318



>ref|XP_010251778.1| PREDICTED: caffeoylshikimate esterase-like [Nelumbo nucifera]
Length=331

 Score =   427 bits (1097),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 199/315 (63%), Positives = 252/315 (80%), Gaps = 0/315 (0%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             MAHPI QANE SP+G+L+REEFYKKH ++H+E F+LN+   KIFTQ W  DS   PRGVV
Sbjct  1     MAHPIHQANENSPFGELTREEFYKKHSVLHQEKFILNKQNMKIFTQCWGPDSTIRPRGVV  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              M+HGYTS+SSW+FEL AVA+AK+G +V A+DL GHG+SEG  GHIP I PVV DCI C 
Sbjct  61    AMVHGYTSDSSWIFELTAVAIAKSGFYVTALDLQGHGFSEGLSGHIPDIRPVVDDCIQCF  120

Query  1001  DSARAHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEF  822
             D+ARA+HPKLPAFLYGESLGGAIAIL+ L QK +W+GL+LSG MCGVS K++P WPLE  
Sbjct  121   DTARANHPKLPAFLYGESLGGAIAILVALRQKELWSGLVLSGAMCGVSAKFRPAWPLEML  180

Query  821   LPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYI  642
             LP+AAFFAP W+I+ TKP +  S++E  K+KLVA +PNR  + +PPAATALE L+VC+ +
Sbjct  181   LPVAAFFAPTWKIVITKPIASRSFKEEWKRKLVAGNPNRRSSGKPPAATALEFLRVCEQV  240

Query  641   QNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESVE  462
             +   HELE+PLL+L G DD+VCD ++ + +++ A SKDKTLKIF+GMWHQLIGEP E V+
Sbjct  241   KRRSHELELPLLVLHGEDDQVCDSDSARLLYELAESKDKTLKIFSGMWHQLIGEPKEGVD  300

Query  461   LVFNTTLSWIQMRAN  417
             +VF   LSW++ R +
Sbjct  301   MVFGAILSWLRDRTS  315



>ref|XP_010245789.1| PREDICTED: caffeoylshikimate esterase-like [Nelumbo nucifera]
Length=330

 Score =   415 bits (1067),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 203/317 (64%), Positives = 248/317 (78%), Gaps = 2/317 (1%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQ--HDSCDEPRG  1188
             MAHPI QANE SP+GDLSREEFYKKHH++H+E F+LN+   KIFTQSW+  + +  E RG
Sbjct  1     MAHPIHQANENSPFGDLSREEFYKKHHVLHQEKFMLNKQNMKIFTQSWRPANTAMAELRG  60

Query  1187  VVCMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCIL  1008
             +V M+HGYTSESSW+FEL AVA+AK  L+V A+DL GHGYSEG  GHIP I P+V DCI 
Sbjct  61    LVAMVHGYTSESSWVFELTAVAIAKARLYVCALDLQGHGYSEGLSGHIPDIRPLVDDCIQ  120

Query  1007  CLDSARAHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLE  828
               D+AR  HPKLPAFL+GESLGGA+A+L+ L QK VW+GL+L+G MCGVS K+KP WPLE
Sbjct  121   YFDTARDDHPKLPAFLFGESLGGAVAMLVALKQKGVWSGLVLNGAMCGVSSKFKPAWPLE  180

Query  827   EFLPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCK  648
               LP+AAFFAP WRI  TKP +  SY+E  K+KLVAK+PNR    +PPAATALE L+VC+
Sbjct  181   MLLPVAAFFAPTWRIAITKPIASRSYKEEWKRKLVAKNPNRRSYGKPPAATALEFLRVCE  240

Query  647   YIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNES  468
              I+  CHELE+PLL++ G DD VCD ++ + V++ A SKDKTLKIF GMWHQ IGEP E 
Sbjct  241   QIRRKCHELELPLLVVHGEDDLVCDSDSARLVYEKAESKDKTLKIFPGMWHQWIGEPKEG  300

Query  467   VELVFNTTLSWIQMRAN  417
             V+ VF T LSW+Q R +
Sbjct  301   VDQVFGTILSWLQDRTD  317



>ref|XP_011096881.1| PREDICTED: caffeoylshikimate esterase-like [Sesamum indicum]
Length=320

 Score =   407 bits (1047),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 198/315 (63%), Positives = 249/315 (79%), Gaps = 1/315 (0%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQ-HDSCDEPRGVVC  1179
             HPI +ANE+SPYG+L++EEFY+KHHI H E F+LN++  KIFTQSWQ   S  + +GVV 
Sbjct  4     HPIHEANESSPYGNLTKEEFYQKHHIFHHETFMLNKHNMKIFTQSWQPAGSNSQLKGVVG  63

Query  1178  MIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLD  999
             MIHGYTSES WLFEL+AV +AK G  V ++DL GHG+SEG R HI  +  +VHDC+   D
Sbjct  64    MIHGYTSESGWLFELSAVGIAKAGFLVCSLDLQGHGFSEGPRDHITDVQSLVHDCLQYFD  123

Query  998   SARAHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFL  819
             S RAHHP LP FLYGESLG AIAILICL+QK  WNGLI+SG MC +S K+KP+WPLE+ L
Sbjct  124   SVRAHHPNLPHFLYGESLGAAIAILICLHQKKAWNGLIVSGAMCEISSKFKPVWPLEKLL  183

Query  818   PLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQ  639
             P  AF AP+WRI  T+PP+  SYRE  K+KLV +SPNR  + +P AATAL+LL+VC+YI+
Sbjct  184   PPVAFVAPSWRIPITRPPASRSYRENWKRKLVERSPNRRTSGKPTAATALQLLRVCEYIK  243

Query  638   NNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESVEL  459
              NCHE+E P+L+L GG+D +CD +  K +++SA+SKDK+LKIF GMWHQLIGEPNES E 
Sbjct  244   RNCHEVEAPMLVLHGGEDMICDPDGAKHLYESASSKDKSLKIFPGMWHQLIGEPNESAEK  303

Query  458   VFNTTLSWIQMRANL  414
             +F+T LSWI++RA L
Sbjct  304   IFDTILSWIEVRAGL  318



>ref|XP_002300571.2| hypothetical protein POPTR_0001s47090g [Populus trichocarpa]
 gb|EEE85376.2| hypothetical protein POPTR_0001s47090g [Populus trichocarpa]
Length=333

 Score =   396 bits (1018),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 191/315 (61%), Positives = 244/315 (77%), Gaps = 1/315 (0%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQ-HDSCDEPRGV  1185
             ++HPI QANE SPYGDL+REEFYKKH I+H+E F+ N+ + KIFTQ W+  D   + +G+
Sbjct  2     LSHPIHQANEKSPYGDLTREEFYKKHQILHQESFMFNKKKMKIFTQFWRPDDPTSQLKGI  61

Query  1184  VCMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILC  1005
             V M+HGY+SESSWL EL A+A+AK G  V A+DL GHGYS+G RGHIP I  VV DCI+ 
Sbjct  62    VAMVHGYSSESSWLNELTAIAIAKAGFLVCALDLQGHGYSDGLRGHIPNIQYVVSDCIMF  121

Query  1004  LDSARAHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEE  825
              DS +A+ P LPAFLYGESLGGAI+ILICL Q + W+GLILSG MCG+S K+KP+WPLE+
Sbjct  122   FDSVKANSPNLPAFLYGESLGGAISILICLKQGYTWDGLILSGAMCGISAKFKPMWPLEK  181

Query  824   FLPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKY  645
              LPLAA FAP WR++ +KP S  SY+E  K++LVA +PNR  + +PPAATALE L+VC+Y
Sbjct  182   LLPLAALFAPTWRVVASKPVSSRSYKEEWKRRLVANNPNRPKSGKPPAATALEFLRVCEY  241

Query  644   IQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESV  465
             I+ +C++L VP L++ G DD  CD  +   V++SA SKDKTLKIF GMWH L+GEP E+V
Sbjct  242   IRKHCYDLGVPFLMVHGEDDFACDFRSASFVYESATSKDKTLKIFPGMWHMLVGEPKENV  301

Query  464   ELVFNTTLSWIQMRA  420
             ELVF T L+W++  A
Sbjct  302   ELVFGTILTWLRDHA  316



>ref|XP_006448890.1| hypothetical protein CICLE_v10017467mg [Citrus clementina]
 gb|ESR62130.1| hypothetical protein CICLE_v10017467mg [Citrus clementina]
Length=330

 Score =   392 bits (1007),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 197/322 (61%), Positives = 247/322 (77%), Gaps = 8/322 (2%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSC-------  1203
             M+HPI QANE SPYGDL+REEFYKKH IIH+E F+LN+ + K+FTQ+W+ + C       
Sbjct  1     MSHPISQANENSPYGDLTREEFYKKHQIIHEESFMLNKRKMKLFTQTWRPEYCANNNHLH  60

Query  1202  -DEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPV  1026
               + +G+V M+HGYT++SSW+ EL AVA+AK G  V A+DL GHG S+G  GHIP I  V
Sbjct  61    HQQFKGLVAMVHGYTADSSWISELTAVAIAKLGFLVCALDLQGHGQSDGYPGHIPNIQHV  120

Query  1025  VHDCILCLDSARAHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYK  846
             V DC    DS +A +PKLP+FLYGESLGGAI ILI L QK+ W+GLIL+G MCG+S K+K
Sbjct  121   VQDCTQFFDSVKAQNPKLPSFLYGESLGGAICILISLQQKYGWDGLILNGSMCGISSKFK  180

Query  845   PIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALE  666
             P WPLE+ LP+AA FAP W+++ TKP + +S++E  K++LVAK+PNR  + +PPAATALE
Sbjct  181   PTWPLEKLLPVAALFAPTWKVVVTKPVASKSFKEEWKRRLVAKNPNRRSSGKPPAATALE  240

Query  665   LLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI  486
              L+VCKYI+ +CHEL+VPLLIL G DD VCD  A + V++SAASKDKTLKI  GM H LI
Sbjct  241   FLRVCKYIRTHCHELQVPLLILHGEDDVVCDPEAARFVYESAASKDKTLKILPGMRHMLI  300

Query  485   GEPNESVELVFNTTLSWIQMRA  420
             GE  E+VELVF T LSWIQ RA
Sbjct  301   GETGENVELVFGTILSWIQERA  322



>ref|XP_011039896.1| PREDICTED: caffeoylshikimate esterase-like [Populus euphratica]
Length=356

 Score =   389 bits (998),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 188/322 (58%), Positives = 245/322 (76%), Gaps = 2/322 (1%)
 Frame = -1

Query  1382  YQHRK*KMAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQ-HDS  1206
             +Q +K  ++HPI QANE SPYGDL+REEFYKKH I+H+E F+ N+   +IFTQSW+  D 
Sbjct  27    FQDKK-MLSHPIHQANEKSPYGDLTREEFYKKHQILHQERFMFNKKNMRIFTQSWRPDDP  85

Query  1205  CDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPV  1026
               +  G+V M+HGY+SESSWL EL A+A+AK G  V A+DL GHGYS+G RGHIP I  V
Sbjct  86    SSQLEGIVAMVHGYSSESSWLNELTAIAIAKAGFLVCALDLQGHGYSDGLRGHIPNIRYV  145

Query  1025  VHDCILCLDSARAHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYK  846
             V DCI+  DS +A+ P LPAFLYGESLGGAI+ILICL Q + W+G ILSG MCG+S K+K
Sbjct  146   VSDCIMFFDSVKANSPNLPAFLYGESLGGAISILICLKQGYTWDGFILSGAMCGISAKFK  205

Query  845   PIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALE  666
             P+WPLE+ LPLAA FAP W+++ +K  S  SY+E  K++LVA +PNR  + +PPAATALE
Sbjct  206   PMWPLEKLLPLAALFAPTWKVVASKSVSSRSYKEEWKRRLVANNPNRPKSGKPPAATALE  265

Query  665   LLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI  486
              L+VC+YI+ +C++L VP L++ G DD  CD  +    ++SA+SKDKTLKIF GMWH L+
Sbjct  266   FLRVCEYIRMHCYDLGVPFLMVHGEDDFACDFRSACFAYESASSKDKTLKIFPGMWHMLV  325

Query  485   GEPNESVELVFNTTLSWIQMRA  420
             GEP E+V+LVF T L+W++  A
Sbjct  326   GEPKENVDLVFGTILTWLRDHA  347



>ref|XP_008441075.1| PREDICTED: caffeoylshikimate esterase-like [Cucumis melo]
Length=330

 Score =   381 bits (979),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 182/310 (59%), Positives = 240/310 (77%), Gaps = 0/310 (0%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M+HPI QANE SPYG+L+REEFYKKH++ H E F+LN  + KIFTQSW+ DS  + +GVV
Sbjct  1     MSHPINQANENSPYGELTREEFYKKHNVTHHESFILNAQKMKIFTQSWRPDSDTKLKGVV  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              M+HGYT +S W+FEL  VA+AK G  V ++DL GHG SEG  G IP I+ +VHDC L  
Sbjct  61    AMVHGYTCDSGWIFELTGVAIAKLGFLVCSLDLQGHGRSEGAPGSIPDIELLVHDCTLFF  120

Query  1001  DSARAHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEF  822
             DS R  HP LPAFLYGESLGGAI+ILI L Q+ VWNG++L+G MCG+S K+KPIWPLE+ 
Sbjct  121   DSIREQHPNLPAFLYGESLGGAISILISLKQEGVWNGIVLNGFMCGISGKFKPIWPLEKL  180

Query  821   LPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYI  642
             LP+AA  AP+ R++ +KP + +SY+E  K++LVA++PNR  + +PP ATALE L+VC+YI
Sbjct  181   LPIAASLAPSLRLVISKPVASKSYKEEWKRRLVARNPNRRFSGKPPMATALEFLRVCEYI  240

Query  641   QNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESVE  462
             + NCHE+ VP+L++ G DD VCD  + + VF++A S+DKTLK++ GMWHQLIGE  E VE
Sbjct  241   KRNCHEIRVPMLMVHGEDDVVCDSWSARYVFEAAESEDKTLKVYPGMWHQLIGEAKEDVE  300

Query  461   LVFNTTLSWI  432
             +V+ T L+W+
Sbjct  301   IVYGTILNWL  310



>ref|XP_008794508.1| PREDICTED: caffeoylshikimate esterase-like [Phoenix dactylifera]
Length=326

 Score =   380 bits (977),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 188/323 (58%), Positives = 235/323 (73%), Gaps = 1/323 (0%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDS-CDEPRGV  1185
             M HPI QAN+  PYG L+REEFY+KH ++H+E F+LN +  KIFTQ+W+  S   E +GV
Sbjct  1     MNHPILQANKNCPYGGLTREEFYQKHQLLHQEAFMLNGHNGKIFTQTWRPASPSSELKGV  60

Query  1184  VCMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILC  1005
             V M+HGY SESSW+F+L AVA+AK G    A+DLPGHGYSEG+RGHIP I  V+ DCI  
Sbjct  61    VAMVHGYNSESSWIFQLTAVAIAKLGFLACALDLPGHGYSEGQRGHIPTISLVIDDCIQF  120

Query  1004  LDSARAHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEE  825
              DS R  + +LPAFLYGESLGGAIA+L+ L QK  W+GLIL+G MCGVS K+KP+WPLE+
Sbjct  121   FDSVRLAYGRLPAFLYGESLGGAIAMLVYLRQKAKWDGLILNGAMCGVSAKFKPVWPLEK  180

Query  824   FLPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKY  645
              LPLAA  APNWR+  TKP    SY+E  K++LV +SP     E PPA+TALE L++C+ 
Sbjct  181   LLPLAALIAPNWRVTVTKPLVDMSYKEKWKRELVRRSPRAQNYEHPPASTALEFLRICEE  240

Query  644   IQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESV  465
             I   C ELE+P+L+L GG+D VCD  + + V++ A SKDKTLKI  GMWHQLIGEP E+V
Sbjct  241   IGRRCGELELPMLVLHGGEDSVCDSGSAELVYELAGSKDKTLKILPGMWHQLIGEPQETV  300

Query  464   ELVFNTTLSWIQMRANLARAHKF  396
             EL F    SW++ RA  A    F
Sbjct  301   ELGFGIIFSWLKDRAKRASLASF  323



>ref|XP_006448889.1| hypothetical protein CICLE_v10015863mg [Citrus clementina]
 gb|ESR62129.1| hypothetical protein CICLE_v10015863mg [Citrus clementina]
Length=336

 Score =   379 bits (974),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 191/323 (59%), Positives = 240/323 (74%), Gaps = 8/323 (2%)
 Frame = -1

Query  1364  KMAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSC------  1203
             KM+HPI QANE SPYGDL+ EEFYKKH IIH+E F+LN+ + K+FTQ+W+ + C      
Sbjct  2     KMSHPISQANENSPYGDLTLEEFYKKHQIIHEESFMLNKRKMKLFTQTWRPEYCANNNHL  61

Query  1202  --DEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDP  1029
                + +G+V M+HGYT++SSW+ EL AVA+AK G  V A+DL GHG S+G  GHIP I  
Sbjct  62    HHQQFKGLVAMVHGYTADSSWISELTAVAIAKLGFLVCALDLQGHGQSDGYPGHIPNIQH  121

Query  1028  VVHDCILCLDSARAHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKY  849
             VV DC    DS ++  PKLP+ LYGESLGGAI ILI L QK+ W+GLIL+G MCG+S  +
Sbjct  122   VVQDCTQFFDSVKSQKPKLPSLLYGESLGGAICILISLQQKYGWDGLILNGSMCGISSTF  181

Query  848   KPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATAL  669
             KP  PLE+ LP+ A FAP W+++ TKP + +S++E  K++LVAK+PNR  + +PPAAT L
Sbjct  182   KPTRPLEKLLPVDALFAPTWKVVVTKPVASKSFKEEWKRRLVAKNPNRRSSGKPPAATEL  241

Query  668   ELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQL  489
             E L+VCKYI+ +CHELEVPL+IL G DD VCD  A   V++SAASKDKTLKI  GMWH L
Sbjct  242   EFLRVCKYIRMHCHELEVPLIILHGEDDVVCDPEAATFVYESAASKDKTLKILPGMWHML  301

Query  488   IGEPNESVELVFNTTLSWIQMRA  420
             IGE  E+VELVF T  SWIQ RA
Sbjct  302   IGETGENVELVFGTIFSWIQERA  324



>gb|KGN49464.1| hypothetical protein Csa_6G525500 [Cucumis sativus]
Length=328

 Score =   379 bits (972),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 181/317 (57%), Positives = 240/317 (76%), Gaps = 0/317 (0%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M+HPI QANE SPYG+L+REEFYKKH++ H E F+LN  + KIFTQSWQ DS  + +GVV
Sbjct  1     MSHPISQANENSPYGELTREEFYKKHNVTHHESFILNAQKMKIFTQSWQPDSDSKLKGVV  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              M+HGYT +S W+FEL  +A+AK G  V ++DL GHG SEG  G I  I+ +V DC    
Sbjct  61    AMVHGYTCDSGWIFELTGIAIAKLGFLVCSLDLQGHGRSEGAPGSIRDIELLVLDCTQFF  120

Query  1001  DSARAHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEF  822
             DS R  HP LPAFLYGESLGGAI+ILI L Q+ VWNG++L+G MCG+S K+KPIWPLE+ 
Sbjct  121   DSIREQHPNLPAFLYGESLGGAISILISLKQEGVWNGIVLNGSMCGISAKFKPIWPLEKL  180

Query  821   LPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYI  642
             LP+AA  AP+ R++ +KP + +SY+E  K++LVA++PNR  + +PP ATALE L+VC+YI
Sbjct  181   LPIAASLAPSLRLVISKPVASKSYKEEWKRRLVARNPNRRFSGKPPMATALEFLRVCEYI  240

Query  641   QNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESVE  462
             + NCHE+ VPLL++ G DD VCD  + + V+++A S+DKTLK++ GMWHQLIGE  E+VE
Sbjct  241   KRNCHEIRVPLLMVHGEDDVVCDSWSARYVYEAAESEDKTLKVYPGMWHQLIGETKENVE  300

Query  461   LVFNTTLSWIQMRANLA  411
             +V+ T  +W+  RA  A
Sbjct  301   VVYGTIFNWLVDRAEKA  317



>ref|XP_004158692.1| PREDICTED: monoglyceride lipase-like [Cucumis sativus]
Length=328

 Score =   378 bits (971),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 181/317 (57%), Positives = 240/317 (76%), Gaps = 0/317 (0%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M+HPI QANE SPYG+L+REEFYKKH++ H E F+LN  + KIFTQSWQ DS  + +GVV
Sbjct  1     MSHPISQANENSPYGELTREEFYKKHNVTHHESFILNAQKMKIFTQSWQPDSDSKLKGVV  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              M+HGYT +S W+FEL  +A+AK G  V ++DL GHG SEG  G I  I+ +V DC    
Sbjct  61    AMVHGYTCDSGWIFELTGIAIAKLGFLVCSLDLQGHGRSEGAPGSIRDIELLVLDCTQFF  120

Query  1001  DSARAHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEF  822
             DS R  HP LPAFLYGESLGGAI+ILI L Q+ VWNG++L+G MCG+S K+KPIWPLE+ 
Sbjct  121   DSIREQHPNLPAFLYGESLGGAISILISLKQEGVWNGIVLNGSMCGISAKFKPIWPLEKL  180

Query  821   LPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYI  642
             LP+AA  AP+ R++ +KP + +SY+E  K++LVA++PNR  + +PP ATALE L+VC+YI
Sbjct  181   LPIAASLAPSLRLVISKPVASKSYKEEWKRRLVARNPNRRFSGKPPMATALEFLRVCEYI  240

Query  641   QNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESVE  462
             + NCHE+ VPLL++ G DD VCD  + + V+++A S+DKTLK++ GMWHQLIGE  E+VE
Sbjct  241   KRNCHEIRVPLLMVHGEDDVVCDSWSARYVYEAAESEDKTLKVYPGMWHQLIGETKENVE  300

Query  461   LVFNTTLSWIQMRANLA  411
             +V+ T  +W+  RA  A
Sbjct  301   VVYGTIFNWLVDRAEKA  317



>gb|EYU19116.1| hypothetical protein MIMGU_mgv1a027063mg [Erythranthe guttata]
Length=322

 Score =   366 bits (940),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/321 (57%), Positives = 232/321 (72%), Gaps = 7/321 (2%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQ------HDSCD  1200
             M+HPI +ANE SPYGDL++EEFYKKHHI H++ F+LN +  KIFTQSWQ      + +  
Sbjct  1     MSHPIHEANENSPYGDLTKEEFYKKHHIFHQQSFMLNNHNMKIFTQSWQPADSNPNPNPS  60

Query  1199  EPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVH  1020
                G V MIHGYTSESSWLFELNAVA+AK G FV A+DL GHG S+G   HI  I+P+V 
Sbjct  61    PLNGFVGMIHGYTSESSWLFELNAVAIAKAGFFVCALDLQGHGLSQGPHDHISDINPLVQ  120

Query  1019  DCILCLDSARAHHPKLPAFLYGESLGGAIAILICLNQKHV-WNGLILSGPMCGVSKKYKP  843
             DC+   DS RA +  +P F+YGESLG AIAIL+CL Q+ + W GLI++G MC VS KYKP
Sbjct  121   DCLQFFDSKRADYRNIPHFMYGESLGAAIAILVCLQQRTMRWRGLIVAGAMCEVSNKYKP  180

Query  842   IWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALEL  663
             +WPLE+ LP+AA  APNWRI  T+ P+  SYRE  K+ LV +SPNR    +P A TAL+L
Sbjct  181   MWPLEKLLPIAALIAPNWRIWITRAPTSRSYRERWKRVLVERSPNRRSCGKPTAGTALQL  240

Query  662   LKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIG  483
             L+VC  ++  C +L+V +LIL GG D +CD    + ++++AAS+DKTL+IF GMWHQLIG
Sbjct  241   LRVCDCVREKCADLDVAMLILHGGGDVICDPKGARFLYETAASEDKTLRIFEGMWHQLIG  300

Query  482   EPNESVELVFNTTLSWIQMRA  420
             E NE  + VF+T L WIQ R 
Sbjct  301   ESNEGAQQVFDTMLEWIQART  321



>gb|EPS70994.1| hypothetical protein M569_03765, partial [Genlisea aurea]
Length=314

 Score =   365 bits (937),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 182/315 (58%), Positives = 228/315 (72%), Gaps = 2/315 (1%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEP-RGV  1185
             MAHPI  ANE SPYG+ +REEFYKKH I H+  F+LN+   KIFTQ+WQ      P + +
Sbjct  1     MAHPIHGANEASPYGNQTREEFYKKHRISHRHTFMLNQQSMKIFTQTWQPSDPTVPLKAL  60

Query  1184  VCMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILC  1005
             + MIHGYTSESSWL ELN+VA AK G FV A+DL GHGYSEG   HIP +DP++ DCI  
Sbjct  61    IAMIHGYTSESSWLSELNSVAFAKAGFFVCALDLQGHGYSEGPPDHIPDLDPLIQDCIQY  120

Query  1004  LDSARAHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEE  825
              DS RA +PKLP F+YGESLGG+IAI +CL QK  W GLILSG MC +SKK+K +WPL++
Sbjct  121   FDSIRAQYPKLPHFIYGESLGGSIAISVCLKQKQAWRGLILSGAMCEISKKFK-LWPLDK  179

Query  824   FLPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKY  645
              +  AAF AP+WRI   KPPS  SYRE  K+KL  +SP R    +P  A+ L+  K+C+Y
Sbjct  180   LVSTAAFIAPSWRIGIIKPPSSISYREEWKRKLTWRSPTRKTCGKPTPASTLQFFKICRY  239

Query  644   IQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESV  465
             I+N+C EL+V +L+L GG+D VCD    + +++ AAS DKTLKI+  MWH LIGEPN+ V
Sbjct  240   IKNHCDELDVAMLVLHGGNDPVCDPQGARNLWERAASSDKTLKIYPDMWHVLIGEPNDRV  299

Query  464   ELVFNTTLSWIQMRA  420
             E  FN  LSWI++RA
Sbjct  300   EEAFNYMLSWIEIRA  314



>ref|XP_010923690.1| PREDICTED: caffeoylshikimate esterase-like [Elaeis guineensis]
Length=326

 Score =   358 bits (919),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 180/318 (57%), Positives = 225/318 (71%), Gaps = 1/318 (0%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCD-EPRGV  1185
             M HPI QAN+ SPYG L+REEFY+KH I+H+E  +LN +  KIFTQ+W+  S   +  G+
Sbjct  1     MNHPIHQANKNSPYGGLTREEFYQKHQILHQEAHMLNRHSMKIFTQTWRPASPSVKLNGI  60

Query  1184  VCMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILC  1005
             V M+HGY SESSW+F+L AVA+AK G    A+DLPGHG+S+G RGHIP I PV+ DCI  
Sbjct  61    VAMVHGYNSESSWIFQLTAVAIAKLGFLACALDLPGHGHSQGPRGHIPTIGPVIDDCIQF  120

Query  1004  LDSARAHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEE  825
              DS R+ H  LPAFLYGESLGGAIA+L+   QK  W+GLIL+G MCGVS K+KP WPLE+
Sbjct  121   FDSVRSAHGHLPAFLYGESLGGAIAMLVYFKQKSKWDGLILNGAMCGVSTKFKPPWPLEK  180

Query  824   FLPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKY  645
              LP  A   PNWR+  T+     SY+E  KK+LV +SP     E PPA+TA E LKVC+ 
Sbjct  181   LLPFVACITPNWRVTVTESLVDRSYKENWKKELVRRSPRAQEFEHPPASTAWEFLKVCEE  240

Query  644   IQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESV  465
             I   C ELE+PLL+L G +D VCD ++ + V+  A S+DKTL+I  GMWHQLIGEP E+V
Sbjct  241   IGRRCSELELPLLVLHGEEDSVCDSDSAELVYALARSEDKTLEILPGMWHQLIGEPQETV  300

Query  464   ELVFNTTLSWIQMRANLA  411
             EL F    SW++ RA  A
Sbjct  301   ELGFGIIFSWLKDRAKRA  318



>gb|KDP34930.1| hypothetical protein JCGZ_09218 [Jatropha curcas]
Length=295

 Score =   339 bits (869),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 172/309 (56%), Positives = 226/309 (73%), Gaps = 29/309 (9%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HPI QANE +P+GD + EEFYKKH I+H + F+LN+ + KIFTQSW  DS + P+G+V M
Sbjct  4     HPINQANENNPFGDFTTEEFYKKHKILHHQSFMLNKKKMKIFTQSWVLDSTN-PKGLVAM  62

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
             IHGY+SESSW+ EL A+A+AK G  V+A+DL GHG S+G  GHIP I  +V+DCI   DS
Sbjct  63    IHGYSSESSWVNELTAIAIAKLGFLVFALDLQGHGRSDGLPGHIPNIQYLVNDCIQYFDS  122

Query  995   ARAHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLP  816
              +A +PK+PAFLYGESLG                             K+KPIWPLE+ LP
Sbjct  123   VKAEYPKVPAFLYGESLGA----------------------------KFKPIWPLEKLLP  154

Query  815   LAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQN  636
             +AA FAP+W+ + +K    +SY+E  K+KL+AK+PNR P  +PPAATALELL+VC++I+N
Sbjct  155   VAALFAPSWKGVVSKSVGSKSYKEEWKRKLMAKNPNRRPTGKPPAATALELLRVCEFIRN  214

Query  635   NCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESVELV  456
             +CHEL+VPLLI+ GGDD VCD ++ + V++SA SKDKTLKIF GMWH LIGEP E+V++V
Sbjct  215   HCHELDVPLLIVHGGDDMVCDFDSARFVYESATSKDKTLKIFPGMWHVLIGEPKENVQVV  274

Query  455   FNTTLSWIQ  429
             F+T LSW++
Sbjct  275   FDTILSWLE  283



>ref|XP_002523188.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39219.1| conserved hypothetical protein [Ricinus communis]
Length=290

 Score =   331 bits (848),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 171/318 (54%), Positives = 217/318 (68%), Gaps = 33/318 (10%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M+HPI QANE SPYG+ +REEFY+KH I+  + F LN+   KIFTQ W  DS  +P+G+V
Sbjct  1     MSHPIHQANEESPYGEYTREEFYRKHQILQHQSFTLNKENMKIFTQLWSQDSASQPKGLV  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              M+HGY+SESSW+ EL AVA+AK G  V A+DL GHGYS+G  GHIP I  VV+DCI   
Sbjct  61    AMVHGYSSESSWINELTAVAIAKAGFLVCALDLQGHGYSDGLPGHIPDIQSVVNDCIQVF  120

Query  1001  DSARAHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEF  822
             DS +A +PKLPAFLY                                  K+KPIWPLE+ 
Sbjct  121   DSVKADNPKLPAFLYA---------------------------------KFKPIWPLEKL  147

Query  821   LPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYI  642
             LP+AA  AP+WRI+ +KP + +SY+E  K++LVAK+PNR    +PPAATA+  L+VC+YI
Sbjct  148   LPVAALLAPSWRILVSKPVASKSYKEEWKRRLVAKNPNRRRPGKPPAATAMAFLRVCEYI  207

Query  641   QNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESVE  462
             + +CHELEV LL++ G +D VCD NA + V++SAA+KDKTLKIF GMWH LIGEP E+VE
Sbjct  208   RRHCHELEVSLLMVHGEEDAVCDVNAARFVYESAATKDKTLKIFPGMWHMLIGEPKENVE  267

Query  461   LVFNTTLSWIQMRANLAR  408
             LVF T  SW+   A  AR
Sbjct  268   LVFCTIFSWLGDHAAKAR  285



>ref|XP_004307391.1| PREDICTED: monoglyceride lipase-like [Fragaria vesca subsp. vesca]
Length=328

 Score =   312 bits (800),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 173/320 (54%), Positives = 215/320 (67%), Gaps = 4/320 (1%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M HPI +ANE SP+GDL+ EEFY +H + H   +V N    K+FTQ W      E  GV+
Sbjct  1     MPHPISEANEKSPFGDLTAEEFYSRHSVSHGSEYVTNPRGLKLFTQWWTPLPPAEVLGVL  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              ++HG+T E+SW  +L AV  AK G  V AID  GHG+S+G   HIP I+PVV DCI   
Sbjct  61    AIVHGFTGETSWFVQLTAVNFAKAGFAVCAIDHQGHGFSDGLVAHIPDINPVVDDCISFF  120

Query  1001  DSARAHH-PKLPAFLYGESLGGAIAILICLNQ-KHVWNGLILSGPMCGVSKKYKPIWPLE  828
             +S RA H P LP+FLY ESLGGAIAIL+ L +    W+GLIL+G MCG+S K+KP WPLE
Sbjct  121   ESFRARHSPSLPSFLYAESLGGAIAILVTLRRVGRPWDGLILNGAMCGISAKFKPPWPLE  180

Query  827   EFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKVC  651
               L L A   P WR++ T+    E S++E  K+KL   SP R P  RP AATALELL+VC
Sbjct  181   HLLFLVAAVIPTWRVVPTRGSLPEVSFKEEWKRKLALASPRR-PLARPRAATALELLRVC  239

Query  650   KYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNE  471
             K +Q    E+EVPLLI+ GGDD VCD   V+ +FK A+SKDKTL+I  GMWHQLIGEP E
Sbjct  240   KELQGKFEEVEVPLLIVHGGDDVVCDPACVEELFKRASSKDKTLRIHPGMWHQLIGEPPE  299

Query  470   SVELVFNTTLSWIQMRANLA  411
             +VELVF   + W++ RA  A
Sbjct  300   NVELVFGEMVDWLRTRAERA  319



>ref|XP_006854516.1| hypothetical protein AMTR_s00175p00065840 [Amborella trichopoda]
 gb|ERN15983.1| hypothetical protein AMTR_s00175p00065840 [Amborella trichopoda]
Length=332

 Score =   307 bits (787),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 159/324 (49%), Positives = 213/324 (66%), Gaps = 8/324 (2%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSW-----QHDSCDEPR  1191
             HPI +ANE SP+GD + ++FY +H I H   F+ N     IFTQSW      HDS  +  
Sbjct  7     HPIAEANERSPFGDFTPDQFYDRHGITHSSSFMRNARGMNIFTQSWLPIKNDHDS-KQVM  65

Query  1190  GVVCMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCI  1011
             G+VC++HG+T ESSW  +L AVAMAK G    A+D  GHG S+G   HIP I+PV+ DC 
Sbjct  66    GIVCVVHGFTGESSWFVQLTAVAMAKQGFACCALDHQGHGLSDGLSTHIPNIEPVLDDCQ  125

Query  1010  LCLDSARAHHP-KLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWP  834
                 + R+  P  LPAFLY ESLGGA+A+ + L  K  W+GLIL+G MCG+S ++KP WP
Sbjct  126   AFFSNFRSRFPPSLPAFLYAESLGGAMALFLHLRDKRSWSGLILNGAMCGISPRFKPPWP  185

Query  833   LEEFLPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKV  654
             LE  L +AA  AP WR++ T+   R S++E  K +L   SP R    +P A TALELL++
Sbjct  186   LEHLLWIAAAVAPTWRLVPTRGIPRASFKEEWKFRLAVASPYR-TARKPRAGTALELLRI  244

Query  653   CKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPN  474
             CK +Q    E+E P+L++ G +D+VCD   V+ + + A SKDKTLKI+ GMWHQL+GEP 
Sbjct  245   CKVLQERFEEVEAPMLVVHGEEDRVCDPKGVEELVRRAGSKDKTLKIYEGMWHQLVGEPQ  304

Query  473   ESVELVFNTTLSWIQMRANLARAH  402
             E+VE VF   ++W++ RA  ARAH
Sbjct  305   ENVEKVFGDIINWLKERATRARAH  328



>ref|XP_010534286.1| PREDICTED: caffeoylshikimate esterase-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010534287.1| PREDICTED: caffeoylshikimate esterase-like isoform X2 [Tarenaya 
hassleriana]
Length=329

 Score =   305 bits (780),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 157/311 (50%), Positives = 203/311 (65%), Gaps = 4/311 (1%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HP+  ANE SP+GDLS EEFY +H + H   F+ N    K+FTQ W       P G+V +
Sbjct  4     HPVADANEKSPFGDLSAEEFYNRHGVTHSSAFITNSRGLKLFTQWWSPLPPSRPLGLVAV  63

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
             +HG+T ESSW  +L ++  AK+G    AID  GHG+S+G   HIP I+PVV DCI   D 
Sbjct  64    VHGFTGESSWFLQLTSILFAKSGFIAVAIDHQGHGFSDGLGAHIPDINPVVDDCISFFDD  123

Query  995   ARAHH--PKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEF  822
              R+ H  P LP FLY ESLGGAIA+ I + QK  W+GLIL+G MCG+S K+KP WPLE  
Sbjct  124   FRSRHVSPDLPCFLYSESLGGAIALYIAIRQKSRWDGLILNGAMCGISAKFKPPWPLEHL  183

Query  821   LPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKY  645
             L + A   P WR+I T+    + S++E  KKKL   SP R    RP AATA EL++VCK 
Sbjct  184   LFVVATLIPTWRVIPTRGSIPDLSFKEPWKKKLALASPRR-TVARPRAATAYELVRVCKD  242

Query  644   IQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESV  465
             +Q    E+EVP+LI+ GGDD VCD   V+ + + A S DKT+KI+ GMWHQL+GEP E+ 
Sbjct  243   LQGRFEEVEVPILIVHGGDDVVCDPACVEELHRRAKSVDKTIKIYPGMWHQLVGEPEENC  302

Query  464   ELVFNTTLSWI  432
             +LVF+  L W+
Sbjct  303   DLVFSDMLEWL  313



>ref|XP_010524322.1| PREDICTED: caffeoylshikimate esterase [Tarenaya hassleriana]
Length=325

 Score =   303 bits (777),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 161/316 (51%), Positives = 204/316 (65%), Gaps = 5/316 (2%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HP+ +A E SP+G LS +EFY +H + H   FV N    K+FTQ W   S   P G+V +
Sbjct  4     HPVSEATEQSPFGSLSADEFYNRHSVSHSSAFVTNPRGLKLFTQWWSPLS-GRPLGLVAV  62

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
             +HG+TSESSW  +L +V  AK+G    AID  GHG+S+G   HIP I+PVV DCI   D 
Sbjct  63    VHGFTSESSWFLQLTSVLFAKSGFLTCAIDHQGHGFSDGLITHIPDINPVVDDCISFFDD  122

Query  995   ARAHH--PKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEF  822
              R+ H  P LP+FLY ESLGGAIAI I L QK +W+GLIL+G MCG+S K+KP WPLE  
Sbjct  123   FRSRHVPPHLPSFLYSESLGGAIAIYITLRQKTLWDGLILNGAMCGISPKFKPPWPLEHL  182

Query  821   LPLAAFFAPNWRIIFTKPP-SRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKY  645
             L L A   P W +I T+   +  S++E  KKKL   SP R    RP AATA EL++VC+ 
Sbjct  183   LSLVATLVPTWHVIPTRGSIAGVSFKEPWKKKLALASPRR-TVARPRAATAYELMRVCRD  241

Query  644   IQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESV  465
             +Q   HE+EVP LI+ GGDD VCD + V+ + + A S DKT+KI+ GMWHQLIGE  E V
Sbjct  242   LQGQFHEVEVPFLIVHGGDDVVCDPSCVEELHRRAMSVDKTIKIYPGMWHQLIGEAEEDV  301

Query  464   ELVFNTTLSWIQMRAN  417
             + VF   L W+  R  
Sbjct  302   DKVFADILDWLNTRTE  317



>ref|XP_011040996.1| PREDICTED: caffeoylshikimate esterase [Populus euphratica]
Length=331

 Score =   303 bits (776),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 162/322 (50%), Positives = 208/322 (65%), Gaps = 6/322 (2%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HP+ +ANE SP+G LS  EFY KHH+ H   ++ N    K+FTQ W      +P G V +
Sbjct  5     HPVAEANEQSPFGTLSPTEFYAKHHVTHSSEYITNSRGFKLFTQRWTPLPPTKPIGCVAV  64

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRG---HIPRIDPVVHDCILC  1005
             +HG+T ESSW  +L ++  AK G  V AID  GHG+S+G      HIP I+PVV DC+  
Sbjct  65    VHGFTGESSWFIQLTSILFAKNGFSVCAIDHQGHGFSDGLDNLMYHIPDINPVVEDCMQY  124

Query  1004  LDSARAHH-PKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLE  828
               + R +H P LPAFLY ESLGGAIA+ I L QK  W+GLIL+G MCG+S K+KP WPLE
Sbjct  125   FKTFRENHAPDLPAFLYSESLGGAIALYITLRQKGAWDGLILNGAMCGISAKFKPPWPLE  184

Query  827   EFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKVC  651
               L + A   P WR++ T+    E S++E  K KL   SP R    RP AATALEL++VC
Sbjct  185   HLLFVVAAVVPTWRVVPTRGSLPEVSFKEEWKAKLAFASPKRVAM-RPRAATALELVRVC  243

Query  650   KYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNE  471
             K +Q    E++VPLL++ GGDD VCD    K +F+ AAS D+TLKI+ GMWHQL+GEP E
Sbjct  244   KELQGRFEEVDVPLLVVHGGDDMVCDPACAKELFERAASTDRTLKIYPGMWHQLVGEPEE  303

Query  470   SVELVFNTTLSWIQMRANLARA  405
             +V LVF   + W+Q RA    A
Sbjct  304   NVNLVFGDIVEWLQNRAKRGGA  325



>ref|XP_008446889.1| PREDICTED: caffeoylshikimate esterase-like [Cucumis melo]
Length=333

 Score =   303 bits (776),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 161/321 (50%), Positives = 209/321 (65%), Gaps = 9/321 (3%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M HP+  A+E SP+G L+ +EFY +H + H   F+ N    K+FTQ W       P G++
Sbjct  1     MVHPVEDADERSPFGSLTADEFYARHSVTHGSEFITNSRGLKLFTQWWIPQPPINPIGII  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              ++HG+T ESSW  +L AV   K G    AID  GHG+SEG + HIP I+PVV DCI   
Sbjct  61    AIVHGFTGESSWFIQLTAVHFTKAGFITCAIDHQGHGFSEGLQYHIPDINPVVEDCISFF  120

Query  1001  DSARAHH-PKLPAFLYGESLGGAIAILICLNQKHV------WNGLILSGPMCGVSKKYKP  843
             D+ R  H P LP+FLY ESLGGAIA+LI L QK        WNG++L+G MCG+S K+KP
Sbjct  121   DAFRERHAPSLPSFLYSESLGGAIALLITLRQKSTTENSRPWNGVVLNGAMCGISPKFKP  180

Query  842   IWPLEEFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALE  666
              WPLE FL LAA   P WR++ T+    + S++   K+KL   SP R    RP AATA E
Sbjct  181   PWPLEHFLSLAAALLPTWRVVPTRGSIPDVSFKVDWKRKLATASPRRV-VARPRAATAEE  239

Query  665   LLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI  486
             L++VC+ +Q    E+EVPLLI  GGDD +CD   V+ +++ AASKDKTLKI+ GMWHQLI
Sbjct  240   LMRVCRELQERFEEVEVPLLISHGGDDVICDPACVEELYRRAASKDKTLKIYPGMWHQLI  299

Query  485   GEPNESVELVFNTTLSWIQMR  423
             GEP E+VELVF   + W++ R
Sbjct  300   GEPKENVELVFGDMVEWLRSR  320



>ref|XP_006436421.1| hypothetical protein CICLE_v10033579mg [Citrus clementina]
 ref|XP_006485682.1| PREDICTED: caffeoylshikimate esterase-like [Citrus sinensis]
 ref|XP_006485685.1| PREDICTED: caffeoylshikimate esterase-like [Citrus sinensis]
 gb|ESR49661.1| hypothetical protein CICLE_v10033579mg [Citrus clementina]
Length=336

 Score =   303 bits (775),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 161/317 (51%), Positives = 212/317 (67%), Gaps = 3/317 (1%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HP+ +ANE S +G L+ +EFY +H + H   ++ N    ++FTQ W      +  GV+C+
Sbjct  4     HPVAEANEQSLFGSLTPDEFYARHSVSHSSEYITNSRGLRLFTQWWTPLPPAKTLGVLCV  63

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
             +HG+T E+SW+ +L AV  AK+G    AID  GHG+S+G   HIP ++PVV D I   DS
Sbjct  64    VHGFTGETSWIVQLTAVLFAKSGFATCAIDHQGHGFSDGLVAHIPDLNPVVEDAISFFDS  123

Query  995   ARAHH-PKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFL  819
              RA H P LPAFLY ESLGGAIA+ I L QK  W+GLIL+G MCG+S+K+KP WPLE  L
Sbjct  124   FRARHAPDLPAFLYSESLGGAIALYITLRQKGAWDGLILNGAMCGISQKFKPPWPLEHLL  183

Query  818   PLAAFFAPNWRIIFTKPP-SRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYI  642
                A+  P WR++ T+      S++E  K+KL   SP R P  RP AATALELL+V + +
Sbjct  184   FTVAWLVPTWRVVPTRGSLPMVSFKEEWKRKLALSSPRR-PVARPRAATALELLRVSRDL  242

Query  641   QNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESVE  462
             Q    E+EVP+LI  GGDD VCD   V+ ++K AASKDKTL I+ GMWHQLIGEP E+VE
Sbjct  243   QGRFEEVEVPMLICHGGDDVVCDPACVEELYKRAASKDKTLSIYPGMWHQLIGEPEENVE  302

Query  461   LVFNTTLSWIQMRANLA  411
             LVF   + W++ RA+ A
Sbjct  303   LVFGEMVEWLRERASSA  319



>gb|KDP44357.1| hypothetical protein JCGZ_20037 [Jatropha curcas]
Length=339

 Score =   302 bits (774),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 161/321 (50%), Positives = 208/321 (65%), Gaps = 6/321 (2%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HP+ +ANE SP+G LS  EFY +H + H   ++ N    K+FTQ W      E  G V M
Sbjct  5     HPVAEANEESPFGTLSPAEFYSRHRVTHSSEYITNSRGLKLFTQWWTPLPPTEIIGCVAM  64

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRG---HIPRIDPVVHDCILC  1005
             +HGYT ESSW  +L ++  A++G  V AID  GHG+S+G  G   HIP ++PVV DCI  
Sbjct  65    VHGYTGESSWFVQLTSILFAQSGFAVCAIDHQGHGFSDGLDGLIYHIPDLNPVVDDCIQF  124

Query  1004  LDSAR-AHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLE  828
              +  R  H P LPAFLY ESLGGAIA+ I L QK  W+GLIL+G MCG+S K+KP WPLE
Sbjct  125   FNRFRETHAPNLPAFLYAESLGGAIALYITLRQKGKWDGLILNGAMCGISDKFKPPWPLE  184

Query  827   EFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKVC  651
               L + A   P WR++ T+    + S++E  K+KL   SP R    RP AATALELL+VC
Sbjct  185   HLLFIVAAVMPTWRVVPTRGSLPDLSFKEEWKRKLAVSSPRRI-VARPRAATALELLRVC  243

Query  650   KYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNE  471
             + +Q    E+EVPLLI  GGDD VCD   V+ + + A S+DKTLKI+ GMWHQ++GEP E
Sbjct  244   RDLQGKFEEVEVPLLIAHGGDDLVCDPACVEELHRRATSRDKTLKIYPGMWHQIVGEPEE  303

Query  470   SVELVFNTTLSWIQMRANLAR  408
             +V LVF   + W++ RA  AR
Sbjct  304   NVNLVFGDMMEWLKSRAERAR  324



>ref|XP_004157524.1| PREDICTED: monoglyceride lipase-like [Cucumis sativus]
Length=333

 Score =   302 bits (773),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 160/321 (50%), Positives = 207/321 (64%), Gaps = 9/321 (3%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M HP+  A+E SP+G L+ +EFY +H + H   F+ N    K+FTQ W       P G++
Sbjct  1     MVHPVEDADERSPFGSLTADEFYARHSVTHGSKFITNSRGLKLFTQWWIPQPPVNPIGII  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              ++HG+T E+SW  +L AV   K G    AID  GHG+SEG   HIP I+PVV DCI   
Sbjct  61    GIVHGFTGETSWFIQLTAVHFTKAGFITCAIDHQGHGFSEGLLYHIPDINPVVEDCISFF  120

Query  1001  DSARAHH-PKLPAFLYGESLGGAIAILICLNQKHV------WNGLILSGPMCGVSKKYKP  843
             DS R  H P LP+FLY ESLGGAIA+LI L QK        WNG++L+G MCG+S K+KP
Sbjct  121   DSFRERHAPSLPSFLYSESLGGAIALLITLRQKSTTENSRPWNGVVLNGAMCGISPKFKP  180

Query  842   IWPLEEFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALE  666
              WPLE FL LAA   P WR++ T+    + S++   K+KL   SP R    RP AATA E
Sbjct  181   PWPLEHFLSLAAALLPTWRVVPTRGSIPDVSFKVDWKRKLATASPRRVVT-RPRAATAQE  239

Query  665   LLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI  486
             L++VC+ +Q    E+EVPLLI  GGDD +CD   V+ +++ A SKDKTLKI+ GMWHQLI
Sbjct  240   LMRVCRELQERFEEVEVPLLISHGGDDVICDPACVEELYRRATSKDKTLKIYPGMWHQLI  299

Query  485   GEPNESVELVFNTTLSWIQMR  423
             GEP E+VELVF   + W++ R
Sbjct  300   GEPKENVELVFGDMVEWLRSR  320



>ref|XP_004142429.1| PREDICTED: monoglyceride lipase-like [Cucumis sativus]
 gb|KGN52274.1| hypothetical protein Csa_5G623380 [Cucumis sativus]
Length=333

 Score =   302 bits (773),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 160/321 (50%), Positives = 207/321 (64%), Gaps = 9/321 (3%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M HP+  A+E SP+G L+ +EFY +H + H   F+ N    K+FTQ W       P G++
Sbjct  1     MVHPVEDADEQSPFGSLTADEFYARHSVTHGSEFITNSRGLKLFTQWWIPQPPVNPIGII  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              ++HG+T E+SW  +L AV   K G    AID  GHG+SEG   HIP I+PVV DCI   
Sbjct  61    GIVHGFTGETSWFIQLTAVHFTKAGFITCAIDHQGHGFSEGLLYHIPDINPVVEDCISFF  120

Query  1001  DSARAHH-PKLPAFLYGESLGGAIAILICLNQKHV------WNGLILSGPMCGVSKKYKP  843
             DS R  H P LP+FLY ESLGGAIA+LI L QK        WNG++L+G MCG+S K+KP
Sbjct  121   DSFRERHAPSLPSFLYSESLGGAIALLITLRQKSTTENSRPWNGVVLNGAMCGISPKFKP  180

Query  842   IWPLEEFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALE  666
              WPLE FL LAA   P WR++ T+    + S++   K+KL   SP R    RP AATA E
Sbjct  181   PWPLEHFLSLAAALLPTWRVVPTRGSIPDVSFKVDWKRKLATASPRRVVT-RPRAATAQE  239

Query  665   LLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI  486
             L++VC+ +Q    E+EVPLLI  GGDD +CD   V+ +++ A SKDKTLKI+ GMWHQLI
Sbjct  240   LMRVCRELQERFEEVEVPLLISHGGDDVICDPACVEELYRRATSKDKTLKIYPGMWHQLI  299

Query  485   GEPNESVELVFNTTLSWIQMR  423
             GEP E+VELVF   + W++ R
Sbjct  300   GEPKENVELVFGDMVEWLRSR  320



>ref|NP_197002.1| esterase/lipase/thioesterase family protein [Arabidopsis thaliana]
 emb|CAC01817.1| lysophospholipase-like protein [Arabidopsis thaliana]
 gb|AAY78825.1| esterase/lipase/thioesterase family protein [Arabidopsis thaliana]
 gb|AED92098.1| esterase/lipase/thioesterase family protein [Arabidopsis thaliana]
Length=327

 Score =   300 bits (768),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 155/321 (48%), Positives = 211/321 (66%), Gaps = 5/321 (2%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HP+ +AN +SP+G LS  EFY +H + H   +V N    K+FTQ W   +   P G++ +
Sbjct  4     HPVSEANASSPFGSLSAAEFYSRHSVTHSSAYVTNPTGLKLFTQWWTPLN-RPPLGLIAV  62

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
             +HG+T ESSW  +L +V  AK+G    AID  GHG+S+G   HIP I+ +V DCI   D 
Sbjct  63    VHGFTGESSWFLQLTSVLFAKSGYLTCAIDHQGHGFSDGLTAHIPNINLIVDDCISFFDD  122

Query  995   ARAHHPK--LPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEF  822
              R  H    LPAFLY ESLGGAIA+ I L QKH WNGLILSG MC +S K+KP WPL+  
Sbjct  123   FRKRHASSFLPAFLYSESLGGAIALYITLRQKHQWNGLILSGAMCSISHKFKPPWPLQHL  182

Query  821   LPLAAFFAPNWRIIFTKPP-SRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKY  645
             L LAA   P WR++ T+   +  S++E  K+KL   +PNR    +P AATA EL++VC+ 
Sbjct  183   LTLAATLIPTWRVVPTRGSIAGVSFKEPWKRKLAYANPNRTVG-KPRAATAYELVRVCED  241

Query  644   IQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESV  465
             +QN   E+EVPL+I+ G DD VCD  +V+ +++  +S+DKT+KI+ GMWHQLIGE  E+V
Sbjct  242   LQNRFEEVEVPLMIVHGRDDVVCDPASVEELYRRCSSRDKTIKIYPGMWHQLIGESEENV  301

Query  464   ELVFNTTLSWIQMRANLARAH  402
             +LVF   L WI+ R+ ++  H
Sbjct  302   DLVFGDVLDWIKTRSEISTIH  322



>gb|AGV54710.1| monoglyceride lipase [Phaseolus vulgaris]
Length=325

 Score =   300 bits (767),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 163/323 (50%), Positives = 210/323 (65%), Gaps = 4/323 (1%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M HPI +ANE SP+G L+ ++FY +H + H   F+ N    K+FTQ W         G +
Sbjct  1     MVHPIAEANEESPFGTLTPDDFYARHSVSHASEFITNPRGLKLFTQWWLPLPPTTIVGTL  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              ++HG+T ESSWL +L AV  AK G    AID  GHG+S+G   HIP I+PVV DCI   
Sbjct  61    AVVHGFTGESSWLIQLTAVHFAKAGFATCAIDHQGHGFSDGLIAHIPDINPVVDDCISFF  120

Query  1001  DSARAH-HPKLPAFLYGESLGGAIAILICLNQ-KHVWNGLILSGPMCGVSKKYKPIWPLE  828
             +S R+   P LP+FLY ESLGGAIA+LI L + K  WNG+IL+G MCG+S K+KP WPLE
Sbjct  121   ESFRSRFDPSLPSFLYSESLGGAIALLITLRRGKKPWNGVILNGAMCGISAKFKPPWPLE  180

Query  827   EFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKVC  651
              FL +AA   P WR++ T+    + S++   K+KL   SP R    RP AATA ELL++C
Sbjct  181   HFLSIAAAVIPTWRVVPTRGSIPDVSFKVEWKRKLALASPRR-TVARPRAATAQELLRIC  239

Query  650   KYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNE  471
             + +Q    E+EVPLL+  GGDD VCD   V+ ++  AASKDKTLKI+ GMWHQ+IGEP E
Sbjct  240   RELQERYEEVEVPLLVAHGGDDVVCDPACVEELYARAASKDKTLKIYPGMWHQMIGEPEE  299

Query  470   SVELVFNTTLSWIQMRANLARAH  402
             +VELVF   L W+  RA  A  H
Sbjct  300   NVELVFGDMLEWLSSRAQRATVH  322



>ref|XP_009120902.1| PREDICTED: caffeoylshikimate esterase-like [Brassica rapa]
Length=335

 Score =   299 bits (766),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 156/324 (48%), Positives = 207/324 (64%), Gaps = 6/324 (2%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HPI  A+E++P+G LS +EFY KH + H   F+ N    KIFTQ W       P G+V +
Sbjct  4     HPISDADESNPFGSLSADEFYAKHSVTHSSAFITNPRGLKIFTQWWSPLPPARPIGIVAV  63

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
             +HG+T ESSW  +L ++  AK+G    AID  GHG+S+G   HIP I+PVV DCI   D 
Sbjct  64    VHGFTGESSWFLQLTSILFAKSGYITCAIDHQGHGFSDGLVAHIPDINPVVDDCISFFDD  123

Query  995   ARAHH----PKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLE  828
              R  +    P LP FLY ESLGGAIA+ I L Q+ VW+GLIL+G MCG+S K+KP WPLE
Sbjct  124   FRNRNRQETPDLPCFLYSESLGGAIALYISLRQRGVWDGLILNGAMCGISAKFKPPWPLE  183

Query  827   EFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKVC  651
               L + A   P WR+I T+    + S++E  K+KL   SP R    RP AATA EL++VC
Sbjct  184   HLLFVVANLIPTWRVIPTRGSIPDVSFKEPWKRKLAIASPRR-TVARPRAATAYELIRVC  242

Query  650   KYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNE  471
               +Q    E+EVPLLI+ GG D VCDQ  V+ + + A+S DKT+KI+ GMWHQ++GE  E
Sbjct  243   NELQGRFEEVEVPLLIVHGGGDVVCDQACVEELHRRASSGDKTIKIYPGMWHQMVGESEE  302

Query  470   SVELVFNTTLSWIQMRANLARAHK  399
              V+LV+   L+W++ R+  A   K
Sbjct  303   DVDLVYGDILTWLKTRSERAAERK  326



>ref|XP_002871641.1| esterase/lipase/thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH47900.1| esterase/lipase/thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=324

 Score =   298 bits (764),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 154/321 (48%), Positives = 210/321 (65%), Gaps = 6/321 (2%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HP+ +AN +SP+G LS   FY +H + H   FV N    K+FTQ W   +   P G++ +
Sbjct  4     HPVSEANASSPFGSLSAATFYSRHSVAHSSAFVTNPTGLKLFTQWWTPLN-RPPLGLIAV  62

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
             +HG+T ESSW  +L +V  AK+G    AID  GHG+S+G   HIP I+ +V DCI   D 
Sbjct  63    VHGFTGESSWFLQLTSVLFAKSGYLTCAIDHQGHGFSDGLTAHIPNINLIVDDCISFFDD  122

Query  995   ARAHHPK---LPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEE  825
              R  H     LP+FLY ESLGGAIA+ I L QKH WNGLILSG MC +S K+KP WPL+ 
Sbjct  123   FRKRHASFSSLPSFLYSESLGGAIALYITLRQKHQWNGLILSGAMCSISHKFKPPWPLQH  182

Query  824   FLPLAAFFAPNWRIIFTKPP-SRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCK  648
              L LAA   P WR++ T+   +  S++E  K+KL   +PNR    +P AATA EL++VC+
Sbjct  183   LLTLAATLIPTWRVVPTRGSIAGVSFKEPWKRKLAYANPNRTVG-KPRAATAYELVRVCE  241

Query  647   YIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNES  468
              +Q+   E+EVPL+I+ GGDD VCD  +V+ +++  +S+DKT+KI+ GMWHQLIGE  E+
Sbjct  242   DLQSRFEEVEVPLMIVHGGDDVVCDPASVEELYRRCSSRDKTIKIYPGMWHQLIGESEEN  301

Query  467   VELVFNTTLSWIQMRANLARA  405
             V+LVF   L WI  R+ ++R 
Sbjct  302   VDLVFGDVLDWIMKRSEISRT  322



>ref|XP_007143700.1| hypothetical protein PHAVU_007G094400g [Phaseolus vulgaris]
 gb|ESW15694.1| hypothetical protein PHAVU_007G094400g [Phaseolus vulgaris]
Length=325

 Score =   298 bits (764),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 162/323 (50%), Positives = 210/323 (65%), Gaps = 4/323 (1%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M HPI +ANE SP+G L+ ++FY +H + H   F+ N    K+FTQ W         G +
Sbjct  1     MVHPIAEANEESPFGTLTPDDFYARHSVNHASEFITNPRGLKLFTQWWLPLPPTTIVGTL  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              ++HG+T ESSWL +L AV  AK G    AID  GHG+S+G   HIP I+PVV DCI   
Sbjct  61    AVVHGFTGESSWLIQLTAVHFAKAGFATCAIDHQGHGFSDGLIAHIPDINPVVDDCISFF  120

Query  1001  DSARAH-HPKLPAFLYGESLGGAIAILICLNQ-KHVWNGLILSGPMCGVSKKYKPIWPLE  828
             +S R+   P LP+FLY ESLGGAIA+LI L + K  WNG+IL+G MCG+S K+KP WPLE
Sbjct  121   ESFRSRFDPSLPSFLYSESLGGAIALLITLRRGKKPWNGVILNGAMCGISAKFKPPWPLE  180

Query  827   EFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKVC  651
              FL +AA   P WR++ T+    + S++   K+KL   SP R    RP AATA EL+++C
Sbjct  181   HFLSIAAAVIPTWRVVPTRGSIPDVSFKVEWKRKLALASPRR-TVARPRAATAQELMRIC  239

Query  650   KYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNE  471
             + +Q    E+EVPLL+  GGDD VCD   V+ ++  AASKDKTLKI+ GMWHQ+IGEP E
Sbjct  240   RELQERYEEVEVPLLVAHGGDDVVCDPACVEELYARAASKDKTLKIYPGMWHQMIGEPEE  299

Query  470   SVELVFNTTLSWIQMRANLARAH  402
             +VELVF   L W+  RA  A  H
Sbjct  300   NVELVFGDMLEWLSSRAQRATVH  322



>ref|XP_009779135.1| PREDICTED: caffeoylshikimate esterase [Nicotiana sylvestris]
Length=335

 Score =   298 bits (764),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 161/329 (49%), Positives = 209/329 (64%), Gaps = 9/329 (3%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M HP+ +ANE SP+G LS +EFY  H + H   F+ N    K+FTQ W       P GVV
Sbjct  1     MKHPVAEANEVSPFGSLSPDEFYSHHSVSHGSEFITNSRGLKLFTQWWTPLPPANPIGVV  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
             C++HG+T ESSW  +L AV  AK G  V AID  GHG+S+G   HIP I+PVV DCI   
Sbjct  61    CVVHGFTGESSWFVQLTAVHFAKHGFAVCAIDHQGHGFSDGLVAHIPDINPVVDDCIAFF  120

Query  1001  DSARAHH--PKLPAFLYGESLGGAIAILICLNQ-----KHVWNGLILSGPMCGVSKKYKP  843
             DS R  H  P LP+FLY ESLGGAIA+LI L Q        ++G++L+G MCG+S K+KP
Sbjct  121   DSFRQRHAPPYLPSFLYAESLGGAIALLITLRQGDSALNRPFDGVVLNGAMCGISAKFKP  180

Query  842   IWPLEEFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALE  666
              WPLE  L +AAF  P WR++ T+    E S++   K+KL   SP R P  RP AATA E
Sbjct  181   PWPLEHLLDIAAFLIPTWRVVPTRGSIPEVSFKMEWKRKLAVASPRR-PLGRPRAATARE  239

Query  665   LLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI  486
             L++VC  +Q    E++VP L++ GG D VCD   V+ +++ A+S+DKTL ++ GMWHQL+
Sbjct  240   LVRVCGDLQRRFEEVKVPFLVIHGGGDVVCDPACVENLYRRASSEDKTLNVYPGMWHQLV  299

Query  485   GEPNESVELVFNTTLSWIQMRANLARAHK  399
             GEP E+VE VF   L W+  RA  A   K
Sbjct  300   GEPEENVEQVFGDVLEWLTTRAERAAGKK  328



>ref|XP_007009827.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY18637.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=339

 Score =   298 bits (764),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 163/319 (51%), Positives = 210/319 (66%), Gaps = 9/319 (3%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEP-RGVVC  1179
             HP+ +A+E SP+G L+ +EFY +H + H   F  N    K+FTQ W     + P  G+V 
Sbjct  4     HPVAEADEKSPFGTLTPDEFYARHSVSHSSEFFTNARGLKLFTQWWT--PLNTPISGIVA  61

Query  1178  MIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRG---HIPRIDPVVHDCIL  1008
             ++HG+T ESSWL +L +V  AK+G    AID  GHG+SEG  G   HIP ID VV DCI 
Sbjct  62    VVHGFTGESSWLLQLTSVLFAKSGFAACAIDHQGHGFSEGLDGLEAHIPSIDGVVDDCIQ  121

Query  1007  CLDSARAHHP-KLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPL  831
               D+ RA H   LPAFLY ESLGGAIA+ I L QK  W+GLIL+G MCG+S K+KP WPL
Sbjct  122   FFDAYRARHAADLPAFLYAESLGGAIALYISLRQKGAWDGLILNGAMCGISAKFKPPWPL  181

Query  830   EEFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKV  654
             E FL +AA   P WR++ T+    E S++E  K+KL   SP R    RP AATA EL+++
Sbjct  182   EHFLFIAAKLMPTWRVVPTRGSLPEVSFKEPWKRKLAIASPRR-TVARPRAATAYELIRI  240

Query  653   CKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPN  474
             C  +Q    E++VPLLI+ GGDD VCD   ++ ++K AAS DKTLKI+  MWHQLIGEP 
Sbjct  241   CNDLQGKFEEVDVPLLIVHGGDDVVCDPACIEELYKRAASVDKTLKIYPEMWHQLIGEPE  300

Query  473   ESVELVFNTTLSWIQMRAN  417
             E VELVF   + W++ RA+
Sbjct  301   EGVELVFGEMVEWLKSRAS  319



>emb|CDX92543.1| BnaA10g15820D [Brassica napus]
Length=339

 Score =   298 bits (764),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 156/324 (48%), Positives = 206/324 (64%), Gaps = 6/324 (2%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HPI  A+E++P+G LS +EFY KH + H   F  N    KIFTQ W       P G+V +
Sbjct  4     HPIADADESNPFGSLSADEFYAKHSVTHSSAFTTNPRGLKIFTQWWSPLPPTTPVGIVAV  63

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
             +HG+T ESSW  +L ++  AK+G    AID  GHG+S+G   HIP I+PVV DCI   D 
Sbjct  64    VHGFTGESSWFLQLTSILFAKSGYITCAIDHQGHGFSDGLVAHIPDINPVVDDCISFFDD  123

Query  995   ARAHH----PKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLE  828
              R  +    P LP FLY ESLGGAIA+ I L Q+ VW+GLIL+G MCG+S K+KP WPLE
Sbjct  124   FRNRNRQETPDLPCFLYSESLGGAIALYISLRQRGVWDGLILNGAMCGISAKFKPPWPLE  183

Query  827   EFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKVC  651
               L + A   P WR+I T+    + S++E  K+KL   SP R    RP AATA EL++VC
Sbjct  184   HLLFVVANLIPTWRVIPTRGSIPDVSFKEPWKRKLAIASPRR-TVARPRAATAYELIRVC  242

Query  650   KYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNE  471
               +Q    E+EVPLLI+ GG D VCDQ  V+ + + A+S DKT+KI+ GMWHQ++GE  E
Sbjct  243   NELQGRFEEVEVPLLIVHGGGDVVCDQACVEELHRRASSGDKTIKIYPGMWHQMVGESEE  302

Query  470   SVELVFNTTLSWIQMRANLARAHK  399
              V+LV+   L+W++ R+  A   K
Sbjct  303   DVDLVYGDILTWLKTRSERAAERK  326



>ref|XP_003536355.1| PREDICTED: caffeoylshikimate esterase-like [Glycine max]
Length=325

 Score =   298 bits (762),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 161/323 (50%), Positives = 209/323 (65%), Gaps = 4/323 (1%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M HPI +ANE SP+G L+ EEFY  H + H   FV N    K+FTQ W         G +
Sbjct  1     MVHPIAEANEESPFGKLTPEEFYAHHSVSHGSEFVTNPRGLKLFTQWWTPLPPKTIIGTL  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              ++HGYT ESSWL +L AV  AK G    A+D  GHG+S+G   HIP I+PVV DCI   
Sbjct  61    AVVHGYTGESSWLLQLTAVHFAKAGFATCALDHQGHGFSDGLVAHIPDINPVVDDCITFF  120

Query  1001  DSARAH-HPKLPAFLYGESLGGAIAILICLNQKH-VWNGLILSGPMCGVSKKYKPIWPLE  828
             ++ R+   P LP+FLY ESLGGAIA+LI L ++  +W+G+IL+G MCG+S K+KP WPLE
Sbjct  121   ENFRSRFDPSLPSFLYAESLGGAIALLITLRRREMLWSGVILNGAMCGISAKFKPPWPLE  180

Query  827   EFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKVC  651
              FL + A   P WR++ T+    E S++   K++L   SP R    RP AATA ELL++C
Sbjct  181   HFLSVVAAVIPTWRVVPTRGSIPEVSFKVEWKRRLALASPRR-TVARPRAATAQELLRIC  239

Query  650   KYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNE  471
             + +Q    E+EVPLL+  GGDD VCD   V+ +   AASKDKTLKI+ GMWHQ++GEP E
Sbjct  240   RELQGRYEEVEVPLLVAHGGDDVVCDPACVEELHARAASKDKTLKIYPGMWHQMVGEPEE  299

Query  470   SVELVFNTTLSWIQMRANLARAH  402
             +VELVF   L W++ RA  A  H
Sbjct  300   NVELVFGDMLEWLRTRAQRAPEH  322



>ref|XP_010492319.1| PREDICTED: caffeoylshikimate esterase-like [Camelina sativa]
Length=328

 Score =   298 bits (762),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 211/319 (66%), Gaps = 6/319 (2%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HP+ +AN +SP+G LS  EFY +H + H   +V N    K+FTQ W   +   P G++ +
Sbjct  4     HPVSEANTSSPFGSLSAAEFYSRHSVAHSSAYVTNPTGLKLFTQWWTPLN-RPPLGLIAV  62

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
             +HG+T ESSW  +L +V  AK+G    AID  GHG+S+G   HIP I+ +V DCI   D 
Sbjct  63    VHGFTGESSWFLQLTSVLFAKSGYLTCAIDHQGHGFSDGLTAHIPNINLIVDDCISLFDD  122

Query  995   ARAHHP---KLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEE  825
              R  H     LP+FLY ESLGGAIA+ I L QKH WNGLILSG MC +S K+KP WPL+ 
Sbjct  123   FRNRHSTSSSLPSFLYSESLGGAIALYITLRQKHQWNGLILSGGMCSISHKFKPPWPLQH  182

Query  824   FLPLAAFFAPNWRIIFTKPP-SRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCK  648
              L LAA   P WR++ T+   +  S++E  K+KL   +PNR    RP AATA EL++VC+
Sbjct  183   LLTLAATLIPTWRVVPTRGSIAGVSFKEPWKRKLAFANPNRTVG-RPRAATAYELVRVCE  241

Query  647   YIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNES  468
              +Q+   E+EVPL+I+ GGDD VCD  +V+ +++  +SKDKT+K++ GMWHQLIGE  E+
Sbjct  242   ELQSRFEEVEVPLMIVHGGDDVVCDPASVEELYRRCSSKDKTIKVYPGMWHQLIGESEEN  301

Query  467   VELVFNTTLSWIQMRANLA  411
             V+LVF   L WI+ R+ ++
Sbjct  302   VDLVFRDVLDWIKERSEVS  320



>ref|XP_010420143.1| PREDICTED: caffeoylshikimate esterase-like [Camelina sativa]
Length=328

 Score =   298 bits (762),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 155/319 (49%), Positives = 212/319 (66%), Gaps = 6/319 (2%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HP+ +AN +SP+G LS  EFY +H + H   +V N    K+FTQ W   +   P G++ +
Sbjct  4     HPVSEANTSSPFGSLSAAEFYSRHSVAHSSAYVTNPTGLKLFTQWWTPLN-RPPLGLIAV  62

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
             +HG+T ESSW  +L +V  AK+G    AID  GHG+S+G   HIP I+ +V DCI   D 
Sbjct  63    VHGFTGESSWFLQLTSVLFAKSGYLTCAIDHQGHGFSDGLTAHIPNINLIVDDCISFFDD  122

Query  995   ARAHHP---KLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEE  825
              R  H     LP+FLY ESLGGAIA+ I L QKH WNGLILSG MC +S K+KP WPL+ 
Sbjct  123   FRNRHSTSSSLPSFLYSESLGGAIALYITLRQKHQWNGLILSGGMCSISHKFKPPWPLQH  182

Query  824   FLPLAAFFAPNWRIIFTKPP-SRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCK  648
              L LAA   P WR++ T+   +  S++E  K+KL   +PNR    RP AATA EL++VC+
Sbjct  183   LLTLAATLIPTWRVVPTRGSIAGVSFKEPWKRKLAFANPNRTVG-RPRAATAYELVRVCE  241

Query  647   YIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNES  468
              +Q+   E+EVPL+I+ GGDD VCD  +V+ +++  +SKDKT+KI+ GMWHQLIGE  E+
Sbjct  242   ELQSRFEEVEVPLMIVHGGDDVVCDPASVEELYRRCSSKDKTIKIYPGMWHQLIGESEEN  301

Query  467   VELVFNTTLSWIQMRANLA  411
             V+LVF   L+WI+ R+ ++
Sbjct  302   VDLVFRDVLNWIKERSEVS  320



>ref|XP_006400484.1| hypothetical protein EUTSA_v10014061mg [Eutrema salsugineum]
 gb|ESQ41937.1| hypothetical protein EUTSA_v10014061mg [Eutrema salsugineum]
Length=335

 Score =   297 bits (761),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 208/322 (65%), Gaps = 4/322 (1%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HPI  A+E +P+G LS EEFY KH + H   F+ N    K+FTQ W       P G+V +
Sbjct  4     HPIADADEHNPFGSLSAEEFYAKHSVSHSSAFITNPRGLKLFTQWWSPLPPARPIGIVAV  63

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
             +HG+T ESSWL +L ++  AK+G    AID  GHG+S+G   HIP I+PVV DCI   D 
Sbjct  64    VHGFTGESSWLIQLTSILFAKSGYITCAIDHQGHGFSDGLIAHIPDINPVVDDCISFFDD  123

Query  995   ARAHH--PKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEF  822
              R     P LP FLY ESLGGAIA+ I L Q+ VW+GLIL+G MCG+S K+KP WPLE F
Sbjct  124   FRNRQETPDLPCFLYSESLGGAIALYISLRQRGVWDGLILNGAMCGISAKFKPPWPLEHF  183

Query  821   LPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKY  645
             L + A   P WR+I T+    + S++E  K+KL   SP R    RP AATA EL++VCK 
Sbjct  184   LFVVANLIPTWRVIPTRGSIPDVSFKEPWKRKLALASPRR-TVARPRAATAYELIRVCKE  242

Query  644   IQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESV  465
             +Q    E+E+PLLI+ GGDD VCD   V+ +++ A S+DKT+KI+  +WHQ++GE  E+V
Sbjct  243   LQERFEEVEIPLLIVHGGDDVVCDPACVEELYRRAGSEDKTIKIYPELWHQMVGESEENV  302

Query  464   ELVFNTTLSWIQMRANLARAHK  399
             +LV+   L W+  R+ +A   K
Sbjct  303   DLVYGDILKWLNSRSEIAAGRK  324



>gb|EYU39580.1| hypothetical protein MIMGU_mgv1a009732mg [Erythranthe guttata]
Length=333

 Score =   296 bits (758),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 162/326 (50%), Positives = 214/326 (66%), Gaps = 9/326 (3%)
 Frame = -1

Query  1364  KMAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEP-RG  1188
             K  HPI +ANETSP+G LS++EFY  H + H   ++  +   K+FTQ W       P +G
Sbjct  3     KYKHPIAEANETSPFGSLSQDEFYAHHSVSHGSEYITGKQNLKLFTQWWAPLQPAGPLKG  62

Query  1187  VVCMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCIL  1008
             VVC++HGYT ESSW  +L AV +AK G  V AID  GHG+SEG   H+P ID VV DCI 
Sbjct  63    VVCVVHGYTGESSWFVQLTAVHVAKHGFAVCAIDHMGHGFSEGLVAHVPDIDAVVDDCIS  122

Query  1007  CLDSARAHH-PKLPAFLYGESLGGAIAILICLNQKHV-----WNGLILSGPMCGVSKKYK  846
               D  RA H P LPAFLY ESLGGAIA+LI L ++ +     ++G++L+G MCG+S K+K
Sbjct  123   FFDGFRAKHAPDLPAFLYAESLGGAIALLITLRREGIVPERGFDGVVLNGAMCGISNKFK  182

Query  845   PIWPLEEFLPLAAFFAPNWRIIFTKPP-SRESYREVLKKKLVAKSPNRFPNERPPAATAL  669
             P WPLE FL +AA+  P W ++ T+      S++   K+KL   SP R P  RP AATA 
Sbjct  183   PPWPLEHFLSIAAYLIPTWCVVPTRGSLPNVSFKVDWKRKLALASPRR-PLLRPRAATAQ  241

Query  668   ELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQL  489
             ELL+VC+ +Q+   E++VP LI+ GG D VCD    + + + AASKDKTL+I+  MWHQL
Sbjct  242   ELLRVCREVQDKFAEVDVPFLIVHGGGDIVCDPACAEDLHRRAASKDKTLRIYPEMWHQL  301

Query  488   IGEPNESVELVFNTTLSWIQMRANLA  411
             +GEP E+VELVF   + W+  RA+ A
Sbjct  302   VGEPEENVELVFGEVVDWLLTRADRA  327



>ref|XP_004134900.1| PREDICTED: monoglyceride lipase-like [Cucumis sativus]
Length=267

 Score =   294 bits (752),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 142/256 (55%), Positives = 192/256 (75%), Gaps = 0/256 (0%)
 Frame = -1

Query  1178  MIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLD  999
             M+HGYT +S W+FEL  +A+AK G  V ++DL GHG SEG  G I  I+ +V DC    D
Sbjct  1     MVHGYTCDSGWIFELTGIAIAKLGFLVCSLDLQGHGRSEGAPGSIRDIELLVLDCTQFFD  60

Query  998   SARAHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFL  819
             S R  HP LPAFLYGESLGGAI+ILI L Q+ VWNG++L+G MCG+S K+KPIWPLE+ L
Sbjct  61    SIREQHPNLPAFLYGESLGGAISILISLKQEGVWNGIVLNGSMCGISAKFKPIWPLEKLL  120

Query  818   PLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQ  639
             P+AA  AP+ R++ +KP + +SY+E  K++LVA++PNR  + +PP ATALE L+VC+YI+
Sbjct  121   PIAASLAPSLRLVISKPVASKSYKEEWKRRLVARNPNRRFSGKPPMATALEFLRVCEYIK  180

Query  638   NNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESVEL  459
              NCHE+ VPLL++ G DD VCD  + + V+++A S+DKTLK++ GMWHQLIGE  E+VE+
Sbjct  181   RNCHEIRVPLLMVHGEDDVVCDSWSARYVYEAAESEDKTLKVYPGMWHQLIGETKENVEV  240

Query  458   VFNTTLSWIQMRANLA  411
             V+ T  +W+  RA  A
Sbjct  241   VYGTIFNWLVDRAEKA  256



>ref|XP_006288192.1| hypothetical protein CARUB_v10001430mg [Capsella rubella]
 gb|EOA21090.1| hypothetical protein CARUB_v10001430mg [Capsella rubella]
Length=328

 Score =   295 bits (756),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 152/319 (48%), Positives = 212/319 (66%), Gaps = 6/319 (2%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HP+ +AN +SP+G LS  EFY +H + H   +  N +  K+FTQ W   +   P G++ +
Sbjct  4     HPVSEANTSSPFGSLSAAEFYSRHSVAHSSAYFTNPSGLKLFTQWWTPLN-RPPLGLIAV  62

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
             +HG+T ESSW  +L +V  AK+G    AID  GHG+S+G   HIP I+ +V DCI   D 
Sbjct  63    VHGFTGESSWFLQLTSVLFAKSGYLTCAIDHRGHGFSDGLTAHIPNINLIVDDCISFFDD  122

Query  995   ARAHHPK---LPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEE  825
              R  H     LP+FLY ESLGGAIA+ I L QKH WNGLILSG MC +S K+KP WPL+ 
Sbjct  123   FRKRHATSSALPSFLYSESLGGAIALYITLRQKHQWNGLILSGAMCSISHKFKPPWPLQH  182

Query  824   FLPLAAFFAPNWRIIFTKPP-SRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCK  648
              L +AA   P WR++ T+   +  S++E  K+KL   +PNR    +P AATA EL++VC+
Sbjct  183   LLTIAATLIPTWRVVPTRGSIAGVSFKEPWKRKLAFSNPNRTAG-KPRAATAYELVRVCE  241

Query  647   YIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNES  468
              +Q+   E+EVPL+I+ GG+D VCD  +V+ +++  +SKDKTLK+++GMWHQLIGE  E+
Sbjct  242   DLQSRFEEVEVPLMIVHGGEDVVCDPASVEELYRRCSSKDKTLKVYSGMWHQLIGESEEN  301

Query  467   VELVFNTTLSWIQMRANLA  411
             V+LVF   L WI+ RA ++
Sbjct  302   VDLVFGDVLDWIKKRAYIS  320



>gb|KDO44719.1| hypothetical protein CISIN_1g035721mg, partial [Citrus sinensis]
Length=308

 Score =   294 bits (753),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 158/304 (52%), Positives = 204/304 (67%), Gaps = 3/304 (1%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HP+ +ANE S +G L+ +EFY +H + H   ++ N    ++FTQ W      +  GV+C+
Sbjct  4     HPVAEANEQSLFGSLTPDEFYARHSVSHSSEYITNSRGLRLFTQWWTPLPPAKTLGVLCV  63

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
             +HG+T ESSW+ +L AV  AK+G    AID  GHG+S+G   HIP ++PVV D I   DS
Sbjct  64    VHGFTGESSWIVQLTAVLFAKSGFATCAIDHQGHGFSDGLVAHIPDLNPVVEDAISFFDS  123

Query  995   ARAHH-PKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFL  819
              RA H P LPAFLY ESLGGAIA+ I L QK  W+GLIL+G MCG+S+K+KP WPLE  L
Sbjct  124   FRARHAPDLPAFLYSESLGGAIALYITLRQKGAWDGLILNGAMCGISQKFKPPWPLEHLL  183

Query  818   PLAAFFAPNWRIIFTKPP-SRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYI  642
                A+  P WR++ T+      S++E  K+KL   SP R P  RP AATALELL+V + +
Sbjct  184   FTVAWLVPTWRVVPTRGSLPMVSFKEEWKRKLALSSPRR-PVARPRAATALELLRVSRDL  242

Query  641   QNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESVE  462
             Q    E+EVP+LI  GGDD VCD   V+ ++K AASKDKTL I+ GMWHQLIGEP E+VE
Sbjct  243   QGRFEEVEVPMLICHGGDDVVCDPACVEELYKRAASKDKTLSIYPGMWHQLIGEPEENVE  302

Query  461   LVFN  450
             LVF 
Sbjct  303   LVFG  306



>ref|XP_009392259.1| PREDICTED: caffeoylshikimate esterase-like [Musa acuminata subsp. 
malaccensis]
Length=336

 Score =   295 bits (755),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 212/322 (66%), Gaps = 8/322 (2%)
 Frame = -1

Query  1364  KMAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGV  1185
             KM HP+ +A+E SP+G LS E+FY +H + H     +N    +IFTQ W+      P   
Sbjct  5     KMTHPVAEADERSPFGRLSAEDFYARHAVSHASSSFVNPRGLRIFTQWWEPLPPARPIAT  64

Query  1184  VCMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILC  1005
             V ++HG+T ESSWL +L AV +AK G  V A+D  GHG+S+G   HIP I+PVV DC+  
Sbjct  65    VAVVHGFTGESSWLVQLTAVYLAKHGFAVGALDHQGHGFSDGLVAHIPDIEPVVDDCVTF  124

Query  1004  LDSARAHH-PKLPAFLYGESLGGAIAILICLNQK-----HVWNGLILSGPMCGVSKKYKP  843
              DS RA + P LP FLY ESLGGAIA++I L +K       W+G++L+G MCG+S K+KP
Sbjct  125   FDSFRARYPPSLPCFLYAESLGGAIALMIHLREKDGRATRGWDGVVLNGAMCGISPKFKP  184

Query  842   IWPLEEFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALE  666
              WPLE  L LAA  AP W I FT+    + S++   K+KL   SP R    RP AATALE
Sbjct  185   PWPLEHLLWLAAAIAPTWNIAFTRGSIPDVSFKVEWKRKLALASPRR-TVARPRAATALE  243

Query  665   LLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI  486
             LL+VC+ +Q    ++ +P+LI+ G DD VCD   V+ + + AAS+DKT++IF GMWHQ++
Sbjct  244   LLRVCREVQGKFEQVTLPMLIVHGADDVVCDPACVEELRRRAASEDKTIRIFPGMWHQIV  303

Query  485   GEPNESVELVFNTTLSWIQMRA  420
             GEP+E+VELVF   + W++ RA
Sbjct  304   GEPDENVELVFGEIIEWLKARA  325



>ref|XP_003591911.1| Monoglyceride lipase [Medicago truncatula]
 gb|AES62162.1| alpha/beta hydrolase family protein [Medicago truncatula]
Length=325

 Score =   295 bits (754),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 160/320 (50%), Positives = 208/320 (65%), Gaps = 4/320 (1%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M HPI +AN+ SP+G L+ EEFY +H + H   F+ N    K+FTQ W  +   +  G +
Sbjct  1     MVHPIAEANDHSPFGTLTPEEFYTRHSVTHASEFITNSRGLKLFTQWWIPNPPTKLIGTL  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              ++HGYT ESSW  +L+AV  AK G    AID  GHG+S+G   HIP ++PVV DCI   
Sbjct  61    AVVHGYTGESSWTVQLSAVYFAKAGFATCAIDHQGHGFSDGLIAHIPDVNPVVDDCISFF  120

Query  1001  DSARAH-HPKLPAFLYGESLGGAIAILICLNQKHV-WNGLILSGPMCGVSKKYKPIWPLE  828
             +S R+     LP+FLY ESLGGAIA+LI L +  + WNGLIL+G MCGVS K+KP WPLE
Sbjct  121   ESFRSRFDSSLPSFLYSESLGGAIALLITLRRGGLPWNGLILNGAMCGVSDKFKPPWPLE  180

Query  827   EFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKVC  651
              FL LAA   P WR++ T+    + S++E  K+KL   SP R    RP AATA ELL++C
Sbjct  181   HFLSLAAAVIPTWRVVPTRGSIPDVSFKEEWKRKLAIASPKR-TVARPRAATAQELLRIC  239

Query  650   KYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNE  471
             + +Q    E++VP L + GGDD VCD   V+ ++  A SKDKTLKI+ GMWHQL+GEP E
Sbjct  240   RELQGRFEEVDVPFLAVHGGDDIVCDPACVEELYSRAGSKDKTLKIYDGMWHQLVGEPEE  299

Query  470   SVELVFNTTLSWIQMRANLA  411
             +VELVF   L W+   A  A
Sbjct  300   NVELVFGDMLEWLIKHAQRA  319



>ref|XP_006400019.1| hypothetical protein EUTSA_v10014122mg [Eutrema salsugineum]
 gb|ESQ41472.1| hypothetical protein EUTSA_v10014122mg [Eutrema salsugineum]
Length=321

 Score =   294 bits (752),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 153/318 (48%), Positives = 207/318 (65%), Gaps = 6/318 (2%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HP+ +AN +SP+G LS  EFY +H + H   +V N    K+FTQ W   +   P G++ +
Sbjct  4     HPVSEANTSSPFGSLSAAEFYSRHSVTHSSAYVTNPTGLKLFTQWWTPLN-RPPLGLIAV  62

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
             +HG+T ESSW  +L +V  AK+G    AID  GHG+S+G   HIP I+ +V DCI   D 
Sbjct  63    VHGFTGESSWFLQLTSVLFAKSGFLTCAIDHQGHGFSDGLTAHIPNINLIVDDCISFFDD  122

Query  995   ARAHHPK---LPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEE  825
              R  H     LP+FLY ESLGGAIA+ I L QK  WNGLILSG MC +S K+KP WPL+ 
Sbjct  123   FRNRHSSSSSLPSFLYAESLGGAIALYITLRQKSHWNGLILSGAMCSISHKFKPPWPLQH  182

Query  824   FLPLAAFFAPNWRIIFTKPP-SRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCK  648
              L LAA   P WR++ T+   +  S++E  K+KL   +PNR    RP AATA EL++VC+
Sbjct  183   LLTLAATLIPTWRVVPTRGSIAGVSFKEPWKRKLAFSNPNRTVG-RPRAATAYELVRVCE  241

Query  647   YIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNES  468
              +Q+   E+EVPL+I+ GGDD VCD ++V+ +++   S+DKT+KI+ GMWHQLIGE    
Sbjct  242   DLQSRFEEVEVPLMIVHGGDDVVCDPSSVEELYRRCNSRDKTIKIYQGMWHQLIGESESD  301

Query  467   VELVFNTTLSWIQMRANL  414
             V+LVF   L WIQ R+ +
Sbjct  302   VDLVFGDILDWIQKRSEI  319



>ref|XP_002274887.1| PREDICTED: caffeoylshikimate esterase [Vitis vinifera]
Length=329

 Score =   294 bits (752),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 157/317 (50%), Positives = 205/317 (65%), Gaps = 5/317 (2%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M HP+ +ANE SP+G LS  EFY +H + H   ++ N    K+FTQSW      +  G +
Sbjct  1     MVHPVAEANEQSPFGSLSPSEFYARHSVTHSSEYITNSRGMKLFTQSWTPLPPTKIIGTL  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              ++HG+T ESSW  +L AV   K G    AID  GHG+S+G   HIP I+PVV DCI   
Sbjct  61    AVVHGFTGESSWFLQLTAVHFTKAGFATCAIDHQGHGFSDGLVAHIPDINPVVDDCIAFF  120

Query  1001  DSARAHH-PKLPAFLYGESLGGAIAILICLNQ--KHVWNGLILSGPMCGVSKKYKPIWPL  831
             DS RA H P LP+FLY ESLGGAIA+LI L +     W+GL+L+G MCG+S K+KP WPL
Sbjct  121   DSFRARHAPSLPSFLYSESLGGAIALLITLRRGPSRPWDGLVLNGAMCGISPKFKPPWPL  180

Query  830   EEFLPLAAFFAPNWRIIFTKPP-SRESYREVLKKKLVAKSPNRFPNERPPAATALELLKV  654
             E FL L A   P WR++ T+    + S++   K+ L   SP R P  RP AATA ELL+V
Sbjct  181   EHFLFLLAAVVPTWRVVPTRGALPQLSFKVEWKRNLALASPRR-PVARPRAATAQELLRV  239

Query  653   CKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPN  474
             C+ IQN   E+EVP L++ G DD VCD   V+ +++ A SKDKTLKI+  M HQL+GEP+
Sbjct  240   CREIQNRYGEMEVPFLVVHGADDVVCDPACVEELYRRAPSKDKTLKIYPDMIHQLVGEPD  299

Query  473   ESVELVFNTTLSWIQMR  423
             E+VELVF   + W++ R
Sbjct  300   ENVELVFGDIVEWLRTR  316



>ref|XP_010067299.1| PREDICTED: caffeoylshikimate esterase [Eucalyptus grandis]
 gb|KCW65403.1| hypothetical protein EUGRSUZ_G02828 [Eucalyptus grandis]
Length=336

 Score =   293 bits (751),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 154/314 (49%), Positives = 204/314 (65%), Gaps = 6/314 (2%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M+HPI +A+E SP+G L+ +EFY +H + H   FV N    ++FTQ W         GV+
Sbjct  1     MSHPIAEASEASPFGSLTPDEFYARHSVSHGSEFVTNPRGLRLFTQWWTPLPPAPTLGVL  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              ++HGYT ESSWL +L +V  A+ G    A+D  GHG+S+G   HIP ++PVV DCI   
Sbjct  61    AVVHGYTGESSWLVQLTSVFFARAGFATCALDHQGHGFSDGLVAHIPDVNPVVDDCIAFF  120

Query  1001  DSARAHH--PKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLE  828
             DS RA H  P LPAFLY ESLGGAIA+ + L Q   W GL+L+G MCG+S K+KP WPLE
Sbjct  121   DSFRARHAPPGLPAFLYAESLGGAIALYVALRQPGAWAGLVLNGAMCGISAKFKPPWPLE  180

Query  827   EFLPLAAFFAPNWRIIFTKP--PSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKV  654
               L L A   P W ++ T+   P R S++E  K++L   SP R    RP AAT LELL++
Sbjct  181   HLLFLVAAVIPTWHVVPTRGSIPDR-SFKEERKRRLALASPRR-TVARPRAATGLELLRI  238

Query  653   CKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPN  474
             C+ +Q    E+EVPLLI+ G DD VCD   V+ ++  A SKDKTL+I+ GMWHQL+GEP+
Sbjct  239   CRELQGRFEEVEVPLLIVHGSDDVVCDPACVEELYARAGSKDKTLRIYPGMWHQLVGEPD  298

Query  473   ESVELVFNTTLSWI  432
             ESV++VF     W+
Sbjct  299   ESVDMVFGEMKEWL  312



>emb|CDY13986.1| BnaC09g38400D [Brassica napus]
Length=335

 Score =   293 bits (751),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 154/324 (48%), Positives = 206/324 (64%), Gaps = 6/324 (2%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HPI  A+E +P+G LS +EFY KH +     F+ N    KIFTQ W       P G+V +
Sbjct  4     HPIADADENNPFGSLSADEFYAKHSVTQSSAFITNPRGLKIFTQWWSPLPPARPIGIVAV  63

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
             +HG+T ESSW  +L ++  AK+G    AID  GHG+S+G   HIP I+PVV DCI   D 
Sbjct  64    VHGFTGESSWFLQLTSILFAKSGYITCAIDHQGHGFSDGLVAHIPDINPVVDDCISFFDD  123

Query  995   ARAHHPK----LPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLE  828
              R  + +    LP FLY ESLGGAIA+ I L Q+ VW+GLIL+G MCG+S K+KP WPLE
Sbjct  124   FRNRNRQETHNLPCFLYSESLGGAIALYISLRQRGVWDGLILNGAMCGISAKFKPPWPLE  183

Query  827   EFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKVC  651
               L + A   P WR+I T+    + S++E  K+KL   SP R    RP AATA EL++VC
Sbjct  184   HLLFVVANLIPTWRVIPTRGSIPDVSFKEPWKRKLAIASPRR-TVARPRAATAYELIRVC  242

Query  650   KYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNE  471
               +Q    E+EVPLLI+ GG D VCDQ  V+ + + A+S+DKT+KI+ GMWHQ++GE  E
Sbjct  243   NELQGRFEEVEVPLLIVHGGGDVVCDQACVEELHRRASSEDKTIKIYPGMWHQMVGESEE  302

Query  470   SVELVFNTTLSWIQMRANLARAHK  399
              V+LV+   L+W++ R+  A   K
Sbjct  303   DVDLVYGDILTWLKTRSETAAERK  326



>ref|XP_007218284.1| hypothetical protein PRUPE_ppa008391mg [Prunus persica]
 gb|EMJ19483.1| hypothetical protein PRUPE_ppa008391mg [Prunus persica]
Length=333

 Score =   293 bits (749),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 159/317 (50%), Positives = 205/317 (65%), Gaps = 5/317 (2%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             MAHPI +AN+ SP+G L+ + FY +H + H   ++ N    K+FTQ W         G +
Sbjct  1     MAHPIAEANDQSPFGSLTPDAFYSRHKVSHASEYITNPRGLKLFTQWWTPLPPTPVLGTL  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              ++HG+T E+SW  +L AV  AK+G  V AID  GHG+S+G   HIP I+PVV DCI   
Sbjct  61    AIVHGFTGETSWFVQLTAVHFAKSGFAVCAIDHQGHGFSDGLVAHIPDINPVVDDCISFF  120

Query  1001  DSARAHH--PKLPAFLYGESLGGAIAILICLNQ-KHVWNGLILSGPMCGVSKKYKPIWPL  831
             DS RA H  P LPAF+Y ESLGGAIA+LI L Q    WNGLIL+G MCG+S K KP WPL
Sbjct  121   DSFRARHAPPNLPAFIYAESLGGAIALLITLRQGSGAWNGLILNGAMCGISAKIKPPWPL  180

Query  830   EEFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKV  654
             E  L L A   P WR++ T+    + S++   K++L   SP R    RP AATALELL+V
Sbjct  181   EHLLFLVAAVIPTWRVVPTRGSLPDLSFKVEWKRRLALASPRR-TVARPRAATALELLRV  239

Query  653   CKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPN  474
             CK +Q    E+EVPLLI+ GGDD VCD   V+ +   A+SKDKTL+I  GMWHQL+GE  
Sbjct  240   CKELQARFEEVEVPLLIVHGGDDLVCDPACVEELHGRASSKDKTLRIHEGMWHQLVGETQ  299

Query  473   ESVELVFNTTLSWIQMR  423
             E V+LVF   ++W++ R
Sbjct  300   EDVDLVFGEMVAWLRTR  316



>emb|CDY44908.1| BnaA02g04130D [Brassica napus]
Length=335

 Score =   293 bits (749),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 153/322 (48%), Positives = 207/322 (64%), Gaps = 4/322 (1%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HPI  A+E +P+G LS +EFY KH + H   F+ N    K+FTQ W       P G+V +
Sbjct  4     HPIADADERNPFGSLSADEFYAKHSVSHSSAFITNPRGLKLFTQWWSPLPPTPPIGIVAV  63

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
             +HG+T ESSW  +L ++  AK+G    AID  GHG+S+G   HIP I+PVV DCI   D 
Sbjct  64    VHGFTGESSWFLQLTSILFAKSGFITCAIDHQGHGFSDGLVAHIPDINPVVDDCISFFDD  123

Query  995   ARAHH--PKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEF  822
              R+    P LP FLY ESLGGAIA+ + L Q+ VW+GLIL+G MCG+S+K+KP WPLE  
Sbjct  124   FRSRQETPDLPCFLYSESLGGAIALYVSLRQRGVWDGLILNGAMCGISRKFKPPWPLEHL  183

Query  821   LPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKY  645
             L + A   P WR+I T+    + S++E  K+KL   SP R    RP AATA EL+++C  
Sbjct  184   LFVVANLIPTWRVIPTRGSIPDVSFKEPWKRKLALASPRR-TVARPRAATAYELIRICNE  242

Query  644   IQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESV  465
             +Q    E+EVPLLI+ GG D VCD   V+ + + AAS+DKT+KI+  MWHQ++GE  E+V
Sbjct  243   LQEKFEEVEVPLLIVHGGGDVVCDPACVEELHRRAASEDKTIKIYPEMWHQMVGESEENV  302

Query  464   ELVFNTTLSWIQMRANLARAHK  399
             +LV+   L+W++ RA  A   K
Sbjct  303   DLVYGDILNWLKSRAESAAERK  324



>ref|XP_010492984.1| PREDICTED: caffeoylshikimate esterase-like [Camelina sativa]
Length=331

 Score =   292 bits (747),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 153/322 (48%), Positives = 204/322 (63%), Gaps = 4/322 (1%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HPI  ANE SP+G L+ EEFY KH + H   F+ N    K+FTQ W      +P G++ +
Sbjct  4     HPISDANEHSPFGSLTAEEFYAKHSVSHSSAFITNPRGLKLFTQWWSPLPPTKPIGIIAV  63

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
             +HG+T ESSW  +L ++  AK+G    AID  GHG+S+G   HIP I+PVV DCI   D 
Sbjct  64    VHGFTGESSWFLQLTSILFAKSGFITCAIDHQGHGFSDGLIAHIPDINPVVDDCISFFDD  123

Query  995   ARAHH--PKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEF  822
              R+      LP FLY ESLGGAIA+ I L Q+ VW+GLIL+G MCG+S K+KP WPLE  
Sbjct  124   FRSRQTPSDLPCFLYSESLGGAIALYISLRQRGVWDGLILNGAMCGISDKFKPPWPLEHL  183

Query  821   LPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKY  645
             L + A   P WR++ T+    E S++E  K+KL   SP R    +P AATA EL++VCK 
Sbjct  184   LFVVANLIPTWRVVPTRGSIPEVSFKEPWKRKLAMASPRR-TVAKPRAATAYELIRVCKD  242

Query  644   IQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESV  465
             +Q    E+EVP LI+ GG D VCD   V+ + + A S+DKT+KI+  +WHQ+IGE  E V
Sbjct  243   LQERFEEVEVPFLIVHGGGDVVCDVACVEELHRRAISEDKTIKIYPELWHQMIGESEEKV  302

Query  464   ELVFNTTLSWIQMRANLARAHK  399
             ++V+   LSW++ RA  A   K
Sbjct  303   DMVYGDMLSWLKTRAESAAERK  324



>ref|XP_010253670.1| PREDICTED: caffeoylshikimate esterase-like [Nelumbo nucifera]
Length=339

 Score =   292 bits (748),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 152/322 (47%), Positives = 212/322 (66%), Gaps = 4/322 (1%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M HP+  AN+ SP+G LS  EFY +H + H    + N    K+FTQSW      +  G+V
Sbjct  1     MVHPVADANDQSPFGSLSPSEFYARHSVSHSSDHITNSRGLKLFTQSWTPFPPTKVIGIV  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              ++HG+T ESSW  +L ++  AK+G    AID  GHG+SEG + HIP I+PVV DC    
Sbjct  61    AVVHGFTGESSWFVQLTSILFAKSGFATCAIDHQGHGFSEGLKNHIPDINPVVDDCQTYF  120

Query  1001  DSARAHH-PKLPAFLYGESLGGAIAILICLNQK-HVWNGLILSGPMCGVSKKYKPIWPLE  828
             +S RA + P LPAFLY ESLGGAIA+L+ L +    W+GL+L+G MCG+S K+KP WPLE
Sbjct  121   ESFRARYPPSLPAFLYAESLGGAIAVLLHLRRGPRPWHGLVLNGAMCGISSKFKPPWPLE  180

Query  827   EFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKVC  651
              FL L +   P W+++ T+    E S++E  K++L   SP R  + RP AATALELL+VC
Sbjct  181   HFLSLVSAVIPTWQVVPTRGSIVERSFKEDWKRRLALASPRR-SSARPRAATALELLRVC  239

Query  650   KYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNE  471
             + +Q    E++ PLLI+ G DD +CD   V+ +++ AASKDKT++++ GMWHQL+GE  +
Sbjct  240   REVQGRLSEVDAPLLIVHGADDVICDPACVEDLYQRAASKDKTIRVYPGMWHQLVGESED  299

Query  470   SVELVFNTTLSWIQMRANLARA  405
             +VELVF   + W++ RA  A A
Sbjct  300   NVELVFGEIVDWLRSRAESAGA  321



>ref|XP_008367428.1| PREDICTED: caffeoylshikimate esterase-like [Malus domestica]
Length=329

 Score =   291 bits (746),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 161/319 (50%), Positives = 209/319 (66%), Gaps = 5/319 (2%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             MAHPI +ANE SP G L+ E FY +H++ H   +  N    K+FTQ W      E  G +
Sbjct  1     MAHPIAEANEZSPXGXLTPEAFYSRHNVSHASEYTTNPRGLKLFTQWWTPLPPTEIVGTL  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              ++HG+T E+SW  +L AV  AK+G  V AID  GHG+S+G   HIP I+ VV DCI   
Sbjct  61    AIVHGFTGETSWFVQLTAVHFAKSGFAVCAIDHQGHGFSDGLIAHIPDINLVVDDCISFF  120

Query  1001  DSARAHH-PK-LPAFLYGESLGGAIAILICLNQ-KHVWNGLILSGPMCGVSKKYKPIWPL  831
             DS RA+H PK  P+FLY ESLGGAIA+L+ L Q    W+GLIL+G MCG+S K+KP WPL
Sbjct  121   DSFRANHAPKNRPSFLYSESLGGAIALLVTLRQGSGAWDGLILNGAMCGISPKFKPPWPL  180

Query  830   EEFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKV  654
             E  L L A   P WR++ T+    + S++E  K+KL   SP R    RP AATALELL+V
Sbjct  181   EHLLFLVAAVIPTWRVVPTRGSLPDVSFKEEWKRKLALASPRR-TVARPRAATALELLRV  239

Query  653   CKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPN  474
             CK +Q    E+EVPLLI+ GGDD VCD    + +++ A+SKDKTL+I  G+WHQL+GEP 
Sbjct  240   CKELQGKFEEVEVPLLIVHGGDDVVCDPXCAEELYRRASSKDKTLRIHEGLWHQLVGEPQ  299

Query  473   ESVELVFNTTLSWIQMRAN  417
             E V+LVF   + W++ RA 
Sbjct  300   EKVDLVFGEMVEWLRTRAQ  318



>gb|KFK26173.1| hypothetical protein AALP_AA8G212300 [Arabis alpina]
Length=332

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 152/322 (47%), Positives = 203/322 (63%), Gaps = 4/322 (1%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HPI  A+E +P+G LS +EFY KH + H   F+ N    K+FTQ W   S   P G++ +
Sbjct  4     HPISDADERNPFGSLSADEFYAKHSVSHSSAFITNPRGLKLFTQWWSPLSPTTPIGIIAV  63

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
             +HG+T ESSW  +L ++  AK+G    AID  GHG+S+G   HIP I+PVV DCI   D 
Sbjct  64    VHGFTGESSWFLQLTSILFAKSGFITCAIDHQGHGFSDGLITHIPDINPVVDDCISFFDD  123

Query  995   ARAHH--PKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEF  822
              R     P LP FLY ESLGGAIA+ I L Q+ VW+GLIL+G MCG+S K+KP WPLE  
Sbjct  124   FRNRQSPPDLPCFLYSESLGGAIALYISLRQRGVWDGLILNGAMCGISDKFKPQWPLEHL  183

Query  821   LPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKY  645
             L + A   P WR+I T+    + S++E  K+KL   SP R    RP AATA EL+++CK 
Sbjct  184   LFVVATLIPTWRVIPTRGSIPDVSFKEPWKRKLALASPRR-TVARPRAATAYELIRICKE  242

Query  644   IQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESV  465
             +Q    E+EVP LI+ GG D VCD   V+ + + A S+DKT+KI+  +WHQ+IGE  E+V
Sbjct  243   LQERFEEVEVPFLIVHGGGDVVCDSACVEDLHRRATSEDKTIKIYPELWHQMIGESEENV  302

Query  464   ELVFNTTLSWIQMRANLARAHK  399
             +LV+   L W++ RA      K
Sbjct  303   DLVYGDILKWLKSRAETVAEKK  324



>ref|XP_008347481.1| PREDICTED: caffeoylshikimate esterase-like [Malus domestica]
 ref|XP_008357257.1| PREDICTED: caffeoylshikimate esterase-like [Malus domestica]
Length=330

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 159/321 (50%), Positives = 212/321 (66%), Gaps = 5/321 (2%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             MAHPI +ANE SP+G L+ E FY +H++ H   +  N    K FTQ W      E  G +
Sbjct  1     MAHPIAEANEQSPFGALTPEAFYSRHNVSHASEYFTNPRGLKRFTQWWTPLPPTEIVGTL  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              ++HG+T E+SW  +L AV  AK+G  V AID  GHG+S+G   HIP I+PVV DCI   
Sbjct  61    AIVHGFTGETSWFVQLTAVHFAKSGFVVCAIDHQGHGFSDGLAAHIPDINPVVDDCISFF  120

Query  1001  DSARAHH-PK-LPAFLYGESLGGAIAILICLNQ-KHVWNGLILSGPMCGVSKKYKPIWPL  831
             DS RA+H PK  P+FLY ESLGGAIA+L+   Q    W+GLIL+G MCG+S K+KP WPL
Sbjct  121   DSFRANHAPKNRPSFLYAESLGGAIALLMTFRQGSGAWDGLILNGAMCGISPKFKPPWPL  180

Query  830   EEFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKV  654
             E  L L A   P WR++ T+    + S++E  K+KL   +P R P  RP A+TALELL+V
Sbjct  181   EHLLFLVAAVIPTWRVVPTRGSITDVSFKEEWKRKLALANPRR-PVARPRASTALELLRV  239

Query  653   CKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPN  474
             CK +Q    E+EVP+LI+ GGDD +CD   V+ +++ A+SKDKT++I  G+WHQLIGE  
Sbjct  240   CKELQGRFEEMEVPVLIVHGGDDVLCDPACVEELYRRASSKDKTIRIHEGLWHQLIGESQ  299

Query  473   ESVELVFNTTLSWIQMRANLA  411
             E+V+LVF   + W++ RA  A
Sbjct  300   ENVDLVFGEMVEWLRTRAERA  320



>ref|XP_010099613.1| hypothetical protein L484_013404 [Morus notabilis]
 gb|EXB80079.1| hypothetical protein L484_013404 [Morus notabilis]
Length=326

 Score =   291 bits (745),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 151/318 (47%), Positives = 207/318 (65%), Gaps = 3/318 (1%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HP+ +AN+ SP+G  + EEF  +H + H   ++ N    K+FTQ W      E  G+V +
Sbjct  8     HPVAEANDQSPFGSSTPEEFCARHSVAHSSAYITNPRGLKLFTQWWTPLPPKEILGIVAV  67

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
             +HG+T ESSWL +L ++  A+ G  V AID  GHG+S+G   HIP I+PV+ DC+   D 
Sbjct  68    VHGFTGESSWLVQLTSIFFAEAGFAVCAIDHQGHGFSDGLIAHIPDINPVIDDCVSFFDE  127

Query  995   ARAH-HPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFL  819
              R+     LPAFLY ESLGGAIA+LI L +  +WNG++L+G MCG+S K+KP WPLE  L
Sbjct  128   FRSRFSSSLPAFLYAESLGGAIALLITLRRGQIWNGVVLNGAMCGISAKFKPPWPLEHLL  187

Query  818   PLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYI  642
              L A   P WR++ T+    E S++E  K++L   SP R    RP AATALELL+VC+ +
Sbjct  188   FLVAAVIPTWRVVPTRGSLPEVSFKEEWKRRLAIASPRR-KVARPRAATALELLRVCREL  246

Query  641   QNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESVE  462
             Q    E+EVP+LI+ GGDD VCD   V+ + + A+SKDKT++I  GMWHQL+GEP ESV+
Sbjct  247   QERFEEVEVPMLIVHGGDDIVCDPACVEELHRRASSKDKTIRIHDGMWHQLVGEPKESVD  306

Query  461   LVFNTTLSWIQMRANLAR  408
             +VF     W++ R   AR
Sbjct  307   MVFGDMEEWLRSRVQRAR  324



>ref|XP_011084365.1| PREDICTED: caffeoylshikimate esterase [Sesamum indicum]
Length=333

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 156/325 (48%), Positives = 220/325 (68%), Gaps = 10/325 (3%)
 Frame = -1

Query  1364  KMAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQK-KIFTQSWQHDSCDEP-R  1191
             K  HP+ +ANETSP+G++  EEFY +H +IH   ++ ++    ++FTQ W       P +
Sbjct  3     KYKHPVAEANETSPFGEVGAEEFYARHSVIHASDYITSKKLNLRLFTQWWAPQEPAGPLK  62

Query  1190  GVVCMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCI  1011
             G+VC++HG+T ESSW  +L AV +AK G  V AID  GHG+SEG   H+P ++ VV +CI
Sbjct  63    GIVCVVHGFTGESSWFVQLTAVHLAKHGFAVCAIDHMGHGFSEGLVAHLPDMNLVVDECI  122

Query  1010  LCLDSARAHHP-KLPAFLYGESLGGAIAILICLNQKHV-----WNGLILSGPMCGVSKKY  849
             L  +  RA +P  LPAFLY ESLGGAIA+LI L ++ +     ++G++L+G MCG+S K+
Sbjct  123   LFFNGFRAKYPPDLPAFLYAESLGGAIALLITLRREGLVPERRFDGVVLNGAMCGISDKF  182

Query  848   KPIWPLEEFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATA  672
             KP WPLE FL +AAF  P W ++ T+    + S++   K+KL   SP R P ++P AATA
Sbjct  183   KPPWPLEHFLAIAAFLIPTWCVVPTRGSLPDVSFKVEWKRKLAIASPRR-PLQKPRAATA  241

Query  671   LELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQ  492
              ELL+VC+ +Q    E++VP LI+ GGDD VCD   V+ ++  AASKDKTL+I+ GMWHQ
Sbjct  242   QELLRVCREVQGKFDEVDVPFLIVHGGDDIVCDPACVEELYNRAASKDKTLRIYPGMWHQ  301

Query  491   LIGEPNESVELVFNTTLSWIQMRAN  417
             L+GEP+E+VELVF   + W+  RA 
Sbjct  302   LVGEPDENVELVFGDVVDWLVTRAE  326



>ref|XP_009126022.1| PREDICTED: caffeoylshikimate esterase [Brassica rapa]
Length=328

 Score =   291 bits (745),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 151/317 (48%), Positives = 205/317 (65%), Gaps = 6/317 (2%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HP+ +AN +SP+G LS  EFY  H + H   ++ N    K+FTQ W       P G++ +
Sbjct  4     HPVSKANASSPFGSLSAAEFYSLHSVAHSSAYITNPTGLKLFTQ-WWTPLHRPPLGLIAV  62

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
             +HG+T ESSW  +L +V  AK+G    AID  GHG+S+G   HIP I+ +V DCI   D 
Sbjct  63    VHGFTGESSWFLQLTSVLFAKSGFLTCAIDHQGHGFSDGLTAHIPNINLIVGDCISFFDD  122

Query  995   ARAHHPK---LPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEE  825
              R+ H     LP+FLY ESLGGAIA+ I L QK  WNGLILSG MC +S K+KP WPL+ 
Sbjct  123   FRSRHASSSSLPSFLYSESLGGAIALYITLRQKSKWNGLILSGAMCSISHKFKPPWPLQH  182

Query  824   FLPLAAFFAPNWRIIFTKPP-SRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCK  648
              L LAA   P WR++ T+   +  S++E  K+KL   +PNR    +P AATA EL++VC+
Sbjct  183   LLTLAATLIPTWRVVPTRGTIAGVSFKEPWKRKLAFANPNRTVG-KPRAATAYELVRVCE  241

Query  647   YIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNES  468
              +Q+   E+EVPL+I+ GGDD VCD ++V+ ++    S+DKT+KI+ GMWHQLIGE  E+
Sbjct  242   DLQSRFEEVEVPLMIVHGGDDVVCDPSSVEELYMRCKSRDKTIKIYPGMWHQLIGESEEN  301

Query  467   VELVFNTTLSWIQMRAN  417
             V+LVF   L WI  R+ 
Sbjct  302   VDLVFGDVLKWITNRSQ  318



>ref|XP_009611906.1| PREDICTED: caffeoylshikimate esterase [Nicotiana tomentosiformis]
Length=338

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 156/319 (49%), Positives = 207/319 (65%), Gaps = 9/319 (3%)
 Frame = -1

Query  1364  KMAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGV  1185
             +M HP+ +ANE SP+G LS +EFY +H + H   F+ N    K+FTQ W       P GV
Sbjct  3     RMKHPVAEANEVSPFGSLSPDEFYSRHSVSHGSDFITNSRGLKLFTQWWTPLPPTNPIGV  62

Query  1184  VCMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILC  1005
             VC++HG+T ESSW  +L AV  AK G  V AID  GHG+S+G   HIP I+PVV DCI  
Sbjct  63    VCVVHGFTGESSWFVQLTAVHFAKHGFSVCAIDHQGHGFSDGLVAHIPDINPVVDDCIAF  122

Query  1004  LDSARAHH--PKLPAFLYGESLGGAIAILICLNQKHV-----WNGLILSGPMCGVSKKYK  846
              DS R  H  P LP+FLY ESLGGAIA+LI L Q +      ++G++L+G MCG+S K+K
Sbjct  123   FDSFRQRHAPPYLPSFLYAESLGGAIALLITLRQGNSALNKPFDGVVLNGAMCGISAKFK  182

Query  845   PIWPLEEFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATAL  669
             P WPLE  L +AAF    WR++ T+    E S++   K+KL   SP R P  RP AATA 
Sbjct  183   PPWPLEHLLDIAAFLISTWRVVPTRGSIPEVSFKMEWKRKLAVASPRR-PLGRPRAATAR  241

Query  668   ELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQL  489
             EL++VC  +Q    E++VP LI+ GG D VCD   V+ +++ A+S+DKTL ++ GMWHQL
Sbjct  242   ELVRVCGDLQRRFEEVKVPFLIIHGGGDVVCDPACVEDLYRRASSEDKTLNVYPGMWHQL  301

Query  488   IGEPNESVELVFNTTLSWI  432
             +GE  E+VE VF+  L W+
Sbjct  302   VGEAEENVEQVFSDVLEWL  320



>ref|XP_009345381.1| PREDICTED: caffeoylshikimate esterase [Pyrus x bretschneideri]
Length=330

 Score =   291 bits (744),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 158/321 (49%), Positives = 214/321 (67%), Gaps = 5/321 (2%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             MAHPI +ANE SP+G L+ E FY +H++ H   +  N    K FTQ W   +  +  G +
Sbjct  1     MAHPIAEANEHSPFGALTPEAFYSRHNVSHASEYFTNPRGLKRFTQWWTPLAPTQIVGTL  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              ++HG+T E+SW  +L AV  A++G  V AID  GHG+S+G   HIP ++PVV DCI   
Sbjct  61    AIVHGFTGETSWFVQLTAVHFAESGFVVCAIDHQGHGFSDGLAAHIPDVNPVVDDCISFF  120

Query  1001  DSARAHH-PK-LPAFLYGESLGGAIAILICLNQ-KHVWNGLILSGPMCGVSKKYKPIWPL  831
             DS RA+H PK LP+FLY ESLGGAIA+L+ L Q    W+GLIL+G MCG+S K+KP WPL
Sbjct  121   DSFRANHAPKNLPSFLYAESLGGAIALLMTLRQGSGAWDGLILNGAMCGISPKFKPPWPL  180

Query  830   EEFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKV  654
             E  L L A   P WR++ T+    + S++E  K+KL   +P R P  RP A+TALELL+V
Sbjct  181   EHLLFLVAAVIPTWRVVPTRGSITDVSFKEEWKRKLALANPRR-PVARPRASTALELLRV  239

Query  653   CKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPN  474
             CK +Q    E+EVP+LI+ GGDD +CD   V+ +++ A+SKDKT+ I  G+WHQLIGE  
Sbjct  240   CKELQGRFEEVEVPVLIVHGGDDVLCDPACVEELYRRASSKDKTISIHEGLWHQLIGESQ  299

Query  473   ESVELVFNTTLSWIQMRANLA  411
             E+V+LVF   + W++ RA  A
Sbjct  300   ENVDLVFGEMVEWLRTRAERA  320



>emb|CDP04353.1| unnamed protein product [Coffea canephora]
Length=330

 Score =   291 bits (744),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 160/327 (49%), Positives = 212/327 (65%), Gaps = 8/327 (2%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSW--QHDSCDEPRGVV  1182
             HP+ +ANE SP+G L+ EEFY +H + H   F+ N    K+FTQ W    DS     GVV
Sbjct  4     HPVAEANEKSPFGSLTPEEFYARHKVTHGTEFITNPRGLKLFTQWWIPLPDSGKPLIGVV  63

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
             C++HG+T ESSW  +L +V +AK G  V AID  GHG+SEG + HIP I+PVV DC+   
Sbjct  64    CVVHGFTGESSWFVQLTSVHLAKQGFAVCAIDHQGHGFSEGLQAHIPDINPVVDDCVAFF  123

Query  1001  DSARAHH--PKLPAFLYGESLGGAIAILICLNQ--KHVWNGLILSGPMCGVSKKYKPIWP  834
             D  R  H  P LPAFLY ESLGGAIA+LI L +  K  ++G++L+G MCGVS K+KP WP
Sbjct  124   DDFRERHVPPNLPAFLYSESLGGAIALLITLRKDLKRPYDGVVLNGAMCGVSDKFKPPWP  183

Query  833   LEEFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLK  657
             LE FL + A   P W++I T+    E S++   K+KL   SP R P  RP AATA ELL+
Sbjct  184   LEHFLSIVAAVVPTWQVIPTRGRIPEVSFKVEWKRKLAMASPRR-PLARPRAATAQELLR  242

Query  656   VCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEP  477
             +   +Q+   E+ VPLLI+ GGDD +CD    + ++K AASKDKT+ I+ GMWHQL+GE 
Sbjct  243   LSGELQDRFGEVTVPLLIVHGGDDVICDPACAEDLYKRAASKDKTIHIYPGMWHQLVGES  302

Query  476   NESVELVFNTTLSWIQMRANLARAHKF  396
             +E VE VF   + W++ RA  A +  +
Sbjct  303   DEDVERVFGDIVEWLRTRAERAASSSY  329



>ref|XP_010420728.1| PREDICTED: caffeoylshikimate esterase-like [Camelina sativa]
Length=331

 Score =   291 bits (744),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 152/322 (47%), Positives = 204/322 (63%), Gaps = 4/322 (1%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HPI  ANE SP+G L+ +EFY KH + H   F+ N    K+FTQ W      +P G++ +
Sbjct  4     HPISDANEHSPFGSLTADEFYAKHSVSHSSAFITNPRGLKLFTQWWTPLPPTKPIGIIAV  63

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
             +HG+T ESSW  +L ++  AK+G    AID  GHG+S+G   HIP ++PVV DCI   D 
Sbjct  64    VHGFTGESSWFLQLTSILFAKSGFITCAIDHQGHGFSDGLIAHIPDLNPVVDDCISFFDD  123

Query  995   ARAHH--PKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEF  822
              R+      LP FLY ESLGGAIA+ I L Q+ VW+GLIL+G MCG+S K+KP WPLE  
Sbjct  124   FRSRQTPSDLPCFLYSESLGGAIALYISLRQRGVWDGLILNGAMCGISDKFKPPWPLEHL  183

Query  821   LPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKY  645
             L + A   P WR++ T+    E S++E  K+KL   SP R    +P AATA EL++VCK 
Sbjct  184   LFVVANLIPTWRVVPTRGSIPEVSFKEPWKRKLAMASPRR-TVAKPRAATAYELIRVCKD  242

Query  644   IQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESV  465
             +Q    E+EVP LI+ GG D VCD   V+ + + A S+DKT+KI+  +WHQ+IGE  E V
Sbjct  243   LQERFEEVEVPFLIVHGGGDVVCDVACVEELHRRAISEDKTIKIYPELWHQMIGESEEKV  302

Query  464   ELVFNTTLSWIQMRANLARAHK  399
             +LV+   LSW++ RA  A   K
Sbjct  303   DLVYGDMLSWLKTRAESAAERK  324



>ref|XP_009126352.1| PREDICTED: caffeoylshikimate esterase-like [Brassica rapa]
Length=335

 Score =   290 bits (743),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 152/322 (47%), Positives = 207/322 (64%), Gaps = 4/322 (1%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HPI  A+E +P+G LS +EFY KH + H   F+ N    K+FTQ W       P G+V +
Sbjct  4     HPIADADERNPFGSLSADEFYAKHSVSHSSAFITNPRGLKLFTQWWSPLPPTPPIGIVAV  63

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
             ++G+T ESSW  +L ++  AK+G    AID  GHG+S+G   HIP I+PVV DCI   D 
Sbjct  64    VYGFTGESSWFLQLTSILFAKSGFITCAIDHQGHGFSDGLVAHIPDINPVVDDCISFFDD  123

Query  995   ARAHH--PKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEF  822
              R+    P LP FLY ESLGGAIA+ + L Q+ VW+GLIL+G MCG+S+K+KP WPLE  
Sbjct  124   FRSRQETPDLPCFLYSESLGGAIALYVSLRQRGVWDGLILNGAMCGISRKFKPPWPLEHL  183

Query  821   LPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKY  645
             L + A   P WR+I T+    + S++E  K+KL   SP R    RP AATA EL+++C  
Sbjct  184   LFVVANLIPTWRVIPTRGSIPDVSFKEPWKRKLALASPRR-TVARPRAATAYELIRICNE  242

Query  644   IQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESV  465
             +Q    E+EVPLLI+ GG D VCD   V+ + + AAS+DKT+KI+  MWHQ++GE  E+V
Sbjct  243   LQERFEEVEVPLLIVHGGGDVVCDPACVEELHRRAASEDKTIKIYPEMWHQMVGESEENV  302

Query  464   ELVFNTTLSWIQMRANLARAHK  399
             +LV+   L+W++ RA  A   K
Sbjct  303   DLVYGDILNWLKSRAESAAERK  324



>emb|CDX85571.1| BnaA02g02420D [Brassica napus]
Length=328

 Score =   290 bits (743),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 150/317 (47%), Positives = 205/317 (65%), Gaps = 6/317 (2%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HP+ +AN +SP+G LS  EFY  H + H   ++ N    K+FTQ W       P G++ +
Sbjct  4     HPVSEANASSPFGSLSAAEFYSLHSVAHSSAYITNPTGLKLFTQ-WWTPLHRPPLGLIAV  62

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
             +HG+T ESSW  +L +V  AK+G    AID  GHG+S+G   HIP I+ +V DCI   D 
Sbjct  63    VHGFTGESSWFLQLTSVLFAKSGFLTCAIDHQGHGFSDGLTAHIPNINLIVDDCISFFDD  122

Query  995   ARAHHPK---LPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEE  825
              R+ H     LP+FLY ESLGGAIA+ I L QK  WNGLILSG MC +S K+KP WPL+ 
Sbjct  123   FRSRHASSSSLPSFLYSESLGGAIALYITLRQKSKWNGLILSGAMCSISHKFKPPWPLQH  182

Query  824   FLPLAAFFAPNWRIIFTKPP-SRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCK  648
              L LAA   P WR++ T+   +  S++E  K+KL   +PNR    +P AATA EL++VC+
Sbjct  183   LLTLAATLIPTWRVVPTRGTIAGVSFKEPWKRKLAFANPNRTVG-KPRAATAYELVRVCE  241

Query  647   YIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNES  468
              +Q+   E+EVPL+I+ GGDD VCD ++V+ ++    S+DKT+KI+ GMWHQLIGE  E+
Sbjct  242   DLQSRFEEVEVPLMIVHGGDDVVCDPSSVEELYMRCKSRDKTIKIYPGMWHQLIGESEEN  301

Query  467   VELVFNTTLSWIQMRAN  417
             V+ VF   L WI+ R+ 
Sbjct  302   VDFVFGDVLEWIKNRSQ  318



>ref|XP_009349702.1| PREDICTED: caffeoylshikimate esterase-like [Pyrus x bretschneideri]
Length=329

 Score =   290 bits (742),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 160/319 (50%), Positives = 207/319 (65%), Gaps = 5/319 (2%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             MAHPI +ANE SP+G L+ E FY +H++ H   +  N    K+FTQ W      E  G +
Sbjct  1     MAHPIAEANEQSPFGALTPEAFYSRHNVSHASEYTTNPRGLKLFTQWWTPLPPTEIVGTL  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              ++HGYT E+SW  +L AV  AK+G  V AID  GHG+S+G   HIP I+ VV DCI   
Sbjct  61    AIVHGYTGETSWFVQLTAVHFAKSGFAVCAIDHQGHGFSDGLVAHIPDINLVVDDCISFF  120

Query  1001  DSARAHH-PK-LPAFLYGESLGGAIAILICLNQ-KHVWNGLILSGPMCGVSKKYKPIWPL  831
             DS R  H PK  P+F+Y ESLGGAIA+LI L Q    W+GLIL+G MCG+S K+KP WPL
Sbjct  121   DSFRTKHAPKNRPSFIYSESLGGAIALLITLRQGSGAWDGLILNGAMCGISPKFKPPWPL  180

Query  830   EEFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKV  654
             E  L L A   P WR++ T+    + S++E  K+KL   SP R    RP AATALELL+V
Sbjct  181   EHLLFLVAAVIPTWRVVPTRGSLPDVSFKEEWKRKLALASPRR-SVARPRAATALELLRV  239

Query  653   CKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPN  474
             CK +Q    E+EVPLLI+ GGDD VCD    + +++ A+SKDKTL+I  G+WHQL+GE  
Sbjct  240   CKELQGKFEEVEVPLLIVHGGDDVVCDPACSEELYRRASSKDKTLRIHEGLWHQLVGESQ  299

Query  473   ESVELVFNTTLSWIQMRAN  417
             E V+LVF   + W++ RA 
Sbjct  300   EDVDLVFGEMVEWLRTRAE  318



>gb|KFK26175.1| hypothetical protein AALP_AA8G212500 [Arabis alpina]
Length=327

 Score =   290 bits (741),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 151/322 (47%), Positives = 203/322 (63%), Gaps = 4/322 (1%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HPI  A+E +P+G LS +EFY KH + H   F+ N    K+FTQ W       P G++ +
Sbjct  4     HPICDADERNPFGSLSADEFYAKHSVSHSSAFITNPRGLKLFTQWWSPLPPTTPIGIIAV  63

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
             +HG+T ESSW  +L ++  AK+G    AID  GHG+S+G   HIP I+PVV DCI   D 
Sbjct  64    VHGFTGESSWFLQLTSILFAKSGFITCAIDHQGHGFSDGLIAHIPDINPVVDDCISFFDD  123

Query  995   ARAHH--PKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEF  822
              R     P LP FLY ESLGGAIA+ I L Q+ VW+GLIL+G MCG+S K+KP WPLE  
Sbjct  124   FRNRQSPPDLPCFLYSESLGGAIALYISLRQRGVWDGLILNGAMCGISDKFKPPWPLEHL  183

Query  821   LPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKY  645
             L + A   P WR+I T+    + S++E  K+KL   SP R    RP AATA EL++VCK 
Sbjct  184   LFVVANLIPTWRVIPTRGSIPDVSFKEPWKRKLALASPRR-TVARPRAATAYELIRVCKE  242

Query  644   IQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESV  465
             +Q    E++VP LI+ GG D VCD   V+ + + A S+DKT+KI+  +WHQ++GE  E+V
Sbjct  243   LQERFEEVDVPFLIVHGGGDVVCDSACVEELHRRATSQDKTIKIYPELWHQMVGESEENV  302

Query  464   ELVFNTTLSWIQMRANLARAHK  399
             +LV+   L W++ RA  A   K
Sbjct  303   DLVYGDMLKWLKSRAETAAERK  324



>emb|CDY69863.1| BnaCnng65700D [Brassica napus]
Length=335

 Score =   290 bits (742),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 150/322 (47%), Positives = 206/322 (64%), Gaps = 4/322 (1%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HPI  A+E +P+G LS +EFY KH + H   F+ N    K+FTQ W       P G+V +
Sbjct  4     HPIADADERNPFGSLSADEFYAKHSVSHSSAFITNPRGLKLFTQWWSPLPPTPPVGIVAV  63

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
             +HG+T ESSW  +L ++  AK+G    AID  GHG+S+G   HIP I+PVV DCI   D 
Sbjct  64    VHGFTGESSWFLQLTSILFAKSGFITCAIDHQGHGFSDGLVAHIPDINPVVDDCISFFDD  123

Query  995   ARAHH--PKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEF  822
              R+    P LP FLY ESLGGAIA+ + L Q+  W+GL+L+G MCG+S+K+KP WPLE  
Sbjct  124   FRSRQETPDLPCFLYSESLGGAIALYVSLRQRGAWDGLVLNGAMCGISRKFKPPWPLEHL  183

Query  821   LPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKY  645
             L + A   P WR+I T+    + S++E  K+KL   SP R    RP AATA EL+++C  
Sbjct  184   LFVVANLIPTWRVIPTRGSIPDVSFKEPWKRKLALASPRR-TVARPRAATAYELIRICNE  242

Query  644   IQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESV  465
             +Q    E++VPLLI+ GG D VCD   V+ + + AAS+DKT+KI+  MWHQ++GE  E+V
Sbjct  243   LQEKFEEVDVPLLIVHGGGDVVCDPACVEELHRRAASEDKTIKIYPEMWHQMVGESEENV  302

Query  464   ELVFNTTLSWIQMRANLARAHK  399
             +LV+   L+W++ RA  A   K
Sbjct  303   DLVYGDILNWLKSRAESAAERK  324



>ref|XP_002311094.2| esterase/lipase/thioesterase family protein [Populus trichocarpa]
 gb|EEE88461.2| esterase/lipase/thioesterase family protein [Populus trichocarpa]
Length=338

 Score =   290 bits (742),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 155/317 (49%), Positives = 204/317 (64%), Gaps = 6/317 (2%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HP+ +AN+ SP+G LS  EFY KH + H   ++ N    K+FTQ W      +  G V +
Sbjct  4     HPVAEANDQSPFGTLSPSEFYAKHQVTHNSEYITNSRGLKLFTQWWTPLPPTKTIGCVAV  63

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRG---HIPRIDPVVHDCILC  1005
             +HG+T ESSW  +L ++  AK G  V AID  GHG+S+G      HIP I+PVV DC+  
Sbjct  64    VHGFTGESSWFVQLTSILFAKHGFVVCAIDHQGHGFSDGLDNLIYHIPDINPVVEDCMRY  123

Query  1004  LDSAR-AHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLE  828
               + R    P LPAFLY ESLGGAIA+ I L Q+  W+GLIL+G MCG+S K+KP WPLE
Sbjct  124   FKTFRETRAPNLPAFLYSESLGGAIALYITLRQRGAWDGLILNGAMCGISAKFKPPWPLE  183

Query  827   EFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKVC  651
               L + A   P W +I T+    E S++E  K+KL   SP R    RP AATA EL++VC
Sbjct  184   HLLFVVAAAVPTWSVIPTRGSIPELSFKEEWKRKLGCASPGRV-TMRPRAATAYELMRVC  242

Query  650   KYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNE  471
             K +Q    E++VPLL++ GGDD VCD  + K +++ AAS DKTLK+++GMWHQLIGEP E
Sbjct  243   KELQGRFEEVDVPLLVVHGGDDVVCDPASAKELYERAASADKTLKMYSGMWHQLIGEPEE  302

Query  470   SVELVFNTTLSWIQMRA  420
             +V LVF   + W+Q RA
Sbjct  303   NVNLVFGDMVEWLQNRA  319



>ref|XP_010454199.1| PREDICTED: caffeoylshikimate esterase-like isoform X1 [Camelina 
sativa]
 ref|XP_010454200.1| PREDICTED: caffeoylshikimate esterase-like isoform X2 [Camelina 
sativa]
Length=331

 Score =   289 bits (740),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 152/322 (47%), Positives = 204/322 (63%), Gaps = 4/322 (1%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HPI  ANE SP+G L+ +EFY KH + H   F+ N    K+FTQ W      +P G++ +
Sbjct  4     HPISDANEHSPFGSLTADEFYAKHSVSHSSAFINNPRGLKLFTQWWSPLPPTKPIGIIAV  63

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
             +HG+T ESSW  +L ++  AK+G    AID  GHG+S+G   HIP ++PVV DCI   D 
Sbjct  64    VHGFTGESSWFLQLTSILFAKSGFITCAIDHQGHGFSDGLIAHIPDLNPVVDDCISFFDD  123

Query  995   ARAHH--PKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEF  822
              R+      LP FLY ESLGGAIA+ I L Q+ VW+GLIL+G MCG+S K+KP WPLE  
Sbjct  124   FRSRQTPSDLPCFLYSESLGGAIALYISLRQRGVWDGLILNGAMCGISDKFKPPWPLEHL  183

Query  821   LPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKY  645
             L + A   P WR++ T+    E S++E  K+KL   SP R    +P AATA EL++VCK 
Sbjct  184   LFVVANLIPTWRVVPTRGSIPEVSFKEPWKRKLAMASPRR-TVAKPRAATAYELIRVCKD  242

Query  644   IQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESV  465
             +Q    E+EVP LI+ GG D VCD   V+ + + A S+DKT+KI+  +WHQ+IGE  E V
Sbjct  243   LQERFEEVEVPFLIVHGGGDVVCDVACVEELHRRAISEDKTIKIYPELWHQMIGESEEKV  302

Query  464   ELVFNTTLSWIQMRANLARAHK  399
             +LV+   LSW++ RA  A   K
Sbjct  303   DLVYGDMLSWLKTRAESAAERK  324



>ref|XP_009344755.1| PREDICTED: caffeoylshikimate esterase-like [Pyrus x bretschneideri]
Length=329

 Score =   289 bits (740),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 160/319 (50%), Positives = 207/319 (65%), Gaps = 5/319 (2%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             MAHPI +ANE SP+G L+ E FY +H++ H   +  N    K+FTQ W      E  G +
Sbjct  1     MAHPIAEANEQSPFGALTPEAFYSRHNVSHASEYTTNPRGLKLFTQWWTPLPPTEIVGTL  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              ++HGYT E+SW  +L AV  AK+G  V AID  GHG+S+G   HIP I+ VV DCI   
Sbjct  61    AIVHGYTGETSWSVQLTAVHFAKSGFAVCAIDHQGHGFSDGLVAHIPDINLVVDDCISFF  120

Query  1001  DSARAHH-PK-LPAFLYGESLGGAIAILICLNQ-KHVWNGLILSGPMCGVSKKYKPIWPL  831
             DS R  H PK  P+F+Y ESLGGAIA+LI L Q    W+GLIL+G MCG+S K+KP WPL
Sbjct  121   DSFRTKHAPKNRPSFIYSESLGGAIALLITLRQGSGAWDGLILNGAMCGISPKFKPPWPL  180

Query  830   EEFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKV  654
             E  L L A   P WR++ T+    + S++E  K+KL   SP R    RP AATALELL+V
Sbjct  181   EHLLFLVAAVIPTWRVVPTRGSLPDVSFKEEWKRKLALASPRR-SVARPRAATALELLRV  239

Query  653   CKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPN  474
             CK +Q    E+EVPLLI+ GGDD VCD    + +++ A+SKDKTL+I  G+WHQL+GE  
Sbjct  240   CKELQGKFEEVEVPLLIVHGGDDVVCDPACSEELYRRASSKDKTLRIHEGLWHQLVGESQ  299

Query  473   ESVELVFNTTLSWIQMRAN  417
             E V+LVF   + W++ RA 
Sbjct  300   EDVDLVFGEMVEWLRTRAE  318



>ref|XP_011031746.1| PREDICTED: caffeoylshikimate esterase-like [Populus euphratica]
Length=338

 Score =   289 bits (739),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 153/319 (48%), Positives = 205/319 (64%), Gaps = 6/319 (2%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             + HP+ +AN+ SP+G LS  EFY KH + H   ++ N    K+FTQ W      +  G V
Sbjct  2     VQHPVAEANDQSPFGTLSPSEFYAKHQVTHNSEYITNTRGLKLFTQWWTPLPPTKTIGCV  61

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRG---HIPRIDPVVHDCI  1011
              ++HG+T ESSW  +L ++  A+ G  V AID  GHG+S+G      HIP I+PVV DC+
Sbjct  62    AVVHGFTGESSWFVQLTSILFAEHGFVVCAIDHQGHGFSDGLDNLIYHIPDINPVVEDCM  121

Query  1010  LCLDSAR-AHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWP  834
                 + R  H P LP FLY ESLGGAIA+ + L Q+ VW+GLIL+G MCG+S K+KP WP
Sbjct  122   RYFKTFRETHAPNLPGFLYSESLGGAIALYVTLRQRGVWDGLILNGAMCGISAKFKPPWP  181

Query  833   LEEFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLK  657
             LE  L + A   P W +I T+    E S++E  K+KL   SP R    RP AATA E ++
Sbjct  182   LEHLLFVVAAVVPTWSVIPTRGSIPELSFKEEWKRKLGYASPRRV-TMRPRAATAYEFMR  240

Query  656   VCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEP  477
             VCK +Q    E++VPLL++ GGDD VCD  + K +++ AAS DKTLK+++GMWHQLIGEP
Sbjct  241   VCKELQGRFEEVDVPLLVVHGGDDVVCDPASAKELYERAASADKTLKMYSGMWHQLIGEP  300

Query  476   NESVELVFNTTLSWIQMRA  420
              E+V LVF   + W+Q RA
Sbjct  301   EENVNLVFGDMVEWLQNRA  319



>ref|XP_002316366.1| esterase/lipase/thioesterase family protein [Populus trichocarpa]
 gb|EEF02537.1| esterase/lipase/thioesterase family protein [Populus trichocarpa]
Length=331

 Score =   288 bits (738),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 155/320 (48%), Positives = 203/320 (63%), Gaps = 6/320 (2%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             + HP+ +ANE SP+G LS  EFY KH + H   ++ N    K+FTQ W      +  G V
Sbjct  3     VQHPVAEANEQSPFGTLSPTEFYAKHQVTHSSEYITNSRGFKLFTQWWTPLPPSKTIGCV  62

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRG---HIPRIDPVVHDCI  1011
              ++HG+T ESSW  +L ++  A+ G  V AID  GHG+S+G      HIP I+PVV DC 
Sbjct  63    AVVHGFTGESSWFIQLTSILFAQKGFSVCAIDHQGHGFSDGLDNLMYHIPDINPVVEDCT  122

Query  1010  LCLDSARAHH-PKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWP  834
                 + R +H P LPAFLY ESLGGAIA+ I L QK  W+GLIL+G MCG+S K+KP WP
Sbjct  123   QYFKTFRENHAPDLPAFLYSESLGGAIALYITLRQKGAWDGLILNGAMCGISAKFKPPWP  182

Query  833   LEEFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLK  657
             LE  L + A   P WR++ T+    E S++E  K KL   SP R    RP AATA EL++
Sbjct  183   LEHLLFVVAAVVPTWRVVPTRGSLPEVSFKEEWKAKLAFASPKRVAM-RPRAATAFELIR  241

Query  656   VCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEP  477
             VCK +Q    E++VPLL++ GGDD VCD    K +F+ AAS D+TLKI+ GMWHQL+GE 
Sbjct  242   VCKELQGRFGEVDVPLLVVHGGDDMVCDPACAKELFERAASTDRTLKIYPGMWHQLVGES  301

Query  476   NESVELVFNTTLSWIQMRAN  417
              E+V LVF   + W++ RA 
Sbjct  302   EENVNLVFGDIVEWLENRAK  321



>ref|NP_197430.1| esterase/lipase/thioesterase family protein [Arabidopsis thaliana]
 gb|AAL36164.1| putative phospholipase [Arabidopsis thaliana]
 gb|AAM63479.1| phospholipase-like protein [Arabidopsis thaliana]
 gb|AAN31882.1| putative phospholipase [Arabidopsis thaliana]
 gb|AAN86200.1| putative phospholipase [Arabidopsis thaliana]
 gb|AED92681.1| esterase/lipase/thioesterase family protein [Arabidopsis thaliana]
Length=330

 Score =   288 bits (738),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 151/316 (48%), Positives = 203/316 (64%), Gaps = 4/316 (1%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HPI  ANE +P+G L+ +EFY KH + H   F+ N    K+FTQ W      +P G++ +
Sbjct  4     HPISDANEHNPFGSLTADEFYAKHSVSHSSAFITNPRGLKLFTQWWSPLPPTKPIGIIAV  63

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
             +HG+T ESSW  +L ++  AK+G    AID  GHG+S+G   HIP I+PVV DCI   D 
Sbjct  64    VHGFTGESSWFLQLTSILFAKSGFITCAIDHQGHGFSDGLIAHIPDINPVVDDCISFFDD  123

Query  995   ARAHH--PKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEF  822
              R+      LP FLY ESLGGAIA+ I L Q+ VW+GLIL+G MCG+S K+KP WPLE  
Sbjct  124   FRSRQTPSDLPCFLYSESLGGAIALYISLRQRGVWDGLILNGAMCGISDKFKPPWPLEHL  183

Query  821   LPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKY  645
             L + A   P WR+I T+    + S++E  K+KL   SP R    +P AATA EL++VCK 
Sbjct  184   LFVVANLIPTWRVIPTRGSIPDVSFKEPWKRKLAMASPRR-TVAKPRAATAYELIRVCKD  242

Query  644   IQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESV  465
             +Q    E+EVPLLI+ GG D VCD   V+ + + A S+DKT+KI+  +WHQ+IGE  E V
Sbjct  243   LQGRFEEVEVPLLIVHGGGDVVCDVACVEELHRRAISEDKTIKIYPELWHQMIGESEEKV  302

Query  464   ELVFNTTLSWIQMRAN  417
             +LV+   LSW++ RA 
Sbjct  303   DLVYGDMLSWLKSRAE  318



>ref|XP_008776344.1| PREDICTED: caffeoylshikimate esterase [Phoenix dactylifera]
Length=354

 Score =   289 bits (739),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 159/358 (44%), Positives = 218/358 (61%), Gaps = 26/358 (7%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M HP+ +A+E SP+G L+  EFY +H + H     +N    +IFTQ W      E  G +
Sbjct  1     MVHPVAEADERSPFGQLTASEFYARHSVSHGSSSFVNPRGLRIFTQWWAPVPPAEVVGTI  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              ++HG+T ESSWL +L AV  AK G  V A+D  GHG+S+G   HIP I+PVV DC+   
Sbjct  61    GVVHGFTGESSWLVQLTAVYFAKAGFAVGALDHQGHGFSDGLVAHIPDIEPVVDDCVAFF  120

Query  1001  DSARAHH-PKLPAFLYGESLGGAIAILICLNQK--------------------HVWNGLI  885
             D+ RA + P+LP FLY ESLGGAIA+LI L ++                      W+GL+
Sbjct  121   DAFRARYPPELPCFLYAESLGGAIALLIHLRERKRAQDQNEGGVPLHDECQSFRDWDGLV  180

Query  884   LSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPN  708
             L+G MCG+S K+KP WPLE  L +AA   P WR+  T+    + S++   K++L   SP 
Sbjct  181   LNGAMCGISPKFKPPWPLEHLLWVAAALVPTWRVAVTRGSIPDVSFKVEWKRRLALASPR  240

Query  707   RFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskd  528
             R P  RP AATALELL+VC+ +Q    E+ +P+LI+ GGDD VCD   V+ +++ A SKD
Sbjct  241   R-PVARPRAATALELLRVCREVQGRYEEVALPMLIVHGGDDVVCDPACVQELYRRAGSKD  299

Query  527   KTLKIFAGMWHQLIGEPNESVELVFNTTLSWIQMRANLARAHKF*PIMHRISIEHQTY  354
             KTL+I+ GMWHQL+GEP+E+VELVF   L W++ RA  A +    P   R+  E   +
Sbjct  300   KTLRIYPGMWHQLVGEPDENVELVFGVILDWLKARALRAASQ---PQQERVEGEAAAF  354



>ref|XP_010679109.1| PREDICTED: caffeoylshikimate esterase-like [Beta vulgaris subsp. 
vulgaris]
Length=328

 Score =   287 bits (735),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 153/326 (47%), Positives = 208/326 (64%), Gaps = 14/326 (4%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M HP+ +ANE SP+G LS  EFY KH + H   ++ N    K+FTQ W      E  GV+
Sbjct  1     MVHPVAEANELSPFGSLSATEFYTKHSVSHSSEYITNSRGMKLFTQCWA-PLLGERIGVI  59

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRG---HIPRIDPVVHDCI  1011
             C++HGYT E+SW  +L ++  AK G  V  ID  GHGYS+   G   HIP ++PV+ DC+
Sbjct  60    CVVHGYTGETSWTVQLTSIYFAKAGFIVCGIDHQGHGYSDALNGYVAHIPDVNPVIDDCV  119

Query  1010  LCLDSARAHH-PKLPAFLYGESLGGAIAILICLNQKHV-------WNGLILSGPMCGVSK  855
                D  R  H P L  FLY ESLGGAIA+LI L +K V       ++G++L+G MCG+S 
Sbjct  120   AYFDEFREKHAPGLKGFLYSESLGGAIALLITLKKKSVGEEGRRGFDGVVLNGAMCGISP  179

Query  854   KYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAA  678
             K+KP WPLE  L  AA   P WR++ T+    + S++   K+KL   SP R+   RP AA
Sbjct  180   KFKPPWPLEYLLGFAAMVLPTWRVVPTRGSIPDVSFKVEWKRKLAIASPKRYMG-RPRAA  238

Query  677   TALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMW  498
             TA EL+++C+ +Q    E++VPL I+ GGDD VCD   V+ +++ A+SKDKTLKI+ GMW
Sbjct  239   TAHELMRICREVQERFEEVDVPLFIVHGGDDVVCDPACVEELYQRASSKDKTLKIYPGMW  298

Query  497   HQLIGEPNESVELVFNTTLSWIQMRA  420
             HQL+GEP E+VELVF   L W++ +A
Sbjct  299   HQLVGEPEENVELVFGDILDWLKAKA  324



>ref|XP_009616354.1| PREDICTED: caffeoylshikimate esterase-like [Nicotiana tomentosiformis]
Length=330

 Score =   287 bits (735),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 153/326 (47%), Positives = 207/326 (63%), Gaps = 17/326 (5%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M HP+ +ANE SP+G LS+ EFY  H + H   F+ N    K+F Q W      +  GVV
Sbjct  1     MKHPVAEANEESPFGSLSQSEFYSHHSVTHNSEFITNSRGLKLFAQWWTPLPPAKIVGVV  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
             C++HG+T ESSW  +L AV +AK G  V AID  GHG+S+G   HIP ++ VV+DCI   
Sbjct  61    CVVHGFTGESSWFVQLTAVHIAKHGFIVCAIDHQGHGFSDGLAAHIPDLNLVVNDCISFF  120

Query  1001  DSARAHHP--KLPAFLYGESLGGAIAILICLNQ-----KHVWNGLILSGPMCGVSKKYKP  843
             DS R  H    LP+FLY ESLGGAIA+LI L Q     +  ++G++L+G MCG+S K+KP
Sbjct  121   DSFRNLHAPQSLPSFLYAESLGGAIALLITLRQGDSAPRRPFDGVVLNGAMCGISNKFKP  180

Query  842   IWPLEEFLPLAAFFAPNWRIIFTKPPSRES-----YREVLKKKLVAKSPNRFPNERPPAA  678
              WPLE  L +AAF  P W ++    P+R S     ++E  K+KL   SP R P  +P AA
Sbjct  181   AWPLEYLLDIAAFLIPTWPVV----PTRGSLPMVAFKEEWKRKLAIASPKR-PLMKPRAA  235

Query  677   TALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMW  498
             TA EL++VC+ +Q    E++VP LI+ GGDD +CD    + +++ + S DKTL I+ GMW
Sbjct  236   TARELMRVCRELQGRFEEVKVPFLIVHGGDDVICDPACAEELYRRSISNDKTLNIYPGMW  295

Query  497   HQLIGEPNESVELVFNTTLSWIQMRA  420
             HQLIGEP E+VE VF   + W++ RA
Sbjct  296   HQLIGEPEENVEKVFGDVVEWLRTRA  321



>ref|XP_010558754.1| PREDICTED: caffeoylshikimate esterase-like [Tarenaya hassleriana]
Length=321

 Score =   286 bits (733),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 146/320 (46%), Positives = 204/320 (64%), Gaps = 12/320 (4%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HP+ +ANE SP+GDLS EEFY +H + H   F+ N    K+FTQ W   S   P G+V +
Sbjct  4     HPVSEANEKSPFGDLSAEEFYDRHGVSHSSDFITNSRGLKLFTQWWTPRSPSRPIGLVAV  63

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
             +HG+T ESSW  EL ++  A++G    AIDL GHG+S+G  G++P I+PVV DCI    S
Sbjct  64    LHGFTFESSWFVELTSILFAESGFITVAIDLQGHGFSDGLTGYVPDINPVVDDCISFFQS  123

Query  995   ARAHH--PKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEF  822
              R  H  P LP FLYGESLGGAIA+ I + +K  W+GL+LSG MC +S ++KP WPLE  
Sbjct  124   FRELHAPPDLPCFLYGESLGGAIALYIAIKEKSRWDGLVLSGAMCEISDRFKPPWPLETV  183

Query  821   LPLAAFFAPNWRIIFTKPPSRES-----YREVLKKKLVAKSPNRFPNERPPAATALELLK  657
             L     F P WR++    P+R       ++E  K KL   +P R  +  P A TA ELL+
Sbjct  184   LSAIVNFIPTWRVV----PTRRRLIDICFKEPWKTKLALANPRRTVS-MPRAGTAYELLR  238

Query  656   VCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEP  477
             VC+ ++    E+E+P++I+ GGDD VC+   V+ + + A S+DKT+ I+ GMWH L+GE 
Sbjct  239   VCEDLKGRFEEVEIPMMIVHGGDDAVCEVRRVEELHRRAKSEDKTVTIYPGMWHLLVGES  298

Query  476   NESVELVFNTTLSWIQMRAN  417
              E+V+LVF   + W++ RA+
Sbjct  299   EENVDLVFGDVVEWLKNRAS  318



>ref|XP_002871877.1| esterase/lipase/thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH48136.1| esterase/lipase/thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=326

 Score =   286 bits (731),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 148/316 (47%), Positives = 203/316 (64%), Gaps = 4/316 (1%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HPI  A+E +P+G L+ +EFY KH + H   F+ N    K+FTQ W      +P G++ +
Sbjct  4     HPISDADEHNPFGSLTADEFYAKHSVSHSSAFITNPRGLKLFTQWWSPLPPTKPIGIIAV  63

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
             +HG+T E+SW  +L ++  AK+G    AID  GHG+S+G   HIP I+PVV DCI   D 
Sbjct  64    VHGFTGETSWFLQLTSILFAKSGFITCAIDHQGHGFSDGLIAHIPDINPVVDDCISFFDD  123

Query  995   ARAHH--PKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEF  822
              R+      LP FLY ESLGGAIA+ I L Q+ VW+GLIL+G MCG+S K+KP WPLE  
Sbjct  124   FRSRQSPSDLPCFLYSESLGGAIALYISLRQRGVWDGLILNGAMCGISDKFKPPWPLEHL  183

Query  821   LPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKY  645
             L + A   P WR+I T+    + S++E  K+KL   SP R    RP AATA EL++VCK 
Sbjct  184   LFVVANLIPTWRVIPTRGSIPDVSFKEPWKRKLAMASPRR-TVARPRAATAYELIRVCKD  242

Query  644   IQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESV  465
             +Q    E+EVPLLI+ GG D +CD   V+ + + A S+DKT+KI+  +WHQ+IGE  + V
Sbjct  243   LQERFEEVEVPLLIVHGGGDVICDVACVEELHRRAISEDKTIKIYPELWHQMIGESEDKV  302

Query  464   ELVFNTTLSWIQMRAN  417
             +LV+   LSW++ RA 
Sbjct  303   DLVYGDMLSWLKTRAE  318



>ref|NP_001042883.1| Os01g0317800 [Oryza sativa Japonica Group]
 dbj|BAB62599.1| phospholipase-like protein [Oryza sativa Japonica Group]
 dbj|BAB93436.1| phospholipase-like protein [Oryza sativa Japonica Group]
 dbj|BAF04797.1| Os01g0317800 [Oryza sativa Japonica Group]
 gb|EAZ11646.1| hypothetical protein OsJ_01509 [Oryza sativa Japonica Group]
 dbj|BAG97428.1| unnamed protein product [Oryza sativa Japonica Group]
Length=329

 Score =   285 bits (730),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 152/316 (48%), Positives = 204/316 (65%), Gaps = 7/316 (2%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPR-GV  1185
             MAHP+ +A+E SP+G L+ EEFY +H ++H     +N    +IFTQ W     D P  G 
Sbjct  1     MAHPVAEADEKSPFGRLTAEEFYARHGVLHTSSTFVNPRGLRIFTQRWVPAGGDAPLLGA  60

Query  1184  VCMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILC  1005
             + ++HG+T ESSW  +L AV  AK G  V A+D  GHG+SEG +GHIP I PV+ DC   
Sbjct  61    IAVVHGFTGESSWTVQLTAVHFAKAGFAVAAVDHQGHGFSEGLQGHIPDIVPVLEDCEAA  120

Query  1004  LDSARAHHPK-LPAFLYGESLGGAIAILICLNQKHVW-NGLILSGPMCGVSKKYKPIWPL  831
                 RA +P  LP FLYGESLGGAIA+L+ L  K  W +G +L+G MCGVS ++ P WPL
Sbjct  121   FAPFRADYPPPLPCFLYGESLGGAIALLLHLRDKERWRDGAVLNGAMCGVSPRFMPPWPL  180

Query  830   EEFLPLAAFFAPNWRIIFTKP--PSRESYREVLKKKLVAKSPNRFPNERPPAATALELLK  657
             E  L  AA  AP WR+ FT+   P R S++   K+ L   SP R     P AATALELL+
Sbjct  181   EHLLWAAAAVAPTWRLAFTRGNIPDR-SFKVPWKRALAVASPRRT-TAPPRAATALELLR  238

Query  656   VCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEP  477
             VC+ +Q+   E+E+PLL++ GG+D VCD    + + + A SKDKTL+++ GMWHQL+GEP
Sbjct  239   VCRELQSRFEEVELPLLVVHGGEDTVCDPGCAEELHRRAGSKDKTLRVYPGMWHQLVGEP  298

Query  476   NESVELVFNTTLSWIQ  429
              E+V+ VF   L W++
Sbjct  299   EENVDKVFGDVLDWLK  314



>ref|XP_004496283.1| PREDICTED: monoglyceride lipase-like [Cicer arietinum]
Length=322

 Score =   284 bits (727),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 156/319 (49%), Positives = 203/319 (64%), Gaps = 4/319 (1%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M HP+ +AN+ SP+G L+ +EFY  H + H   FV N    K+FTQ W         G +
Sbjct  1     MVHPVAEANDHSPFGTLTPDEFYAHHSVSHGSEFVTNPRGLKLFTQWWIPQPPTNIIGTI  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              ++HGYTSESS   +L AV   K G    AID  GHG+S+G   HIP I+PVV DCI   
Sbjct  61    AVVHGYTSESSSFIQLTAVYFTKAGFATCAIDHQGHGFSDGLIAHIPDINPVVDDCITFF  120

Query  1001  DSARAH-HPKLPAFLYGESLGGAIAILICLNQKHV-WNGLILSGPMCGVSKKYKPIWPLE  828
             +S R+  +  LP+FLY ESLGGAIA+LI L +    WNG+IL+G MCGVS K+KP WPLE
Sbjct  121   ESFRSRFNSSLPSFLYSESLGGAIALLITLRRSGTPWNGVILNGAMCGVSAKFKPPWPLE  180

Query  827   EFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLKVC  651
              FL +AA   P W ++ T+    E S++E  K+KL   SP R    RP A+TA ELL++C
Sbjct  181   HFLSMAAAIIPTWCVVPTRGSIPEVSFKEEWKRKLAIASPGR-SMARPRASTAQELLRIC  239

Query  650   KYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNE  471
             + +Q    E+EVP LI+ G +D VCD   V+ ++  A SKDKTLKI+ GMWHQL+GEP E
Sbjct  240   RELQGRFEEVEVPFLIVHGANDVVCDPVCVEELYSRATSKDKTLKIYDGMWHQLVGEPEE  299

Query  470   SVELVFNTTLSWIQMRANL  414
             +VELVF   L W+  RA +
Sbjct  300   NVELVFGDMLEWLYKRATV  318



>ref|XP_006345805.1| PREDICTED: caffeoylshikimate esterase-like [Solanum tuberosum]
Length=335

 Score =   285 bits (728),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 155/333 (47%), Positives = 208/333 (62%), Gaps = 17/333 (5%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M HP+ +ANE SP+G LS+ EFY  H + H   F+ N    K+FTQ W      +  GVV
Sbjct  1     MKHPVAEANELSPFGSLSQSEFYSHHSVTHNSEFITNSRGLKLFTQWWSPLPPAKIIGVV  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
             C++HG+T ESSW  +L AV +AK G  V AID  GHG+S+G   HIP ++ VV DCI   
Sbjct  61    CVVHGFTGESSWFVQLTAVHIAKNGFIVCAIDHQGHGFSDGLIAHIPDLNLVVDDCISFF  120

Query  1001  DSARAHH--PKLPAFLYGESLGGAIAILICLN-----QKHVWNGLILSGPMCGVSKKYKP  843
             DS R  H  P LP+FLY ESLGGAIA+LI L      Q+  ++G++L+G M G+S K+KP
Sbjct  121   DSFRDLHVPPSLPSFLYAESLGGAIALLITLREGDSAQRRPFDGVVLNGGMYGISNKFKP  180

Query  842   IWPLEEFLPLAAFFAPNWRIIFTKPPSRES-----YREVLKKKLVAKSPNRFPNERPPAA  678
              WPLE  L +AA   P W ++    P+R S     ++E  KKKL   SP R P  +P  A
Sbjct  181   PWPLEHLLGIAAVLIPTWPVV----PTRGSLPLVAFKEEWKKKLAIASPKR-PLIKPRPA  235

Query  677   TALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMW  498
             TA EL++VC+ +Q    E++VP LI+ G DD +CD    + +++ + SKDKTLKI+ GMW
Sbjct  236   TARELMRVCRELQGRFEEVKVPFLIVHGSDDNICDPACAEELYRRSTSKDKTLKIYPGMW  295

Query  497   HQLIGEPNESVELVFNTTLSWIQMRANLARAHK  399
             HQL+GEP E+VE VF   + W++ RA  A   K
Sbjct  296   HQLVGEPEENVEKVFGDVVEWLKTRAEGATGDK  328



>emb|CDP04355.1| unnamed protein product [Coffea canephora]
Length=333

 Score =   285 bits (728),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 156/320 (49%), Positives = 207/320 (65%), Gaps = 8/320 (3%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSW--QHDSCDEPRGVV  1182
             HP+ +ANE SP+G L+ EEFY +H + H   F+ N    K+FTQ W    DS     G+V
Sbjct  4     HPVAEANEKSPFGSLTPEEFYARHKVTHGAEFITNARGLKLFTQWWIPLPDSGKPLFGIV  63

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
             C++HG+T ESSW  +L +V +AK G  V AID  GHG+SEG + HIP I+PVV DC+   
Sbjct  64    CVVHGFTCESSWFVQLTSVHLAKQGFAVCAIDHQGHGFSEGLQAHIPDINPVVDDCVAFF  123

Query  1001  DSARAHH--PKLPAFLYGESLGGAIAILICLNQ--KHVWNGLILSGPMCGVSKKYKPIWP  834
             D  R  H  P  P FLY ESLGGAIA+LI L +  K  ++G++L+G MCGVS K+KP WP
Sbjct  124   DDFRERHAPPDWPTFLYSESLGGAIALLITLRKDLKRPYDGIVLNGAMCGVSDKFKPPWP  183

Query  833   LEEFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLK  657
             LE FLP+ A   P W +I T+    E S++   K+KL   SP R P   P AATA ELL+
Sbjct  184   LEHFLPIVAAAVPTWPVIPTRGRIPEVSFKVEWKRKLAVASPKR-PLAMPRAATAQELLR  242

Query  656   VCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEP  477
             + + +Q    E+ VPLLI+ GGD+K+CD    + ++K AASKDKT+ I+ GMWHQL+GE 
Sbjct  243   LSRELQGRFEEVTVPLLIVHGGDNKICDPACAEDLYKRAASKDKTIHIYPGMWHQLVGES  302

Query  476   NESVELVFNTTLSWIQMRAN  417
             +E VE VF   + W++ RA 
Sbjct  303   DEDVERVFGDIVEWLRTRAE  322



>gb|EPS74573.1| hypothetical protein M569_00182, partial [Genlisea aurea]
Length=320

 Score =   282 bits (722),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 148/321 (46%), Positives = 212/321 (66%), Gaps = 9/321 (3%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQK-KIFTQSWQHDSCDEPRGVVC  1179
             HP+ +ANE SP+G+L+ EEFY +H + H   +V +  Q  K+FTQ W         G+VC
Sbjct  1     HPVAEANERSPFGELTAEEFYARHSVTHDSAYVTSVKQNLKLFTQWWLPRDPVPINGIVC  60

Query  1178  MIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLD  999
             ++HG+T ESSW  +L AV +AK G  V AID  GHG+SEG   HIP I+ VV DCIL  +
Sbjct  61    VVHGFTGESSWFVQLTAVHIAKHGFAVCAIDHTGHGFSEGLIAHIPDINSVVDDCILFFN  120

Query  998   SARAHHP-KLPAFLYGESLGGAIAILICLNQKHV-----WNGLILSGPMCGVSKKYKPIW  837
               RA +P +LPAFLY ESLGGAI++LI L ++ +     ++G++L+G MCG+S K+KP W
Sbjct  121   GFRARYPPRLPAFLYSESLGGAISLLITLRREGILPESKFDGVVLNGAMCGISAKFKPPW  180

Query  836   PLEEFLPLAAFFAPNWRIIFTKPP-SRESYREVLKKKLVAKSPNRFPNERPPAATALELL  660
             PLE FL +AA+  P W ++ T+    + S++   K+KL   SP R P  RP AATA ELL
Sbjct  181   PLEHFLSIAAYLIPTWCVVPTRGSLPQVSFKVEWKRKLALASPRR-PLLRPRAATAQELL  239

Query  659   KVCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGE  480
             +VC+ +Q    +++ P LI+ GGDD VCD    + ++++AAS DKT++I+ G+WHQL+GE
Sbjct  240   RVCREVQGKFDQVDAPFLIVHGGDDVVCDPACAEELYRNAASDDKTIRIYPGLWHQLVGE  299

Query  479   PNESVELVFNTTLSWIQMRAN  417
              ++ V+ VF   + W+  RA 
Sbjct  300   SDDDVDTVFGDVVDWLVTRAQ  320



>ref|XP_004239680.1| PREDICTED: caffeoylshikimate esterase [Solanum lycopersicum]
Length=335

 Score =   283 bits (723),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 152/333 (46%), Positives = 210/333 (63%), Gaps = 17/333 (5%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M HP+ +ANE SP+G LS+ EFY  H + H   F+ N    K+FTQ W      +  GVV
Sbjct  1     MKHPVAEANELSPFGTLSQSEFYSHHSVTHNSEFITNSRGLKLFTQWWSPLPPTKIIGVV  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
             C++HG+T ESSW  +L AV +AK G  V AID  GHG+S+G   HIP ++ VV DCI   
Sbjct  61    CVVHGFTGESSWFVQLTAVHIAKNGFIVCAIDHQGHGFSDGLIAHIPDLNLVVDDCISFF  120

Query  1001  DSARAHH--PKLPAFLYGESLGGAIAILICLNQ-----KHVWNGLILSGPMCGVSKKYKP  843
             DS R  H  P LP+FLY ESLGGAIA+LI L +     +  ++G++L+G M G+S K+KP
Sbjct  121   DSFRDLHVPPSLPSFLYAESLGGAIALLITLREGDSAPRRSFDGVVLNGAMYGISNKFKP  180

Query  842   IWPLEEFLPLAAFFAPNWRIIFTKPPSRES-----YREVLKKKLVAKSPNRFPNERPPAA  678
              WPLE  L +AA   P W ++    P+R S     ++E  K+KL   SP R P  +P  A
Sbjct  181   PWPLEHLLGIAAVLIPTWPVV----PTRGSLPLVAFKEEWKRKLAIASPRR-PLIKPRPA  235

Query  677   TALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMW  498
             TA EL++VC+ +Q    E++VP LI+ G DD +CD    + +++ + SKDKTLKI+ GMW
Sbjct  236   TARELMRVCRELQGRFEEVKVPFLIVHGSDDVICDPACAEELYRRSTSKDKTLKIYPGMW  295

Query  497   HQLIGEPNESVELVFNTTLSWIQMRANLARAHK  399
             HQL+GE  E+VE VF   + W++MRA+++   K
Sbjct  296   HQLVGELEENVEQVFGDVVEWLKMRADVSTGDK  328



>gb|KFK25736.1| hypothetical protein AALP_AA8G152900 [Arabis alpina]
Length=329

 Score =   281 bits (720),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 150/320 (47%), Positives = 204/320 (64%), Gaps = 7/320 (2%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HP+ +AN +SP+G LS  EFY +  + H   +V N    K+FTQ W       P G++ +
Sbjct  4     HPVSEANASSPFGSLSAAEFYSRRSVTHSSAYVTNPTGLKLFTQ-WWTPLHRPPLGIIAV  62

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
             +HG+T ESSW  +L ++  AK+G    AID  GHG+S+G   HIP ID +V DCI   D 
Sbjct  63    VHGFTGESSWFLQLTSILFAKSGFLTCAIDHQGHGFSDGLTAHIPNIDLIVDDCISFFDD  122

Query  995   ARAHHPK---LPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEE  825
              R  H     LP FLY ESLGGAIA+ I L QK  WNGLILSG MC +S K+KP WPL+ 
Sbjct  123   FRKRHSSSSSLPCFLYAESLGGAIALYITLRQKTQWNGLILSGAMCSISHKFKPPWPLQH  182

Query  824   FLPLAAFFA-PNWRIIFTKPP-SRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVC  651
              L   A    P WR+I T+   +  S++E  K++L   +PNR    RP AATA EL++VC
Sbjct  183   LLLTLAATLLPTWRVIPTRGSIAGVSFKEPWKRELAFANPNRSAG-RPRAATAYELVRVC  241

Query  650   KYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNE  471
             K +Q    E+EVPL+I+ GGDD VCD ++V+ +++ + S+DKT+KI+ GMWHQLIGE  E
Sbjct  242   KDLQGRFEEVEVPLMIVHGGDDVVCDPSSVEELYQRSRSRDKTIKIYPGMWHQLIGESEE  301

Query  470   SVELVFNTTLSWIQMRANLA  411
             +V+LVF   L W++ R+ + 
Sbjct  302   NVDLVFGDVLDWLKKRSEIT  321



>ref|XP_006377960.1| hypothetical protein POPTR_0011s16720g, partial [Populus trichocarpa]
 gb|ERP55757.1| hypothetical protein POPTR_0011s16720g, partial [Populus trichocarpa]
Length=253

 Score =   278 bits (711),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 150/313 (48%), Positives = 195/313 (62%), Gaps = 68/313 (22%)
 Frame = -1

Query  1358  AHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVC  1179
             +HPI +AN+ SPYGDL+REEFYKKH I+H+E F+ N+   KIFTQSW+ DS  +P+G+V 
Sbjct  1     SHPIHRANDKSPYGDLTREEFYKKHQILHQESFMFNKKNMKIFTQSWRPDSTSQPKGIVA  60

Query  1178  MIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLD  999
             M+HGY+SE                                                    
Sbjct  61    MVHGYSSE----------------------------------------------------  68

Query  998   SARAHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFL  819
             S +A +PKLPAFLYGESLGGAI+ILICL Q + W+GLILS  MCG+S K+KP+WPLE+ L
Sbjct  69    SIKASNPKLPAFLYGESLGGAISILICLKQGYAWDGLILSSAMCGISAKFKPMWPLEKLL  128

Query  818   PLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQ  639
             PLAA                 SY+E  K++LVA +PNR  +E+PP ATALE L+  +YI+
Sbjct  129   PLAAL----------------SYKEEWKRRLVANNPNRRNSEKPPPATALEFLRFSEYIR  172

Query  638   NNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESVEL  459
              +C++L+VP +++ G DD VCD  +   V +SA+SKDKTLK F GMWH LIGEP E+VEL
Sbjct  173   MHCYDLKVPFVMVHGEDDFVCDFRSASFVHESASSKDKTLKTFPGMWHVLIGEPKENVEL  232

Query  458   VFNTTLSWIQMRA  420
             VF T LSW++  A
Sbjct  233   VFETILSWLEDHA  245



>ref|XP_010932980.1| PREDICTED: caffeoylshikimate esterase-like [Elaeis guineensis]
Length=354

 Score =   279 bits (714),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 156/358 (44%), Positives = 216/358 (60%), Gaps = 26/358 (7%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M HP+ +A+E SP+G L+  EFY +H + H     +N    +IFTQ W      E  G +
Sbjct  1     MVHPVAEADERSPFGQLTASEFYARHSVSHGSSSFVNPRGLRIFTQWWAPVPPAEVVGTI  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              ++HG+T ESSWL +L AV  AK G  + A+D  GHG+S+G   HIP I+PVV DCI   
Sbjct  61    GVVHGFTGESSWLVQLTAVYFAKAGFAMGALDHQGHGFSDGLVAHIPDIEPVVDDCIAFF  120

Query  1001  DSARAHH-PKLPAFLYGESLGGAIAILICLNQK--------------------HVWNGLI  885
             D+ RA + P LP FLY ESLGGAIA+LI L ++                      W+GL+
Sbjct  121   DAFRARYPPGLPCFLYAESLGGAIALLIHLRERKRAQNQNEGGVPLHDECRSFRDWDGLV  180

Query  884   LSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPN  708
             L+G MCG+S K+KP WPLE  L +AA   P WR+  T+    + S++   K++L   SP+
Sbjct  181   LNGAMCGISPKFKPPWPLEHLLWVAAALVPTWRVAVTRGSIPDVSFKVEWKRRLALASPH  240

Query  707   RFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskd  528
             R     P AATALELL+VC+ +Q    E+ +P+LI+ GGDD VCD   V+ +++ A SKD
Sbjct  241   RTVAP-PRAATALELLRVCREVQGRYEEVALPMLIVHGGDDVVCDPACVEELYRRAGSKD  299

Query  527   KTLKIFAGMWHQLIGEPNESVELVFNTTLSWIQMRANLARAHKF*PIMHRISIEHQTY  354
             K+L+I+ GMWHQL+GEP+E+VELVF   L W++ RA  A +    P   R+  E   +
Sbjct  300   KSLRIYPGMWHQLVGEPDENVELVFGEILDWLKARALRAASQ---PQQERVEGEAAAF  354



>emb|CDX91009.1| BnaC02g05880D [Brassica napus]
Length=1032

 Score =   295 bits (755),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 152/317 (48%), Positives = 207/317 (65%), Gaps = 8/317 (3%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQ--HDSCDEPRGVV  1182
             HP+ +AN++SP+G LS  EFY +H + H   ++ N    K+FTQ W   H     P G++
Sbjct  4     HPVSEANDSSPFGSLSAAEFYSRHSVAHSSAYITNPTGLKLFTQWWTPLHRP---PLGLI  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              ++HG+T ESSW  +L +V  AK+G    AID  GHG S+G   HIP I+ +V DCI   
Sbjct  61    AVVHGFTGESSWFLQLTSVLFAKSGFLTCAIDHQGHGLSDGLTAHIPNINLIVDDCISFF  120

Query  1001  DSARAHHPK-LPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEE  825
             D  R+ H   LP+FLY ESLGGAIA+ I L QK  WNGLILSG MC +S K+KP WPL+ 
Sbjct  121   DDFRSRHSSSLPSFLYSESLGGAIALYITLRQKSQWNGLILSGAMCSISHKFKPPWPLQH  180

Query  824   FLPLAAFFAPNWRIIFTKPP-SRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCK  648
              L LAA   P WR++ T+   +  S++E  K+KL   +PNR    +P AATA EL++VC+
Sbjct  181   LLTLAATLIPTWRVVPTRGTIAGVSFKEPWKRKLAFANPNRTVG-KPRAATAYELVRVCE  239

Query  647   YIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNES  468
              +Q+   E+EVPL+I+ GGDD VCD ++V+ ++    S+DKT+KI+ GMWHQLIGE  E+
Sbjct  240   DLQSRFEEVEVPLMIVHGGDDVVCDPSSVEELYMRCKSRDKTIKIYPGMWHQLIGESEEN  299

Query  467   VELVFNTTLSWIQMRAN  417
             V+LVF   L WI  R+ 
Sbjct  300   VDLVFGDVLKWITNRSQ  316



>gb|EAY73742.1| hypothetical protein OsI_01616 [Oryza sativa Indica Group]
Length=322

 Score =   276 bits (707),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 151/323 (47%), Positives = 203/323 (63%), Gaps = 7/323 (2%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPR-GV  1185
             MAHP+ +A+E SP+G L+ EEFY +H +++     +N    +IFTQ W     D P  G 
Sbjct  1     MAHPVAEADEKSPFGRLTAEEFYARHGVVNSSSTFVNPRGLRIFTQRWVPAGVDAPLLGA  60

Query  1184  VCMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILC  1005
             + ++HG+T ESSW+ +L AV  AK G  V A+D  GHG SEG + HIP I PV+ DC   
Sbjct  61    IAVVHGFTGESSWMVQLTAVHFAKAGFAVAAVDHQGHGLSEGLQDHIPDIVPVLEDCEAA  120

Query  1004  LDSARAHHPK-LPAFLYGESLGGAIAILICLNQKHVW-NGLILSGPMCGVSKKYKPIWPL  831
                 RA +P  LP FLYGESLGGAIA+L+ L  K  W +G +L+G  CGVS ++ P WPL
Sbjct  121   FAPFRAEYPPPLPCFLYGESLGGAIALLLHLRDKERWRDGAVLNGAFCGVSPRFMPPWPL  180

Query  830   EEFLPLAAFFAPNWRIIFTKP--PSRESYREVLKKKLVAKSPNRFPNERPPAATALELLK  657
             E  L  AA  AP WR+ FT+   P R S++   K+ L   SP R     P AATALELL+
Sbjct  181   EHLLWAAAAVAPTWRLAFTRGNIPDR-SFKVPWKRALAVASPRR-TTAPPRAATALELLR  238

Query  656   VCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEP  477
             V + +Q+   E+E+PLL++ GG+D VCD    + + + A SKDKTL+++ GMWHQL+GE 
Sbjct  239   VSRELQSRFEEVELPLLVVHGGEDTVCDPGCAEELHRRAGSKDKTLRVYPGMWHQLVGES  298

Query  476   NESVELVFNTTLSWIQMRANLAR  408
             +E VE VF   L W++  A  AR
Sbjct  299   DEDVEKVFGHILDWLKSHAANAR  321



>dbj|BAK08241.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=334

 Score =   277 bits (708),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 151/318 (47%), Positives = 202/318 (64%), Gaps = 8/318 (3%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEP-RGV  1185
             M HP+ +A+E SP+G L+ EE+Y +H + H     +N    +IFTQ W   S D P  G 
Sbjct  1     MVHPVAEADERSPFGGLTAEEYYARHGVTHTSSTFVNPRGLRIFTQRWV-PSGDAPVLGA  59

Query  1184  VCMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILC  1005
             + ++HG+T ESSW+  L AV  AK G  V A+D  GHG+SEG + HIP I PV+ DC   
Sbjct  60    IAVVHGFTGESSWMVLLTAVHFAKQGFAVAAVDHQGHGFSEGLQAHIPDIGPVLDDCEAA  119

Query  1004  LDSARAHH-PKLPAFLYGESLGGAIAILICLNQKHVW-NGLILSGPMCGVSKKYKPIWPL  831
                 RA H P LP FLYGESLGGAIA+L+ L  K  W +G +L+G MCGVS ++KP WPL
Sbjct  120   FAPFRADHPPPLPCFLYGESLGGAIALLLHLRDKARWRDGAVLNGAMCGVSPRFKPPWPL  179

Query  830   EEFLPLAAFFAPNWRIIFTKP--PSRESYREVLKKKLVAKSPNRFPNERPPAATALELLK  657
             E  L  AA  AP W + FT+   P R S++   K+ L   SP R     P AATALELL+
Sbjct  180   EHLLWAAAAVAPTWHVAFTRGNIPGR-SFKVGWKRALALASPRRT-TAPPRAATALELLR  237

Query  656   VCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEP  477
             VC+ +Q    E+E+PLL + GG+D VCD   V+ + + A S+DKTL+++ GMWHQ++GEP
Sbjct  238   VCRELQTRFEEVELPLLAVHGGEDTVCDPACVEEMHRRAGSRDKTLRVYPGMWHQIVGEP  297

Query  476   NESVELVFNTTLSWIQMR  423
              E+VE VF   + W++ R
Sbjct  298   EENVEEVFADVVGWLKAR  315



>ref|XP_003567617.1| PREDICTED: caffeoylshikimate esterase-like [Brachypodium distachyon]
Length=326

 Score =   276 bits (707),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 147/315 (47%), Positives = 198/315 (63%), Gaps = 6/315 (2%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M HP+ +ANE SP+G+L+ EEFY +H + H     +N    +IFTQ W         G +
Sbjct  1     MVHPVAEANERSPFGELTAEEFYARHGVTHSSSTFVNPRGLRIFTQRWVPSGGAPVLGAI  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              ++HG+T ES W+  L AV  AK G  V A+D  GHG+SEG + HIP I PV+ DC    
Sbjct  61    AVVHGFTGESGWMVLLTAVHFAKAGFAVAAVDHQGHGFSEGLQAHIPDIGPVLDDCEAAF  120

Query  1001  DSARAHH-PKLPAFLYGESLGGAIAILICLNQKHVW-NGLILSGPMCGVSKKYKPIWPLE  828
                RA + P LP FLYGESLGGAIA+L+ L  K  W +G++L+G MCGVS ++ P WPLE
Sbjct  121   APFRADYPPPLPCFLYGESLGGAIALLLHLRDKQRWRDGVVLNGAMCGVSPRFMPPWPLE  180

Query  827   EFLPLAAFFAPNWRIIFTKP--PSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKV  654
               L +AA  AP W++ FT+   P R S++   K+ L   SP R     P AATALELL++
Sbjct  181   HLLWVAAAVAPTWQVAFTRGNIPGR-SFKVEWKRALAMASPRR-TTAPPRAATALELLRM  238

Query  653   CKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPN  474
             C+ +Q    E+E PLL + GG+D VCD   V+ +   A SKDKTL+++ GMWHQ+IGEP 
Sbjct  239   CRELQARFEEVEAPLLAVHGGEDTVCDPGCVEELHSRAGSKDKTLRVYPGMWHQIIGEPE  298

Query  473   ESVELVFNTTLSWIQ  429
             E+VE VF   + W++
Sbjct  299   ENVEKVFGDVVDWLK  313



>ref|XP_006845999.1| hypothetical protein AMTR_s00155p00055670 [Amborella trichopoda]
 gb|ERN07674.1| hypothetical protein AMTR_s00155p00055670 [Amborella trichopoda]
Length=323

 Score =   273 bits (697),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 147/318 (46%), Positives = 198/318 (62%), Gaps = 3/318 (1%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQ-HDSCDEPRGV  1185
             MA+PI +  + + + +   + F +KH +I ++  + N     I+TQSW    S   P G+
Sbjct  1     MAYPIHERAQEA-FSEFVDDPFLQKHGVIRRQSHMRNRRGLDIYTQSWAPAGSSRRPCGL  59

Query  1184  VCMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILC  1005
             VCMIHG+   S   +EL A+AM K G  VYA+DL GHG SEG RG+IP I  ++ DCI  
Sbjct  60    VCMIHGFMVHSGGPWELTAIAMVKQGFAVYALDLQGHGRSEGLRGYIPDIQWLLDDCIEF  119

Query  1004  LDSARAHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEE  825
              + +RA  P LPAFLYGESLGGA+A+L+ L Q  VW G+ILSGPMCG+++ + P WP+E 
Sbjct  120   FNCSRAEAPGLPAFLYGESLGGALALLVSLRQPGVWKGVILSGPMCGIARSFMPPWPMEL  179

Query  824   FLPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKY  645
              LPLA+   P W+ + T+   + SY+E   +KL+   P       P  A+A ELLK C  
Sbjct  180   LLPLASIVVPTWKAVPTQSLVKASYKEPTFRKLIRTDPY-LCRGLPRVASARELLKACDE  238

Query  644   IQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESV  465
             +Q   +E+ VPLLIL G  D VCD  A + V++   S DKTLKI  GMWHQLIGEP E+V
Sbjct  239   VQRRSYEVCVPLLILHGDTDHVCDVKATEVVYERVQSHDKTLKILPGMWHQLIGEPPENV  298

Query  464   ELVFNTTLSWIQMRANLA  411
             + VF    SW++ RA  A
Sbjct  299   DCVFKLVFSWLRDRATGA  316



>emb|CAN82378.1| hypothetical protein VITISV_036229 [Vitis vinifera]
Length=1395

 Score =   291 bits (746),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 157/318 (49%), Positives = 205/318 (64%), Gaps = 5/318 (2%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M HP+ +ANE SP+G LS  EFY +H + H   ++ N    K+FTQSW      +  G +
Sbjct  1     MVHPVAEANEQSPFGSLSPSEFYARHSVTHSSEYITNSRGMKLFTQSWTPLPPTKIIGTL  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              ++HG+T ESSW  +L AV   K G    AID  GHG+S+G   HIP I+PVV DCI   
Sbjct  61    AVVHGFTGESSWFLQLTAVHFTKAGFATCAIDHQGHGFSDGLVAHIPDINPVVDDCIAFF  120

Query  1001  DSARAHHP-KLPAFLYGESLGGAIAILICLNQ--KHVWNGLILSGPMCGVSKKYKPIWPL  831
             DS RA H   LP+FLY ESLGGAIA+LI L +     W+GL+L+G MCG+S K+KP WPL
Sbjct  121   DSFRARHAXSLPSFLYSESLGGAIALLITLRRGPSRPWDGLVLNGAMCGISPKFKPPWPL  180

Query  830   EEFLPLAAFFAPNWRIIFTKPP-SRESYREVLKKKLVAKSPNRFPNERPPAATALELLKV  654
             E FL L A   P WR++ T+    + S++   K+ L   SP R P  RP AATA ELL+V
Sbjct  181   EHFLFLLAAVVPTWRVVPTRGALPQLSFKVEWKRNLALASPRR-PVARPRAATAQELLRV  239

Query  653   CKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPN  474
             C+ IQN   E+EVP L++ G DD VCD   V+ +++ A SKDKTLKI+  M HQL+GEP+
Sbjct  240   CREIQNRYGEVEVPFLVVHGADDVVCDPACVEELYRRAPSKDKTLKIYPDMIHQLVGEPD  299

Query  473   ESVELVFNTTLSWIQMRA  420
             E+VELVF   + W++ RA
Sbjct  300   ENVELVFGDIVEWLRTRA  317



>ref|XP_001772196.1| predicted protein [Physcomitrella patens]
 gb|EDQ63009.1| predicted protein [Physcomitrella patens]
Length=324

 Score =   265 bits (676),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 151/313 (48%), Positives = 196/313 (63%), Gaps = 7/313 (2%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             HP   A+ TS YG+L  +EFY KH + + E  ++N    +   +SW     +E RGVVC+
Sbjct  6     HPCCDASSTSIYGELEAQEFYDKHGVAYVEDTLVNSRGLRQCWRSWVPVG-EELRGVVCV  64

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
              HGY ++S WL +L  +A+AK G  VYAID  GHG SEG +GHIP I+ VV DCI   D 
Sbjct  65    CHGYGADSGWLVQLTCIAIAKEGYAVYAIDHQGHGKSEGLKGHIPDINVVVDDCIAFFDP  124

Query  995   ARAHHPK----LPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLE  828
                HH      LP FLYGESLGGAIA+LI L Q  +W G++L+G MCG+  K+KP WP E
Sbjct  125   RVRHHIHNFQCLPFFLYGESLGGAIALLIHLRQPELWQGVVLNGAMCGIG-KFKPPWPAE  183

Query  827   EFLPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCK  648
               L L + F P W I+ TK     S++E  K+ L   +PNR+   RP AATA E L+V K
Sbjct  184   YLLGLISGFIPTWPIVPTKDIPTVSFKEPWKRNLARINPNRYTG-RPRAATAREFLRVVK  242

Query  647   YIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNES  468
              I++   E+  PLLIL G  D VCD +  K + ++AASKDKTL ++ GMWHQL+GEP E 
Sbjct  243   EIEDRASEVTAPLLILHGDQDIVCDPDGSKTLHQNAASKDKTLHLYPGMWHQLVGEPTEG  302

Query  467   VELVFNTTLSWIQ  429
             VE VF    SW++
Sbjct  303   VEQVFGDMFSWLE  315



>ref|XP_002455554.1| hypothetical protein SORBIDRAFT_03g013040 [Sorghum bicolor]
 gb|EES00674.1| hypothetical protein SORBIDRAFT_03g013040 [Sorghum bicolor]
Length=330

 Score =   262 bits (670),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 145/319 (45%), Positives = 204/319 (64%), Gaps = 9/319 (3%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPR--G  1188
             M HPI +A+E SP+G L+ +EFY +H + H     +N    +IFTQ W     D  R  G
Sbjct  1     MVHPIAEADERSPFGRLTPDEFYARHGVTHSTSSFVNPRGLRIFTQRWVPRG-DGARVLG  59

Query  1187  VVCMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCIL  1008
              V ++HG+T ESSW+ +L AV +A  G  V A+D  GHG+SEG + H+P I+PV+ DC  
Sbjct  60    AVAVVHGFTGESSWMVQLTAVHLAAAGFAVAALDHQGHGFSEGLQCHVPDIEPVLDDCDA  119

Query  1007  CLDSARAHHPK-LPAFLYGESLGGAIAILICLNQKHVW-NGLILSGPMCGVSKKYKPIWP  834
                  RA +P  LP FLYGESLGGAIA+L+ L  + +W +G +L+G MCG+S +++P WP
Sbjct  120   AFAPFRADYPPPLPCFLYGESLGGAIALLLHLRNRDLWRDGAVLNGAMCGISARFRPPWP  179

Query  833   LEEFLPLAAFFAPNWRIIFTKP--PSRESYREVLKKKLVAKSPNRFPNERPPAATALELL  660
             LE  L  AA   P WR+ FT+   P R S++   K+KL   SP R     P AATALELL
Sbjct  180   LEHLLAAAAKVVPTWRVAFTRGNIPER-SFKVDWKRKLALASPRRT-TAPPRAATALELL  237

Query  659   KVCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGE  480
             +VC+ +Q    E+++PLL++ G +D VCD   V+ ++  A S DKTL+++  MWHQ+IGE
Sbjct  238   RVCRDLQQRFEEVKLPLLVVHGAEDTVCDPACVQELYTRAGSSDKTLRVYPEMWHQIIGE  297

Query  479   PNESVELVFNTTLSWIQMR  423
             P E+VE VF+  + W++ R
Sbjct  298   PEENVEKVFDEIIDWLKAR  316



>tpg|DAA54424.1| TPA: hypothetical protein ZEAMMB73_151003 [Zea mays]
Length=328

 Score =   262 bits (669),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 147/317 (46%), Positives = 203/317 (64%), Gaps = 6/317 (2%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M HPI +A+E SP+G L+ +EFY +H + H     +N    +IFTQ W         G V
Sbjct  1     MVHPIAEADERSPFGRLTPDEFYARHGVTHSASSFVNPRGLRIFTQRWVPSGDAPVLGAV  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              ++HG+T ESSW  +L AV +A  G  V A+D  GHG+SEG +GH+P I+PV+ DC    
Sbjct  61    AVVHGFTGESSWTIQLTAVHLAAAGFAVAALDHQGHGFSEGLQGHLPDINPVLDDCDAAF  120

Query  1001  DSARAHH-PKLPAFLYGESLGGAIAILICLNQKHVW-NGLILSGPMCGVSKKYKPIWPLE  828
                RA + P LP FLYGESLGGAIA+L+ L  + +W +G +L+G MCGVS ++KP WPLE
Sbjct  121   APFRADYPPPLPCFLYGESLGGAIALLLHLRNRDLWRDGAVLNGAMCGVSPRFKPPWPLE  180

Query  827   EFLPLAAFFAPNWRIIFTKP--PSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKV  654
               L  AA   P WR+ FT+   P R S++   K+ L   SP R     P AATALELL+V
Sbjct  181   HLLAAAAAVVPTWRVAFTRGNIPER-SFKVDWKRALALASPRRT-TAPPRAATALELLRV  238

Query  653   CKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPN  474
             C+ +Q    E+++PLL++ G +D VCD   V+ + + A SKDKTL+I+ GMWHQ++GEP 
Sbjct  239   CRELQRRFEEVQLPLLVVHGAEDTVCDPACVEELCRRAGSKDKTLRIYPGMWHQIVGEPE  298

Query  473   ESVELVFNTTLSWIQMR  423
             E+VE VF+  + W++ R
Sbjct  299   ENVEKVFDDIIDWLKAR  315



>ref|XP_002990215.1| hypothetical protein SELMODRAFT_447944 [Selaginella moellendorffii]
 gb|EFJ08775.1| hypothetical protein SELMODRAFT_447944 [Selaginella moellendorffii]
Length=329

 Score =   256 bits (655),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 141/316 (45%), Positives = 196/316 (62%), Gaps = 7/316 (2%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             MAHP   +   S +G  S E+FY KH + H E  + N      +TQSW   + +  + +V
Sbjct  1     MAHPSLDSTVDSLFGGRSPEDFYAKHGVTHGERMITNARGMAQYTQSWL-PTRERVKALV  59

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSE---GRRGHIPRIDPVVHDCI  1011
              + HGY ++S W  +L A+ +A+ G  V+AID  GHG S+   G R ++P I+PVV DCI
Sbjct  60    MVCHGYGADSGWFVQLTAIGIAQRGFAVHAIDHQGHGRSQDWQGLRAYVPDINPVVDDCI  119

Query  1010  LCLDSARAHHP--KLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIW  837
                DS R+      LPAFLYGESLGGA+ +LI L Q  VW+G +L+G MCG+S K+KP W
Sbjct  120   AFFDSVRSQQEFQGLPAFLYGESLGGALCLLIHLRQPGVWSGAVLNGAMCGISPKFKPPW  179

Query  836   PLEEFLPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLK  657
             PLE  L   A  AP W I+ TK     S++E  K++LV K+P R+ + RP A TALELL+
Sbjct  180   PLENLLSYVAALAPTWAIVPTKDIPTVSFKEAWKRELVKKNPVRY-SGRPRAGTALELLR  238

Query  656   VCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEP  477
             V + +     E+ +PLL++ G  D V D    KA++   +SKDKTL+I+ GMWHQL GEP
Sbjct  239   VVRELDERFPEVTLPLLVIHGELDVVTDPEGSKALYDRCSSKDKTLRIYQGMWHQLAGEP  298

Query  476   NESVELVFNTTLSWIQ  429
              E++E+VF    SW++
Sbjct  299   PENLEVVFGELYSWLE  314



>ref|XP_001752999.1| predicted protein [Physcomitrella patens]
 gb|EDQ82040.1| predicted protein [Physcomitrella patens]
Length=320

 Score =   256 bits (654),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 137/312 (44%), Positives = 192/312 (62%), Gaps = 3/312 (1%)
 Frame = -1

Query  1364  KMAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGV  1185
             +  HP   A+ ++ +G+L  E+FY KH + + E  +LN    +   +SW      E RGV
Sbjct  3     RQPHPCCDASSSNIFGELEPEKFYTKHEVSYFEDMLLNSRGLRQCWRSWVPVD-REVRGV  61

Query  1184  VCMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILC  1005
             VC+ HGY +++ WL +L  +A+AK G  VYAID  GHG SEG +GH+P I  VV DCI  
Sbjct  62    VCVCHGYGADAGWLVQLTCIAIAKEGYAVYAIDHQGHGKSEGLKGHVPDIKVVVDDCIAF  121

Query  1004  LDSARAHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEE  825
              DS R  H  +  FLYGES+GGAIA+LI L Q  +W G++L+G MCG+  K+KP WP E 
Sbjct  122   FDSKRGSHKGMSFFLYGESMGGAIALLIHLRQPELWQGVVLNGAMCGIG-KFKPPWPAEH  180

Query  824   FLPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKY  645
              L   +   P W I+ TK     S++E  K++L   +PNR+ + RP AATA E L+V K 
Sbjct  181   LLGFISGIIPTWPIVPTKDIPTVSFKEPWKRELARNNPNRY-SGRPRAATAQEFLRVVKE  239

Query  644   IQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESV  465
             I+    E+  PLL+L GG D VCD + VK + ++ +  DK L ++  MWHQL+GEP+E +
Sbjct  240   IEGRASEVTAPLLMLHGGLDVVCDPDGVKMLHQNVSCADKALHVYPDMWHQLVGEPSEGL  299

Query  464   ELVFNTTLSWIQ  429
             E VF    SW++
Sbjct  300   EQVFGDMFSWLE  311



>ref|XP_002992473.1| hypothetical protein SELMODRAFT_186777 [Selaginella moellendorffii]
 gb|EFJ06411.1| hypothetical protein SELMODRAFT_186777 [Selaginella moellendorffii]
Length=328

 Score =   255 bits (652),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 141/316 (45%), Positives = 195/316 (62%), Gaps = 7/316 (2%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             MAHP   +   S +G  S E+FY KH + H E  + N      +TQSW   + +  + +V
Sbjct  1     MAHPSLDSTVDSLFGGRSPEDFYAKHGVTHGERMITNARGMAQYTQSWL-PTRERVKALV  59

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSE---GRRGHIPRIDPVVHDCI  1011
              + HGY ++S W  +L A+ +A+ G  V+AID  GHG S+   G R ++P I+PVV DCI
Sbjct  60    MVCHGYGADSGWFVQLTAIGIAQRGFAVHAIDHQGHGRSQDWQGLRAYVPDINPVVDDCI  119

Query  1010  LCLDSARAHHP--KLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIW  837
                DS R+      LPAFLYGESLGGA+ +LI L Q  VW+G +L+G MCG+S K+KP W
Sbjct  120   AFFDSVRSQQEFQGLPAFLYGESLGGALCLLIHLRQPGVWSGAVLNGAMCGISPKFKPPW  179

Query  836   PLEEFLPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLK  657
             PLE  L   A  AP W I+ TK     S++E  K++LV K+P R+ + RP A TALELL+
Sbjct  180   PLENLLSYVAALAPTWAIVPTKDIPTVSFKEAWKRELVKKNPVRY-SGRPRAGTALELLR  238

Query  656   VCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEP  477
             V + +     E+ +PLL++ G  D V D    KA++   +SKDKTL+I+ GMWHQL GEP
Sbjct  239   VVRELDERFPEVTLPLLVIHGELDVVTDPEGSKALYDRCSSKDKTLRIYQGMWHQLAGEP  298

Query  476   NESVELVFNTTLSWIQ  429
              E++E VF    SW++
Sbjct  299   PENLEKVFGEVYSWLE  314



>ref|XP_002529580.1| Monoglyceride lipase, putative [Ricinus communis]
 gb|EEF32814.1| Monoglyceride lipase, putative [Ricinus communis]
Length=300

 Score =   225 bits (573),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 168/268 (63%), Gaps = 6/268 (2%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             + HP+ +A+E SP+G LS  EFY +H++     ++ N    K+FTQ W      +    V
Sbjct  5     IQHPVAEASEESPFGKLSASEFYARHNVTCSSEYITNSRGFKLFTQWWTPLPPTKITACV  64

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRG---HIPRIDPVVHDCI  1011
              +IHG+T ESSW  +L ++  A++G  V AID  GHG+S+G  G   HIP + PVV DCI
Sbjct  65    AVIHGFTGESSWFVQLTSILFAQSGFAVCAIDHQGHGFSDGLDGLIYHIPDLAPVVDDCI  124

Query  1010  LCLDSAR-AHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWP  834
                   R +H P LPAFLY ESLGGAIA+ I L +K VW+GLIL+G MCG+S K+KP WP
Sbjct  125   HFFTRFRQSHAPGLPAFLYAESLGGAIALYITLREKGVWDGLILNGAMCGISAKFKPPWP  184

Query  833   LEEFLPLAAFFAPNWRIIFTKPPSRE-SYREVLKKKLVAKSPNRFPNERPPAATALELLK  657
             LE  L + A   P W ++ T+    + S++E  K+KL A +  R    RP AATAL +L+
Sbjct  185   LEHLLFIVAAVVPTWSVVPTRGSIPDVSFKENWKRKL-ATASPRRVAARPRAATALMMLR  243

Query  656   VCKYIQNNCHELEVPLLILQGGDDKVCD  573
             VC  +Q    E++VPLLI+ GGDD VCD
Sbjct  244   VCGELQERFDEVDVPLLIVHGGDDVVCD  271



>ref|XP_009381885.1| PREDICTED: caffeoylshikimate esterase-like [Musa acuminata subsp. 
malaccensis]
Length=177

 Score =   219 bits (559),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 131/171 (77%), Gaps = 1/171 (1%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEP-RGV  1185
             M+HPI QA+++SP+G+L+ EEFY++HHI+H+E F+LN +  KIFTQSW+  S      G+
Sbjct  1     MSHPINQASKSSPFGNLTLEEFYRQHHILHRESFMLNNHNMKIFTQSWRPASPSAAVHGL  60

Query  1184  VCMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILC  1005
             V MIHGY SESSW+F+L AVA+AK G  V A+DL GHG SEGRRGHIP I P+V DC+  
Sbjct  61    VAMIHGYASESSWVFQLTAVAIAKRGFVVCALDLRGHGRSEGRRGHIPSIGPLVDDCVAF  120

Query  1004  LDSARAHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKK  852
               SAR+ HP LPAFLYGESLGGA AIL+ L +K  W+GL+L+G MCGVS  
Sbjct  121   FGSARSAHPHLPAFLYGESLGGATAILVYLREKARWSGLVLNGAMCGVSAS  171



>gb|ABR18313.1| unknown [Picea sitchensis]
Length=325

 Score =   213 bits (541),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 116/314 (37%), Positives = 179/314 (57%), Gaps = 7/314 (2%)
 Frame = -1

Query  1340  ANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSW-QHDSCDEPRGVVCMIHGY  1164
             A+ T+P+G++S EE Y+   I   + F  +      FT++W   D    PR ++CM+HGY
Sbjct  2     ASLTTPWGEISEEEMYRLKGIKASQSFFKSPRGLNYFTRTWLPGDDRGPPRALICMLHGY  61

Query  1163  TSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSA---  993
              ++ SW F+  A+  A+ G    A+DL GHG S+G R ++P +D +V DC    DS    
Sbjct  62    GNDISWTFQNTAIHFAQIGFAAVALDLEGHGRSDGLRAYVPDVDALVADCAAFFDSVWSN  121

Query  992   -RAHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLP  816
               A    LP FLYGES+GGA+ +L+ L     W+G ++  PMC +S K KP WP+ +FL 
Sbjct  122   DTAQFRALPRFLYGESMGGAMCLLVHLRNPTGWDGAVMVAPMCRISDKVKPPWPVAKFLT  181

Query  815   LAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQN  636
               A F P   I+ T+    +S + V  K++VA+S  R    +P   T LELL+V  Y+  
Sbjct  182   FLATFVPTLAIVPTEDLIDKSVK-VPSKRIVARSNPRRYTGKPRLGTVLELLRVTDYVGQ  240

Query  635   NCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVEL  459
                ++++P ++L G  D V D +  + +++ A SKDKTLKI+ GM H L+ GEP+E++ +
Sbjct  241   RLQDVDLPFIVLHGDADVVTDPSVSRNLYEVAKSKDKTLKIYEGMLHSLLFGEPDENIAI  300

Query  458   VFNTTLSWIQMRAN  417
             V      W+  R +
Sbjct  301   VLGDICDWLTQRID  314



>gb|KFK43401.1| hypothetical protein AALP_AA1G121200, partial [Arabis alpina]
Length=319

 Score =   212 bits (539),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 111/309 (36%), Positives = 183/309 (59%), Gaps = 6/309 (2%)
 Frame = -1

Query  1337  NETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTS  1158
              E + +G+ S ++++    II  + F  +     +FT+SW   S   PRG++ M+HGY +
Sbjct  6     TEINFWGETSEQDYFNLKSIIGSKSFFTSPRGLNLFTRSWLPSSQSPPRGLIFMVHGYGN  65

Query  1157  ESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHHP  978
             + SW F+   + +A+ G   +A+D+ GHG S+G R ++P +D VV D I   +S +  +P
Sbjct  66    DISWTFQSTPIFLAQMGFACFALDIEGHGRSDGTRAYVPSVDLVVQDIISFFNSIK-QNP  124

Query  977   K---LPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAA  807
             K   LP FL+GES+GGAI +LI       ++G +L  PMC +S K +P WP+++FL + +
Sbjct  125   KFQNLPRFLFGESMGGAICLLIHFADPLGFDGAVLVAPMCKISDKVRPKWPIDQFLIMIS  184

Query  806   FFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCH  627
              F P W I+ T+    +S +   KK +  ++P R+ NE+P   T +ELL+V  Y+     
Sbjct  185   SFLPTWAIVPTEDLLEKSIKVEEKKPIAKRNPMRY-NEKPRLGTVMELLRVTDYLGKKLK  243

Query  626   ELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQ-LIGEPNESVELVFN  450
             ++ +P ++L G  D V D +  + + + A S+DKTLKI+ GM H  L GEP+E++E+V  
Sbjct  244   DVSIPFIVLHGSADVVTDPDVSRELCEVAKSEDKTLKIYEGMMHSMLFGEPDENIEIVRK  303

Query  449   TTLSWIQMR  423
               +SW+  R
Sbjct  304   DIVSWLNDR  312



>gb|KDP20918.1| hypothetical protein JCGZ_21389 [Jatropha curcas]
Length=318

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/313 (36%), Positives = 177/313 (57%), Gaps = 6/313 (2%)
 Frame = -1

Query  1349  IFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIH  1170
             +    E   +G    EE+YK+  I     F  +     +FT+SW   S   PRG++CM+H
Sbjct  7     LLTETEIHYWGKTPEEEYYKQQGIRASHSFYTSPRGLSLFTRSWLSSSTTPPRGILCMVH  66

Query  1169  GYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSAR  990
             GY ++ SW F+  A+ +A+ G   + ID+ GHG S+G + ++P +D VV DC    +S +
Sbjct  67    GYGNDISWTFQSTAIFLAQKGFACFGIDIEGHGRSQGLKAYVPNVDLVVQDCNFFFNSIK  126

Query  989   AHHPK---LPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFL  819
                P+   LP+FLYGES+GGAI +LI L     ++G IL  PMC +S+  KP WP+ E L
Sbjct  127   -QDPQFHGLPSFLYGESMGGAICLLIHLANPRGFDGAILVAPMCKISEAMKPRWPIPEIL  185

Query  818   PLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQ  639
                A F P W I+ T     +S +   KK +   +P R+   +P   T +ELL+V  Y+ 
Sbjct  186   SFVAKFFPTWAIVPTADVLSKSIKVEKKKPIGEMNPMRY-RGKPRLGTVVELLRVTDYLS  244

Query  638   NNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVE  462
                 ++ +P ++L G  D V D N  +A+++ + S DKT+KI+ GM H L+ GE +E+++
Sbjct  245   QRLCDVSIPFMVLHGNADVVTDPNVSRALYEESQSNDKTIKIYDGMMHSLLFGETDENIQ  304

Query  461   LVFNTTLSWIQMR  423
             +V N   SW+  R
Sbjct  305   IVRNDISSWLNCR  317



>emb|CDO99600.1| unnamed protein product [Coffea canephora]
Length=318

 Score =   209 bits (533),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 114/305 (37%), Positives = 178/305 (58%), Gaps = 6/305 (2%)
 Frame = -1

Query  1322  YGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWL  1143
             +G    +E++  H I   + F  +     +FT+SW   + ++PRGV+ M+HGY ++ SW 
Sbjct  16    WGTTPEDEYFDLHGIKSTKSFYTSPRGVTLFTKSWLPPN-NQPRGVIFMVHGYGNDISWT  74

Query  1142  FELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHHP---KL  972
             F+   + +A+ G   +A+DL GHG SEG + ++P +D VV DC+   +   + +P    L
Sbjct  75    FQATTIFLAQNGYACFAVDLEGHGKSEGLKAYVPNVDLVVDDCLSFFNFILSQNPTFQNL  134

Query  971   PAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPN  792
             P FLYGES+GGAI +LI      ++NG IL  PMC +S+K +P WP+ E L + A FAP 
Sbjct  135   PKFLYGESMGGAICLLIHFKIPTLFNGAILIAPMCKISEKVRPRWPIPEILTIVARFAPT  194

Query  791   WRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVP  612
               I+ T     +S +   KK     +P+R+ N +P   T LELL+V  YI +   ++ +P
Sbjct  195   LPIVPTADLIEKSVKVPEKKITAVSNPSRY-NGKPRLGTVLELLRVTAYINSRLSDVNLP  253

Query  611   LLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSW  435
              L+L G  D V D      +++ A SKD+T+KI+ GM H L+ GEP+E++E+V    L W
Sbjct  254   FLVLHGSADVVTDPQVSMELYELANSKDRTIKIYDGMLHSLLYGEPDENIEIVRGDILKW  313

Query  434   IQMRA  420
             +  R+
Sbjct  314   LNDRS  318



>ref|XP_002889847.1| hydrolase, alpha/beta fold family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH66106.1| hydrolase, alpha/beta fold family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=323

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/309 (36%), Positives = 185/309 (60%), Gaps = 6/309 (2%)
 Frame = -1

Query  1337  NETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTS  1158
              E + +G+ S E+++    II  + F  +     +FT+SW   S   PRG++ M+HGY +
Sbjct  8     TEMNFWGETSEEDYFNLKGIIGSKSFFTSPRGLNLFTRSWLPSSSSPPRGLIFMVHGYGN  67

Query  1157  ESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHHP  978
             + SW F+   + +A+ G   +A+D+ GHG S+G R ++P +D VV D I   +S +  +P
Sbjct  68    DVSWTFQSTPIFLAQMGFACFALDIEGHGRSDGVRAYVPSVDLVVDDIISFFNSIK-QNP  126

Query  977   K---LPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAA  807
             K   LP FL+GES+GGAI +LI       ++G +L  PMC +S K +P WP+++FL + +
Sbjct  127   KFQGLPRFLFGESMGGAICLLIHFADPVGFDGAVLVAPMCKISDKVRPKWPIDQFLIMIS  186

Query  806   FFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCH  627
              F P W I+ T+    +S +   KK +  ++P R+ NE+P   T +ELL+V  Y+ N   
Sbjct  187   RFLPTWAIVPTEDLLEKSIKVEEKKPIAKRNPMRY-NEKPRLGTVMELLRVTDYLGNKLK  245

Query  626   ELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQ-LIGEPNESVELVFN  450
             ++ +P +++ G  D V D +  + +++ A SKDKTLKI+ GM H  L GEP++++E+V  
Sbjct  246   DVSIPFIVVHGSADAVTDPDVSRELYEHAKSKDKTLKIYEGMMHSMLFGEPDDNIEIVRK  305

Query  449   TTLSWIQMR  423
               +SW+  R
Sbjct  306   DIVSWLNDR  314



>ref|XP_010686578.1| PREDICTED: caffeoylshikimate esterase [Beta vulgaris subsp. vulgaris]
Length=308

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 115/305 (38%), Positives = 177/305 (58%), Gaps = 6/305 (2%)
 Frame = -1

Query  1334  ETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSE  1155
             ET  +G    EE+Y +  I   + +  + + + +FT+SW   S   PRG +CM+HGY ++
Sbjct  7     ETHFWGTTPEEEYYTQQGIKSTKSYYTSPSGQTLFTRSWIPLS--PPRGNICMVHGYGND  64

Query  1154  SSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHHPK  975
              SW F+   + +A+ G   +A+DLPGHG S+G +  +P +D VV  CI   +S       
Sbjct  65    ISWTFQSTPIFLAQNGFSCFALDLPGHGQSDGLKAFVPNVDEVVDSCISFFNSIPFQ--S  122

Query  974   LPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAP  795
             LP FL+GES+GGAI +LI L   + + G IL  PMC +S K KP WP+ E L L   F P
Sbjct  123   LPTFLFGESMGGAICLLISLKNPNFFKGAILIAPMCKISDKVKPSWPIPEILTLVGKFMP  182

Query  794   NWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEV  615
                I+ +     +S +   KK +   +P R+ N +P   T +ELL+V  Y+ +  +++ +
Sbjct  183   TLPIVPSPDLLDKSVKVAEKKAIAVMNPLRY-NGKPRLGTVIELLRVTDYLSSKLNDVTI  241

Query  614   PLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLS  438
             P ++L G  D V D N   A+++ A SKDKT+KI+ GM H L+ GE +E+++LV N  L+
Sbjct  242   PFVVLHGSSDVVTDPNVSIALYEEAKSKDKTIKIYEGMLHSLLFGETDENIKLVRNDILA  301

Query  437   WIQMR  423
             W+  R
Sbjct  302   WLSDR  306



>ref|XP_006343251.1| PREDICTED: caffeoylshikimate esterase-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006343252.1| PREDICTED: caffeoylshikimate esterase-like isoform X2 [Solanum 
tuberosum]
Length=317

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/304 (37%), Positives = 178/304 (59%), Gaps = 5/304 (2%)
 Frame = -1

Query  1322  YGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWL  1143
             +G+   E++Y    I   + F  +     +FT+SW   +   P+G++ M+HGY +++SW 
Sbjct  14    WGNTPEEDYYTLQGIKSTKSFFTSPRGLTLFTRSWLPPTKTPPKGIIFMVHGYGNDTSWT  73

Query  1142  FELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHHPK---L  972
             F+   + +AK G   +A+DL GHG S+G + ++P +D V+ DC+   +     +P+   L
Sbjct  74    FQATPIHLAKKGFACFALDLEGHGQSQGLKAYVPNLDLVIDDCLSFFNFVLTQNPEFQDL  133

Query  971   PAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPN  792
             P FL+GES+GGAI +LI   +   +NG IL  PMC +S K KPIWP+ +FL L A FAP 
Sbjct  134   PKFLFGESMGGAICLLIHFIRPKEFNGGILIAPMCKISDKVKPIWPVAQFLTLVARFAPT  193

Query  791   WRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVP  612
               ++ T     +S +   K+ +  ++PNR+   +P   T LELL+V  Y+ +   ++ +P
Sbjct  194   LAVVPTTDLLEKSVKVPEKRIIGGRNPNRYVG-KPRLGTVLELLRVTDYVSSKLCDVNMP  252

Query  611   LLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSW  435
              L+L G  D V D    + ++K A S DKTLKI+ GM H L+ GE +E+VE+V    L+W
Sbjct  253   FLVLHGSADVVTDPEVSRELYKLAKSTDKTLKIYDGMMHSLLFGETDENVEIVRGDILAW  312

Query  434   IQMR  423
             +  R
Sbjct  313   LNDR  316



>ref|XP_010533890.1| PREDICTED: caffeoylshikimate esterase [Tarenaya hassleriana]
Length=323

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 115/304 (38%), Positives = 178/304 (59%), Gaps = 7/304 (2%)
 Frame = -1

Query  1322  YGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWL  1143
             +GD   +E+Y    +I    F  +     +FT+SW   S D PR ++ M+HGY ++ SW 
Sbjct  16    WGDTPEDEYYNLKGVIGSNSFFNSPRGLNLFTRSWLPIS-DPPRALIFMVHGYGNDVSWT  74

Query  1142  FELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHHPK---L  972
             F+  A+ +A+ G   +A+DL GHG S+G RG++P ID V+ DC+   DS +   PK   L
Sbjct  75    FQATAIFLAQMGFACFALDLEGHGRSDGVRGYVPSIDAVIGDCVSFFDSIK-RDPKFQGL  133

Query  971   PAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPN  792
             P FL+GES+GGA+ +LI       + G +L  PMC +S K +P WP+++ L L + F P 
Sbjct  134   PRFLHGESMGGAMCLLIHFADTLGFEGAVLVAPMCKISDKVRPRWPIDQILILMSRFLPT  193

Query  791   WRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVP  612
             W I+ T+    +S +   KK + AK+P R+   +P   T +ELL+V  Y+     ++ +P
Sbjct  194   WAIVPTEDLLEKSIKVEEKKPIAAKNPMRY-RGKPRLGTVMELLRVTDYLGEKLKDVSIP  252

Query  611   LLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQ-LIGEPNESVELVFNTTLSW  435
              ++L G  D V D    +A+++ A SKDKTLKI+ GM H  L GEP+E++ +V N  + W
Sbjct  253   FIVLHGSADVVTDPEVSRALYEEAKSKDKTLKIYEGMLHSMLFGEPDENIAIVRNDIVGW  312

Query  434   IQMR  423
             +  R
Sbjct  313   LNDR  316



>ref|XP_004234129.1| PREDICTED: caffeoylshikimate esterase [Solanum lycopersicum]
Length=317

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/304 (37%), Positives = 176/304 (58%), Gaps = 5/304 (2%)
 Frame = -1

Query  1322  YGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWL  1143
             +G+ S E++Y    I   + F  +     +FT+SW   +   P+G++ MIHGY ++ SW 
Sbjct  14    WGNTSEEDYYTLQGIKSTKSFFTSSRDLTLFTRSWLPPTKTPPKGIIFMIHGYGNDISWT  73

Query  1142  FELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLD---SARAHHPKL  972
             F+   + +AK G   +A+DL GHG S+G + ++P +D V+ DC+       +       L
Sbjct  74    FQATPIHLAKKGFACFALDLEGHGQSQGLKAYVPNLDLVIDDCLSFFSFVLTQNTEFQDL  133

Query  971   PAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPN  792
             P FL+GES+GGAI +LI L +   +NG IL  PMC +S K KPIWP+ +FL L A FAP 
Sbjct  134   PKFLFGESMGGAICVLIHLKRPKEFNGGILIAPMCKISDKVKPIWPIAQFLTLVARFAPT  193

Query  791   WRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVP  612
               ++ T     +S +   K+ +  ++PNR+   +P   T +ELL+V  Y+ +   ++ +P
Sbjct  194   LAVVPTADLLEKSVKVPEKRIIGGRNPNRYFG-KPRLGTVVELLRVTDYVSSKLCDVIMP  252

Query  611   LLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSW  435
              L+L G  D V D    + ++K A S DKTLKI+ GM H L+ GE +E+VE+V    L+W
Sbjct  253   FLVLHGSADVVTDPEVSRELYKLAKSTDKTLKIYDGMMHSLLFGETDENVEIVRGDILAW  312

Query  434   IQMR  423
             +  R
Sbjct  313   LNDR  316



>ref|XP_010475999.1| PREDICTED: caffeoylshikimate esterase-like [Camelina sativa]
Length=323

 Score =   206 bits (525),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 109/317 (34%), Positives = 184/317 (58%), Gaps = 6/317 (2%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M+    +  E + +G+ S E+++    II  + F  +     +FT+SW   +   PRG++
Sbjct  1     MSDQQLETTEINFWGETSEEDYFNHKGIIGSKSFFTSPRGLNLFTRSWLPSASSPPRGLI  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              M+HGY ++ SW F+   + +A+ G   +A+D+ GHG S+G R ++P +D VV D I   
Sbjct  61    FMVHGYGNDVSWTFQSTPIFLAQMGFACFALDIEGHGRSDGVRAYVPSVDLVVDDIISFF  120

Query  1001  DSARAHHPK---LPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPL  831
              S +  +PK   LP FL+GES+GGAI +LI       ++G +L  PMC +S K +P WP+
Sbjct  121   ISIK-QNPKYHGLPRFLFGESMGGAICLLIHFADPLGFDGAVLVAPMCKISDKVRPKWPI  179

Query  830   EEFLPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVC  651
             ++FL + + F P W I+ T+    +S +   KK +  ++P R+  E+P   T +ELL+V 
Sbjct  180   DQFLIMISRFLPTWAIVPTEDLLEKSIKVEEKKPIAKRNPMRY-GEKPRLGTVMELLRVT  238

Query  650   KYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQ-LIGEPN  474
              Y+     ++ +P +++ G  D V D    + +++ A SKDKTLKI+ GM H  L GEP+
Sbjct  239   DYLGKKLKDVSIPFIVVHGSADVVTDPEVSRELYEDAKSKDKTLKIYQGMMHSMLFGEPD  298

Query  473   ESVELVFNTTLSWIQMR  423
             +++++V    +SW+  R
Sbjct  299   DNIDIVRKDIVSWLNDR  315



>ref|XP_009610353.1| PREDICTED: caffeoylshikimate esterase [Nicotiana tomentosiformis]
Length=321

 Score =   206 bits (525),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 112/300 (37%), Positives = 176/300 (59%), Gaps = 5/300 (2%)
 Frame = -1

Query  1310  SREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELN  1131
             + +++Y    I   + F  ++    +FT+SW   +   PRG++ M+HGY ++ SW F+  
Sbjct  22    TEQDYYNLQGIKSTKSFFTSQRNLTLFTRSWLPSAKTPPRGIIFMVHGYGNDISWTFQAT  81

Query  1130  AVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHHPK---LPAFL  960
              + +AK G   +A+DL GHG S+G + ++P ++ V+ DC+         +P+   LP FL
Sbjct  82    PIHLAKNGFACFALDLEGHGQSQGLKAYVPNVNFVIDDCLSFFKFVLTQNPEFQDLPKFL  141

Query  959   YGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRII  780
             YGES+GGAI +LI L    ++NG IL  PMC +S K +P WP+ +FL + A FAP   I+
Sbjct  142   YGESMGGAICLLIHLKSPSMFNGAILIAPMCKISDKVRPRWPIPQFLTILARFAPTLAIV  201

Query  779   FTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLIL  600
              T     +S +   KK +   +PNR+   +P   T LELL+V  Y+ +   ++ +P LIL
Sbjct  202   PTADLLDKSVKVPEKKIIGGMNPNRYFG-KPRLGTVLELLRVTDYVSSKLCDVNLPFLIL  260

Query  599   QGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMR  423
              G  D V D    + +++ A SKDKTLKI+ GM H L+ GE +E+VE+V +  L+W+  R
Sbjct  261   HGSADVVTDPEVSRELYQLAKSKDKTLKIYEGMMHSLLFGETDENVEIVRSDILAWLNDR  320



>ref|NP_172576.1| alpha/beta-hydrolase-like protein [Arabidopsis thaliana]
 gb|AAB65474.1| lysophospholipase isolog; 25331-24357 [Arabidopsis thaliana]
 dbj|BAC42367.1| putative lysophospholipase isolog [Arabidopsis thaliana]
 gb|AAP68220.1| At1g11090 [Arabidopsis thaliana]
 gb|AEE28682.1| alpha/beta-hydrolase-like protein [Arabidopsis thaliana]
Length=324

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 112/309 (36%), Positives = 183/309 (59%), Gaps = 6/309 (2%)
 Frame = -1

Query  1337  NETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTS  1158
              E + +G+ S E+++    II  + F  +     +FT+SW   S   PRG++ M+HGY +
Sbjct  8     TEINFWGETSEEDYFNLKGIIGSKSFFTSPRGLNLFTRSWLPSSSSPPRGLIFMVHGYGN  67

Query  1157  ESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHHP  978
             + SW F+   + +A+ G   +A+D+ GHG S+G R ++P +D VV D I   +S +  +P
Sbjct  68    DVSWTFQSTPIFLAQMGFACFALDIEGHGRSDGVRAYVPSVDLVVDDIISFFNSIK-QNP  126

Query  977   K---LPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAA  807
             K   LP FL+GES+GGAI +LI       ++G +L  PMC +S K +P WP+++FL + +
Sbjct  127   KFQGLPRFLFGESMGGAICLLIQFADPLGFDGAVLVAPMCKISDKVRPKWPVDQFLIMIS  186

Query  806   FFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCH  627
              F P W I+ T+    +S +   KK +  ++P R+ NE+P   T +ELL+V  Y+     
Sbjct  187   RFLPTWAIVPTEDLLEKSIKVEEKKPIAKRNPMRY-NEKPRLGTVMELLRVTDYLGKKLK  245

Query  626   ELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQ-LIGEPNESVELVFN  450
             ++ +P +I+ G  D V D    + +++ A SKDKTLKI+ GM H  L GEP++++E+V  
Sbjct  246   DVSIPFIIVHGSADAVTDPEVSRELYEHAKSKDKTLKIYDGMMHSMLFGEPDDNIEIVRK  305

Query  449   TTLSWIQMR  423
               +SW+  R
Sbjct  306   DIVSWLNDR  314



>ref|NP_001130084.1| hypothetical protein [Zea mays]
 ref|XP_008666998.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008666999.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF78208.1| unknown [Zea mays]
 gb|ACL52908.1| unknown [Zea mays]
 tpg|DAA41128.1| TPA: hypothetical protein ZEAMMB73_741871 [Zea mays]
Length=334

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 115/314 (37%), Positives = 178/314 (57%), Gaps = 7/314 (2%)
 Frame = -1

Query  1310  SREEFYKKHHIIHKEGFVL--NENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFE  1137
             +  EFY  H    +  +    +   +++FT++W+  + + PR +V M+HGY ++ SW F+
Sbjct  21    TEAEFYSAHGTEGESSYFTTPDAGARRLFTRAWRPRAPERPRALVFMVHGYGNDISWTFQ  80

Query  1136  LNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAH--HPKLPAF  963
               AV +A++G   +A DLPGHG S G R  +P +D  V D +    + RA   H  LP F
Sbjct  81    STAVFLARSGFACFAADLPGHGRSHGLRAFVPDLDAAVADLLAFFRAVRAREEHAGLPCF  140

Query  962   LYGESLGGAIAILICLNQK-HVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWR  786
             L+GES+GGAI +LI L  +   W G +L  PMC +S + +P WPL E L   A FAP   
Sbjct  141   LFGESMGGAICLLIHLRTRPEEWAGAVLVAPMCRISDRIRPPWPLPEILTFVARFAPTAA  200

Query  785   IIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLL  606
             I+ T     +S +   K+ + A++P R+ N RP   T +ELL+    +     E+ +P L
Sbjct  201   IVPTADLIEKSVKVPAKRIVAARNPVRY-NGRPRLGTVVELLRATDELAKRLGEVSIPFL  259

Query  605   ILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQ  429
             ++ G  D+V D    +A++ +AASKDKT+KI+ GM H L+ GEP+E++E V    L+W+ 
Sbjct  260   VVHGSTDEVTDPEVSRALYAAAASKDKTIKIYDGMLHSLLFGEPDENIERVRGDILAWLN  319

Query  428   MRANLARAHKF*PI  387
              R      H+  P+
Sbjct  320   ERCTAQATHRNIPV  333



>ref|XP_009782580.1| PREDICTED: caffeoylshikimate esterase [Nicotiana sylvestris]
Length=321

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/300 (37%), Positives = 176/300 (59%), Gaps = 5/300 (2%)
 Frame = -1

Query  1310  SREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELN  1131
             + +++Y    I   + F  +     +FT+SW   + + PRG++ M+HGY ++ SW F+  
Sbjct  22    TEQDYYNLQGIKSTKSFFTSPRNLTLFTRSWLPSAKNPPRGIIFMVHGYGNDISWTFQAT  81

Query  1130  AVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHHPK---LPAFL  960
              + +AK G   +A+DL GHG S+G + ++P ++ V+ DC+   +     +P+   LP FL
Sbjct  82    PIHLAKNGFACFALDLEGHGQSQGLKAYVPNVNFVIDDCLSFYNFVLTQNPEFQDLPKFL  141

Query  959   YGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRII  780
             YGES+GGAI +LI L    ++NG IL  PMC +S K +P WP+ +FL + A FAP   I+
Sbjct  142   YGESMGGAICLLIHLKSPSMFNGAILIAPMCKISDKVRPRWPIPQFLTILARFAPTLAIV  201

Query  779   FTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLIL  600
              T     +S +   KK +   +PNR+   +P   T LELL+V  Y+ +   ++ +P LIL
Sbjct  202   PTADLLDKSVKVPEKKIIGGMNPNRYVG-KPRLGTVLELLRVTDYVSSKLCDVNLPFLIL  260

Query  599   QGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMR  423
              G  D V D    + +++ A  KDKTLKI+ GM H L+ GE +E+VE+V +  L+W+  R
Sbjct  261   HGSADVVTDPEVSRELYQLAKCKDKTLKIYEGMMHSLLFGETDENVEIVRSDILAWLNDR  320



>ref|XP_011096267.1| PREDICTED: caffeoylshikimate esterase [Sesamum indicum]
Length=330

 Score =   204 bits (520),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 108/307 (35%), Positives = 174/307 (57%), Gaps = 5/307 (2%)
 Frame = -1

Query  1322  YGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWL  1143
             +G+   EE+YK+  I     +  +     +FT+SWQ    + PRG++CM+HGY ++ SW 
Sbjct  15    WGNTPEEEYYKEQGIKSSNSYYTSPRGLTLFTRSWQPLQSEPPRGIICMVHGYGNDISWT  74

Query  1142  FELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCIL---CLDSARAHHPKL  972
             F+  A+ +A+ G   +A+DL GHG S G + ++P +D VV DCI    C+ +   + P L
Sbjct  75    FQGTAIFLAQNGFACFALDLEGHGRSRGLKAYVPNVDLVVDDCISFFNCILTQDPNFPNL  134

Query  971   PAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPN  792
             P FL+GES+GGAI +LI   Q   + G +L  PMC +S K +P WP+ + L   A  AP 
Sbjct  135   PRFLFGESMGGAICLLIHFKQPEFFRGAVLIAPMCRISDKVRPKWPIPQILTAVAGIAPT  194

Query  791   WRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVP  612
               I+ T     +S +   KK +   +P R+   +P   T LELL+V  Y+ +   ++ +P
Sbjct  195   LPIVPTADLLEKSVKVPEKKIIGVMNPMRY-QGKPRLGTVLELLRVTDYVSSKLSDVSIP  253

Query  611   LLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSW  435
              +++ G  D V D    + +++ A S+DK++KI+ GM H L+ GE +E+V +V    L W
Sbjct  254   FIVIHGSADVVTDPAVSRELYQVAKSEDKSIKIYEGMMHSLLFGETDENVAIVRGDILKW  313

Query  434   IQMRANL  414
             +  R + 
Sbjct  314   LNDRCSF  320



>ref|XP_010492320.1| PREDICTED: caffeoylshikimate esterase-like [Camelina sativa]
Length=323

 Score =   204 bits (519),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 109/324 (34%), Positives = 187/324 (58%), Gaps = 6/324 (2%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M+    +  E + +G+ S E+++    II  + F  +     +FT+SW   S   PRG++
Sbjct  1     MSDQQLETTEINFWGETSEEDYFNLKGIIGSKSFFTSPRGLNLFTRSWLPSSSSPPRGLI  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              M+HGY ++ SW F+   + +A+ G   +A+D+ GHG S+G R ++P +D +V D I   
Sbjct  61    FMVHGYGNDVSWTFQSTPIFLAQMGFACFALDIEGHGRSDGVRAYVPSVDLIVDDIISFF  120

Query  1001  DSARAHHPK---LPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPL  831
             +S +  +PK   LP FL+GES+GGAI +LI       ++G +L  PMC +S K +P WP+
Sbjct  121   NSIK-QNPKYHGLPRFLFGESMGGAICLLIHFADPLGFDGAVLVAPMCKISDKVRPKWPI  179

Query  830   EEFLPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVC  651
             ++FL + + F P W I+ T+    +S +   KK +  ++P R+  E+P   T +ELL+V 
Sbjct  180   DQFLIMISRFLPTWAIVPTEDLLEKSIKVEEKKPIAKRNPMRY-GEKPRLGTVMELLRVT  238

Query  650   KYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQ-LIGEPN  474
              Y+     ++ +P +++ G  D V D    + +++ A SKDKTLKI+ GM H  L GEP+
Sbjct  239   DYLGKKLKDVSIPFIVVHGSADVVTDPEVSRELYEDAKSKDKTLKIYQGMMHSMLFGEPD  298

Query  473   ESVELVFNTTLSWIQMRANLARAH  402
             +++++V    ++W+  R    + H
Sbjct  299   DNIDIVRKDIVTWLNDRCAGDKTH  322



>ref|XP_010458490.1| PREDICTED: caffeoylshikimate esterase-like [Camelina sativa]
Length=323

 Score =   204 bits (518),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 110/317 (35%), Positives = 185/317 (58%), Gaps = 6/317 (2%)
 Frame = -1

Query  1361  MAHPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVV  1182
             M+    +  E + +G+ S E+++    II  + F  +     +FT+SW   S   PRG++
Sbjct  1     MSDQQLETTEINFWGETSEEDYFNLKGIIGSKSFFTSPRGLNLFTRSWLPSSSSPPRGLI  60

Query  1181  CMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCL  1002
              M+HGY ++ SW F+   + +A+ G   +A+D+ GHG S+G R ++P +D VV D I   
Sbjct  61    FMVHGYGNDVSWTFQSTPIFLAQMGFACFALDIEGHGRSDGVRAYVPSVDLVVDDIISFF  120

Query  1001  DSARAHHPK---LPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPL  831
             +S +  +PK   LP FL+GES+GGAI +LI       ++G +L  PMC +S K +P WP+
Sbjct  121   NSIK-QNPKYHGLPRFLFGESMGGAICLLIHFADPLGFDGAVLVAPMCKISDKVRPKWPI  179

Query  830   EEFLPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVC  651
             ++FL + + F P W I+ T+    +S +   KK +  ++P R+  E+P   T +ELL+V 
Sbjct  180   DQFLIMISRFLPTWAIVPTEDLLEKSIKVEEKKPIAKRNPMRY-GEKPRLGTVMELLRVT  238

Query  650   KYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQ-LIGEPN  474
              Y+     ++ +P +++ G  D V D    + +++ A SKDKTLKI+ GM H  L GEP+
Sbjct  239   DYLGKKLKDVSIPFIVVHGSADVVTDPEVSRELYEDAKSKDKTLKIYQGMMHSMLFGEPD  298

Query  473   ESVELVFNTTLSWIQMR  423
             +++++V    +SW+  R
Sbjct  299   DNIDIVRKDIVSWLNDR  315



>ref|XP_006303706.1| hypothetical protein CARUB_v10011807mg [Capsella rubella]
 gb|EOA36604.1| hypothetical protein CARUB_v10011807mg [Capsella rubella]
Length=322

 Score =   202 bits (514),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 109/316 (34%), Positives = 183/316 (58%), Gaps = 6/316 (2%)
 Frame = -1

Query  1337  NETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTS  1158
              E + +G+ S E+++    II  + F  +     +FT+SW   S   PR ++ M+HGY +
Sbjct  8     TEINFWGETSEEDYFNLKGIIGSKSFFTSPRGLNLFTRSWLPSSSSPPRALIFMVHGYGN  67

Query  1157  ESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHHP  978
             + SW F+   + +A+ G   +A+D+ GHG S+G R ++P +D VV D I   +S +  +P
Sbjct  68    DVSWTFQSTPIFLAQMGFACFALDIEGHGRSDGVRAYVPSVDLVVDDIISFFNSIK-QNP  126

Query  977   K---LPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAA  807
             +   LP FL+GES+GGAI +LI       ++G +L  PMC +S K +P WP+++FL + +
Sbjct  127   QFRGLPRFLFGESMGGAICLLIHFADPSGFDGAVLVAPMCRISDKVRPKWPIDQFLIMIS  186

Query  806   FFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCH  627
              F P W I+ T+    +S +   KK +  ++P R+  E+P   T +ELL+V  Y+     
Sbjct  187   RFLPTWAIVPTEDLLEKSIKVEEKKPIAKRNPMRY-GEKPRLGTVMELLRVTDYLGKKLK  245

Query  626   ELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQ-LIGEPNESVELVFN  450
             ++ +P +++ G  D V D    + +++ A SKDKTLKI+ GM H  L GEP++++E+V  
Sbjct  246   DVSIPFIVVHGSADAVTDPEVSRELYEVAKSKDKTLKIYQGMMHSMLFGEPDDNIEIVRK  305

Query  449   TTLSWIQMRANLARAH  402
               +SW+  R    + H
Sbjct  306   DIVSWLNDRCGGDKTH  321



>ref|XP_006467849.1| PREDICTED: caffeoylshikimate esterase-like [Citrus sinensis]
 gb|KDO75845.1| hypothetical protein CISIN_1g021066mg [Citrus sinensis]
Length=317

 Score =   201 bits (511),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 112/305 (37%), Positives = 180/305 (59%), Gaps = 5/305 (2%)
 Frame = -1

Query  1322  YGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWL  1143
             +G+   EE+Y +  I   + +  +     +FT+SW   +   PRG++CM+HGY ++ SW 
Sbjct  15    WGNTPEEEYYNQQGIRTTQSYHTSPRGLTLFTRSWLPINT-PPRGILCMVHGYGNDISWT  73

Query  1142  FELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAH--HPKLP  969
             F+  +V +A+ G   +A+DL GHG S+G + ++P +D VV DC+   +S +       LP
Sbjct  74    FQGISVFLAQMGFACFALDLEGHGKSQGLKAYVPNVDLVVQDCLSYFNSVKQDPSFNGLP  133

Query  968   AFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNW  789
              FLYGES+GGAI +LI     + ++G IL  PMC +S K KP WP+ + L L A F P  
Sbjct  134   CFLYGESMGGAICLLIHFADPNGFDGAILVAPMCKISDKVKPRWPIPQILSLIARFFPTL  193

Query  788   RIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPL  609
              I+ T+    +S +   KK +   +P+R+   +P   T +ELL+V  Y+    +++ +P 
Sbjct  194   PIVPTQDLLSKSIKVEEKKIIADLNPHRY-RGKPRLGTVVELLRVTDYLSERLYDVSIPF  252

Query  608   LILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWI  432
             ++L G  D V D +  +A+++ A S DKT+KI+ GM H L+ GE +E++E+V N  LSW+
Sbjct  253   IVLHGNADVVTDPSVSEALYEEARSSDKTIKIYDGMLHSLLFGETDENIEIVRNDILSWL  312

Query  431   QMRAN  417
               R N
Sbjct  313   NGRCN  317



>ref|XP_002463034.1| hypothetical protein SORBIDRAFT_02g036570 [Sorghum bicolor]
 gb|EER99555.1| hypothetical protein SORBIDRAFT_02g036570 [Sorghum bicolor]
Length=338

 Score =   201 bits (512),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 113/302 (37%), Positives = 174/302 (58%), Gaps = 7/302 (2%)
 Frame = -1

Query  1310  SREEFYKKHHIIHKEGFVL--NENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFE  1137
             +  EFY  H    +  +    +   +++FT++W+  + + PR +V M+HGY ++ SW F+
Sbjct  23    TEAEFYAAHGAEGEPSYFTTPDAGARRLFTRAWRPRAPERPRALVFMVHGYGNDVSWTFQ  82

Query  1136  LNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAH--HPKLPAF  963
               AV +A++G   +A DLPGHG S G R  +P +D  V D +    + RA   H  LP F
Sbjct  83    STAVFLARSGFACFAADLPGHGRSHGLRAFVPDLDAAVADLLAFFRAVRAREEHAGLPCF  142

Query  962   LYGESLGGAIAILICLNQK-HVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWR  786
             L+GES+GGAI +LI L  +   W G +L  PMC +S + +P WPL E L   A FAP   
Sbjct  143   LFGESMGGAICLLIHLRTRPEEWAGAVLVAPMCRISDRIRPPWPLPEILTFVARFAPTAA  202

Query  785   IIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLL  606
             I+ T     +S +   K+ + A++P R+ N RP   T +ELL+    +     E+ +P L
Sbjct  203   IVPTADLIEKSVKVPAKRIVAARNPVRY-NGRPRLGTVVELLRATDELGKRLGEVSIPFL  261

Query  605   ILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQ  429
             ++ G  D+V D    +A++ +AASKDKT+KI+ GM H L+ GEP+E++E V    L+W+ 
Sbjct  262   VVHGSADEVTDPEVSRALYAAAASKDKTIKIYDGMLHSLLFGEPDENIERVRGDILAWLN  321

Query  428   MR  423
              R
Sbjct  322   ER  323



>ref|XP_001760039.1| predicted protein [Physcomitrella patens]
 gb|EDQ75164.1| predicted protein [Physcomitrella patens]
Length=333

 Score =   201 bits (510),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 114/312 (37%), Positives = 177/312 (57%), Gaps = 7/312 (2%)
 Frame = -1

Query  1343  QANETSPY--GDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIH  1170
              A ET P+  G    EE+Y   +I H+  F        +FTQSW   S   P+ ++ M+H
Sbjct  11    SATETPPFPWGHTPEEEYYASKNITHQSEFTKFPRGVSLFTQSWV-PSNRPPKALILMVH  69

Query  1169  GYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSA-  993
             GY ++SSW+F+  A+   + G   +A+DL GHG SEG  G+IP +D +V DC    +S  
Sbjct  70    GYGNDSSWVFQNTAILFTEMGYAAFALDLYGHGRSEGLLGYIPGVDNLVEDCAFYFNSVK  129

Query  992   -RAHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLP  816
              RA +  LP FLYGESLGGA+ +L+       ++G IL  PMC +S+K  P WP+E  L 
Sbjct  130   NRAAYQNLPRFLYGESLGGALCLLLHFENPTGYDGAILMAPMCKISEKMVPPWPVEYALR  189

Query  815   LAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQN  636
               A +AP   ++ T     +S ++  K+ L   +P+R+   +P   T +ELL+V   ++ 
Sbjct  190   FIARWAPTLPVVPTTDLVDKSVKDPAKRILAKNNPHRYAG-KPRLGTVIELLRVTASLEE  248

Query  635   NCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVEL  459
                ++ +P ++L G  D V +      ++++A S+DKTL+I+ GM H LI GEP+E+V +
Sbjct  249   KLKDVSLPFIVLHGNADVVTEPAVSTFLYETAKSEDKTLRIYEGMLHSLIQGEPDENVAI  308

Query  458   VFNTTLSWIQMR  423
             + N   SW+  R
Sbjct  309   ILNDISSWLDER  320



>ref|XP_006449284.1| hypothetical protein CICLE_v10017806mg [Citrus clementina]
 gb|ESR62524.1| hypothetical protein CICLE_v10017806mg [Citrus clementina]
Length=336

 Score =   201 bits (510),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 112/318 (35%), Positives = 184/318 (58%), Gaps = 5/318 (2%)
 Frame = -1

Query  1322  YGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWL  1143
             +G+   EE+Y +  I   + +  +     +FT+SW   +   PRG++CM+HGY ++ SW 
Sbjct  15    WGNTPEEEYYNQQGIRSTQSYHTSPRGLTLFTRSWLPINT-PPRGILCMVHGYGNDISWT  73

Query  1142  FELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAH--HPKLP  969
             F+  +V +A+ G   +A+D+ GHG S+G + ++P +D VV DC+   +S +       LP
Sbjct  74    FQGISVFLAQMGFACFALDIEGHGKSQGLKAYVPNVDLVVQDCLSYFNSVKQDPSFNGLP  133

Query  968   AFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNW  789
              FLYGES+GGAI +LI     + ++G IL  PMC +S K KP WP+ + L L A F P  
Sbjct  134   CFLYGESMGGAICLLIHFADPNGFDGAILVAPMCKISDKVKPRWPIPQILSLIARFFPTL  193

Query  788   RIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPL  609
              I+ T+    +S +   KK +   +P+R+   +P   T +ELL+V  Y+    +++ +P 
Sbjct  194   PIVPTQDLLSKSIKVEEKKIIADLNPHRY-RGKPRLGTVVELLRVTDYLSERLYDVSIPF  252

Query  608   LILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWI  432
             ++L G  D V D +  +A+++ A S DKT+KI+ GM H L+ GE +E++E+V N  LSW+
Sbjct  253   IVLHGNADVVTDPSVSQALYEEARSSDKTIKIYDGMLHSLLFGETDENIEIVRNDILSWL  312

Query  431   QMRANLARAHKF*PIMHR  378
                A      +F  + H+
Sbjct  313   NGVAKCRLGQRFSNLRHK  330



>ref|XP_002521403.1| Monoglyceride lipase, putative [Ricinus communis]
 gb|EEF40893.1| Monoglyceride lipase, putative [Ricinus communis]
Length=323

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 115/304 (38%), Positives = 175/304 (58%), Gaps = 5/304 (2%)
 Frame = -1

Query  1322  YGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWL  1143
             +G    EE+YK+  I        +     +FT+ W  DS   PR ++CM+HGY ++ SW 
Sbjct  16    WGKTPEEEYYKQQGIRASHSSYTSPRGLSLFTRRWFPDSSSPPRSILCMVHGYGNDISWT  75

Query  1142  FELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHHP---KL  972
             F+  A+ +A+ G   + ID+ GHG S+G +G++P +D VV DC+   +  R   P    L
Sbjct  76    FQSTAIFLAQMGFACFGIDIEGHGRSQGLKGYVPNVDLVVQDCLSFFNFVRQEDPILHGL  135

Query  971   PAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPN  792
             P+FLYGES+GGAI +LI L   + ++G IL  PMC ++   KP WP+ E L   A F P 
Sbjct  136   PSFLYGESMGGAICLLIHLANPNGFDGAILVAPMCKIADDMKPRWPIPEVLSFVAKFLPT  195

Query  791   WRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVP  612
               I+ T     +S +   KKK+   +P R+  E+P   T +ELL+V +Y+     ++ +P
Sbjct  196   LAIVPTADVLSKSIKVEKKKKIGQMNPMRY-REKPRLGTVMELLRVTEYLSKRICDVSIP  254

Query  611   LLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSW  435
              ++L G  D V D N  KA+++ A S+DKT+KI+ GM H L+ GE +E++E V    LSW
Sbjct  255   FIVLHGRADVVTDPNVSKALYEEAKSEDKTIKIYDGMMHSLLFGETDENIETVRRDILSW  314

Query  434   IQMR  423
             +  R
Sbjct  315   LNER  318



>ref|XP_011043243.1| PREDICTED: caffeoylshikimate esterase [Populus euphratica]
Length=323

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/314 (35%), Positives = 177/314 (56%), Gaps = 4/314 (1%)
 Frame = -1

Query  1355  HPIFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCM  1176
             +P+ +  E   +G++  +E+YK+  I        +     +FT+SW   S D P GV+CM
Sbjct  5     NPMPRETEVHFWGNIPEDEYYKQQGIKASRSSYTSPRGLSLFTRSWLPISTDPPLGVMCM  64

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS  996
             +HGY ++ SW F+  A+ +A+ G   + +D+ GHG S+G +G++P +D VV DC+   DS
Sbjct  65    VHGYGNDISWTFQSTAIFLAQMGFACFGLDIEGHGKSQGLKGYVPNVDLVVQDCLSFFDS  124

Query  995   AR--AHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEF  822
              +       LP FLYGES+GGA+ +LI L     ++G +L  PMC +S   KP WP+ + 
Sbjct  125   IKNDTKFHGLPFFLYGESMGGALCLLIHLANPKGFDGAVLVAPMCKISDNIKPRWPISDI  184

Query  821   LPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYI  642
             L L A F P   I+       +S +   K  +   +P R+   +P   T +ELL+V  Y+
Sbjct  185   LLLVAKFLPTLAIVPAASILHKSIKVERKVPIAEMNPLRY-RGKPRLGTVVELLRVTDYL  243

Query  641   QNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESV  465
               N   + +P ++L G  D V D    +++++ A S+DKT+KI+ GM H L+ GE +E+V
Sbjct  244   SQNLRNVTIPFIVLHGSMDVVTDPKVSESLYEEANSEDKTIKIYDGMVHSLLFGETDENV  303

Query  464   ELVFNTTLSWIQMR  423
             E+V    +SW+  R
Sbjct  304   EIVRQDIISWLNDR  317



>ref|XP_007025720.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY28342.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=315

 Score =   199 bits (506),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 113/305 (37%), Positives = 178/305 (58%), Gaps = 5/305 (2%)
 Frame = -1

Query  1322  YGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWL  1143
             +G++S E+++K+  I   + F  +     +FT+SW   S   PRGV+  +HGY ++ SW 
Sbjct  10    WGNISEEDYHKQQGIKGSKSFYTSPRGLSLFTRSWLPIS-GTPRGVIFGVHGYGNDMSWT  68

Query  1142  FELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCI--LCLDSARAHHPKLP  969
             F+   + +A+ G   +A+DL GHG S+G RG++P +D VV DC+    L     +   LP
Sbjct  69    FQSTPIFLAQKGFACFALDLEGHGRSQGLRGYVPNVDLVVQDCLSYFNLIKQDPNLDGLP  128

Query  968   AFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNW  789
              FLYGES+GGAI +LI       + G IL  PMC +S K KP WPL + L   A   P  
Sbjct  129   CFLYGESMGGAICLLIHFADPKGFRGAILVSPMCKISDKVKPRWPLPQVLTFIAKLLPTL  188

Query  788   RIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPL  609
              I+ T+    +S +   KK +  K+P R+   +P   T +ELL+V +Y+     ++ +P 
Sbjct  189   AIVPTEDLLYKSVKVEEKKIIGNKNPLRY-RGKPRLGTVVELLRVTEYLSQKLCDVSIPF  247

Query  608   LILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWI  432
             L++ G  D V D    + +++ A+S+DKT+KI+ GMWH L+ GEP++++E+V +  LSW+
Sbjct  248   LVVHGSADVVTDPAVSRTLYEEASSQDKTIKIYEGMWHSLLFGEPDDNIEIVRSDILSWL  307

Query  431   QMRAN  417
               R N
Sbjct  308   NDRCN  312



>ref|XP_009780674.1| PREDICTED: caffeoylshikimate esterase-like isoform X1 [Nicotiana 
sylvestris]
Length=323

 Score =   199 bits (507),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 109/316 (34%), Positives = 181/316 (57%), Gaps = 7/316 (2%)
 Frame = -1

Query  1349  IFQANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEP--RGVVCM  1176
             I Q  +   +G+   EE+Y   +I   + F  +     +FT+SW   +   P  +G++ M
Sbjct  9     INQTQQLHYWGNTPEEEYYTLQNIKSTKSFFTSPRGLSLFTKSWLPKNISSPNYKGIIFM  68

Query  1175  IHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCI---LC  1005
             +HGY ++ SW+F+   + +AK G   +A+D+ GHG S+G + ++P I+ VV DCI   + 
Sbjct  69    VHGYGNDISWIFQETPIFLAKNGFACFALDIEGHGLSQGIKSYVPNINLVVDDCISYFIS  128

Query  1004  LDSARAHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEE  825
             + +  +    LP FL+GES+GGAI++LI      + NG IL  PMC +S+K +P WP+ +
Sbjct  129   ILTKNSEFQNLPKFLFGESMGGAISLLIHFRNNIMLNGAILRAPMCKISEKMRPKWPIPQ  188

Query  824   FLPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKY  645
              L   A F P   I+ T     +S +   K+++   +PN + N +P   T +EL+ V  +
Sbjct  189   ILTFFARFVPTLAIVPTTDLLDKSVKVPEKREIARMNPNGY-NGKPRLGTVVELMHVTDF  247

Query  644   IQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNES  468
             +    +++ +P L+L G  D V D    K +++ A SKDKT+KI+ GM H L+ GE +E+
Sbjct  248   VSTKLYDVSIPFLVLHGSADVVTDPEVSKELYQKAKSKDKTIKIYDGMVHSLLFGETDEN  307

Query  467   VELVFNTTLSWIQMRA  420
             VE+V N  L+W+  R+
Sbjct  308   VEIVRNDMLAWLNDRS  323



>ref|XP_006417390.1| hypothetical protein EUTSA_v10010022mg [Eutrema salsugineum]
 gb|ESQ35743.1| hypothetical protein EUTSA_v10010022mg [Eutrema salsugineum]
Length=392

 Score =   200 bits (509),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 109/299 (36%), Positives = 177/299 (59%), Gaps = 6/299 (2%)
 Frame = -1

Query  1340  ANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYT  1161
             A E + +G+ S E+++    II  + F  +     +FT+SW   S   PRG++ M+HGY 
Sbjct  27    AKEINFWGETSEEDYFNLKGIIGSKSFFTSPRGLNLFTRSWLPSSSSPPRGLIFMVHGYG  86

Query  1160  SESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHH  981
             ++ SW F+   + +A+ G   +A+D+ GHG S+G R ++P +D VV D I   DS +  +
Sbjct  87    NDVSWTFQSTPIFLAQMGFACFALDIEGHGRSDGVRAYVPSVDLVVDDIISFFDSIK-KN  145

Query  980   PK---LPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLA  810
             PK   LP FL+GES+GGAI +L        ++G +L  PMC +S K +P WP+++FL + 
Sbjct  146   PKFHGLPRFLFGESMGGAICLLTHFADPSGFDGAVLVAPMCKISDKVRPKWPIDQFLIMI  205

Query  809   AFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNC  630
             + F P W I+ T+    +S +   KK +  ++P R+  E+P   T +ELL+V  Y+    
Sbjct  206   SRFLPTWAIVPTEDLLEKSIKVEEKKPIAKRNPMRY-GEKPRLGTVMELLRVTDYLGKKL  264

Query  629   HELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQ-LIGEPNESVELV  456
              ++ +P ++L G  D V D    + +++ A SKDKTLKI+ GM H  L GEP++++E+V
Sbjct  265   KDVSIPFIVLHGSADVVTDPEVSRELYQDAKSKDKTLKIYQGMMHSMLFGEPDDNIEIV  323



>ref|XP_010278298.1| PREDICTED: caffeoylshikimate esterase [Nelumbo nucifera]
Length=360

 Score =   199 bits (506),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 113/301 (38%), Positives = 173/301 (57%), Gaps = 5/301 (2%)
 Frame = -1

Query  1310  SREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELN  1131
             S E++YK   I   + F  +     +F +SW   S   PRG+VCM+HGY ++ SW F+  
Sbjct  44    SEEDYYKSKGIRGSKSFYTSPRGLSLFIRSWLPLSS-HPRGIVCMVHGYGNDISWTFQST  102

Query  1130  AVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS--ARAHHPKLPAFLY  957
              + +A+ G   +A+DL GHG SEG +G +P +D VV D     +S   +  +  LP+FLY
Sbjct  103   PIFLAQKGFASFALDLEGHGRSEGLKGFVPNVDLVVDDIFSFFNSIKEKPEYQGLPSFLY  162

Query  956   GESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIF  777
             GES+GGAI +LI       WNG IL  PMC +S+K +P WP+ + L   A F P   I+ 
Sbjct  163   GESMGGAICLLIHFRDPKAWNGAILVAPMCRISEKVRPRWPIPDILIFFAKFMPTLPIVP  222

Query  776   TKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQ  597
             T     +S +   KK +  K+P R+   +P   T +ELL++  Y+     ++ +P L+L 
Sbjct  223   TADLLDKSVKVPEKKIIGGKNPMRYQG-KPRLGTVVELLRITDYLNRRLCDVSLPFLVLH  281

Query  596   GGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRA  420
             G  D V D    +A++++A S+DKT++I+ GM H L+ GE +E+VE+V    LSW+  R+
Sbjct  282   GSADVVTDPEVSRALYEAAKSEDKTIRIYEGMMHSLLFGETDENVEIVRGDILSWLNHRS  341

Query  419   N  417
              
Sbjct  342   G  342



>ref|XP_002316636.1| hydrolase family protein [Populus trichocarpa]
 gb|EEE97248.1| hydrolase family protein [Populus trichocarpa]
Length=323

 Score =   196 bits (499),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 109/310 (35%), Positives = 172/310 (55%), Gaps = 4/310 (1%)
 Frame = -1

Query  1343  QANETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGY  1164
             +  E   +G+   +E+YK+  I        +     +FT+SW   S D   GV+CM+HGY
Sbjct  9     RETEVHFWGNTPEDEYYKQQGIKASRSSYTSPRGLSLFTRSWLPISTDPVLGVMCMVHGY  68

Query  1163  TSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSAR--  990
              ++ SW F+  A+ +A+ G   + +D+ GHG S+G +G++P +D VV DC+   DS +  
Sbjct  69    GNDISWTFQSTAIFLAQMGFACFGLDIEGHGKSQGLKGYVPNVDLVVQDCLSFFDSIKND  128

Query  989   AHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLA  810
                  LP FLYGES+GGAI +LI L     ++G +L  PMC +S   KP WP+ + L L 
Sbjct  129   TQFHGLPFFLYGESMGGAICLLIHLANPKGFDGAVLVAPMCKISDSIKPRWPISDILLLV  188

Query  809   AFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNC  630
             A F P   I+       +S +   K  +   +P R+   +P   T +ELL+V  Y+  N 
Sbjct  189   AKFLPTLAIVPAASILHKSIKVERKVPIAEMNPMRY-RGKPRLGTVVELLRVTDYLSQNL  247

Query  629   HELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVF  453
               + +P ++L G  D V D    +++++ A S+DKT+KI+ GM H L+ GE +E+VE+V 
Sbjct  248   RNVTIPFIVLHGSMDVVTDPKVSESLYEEAKSEDKTIKIYDGMVHSLLFGETDENVEIVR  307

Query  452   NTTLSWIQMR  423
                +SW+  R
Sbjct  308   QDIISWLNDR  317



>ref|XP_003634858.1| PREDICTED: caffeoylshikimate esterase [Vitis vinifera]
 emb|CAN82216.1| hypothetical protein VITISV_020423 [Vitis vinifera]
Length=314

 Score =   195 bits (496),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 111/310 (36%), Positives = 177/310 (57%), Gaps = 7/310 (2%)
 Frame = -1

Query  1337  NETSPY--GDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGY  1164
             ++  PY  G+   EE+Y    I   +    +     +FT+SWQ  S   PR ++CM+HGY
Sbjct  6     HQNRPYFWGNTPEEEYYNLQGIKSSKSLFTSTRGLSLFTRSWQPLST-PPRALICMVHGY  64

Query  1163  TSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSAR--  990
              ++ SW F+   + +A+ G   +A+DL GHG SEG + ++P +D VV DC+   +S +  
Sbjct  65    GNDISWTFQATPIFLAQMGFACFALDLQGHGQSEGLKAYVPNVDLVVEDCVSFFNSIKQD  124

Query  989   AHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLA  810
                  LP+ LYGES+GGAI +LI L+  + + G IL  PMC +S   +P WP+ + L   
Sbjct  125   VSFHGLPSILYGESMGGAICLLIHLSNPNSFQGAILVAPMCKISDNVRPRWPIPQILTFL  184

Query  809   AFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNC  630
             A F P   I+ T     +S +   KK + A +P R+   +P   T +ELL++  Y+    
Sbjct  185   ARFFPTLPIVPTPDILDKSVKVPEKKIIAAMNPLRYKG-KPRLGTVVELLRITDYLSQKL  243

Query  629   HELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVF  453
              E+++P ++L G  D V D +  +A+++ A S+DKT+KI+ GM H L+ GE +E+V++V 
Sbjct  244   GEVKLPFIVLHGSADAVTDPDVSRALYEEAKSEDKTIKIYYGMMHSLLFGETDENVDIVR  303

Query  452   NTTLSWIQMR  423
                LSW+  R
Sbjct  304   REILSWLNDR  313



>ref|NP_001060014.1| Os07g0565700 [Oryza sativa Japonica Group]
 dbj|BAC22550.1| putative lysophospholipase homolog [Oryza sativa Japonica Group]
 dbj|BAF21928.1| Os07g0565700 [Oryza sativa Japonica Group]
 gb|EAZ04364.1| hypothetical protein OsI_26504 [Oryza sativa Indica Group]
 dbj|BAG99553.1| unnamed protein product [Oryza sativa Japonica Group]
Length=334

 Score =   196 bits (498),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 110/300 (37%), Positives = 169/300 (56%), Gaps = 5/300 (2%)
 Frame = -1

Query  1310  SREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELN  1131
             +  E+Y  H    +  +      +++FT++W+      PR +V M+HGY ++ SW F+  
Sbjct  22    TEAEYYAAHGADGESSYFTPPGGRRLFTRAWRPRGDGAPRALVFMVHGYGNDISWTFQST  81

Query  1130  AVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSA--RAHHPKLPAFLY  957
             AV +A++G   +A DLPGHG S G R  +P +D  + D +    S   R  H  LP FL+
Sbjct  82    AVFLARSGFACFAADLPGHGRSHGLRAFVPDLDSAIADLLAFFRSVRRREEHAGLPCFLF  141

Query  956   GESLGGAIAILICLNQ-KHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRII  780
             GES+GGAI +LI L      W G +L  PMC +S + +P WPL + L   A FAP   I+
Sbjct  142   GESMGGAICLLIHLRTPPEEWAGAVLVAPMCKISDRIRPPWPLPQILTFVARFAPTLAIV  201

Query  779   FTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLIL  600
              T     +S +   K+ + A++P R+ + RP   T +ELL+    +     E+ VP L++
Sbjct  202   PTADLIEKSVKVPAKRLIAARNPMRY-SGRPRLGTVVELLRATDELGARLGEVTVPFLVV  260

Query  599   QGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQ-LIGEPNESVELVFNTTLSWIQMR  423
              G  D+V D +  +A++ +AASKDKT+KI+ GM H  L GEP+E++E V    L+W+  R
Sbjct  261   HGSADEVTDPDISRALYDAAASKDKTIKIYDGMMHSMLFGEPDENIERVRADILAWLNER  320



>ref|XP_004958048.1| PREDICTED: monoglyceride lipase-like [Setaria italica]
Length=335

 Score =   194 bits (492),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 110/306 (36%), Positives = 175/306 (57%), Gaps = 7/306 (2%)
 Frame = -1

Query  1310  SREEFYKKHHIIHKEGFVL--NENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFE  1137
             +  ++Y  H    +  +    +E  +++FT++W+  +   P+ +V M+HGY ++ SW F+
Sbjct  21    TESDYYAAHGAEGEPSYFTTPDEGARRLFTRAWRPRAPARPKALVFMVHGYGNDISWTFQ  80

Query  1136  LNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAH--HPKLPAF  963
               AV +A++G   +A DLPGHG S G R  +P +D  V D +    + RA   H  LP F
Sbjct  81    STAVFLARSGFACFAADLPGHGRSHGLRAFVPDLDAAVADLLAFFRAVRAREEHAGLPCF  140

Query  962   LYGESLGGAIAILICLNQ-KHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWR  786
             L+GES+GGAI +LI L      W G +L  PMC +S + +P WPL E L   A FAP   
Sbjct  141   LFGESMGGAICLLIHLRTPPEEWAGAVLVAPMCRISDRIRPPWPLPEILTFVARFAPTAA  200

Query  785   IIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLL  606
             I+ T     +S +   K+ + A++P R+ N RP   T +ELL+    +     E+ +P L
Sbjct  201   IVPTADLIEKSVKVPAKRVIAARNPVRY-NGRPRLGTVVELLRATDELAKRLGEVTIPFL  259

Query  605   ILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQ  429
             ++ G  D+V D    +A++++AASKDKT+KI+ GM H L+ GE +E++E V    L+W+ 
Sbjct  260   VVHGSADEVTDPEVSRALYEAAASKDKTIKIYDGMLHSLLFGELDENIERVRGDILAWLN  319

Query  428   MRANLA  411
              +  L+
Sbjct  320   EKCTLS  325



>ref|XP_010107055.1| hypothetical protein L484_002466 [Morus notabilis]
 gb|EXC53896.1| hypothetical protein L484_002466 [Morus notabilis]
Length=329

 Score =   193 bits (491),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 108/311 (35%), Positives = 174/311 (56%), Gaps = 10/311 (3%)
 Frame = -1

Query  1322  YGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDE--PRGVVCMIHGYTSESS  1149
             +G+   +++Y    +     +  +     +FT+SW   S  +  PR +V M+HGY ++ S
Sbjct  13    WGNTPEQDYYALQGVRGSSSYFTSPRGLNLFTRSWLPLSSSDFPPRALVFMVHGYGNDIS  72

Query  1148  WLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHHP---  978
             W F+  A+ +A+ G   +A+DL GHG S+G R  +P +D  V DC+    S +       
Sbjct  73    WTFQATAIFLARHGFACFALDLQGHGRSDGLRAFVPEVDLAVQDCLAFFTSVKRDSRFQT  132

Query  977   ---KLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAA  807
                  P+FLYGES+GGAI +L+ L     ++G +L  PMC +S   KP WP+ + L   A
Sbjct  133   LGRPTPSFLYGESMGGAICLLVHLADPLGFDGAVLVAPMCKISDNLKPRWPIPQILTQLA  192

Query  806   FFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCH  627
              F P   I+ T+   R+S +   KK +  ++P R+   +P   T +ELL+V +Y+     
Sbjct  193   RFFPTLAIVPTEDLMRKSVKVEEKKIVADRNPMRY-RGKPRLGTVVELLRVTEYLSGRLS  251

Query  626   ELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFN  450
             E+++P ++L G  D V D N  +A++  A S+DKT++I+ GM H L+ GE +E+VE+V N
Sbjct  252   EVKLPFIVLHGSADAVTDPNVSRALYAEAKSEDKTVRIYDGMMHSLLFGETDENVEIVRN  311

Query  449   TTLSWIQMRAN  417
               LSW+  R N
Sbjct  312   DILSWLNERCN  322



>ref|XP_004146590.1| PREDICTED: monoglyceride lipase-like [Cucumis sativus]
 ref|XP_004158035.1| PREDICTED: monoglyceride lipase-like [Cucumis sativus]
 gb|KGN64644.1| hypothetical protein Csa_1G073040 [Cucumis sativus]
Length=319

 Score =   193 bits (491),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 108/304 (36%), Positives = 176/304 (58%), Gaps = 6/304 (2%)
 Frame = -1

Query  1322  YGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWL  1143
             +G++S E+++    I   + F  +    K+FT+SW       PR ++ M+HGY +  SW 
Sbjct  14    WGNISEEDYFTSQRIKASKSFYTSPRGLKLFTRSWLPLPPTPPRALIFMVHGYGNNISWT  73

Query  1142  FELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSAR--AHHPKLP  969
             F+  ++ +A+ G   +A+DL GHG S+G +  +P +D VVHDC+   +  +       LP
Sbjct  74    FQATSIFLAQMGFACFALDLEGHGRSQGLKAFVPNVDSVVHDCLSFFNFLKLDPQFQGLP  133

Query  968   AFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNW  789
              FLYGES+GGAI ++I       ++G +L  PMC +S   KP WP+ +FL   A F P  
Sbjct  134   CFLYGESMGGAICLMIHFADPKGFDGAVLVAPMCKISDNVKPHWPIPQFLTAVAQFLPTL  193

Query  788   RIIFTKPPSRESYREVLKKKLVAK-SPNRFPNERPPAATALELLKVCKYIQNNCHELEVP  612
              I+ T     +S + V +KK+VA+ +P R+   +P   T +ELL+V +++     ++ +P
Sbjct  194   AIVPTADLLDKSVK-VEEKKIVAEMNPMRY-RGKPRLGTVVELLRVTEHLSQRLKDVNLP  251

Query  611   LLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSW  435
              ++L G  D V D N  K +++ A S+DKT+KI+ GM H ++ GE +E+VE+V N  L W
Sbjct  252   FIVLHGNADVVTDPNVSKTLYEEAKSEDKTIKIYEGMMHSMLYGETDENVEIVRNDILCW  311

Query  434   IQMR  423
             +  R
Sbjct  312   LNER  315



>ref|XP_006846763.1| hypothetical protein AMTR_s00148p00014950 [Amborella trichopoda]
 gb|ERN08344.1| hypothetical protein AMTR_s00148p00014950 [Amborella trichopoda]
Length=217

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/193 (51%), Positives = 134/193 (69%), Gaps = 1/193 (1%)
 Frame = -1

Query  980  PKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFF  801
            P LPAFLY ESLGGA+A+L+ L  K  W+GLIL+G MCG+S ++KP WPLE  L +AA  
Sbjct  22   PSLPAFLYAESLGGAMALLLHLRDKRSWSGLILNGTMCGISPRFKPPWPLEHLLWIAAAV  81

Query  800  APNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHEL  621
            AP W+++ T+     S++E  K +L   SP R    RP A TALELL++CK +Q+   E+
Sbjct  82   APTWQVVPTRAIPHVSFKEEWKFRLALGSPRRTAT-RPRAGTALELLRICKVLQDRFEEV  140

Query  620  EVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESVELVFNTTL  441
            E P+L++ G +D VCD   V+ + + A SKDKTLKI+ GMWHQL+GEP E+VE VF   +
Sbjct  141  EAPMLVVHGEEDIVCDPKGVEELVRRAGSKDKTLKIYEGMWHQLVGEPQENVEKVFGDII  200

Query  440  SWIQMRANLARAH  402
            +W++ RA  ARAH
Sbjct  201  NWLKDRATRARAH  213



>ref|XP_007025719.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY28341.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=315

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/305 (35%), Positives = 177/305 (58%), Gaps = 5/305 (2%)
 Frame = -1

Query  1322  YGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWL  1143
             +G++S E++YK+  I   + F  +     +FT+S    S   PRGV+  +HGY S++SW 
Sbjct  10    WGNVSEEDYYKQQGIKASKSFYTSPRGLSLFTRSLLPIS-GSPRGVIFGVHGYGSDTSWT  68

Query  1142  FELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCI--LCLDSARAHHPKLP  969
             F+   + +A+ G   +A+D+ GHG S+G RG++P +D VV DC+    L     +   LP
Sbjct  69    FQSTPIFLAQKGFACFALDIEGHGRSQGLRGYVPNVDLVVQDCLSYFNLIKQDPNLDGLP  128

Query  968   AFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNW  789
              FLYGES+GGAI ++I       + G IL  PMC +  +  P WP+ + +   +   P  
Sbjct  129   CFLYGESMGGAICLMIHFADPEGFQGAILVSPMCKIPDQLTPGWPIRQVVAFISKLLPTL  188

Query  788   RIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPL  609
              I+ T+    +S +   KK +  K+P R+   +P   TALELL++ +Y+     ++ +P 
Sbjct  189   AIVPTEDVLYKSIKVEEKKIIGNKNPLRY-RGKPRLGTALELLRITEYLGQKLCDVSIPF  247

Query  608   LILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWI  432
             L++ G  D V +    + +++ A+S+DKT+KI+ GMWH L+ GEP++++E+V +  LSW+
Sbjct  248   LVVHGSADVVTEPEVSRTLYEEASSQDKTIKIYEGMWHSLLFGEPDDNIEIVRSDILSWL  307

Query  431   QMRAN  417
               R N
Sbjct  308   NDRCN  312



>ref|XP_007159280.1| hypothetical protein PHAVU_002G224700g [Phaseolus vulgaris]
 gb|ESW31274.1| hypothetical protein PHAVU_002G224700g [Phaseolus vulgaris]
Length=326

 Score =   191 bits (486),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/306 (34%), Positives = 176/306 (58%), Gaps = 7/306 (2%)
 Frame = -1

Query  1322  YGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWL  1143
             +G    E++YK+  I   +         K+FT+SW  +    PR VV M+HGY ++ SW 
Sbjct  19    WGFTPEEDYYKQQGITATKSEFTTARGLKLFTRSWLPNPSTTPRAVVFMVHGYGNDISWT  78

Query  1142  FELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHHPK---L  972
             F+   + +A++G   +A+DL GHG+SEG +  +P ++ V HDC+   +S +  +P+   L
Sbjct  79    FQATPIFLAQSGFACFAVDLQGHGHSEGLKAFVPSVNLVAHDCLCFFNSIKQQNPQFQHL  138

Query  971   PAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPN  792
             P+FL+GES+G AI +LI       ++G +L  PMC +S   +P WP+ + L   A F P 
Sbjct  139   PSFLFGESMGAAICLLIHFLSPEPFHGAVLVAPMCKISDSVRPRWPIPQILTFLAKFFPT  198

Query  791   WRIIFTKPPSRESYREVLKKKLVAK-SPNRFPNERPPAATALELLKVCKYIQNNCHELEV  615
               I+ T     +S + V +KKL+A  +P R+   +P   T +ELL+V  ++     ++ +
Sbjct  199   LPIVPTPDLLFKSVK-VHRKKLIANMNPLRY-RGKPRLGTVVELLRVTDFLNQRLSDVNL  256

Query  614   PLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLS  438
             P ++L G  D V D +  + +++ A + DKT++++ GM H L+ GE +++VE+V    LS
Sbjct  257   PFIVLHGSADAVTDPDVSRELYREARTLDKTIRVYDGMMHSLLFGETDDNVEIVRKDVLS  316

Query  437   WIQMRA  420
             W+  RA
Sbjct  317   WLLARA  322



>ref|XP_008809309.1| PREDICTED: caffeoylshikimate esterase [Phoenix dactylifera]
Length=330

 Score =   191 bits (486),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 115/306 (38%), Positives = 165/306 (54%), Gaps = 10/306 (3%)
 Frame = -1

Query  1304  EEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAV  1125
             EE+Y    I        +     +F +SW   S   PR +VCMIHGY ++ SW F+   +
Sbjct  27    EEYYASQGIRGTSSSFASPGGLSLFARSWLPSS-SPPRALVCMIHGYGNDISWTFQATPI  85

Query  1124  AMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHHPK---LPAFLYG  954
              +A  G    AIDLPGHG S G R  +P +  V  DC+   DS R   P+   LP FLYG
Sbjct  86    FLASHGFACCAIDLPGHGRSPGLRAFLPDLSAVADDCLAYFDSVR-RSPELRGLPCFLYG  144

Query  953   ESLGGAIAILICLNQKH---VWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRI  783
             ES+GGA+ +LI L  +    VW G +L  PMC +S   +P WP+ + L   A  AP   I
Sbjct  145   ESMGGALCLLIHLRDRRPEAVWRGAVLVAPMCKISDSIRPRWPIPQVLTFVARLAPTLPI  204

Query  782   IFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLI  603
             + T     +S R   K+K+ A +P R+   +P   T +ELL+    + +   E+ +P L+
Sbjct  205   VPTADLVDKSVRVEAKRKVAASNPLRY-RGKPRLGTVVELLRATDDLGSRLSEVTLPFLV  263

Query  602   LQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQM  426
             L G  D V D    +A++ +A S+DKT++I+ GM H L+ GE +E+V LV N  L+W+  
Sbjct  264   LHGSADVVTDPAVSRALYDAARSEDKTIRIYEGMMHSLLFGETDENVALVRNDILAWLNE  323

Query  425   RANLAR  408
             R   AR
Sbjct  324   RCGGAR  329



>ref|XP_004505004.1| PREDICTED: monoglyceride lipase-like [Cicer arietinum]
Length=333

 Score =   191 bits (485),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 106/305 (35%), Positives = 171/305 (56%), Gaps = 4/305 (1%)
 Frame = -1

Query  1322  YGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWL  1143
             +G  + +E+Y++  I   + +    +   +FT+SW  +    PR ++ M+HGY ++ SW 
Sbjct  30    WGYTAEDEYYEQERIKSTKSYFTTPSGLTLFTRSWLPNLTTPPRALIFMVHGYGNDISWT  89

Query  1142  FELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARA--HHPKLP  969
             F+   +  A+ G   +++DL GHG S+G +  +P +D VV DCI   +S +   +   LP
Sbjct  90    FQSTPIFFAQMGFACFSLDLQGHGRSQGLKAFVPNVDLVVQDCISFFNSVQKDPNFIGLP  149

Query  968   AFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNW  789
              FLYGES+GGAI +LI  +    + G IL  PMC +S K +P WP+ + L   A F P  
Sbjct  150   CFLYGESMGGAICLLIHFSYPKGFQGAILVAPMCKISDKVRPKWPIPQILTFLAKFFPTL  209

Query  788   RIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPL  609
              I+ T     +S +   KK + A +P R+   +P   T +ELL+V   +     ++E+P 
Sbjct  210   PIVPTPDLLYKSVKVDHKKVIAAMNPLRY-RGKPRLGTVVELLRVTDILSRKLCDVEIPF  268

Query  608   LILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWI  432
             ++L G  D V D    + +++ A S+DKT+K+F GM H L+ GE +E+VE+V N  L W+
Sbjct  269   IVLHGSADVVTDPEVSRELYEEARSQDKTIKVFDGMMHSLLFGETDENVEIVRNHILEWL  328

Query  431   QMRAN  417
               R N
Sbjct  329   NARCN  333



>ref|XP_008442222.1| PREDICTED: caffeoylshikimate esterase [Cucumis melo]
Length=319

 Score =   190 bits (482),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 106/304 (35%), Positives = 175/304 (58%), Gaps = 6/304 (2%)
 Frame = -1

Query  1322  YGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWL  1143
             +G++  E+++    I   + F  +    K+FT+SW       PR ++ M+HGY +  SW 
Sbjct  14    WGNIPEEDYFTSQRIKASKSFYTSPRGLKLFTRSWLPLPPTPPRALIFMVHGYGNNISWT  73

Query  1142  FELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSAR--AHHPKLP  969
             F+  ++ +A+ G   +A+DL GHG S+G +  +P +D VVHDC+   +  +       LP
Sbjct  74    FQATSIFLAQMGFACFALDLEGHGRSQGLKAFVPNVDSVVHDCLSFFNFLKLDPQFQGLP  133

Query  968   AFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNW  789
              FLYGES+GGAI ++I       ++G +L  PMC +S   KP WP+ +FL   A F P  
Sbjct  134   CFLYGESMGGAICLMIHFADPKGFDGAVLVAPMCKISDNVKPHWPIPQFLTAVAKFLPTL  193

Query  788   RIIFTKPPSRESYREVLKKKLVAK-SPNRFPNERPPAATALELLKVCKYIQNNCHELEVP  612
              I+ T     +S + V +KK+VA+ +P R+   +P   T +ELL+V +++     ++ +P
Sbjct  194   AIVPTADLLDKSVK-VEEKKIVAEMNPMRY-RGKPRLGTVVELLRVTEHLSQRLKDVSLP  251

Query  611   LLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSW  435
              ++L G  D V D +  K +++ A S+DKT+KI+ GM H ++ GE +E+VE+V N  L W
Sbjct  252   FIVLHGNADVVTDPDVSKTLYEEAKSEDKTIKIYEGMMHSMLYGETDENVEIVRNDILRW  311

Query  434   IQMR  423
             +  R
Sbjct  312   LNER  315



>emb|CDY20979.1| BnaA08g25460D [Brassica napus]
Length=322

 Score =   190 bits (482),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 107/315 (34%), Positives = 175/315 (56%), Gaps = 6/315 (2%)
 Frame = -1

Query  1334  ETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSW--QHDSCDEPRGVVCMIHGYT  1161
             E + +GD   ++++    I   + +  +     +FT+SW     S   PRG++ M+HGY 
Sbjct  9     EINFWGDTPEQDYFTLKGITGSKSYFTSPRGLNLFTRSWLPSSSSSSPPRGIIFMVHGYG  68

Query  1160  SESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAH-  984
             ++ SW F+  A+ +A+ G   +A+D+ GHG S+G R ++P +D VVHD I  LDS +   
Sbjct  69    NDISWTFQSTAIFLAQNGFACFALDIEGHGRSDGVRAYVPSVDLVVHDLISFLDSIKKQP  128

Query  983   -HPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAA  807
              +   P FL+GES+GGAI++LI       ++G +L  PMC +S K +P WP++  L   +
Sbjct  129   KYQTSPRFLFGESMGGAISLLIHFLDPVAFDGAVLVAPMCKISDKVRPKWPIDRILITIS  188

Query  806   FFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCH  627
                P W I+ T+    +  +   KK +  ++P R+   +P   T +ELL+V  Y+     
Sbjct  189   SLVPTWAIVPTEDLLEKCIKVEEKKPIAKRNPMRY-GGKPRLGTVMELLRVTDYLGKKLK  247

Query  626   ELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQ-LIGEPNESVELVFN  450
             ++ VP L+L G  D V D    + +++SA S+DKTLKI+ GM H  L GE +E++E+V  
Sbjct  248   DVSVPFLVLHGSADVVTDPEVSRELYESAKSEDKTLKIYDGMMHSMLFGETDENIEIVRG  307

Query  449   TTLSWIQMRANLARA  405
               + W+  R    R 
Sbjct  308   DIVGWLNNRCGGDRT  322



>gb|EYU27946.1| hypothetical protein MIMGU_mgv1a026912mg [Erythranthe guttata]
Length=316

 Score =   190 bits (482),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 108/308 (35%), Positives = 174/308 (56%), Gaps = 5/308 (2%)
 Frame = -1

Query  1331  TSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSES  1152
             T  +G+   E++Y++  I   +    +     +FT+SWQ       RGVVCM+HGY ++ 
Sbjct  9     THYWGNTCEEDYYREQGIKSTKSNYTSPRGLTLFTRSWQPLQSSHTRGVVCMVHGYGNDI  68

Query  1151  SWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHHP--  978
             SW F+   + +A+ G   +A+D+ GHG SEG + ++P +D VV DC+   D+  A  P  
Sbjct  69    SWTFQATPIFLAQNGFACFALDIEGHGRSEGLKAYVPSVDDVVDDCLSFYDAVSAQDPDL  128

Query  977   -KLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFF  801
               LP FL+GES+GGAI +LI       +NG +L  PMC +S+K +P WP+ + L   A F
Sbjct  129   RDLPRFLFGESMGGAICLLIHFKAPEFFNGAVLMAPMCRISEKVRPRWPIPQILTAVARF  188

Query  800   APNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHEL  621
             AP   I+ T     +S +   KK +   +P R+ + +P   T LELL+V  Y+     ++
Sbjct  189   APTLPIVPTADLLDKSVKVAEKKIIGGMNPMRY-HGKPRLGTVLELLRVTDYVSGRLRDV  247

Query  620   EVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTT  444
              +P +++ G  D V D    + +++ A S+DK++KI+ GM H L+ GE +E+V +V    
Sbjct  248   GIPFIVMHGDADVVTDPAVSRELYELAKSEDKSVKIYEGMMHSLLFGETDENVAIVRGDV  307

Query  443   LSWIQMRA  420
             L W+  R+
Sbjct  308   LKWLNDRS  315



>ref|XP_008224992.1| PREDICTED: caffeoylshikimate esterase [Prunus mume]
Length=322

 Score =   189 bits (480),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 107/304 (35%), Positives = 169/304 (56%), Gaps = 6/304 (2%)
 Frame = -1

Query  1322  YGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWL  1143
             +G+   +E+Y    I   + F  +    K+FT+ W       PRG++ M+HGY ++ SW 
Sbjct  18    WGNTPEQEYYNLQGIKASKSFYTSPRGLKLFTRQWL-PLLSPPRGLIFMVHGYGNDISWT  76

Query  1142  FELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHHPK---L  972
             F+   + +A+ G   +A+DL GHG S G R  +P +  VV DC+      +   P+   +
Sbjct  77    FQATPIFLAQQGFACFALDLEGHGQSHGLRAFVPDVHLVVQDCLAFFTLVKQQEPQFLNV  136

Query  971   PAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPN  792
             P FLYGES+GGAI +LI   +   + G IL  PMC +S K KP WP+ + L   A F P+
Sbjct  137   PCFLYGESMGGAICLLIHFAEPEAFQGAILVAPMCKISDKVKPRWPIPQILTFVARFFPS  196

Query  791   WRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVP  612
               I+ T     +S +   KK +   +P R+   +P   T +ELLKV +Y+     ++ +P
Sbjct  197   LAIVPTADLMYKSVKVEEKKIIANMNPMRY-RGKPRLGTVVELLKVTEYVSQRLGDVSLP  255

Query  611   LLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSW  435
              ++L G  D V D N  +A+++ A S+DKT+KI+ GM H L+ GE +++V++V    LSW
Sbjct  256   FIVLHGSADVVTDPNVSRALYEEAKSEDKTIKIYEGMMHSLLFGETDQNVDIVRADILSW  315

Query  434   IQMR  423
             +  R
Sbjct  316   LNHR  319



>ref|XP_007211531.1| hypothetical protein PRUPE_ppa008252mg [Prunus persica]
 gb|EMJ12730.1| hypothetical protein PRUPE_ppa008252mg [Prunus persica]
Length=339

 Score =   189 bits (481),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 107/304 (35%), Positives = 169/304 (56%), Gaps = 6/304 (2%)
 Frame = -1

Query  1322  YGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWL  1143
             +G+   +E+Y    I   + F  +    K+FT+ W       PRG++ M+HGY ++ SW 
Sbjct  29    WGNTPEQEYYNLQGIKASKSFYTSPRGLKLFTRQWL-PLLSPPRGLIFMVHGYGNDISWT  87

Query  1142  FELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHHPK---L  972
             F+   + +A+ G   +A+DL GHG S G R  +P +  VV DC+      +   P+   +
Sbjct  88    FQATPIFLAQQGFACFALDLEGHGQSHGLRAFVPDVHLVVQDCLAFFTLVKQQEPQFLNV  147

Query  971   PAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPN  792
             P FLYGES+GGAI +LI   +   + G IL  PMC +S K KP WP+ + L   A F P+
Sbjct  148   PCFLYGESMGGAICLLIHFAEPEAFQGAILVAPMCKISDKVKPRWPIPQILTFVARFFPS  207

Query  791   WRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVP  612
               I+ T     +S +   KK +   +P R+   +P   T +ELLKV +Y+     ++ +P
Sbjct  208   LAIVPTADLMYKSVKVEEKKIIANMNPMRY-RGKPRLGTVVELLKVTEYVSQRLGDVSLP  266

Query  611   LLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSW  435
              ++L G  D V D N  +A+++ A S+DKT+KI+ GM H L+ GE +++V++V    LSW
Sbjct  267   FIVLHGSADVVTDPNVSRALYEEAKSEDKTIKIYEGMMHSLLFGETDQNVDIVRADILSW  326

Query  434   IQMR  423
             +  R
Sbjct  327   LNHR  330



>ref|XP_008383790.1| PREDICTED: caffeoylshikimate esterase-like [Malus domestica]
Length=342

 Score =   189 bits (481),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 108/304 (36%), Positives = 168/304 (55%), Gaps = 7/304 (2%)
 Frame = -1

Query  1322  YGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWL  1143
             +G    +E+Y    I   + F  +    K+FT+ W       PRG++ M+HGY ++ SW 
Sbjct  30    WGTTPEQEYYNLQGIKSSKSFYTSPRGFKLFTRQWL--PLRRPRGIIFMVHGYGNDISWT  87

Query  1142  FELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHHPK---L  972
             F+   + +A+ G   +A+DL GHG S+G R  +P +  VV+DC+   +  +   P+   L
Sbjct  88    FQATPIFLAQNGFACFALDLEGHGGSDGLRAFVPDVGLVVNDCLSFFNLVKQQDPQFQGL  147

Query  971   PAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPN  792
             P FLYGES+GGAI +LI       + G IL  PMC +S K KP WP+ E L   A +   
Sbjct  148   PCFLYGESMGGAICLLIHFAAPEAFQGAILVAPMCKISDKVKPTWPIPEILTFVAGYLXR  207

Query  791   WRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVP  612
               I+ T    R+S +   KK +   +P+R+   +P   T +ELL+V +++     ++ +P
Sbjct  208   LAIVPTADLMRKSVKVEEKKIVADMNPSRY-RGKPRLGTVVELLRVTQHVSERLGDVSLP  266

Query  611   LLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSW  435
              ++L G  D V D    KA++ +A S+DKTLKI+ GM H L+ GE +E+VE+V    L W
Sbjct  267   FIVLHGSADVVTDPEVSKALYAAAKSEDKTLKIYEGMMHSLLFGETDENVEVVRGDILGW  326

Query  434   IQMR  423
             +  R
Sbjct  327   LNHR  330



>ref|XP_010905633.1| PREDICTED: caffeoylshikimate esterase [Elaeis guineensis]
Length=324

 Score =   188 bits (478),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 113/305 (37%), Positives = 166/305 (54%), Gaps = 10/305 (3%)
 Frame = -1

Query  1304  EEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAV  1125
             EE+Y    I     F  +     +FT+SW   S   PR +VCMIHGY ++ SW F+   +
Sbjct  23    EEYYASQGIRGTTSFFASPGGFSLFTRSWLPSS-SPPRALVCMIHGYGNDISWTFQATPI  81

Query  1124  AMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHHPK---LPAFLYG  954
              +A  G    A+DLPGHG S G R  +P +  V  DC+   DS R   P+   LP FLYG
Sbjct  82    FLACHGFACCALDLPGHGRSPGLRAFLPDLSAVADDCLTYFDSVR-RSPELRGLPCFLYG  140

Query  953   ESLGGAIAILICLNQKHV---WNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRI  783
             ES+GGA+ +LI L  +     W G +L  PMC +S   +P WP+ + L   A  AP   I
Sbjct  141   ESMGGALCLLIHLRDRRPEAGWRGAVLVAPMCKISDSIRPRWPIPQILTFVARLAPTLPI  200

Query  782   IFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLI  603
             + T     +S +   K+K+ A +P R+   +P   T +ELL+    + ++  E+ +P L+
Sbjct  201   VPTADLVDKSVKVEAKRKVAASNPLRY-RGKPRLGTVVELLRATDDLGSHLTEVTIPFLV  259

Query  602   LQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQM  426
             L G  D V D    +A++ +A S+DKT++I+ GM H L+ GE +E+V LV N  L+W+  
Sbjct  260   LHGSADVVTDPAVSQALYDAARSEDKTIRIYEGMMHSLLFGETDENVALVRNDILTWLDE  319

Query  425   RANLA  411
             R   A
Sbjct  320   RCGGA  324



>gb|AFK35254.1| unknown [Medicago truncatula]
 gb|AFK64818.1| unknown [Medicago truncatula]
 gb|KEH31129.1| alpha/beta hydrolase family protein [Medicago truncatula]
Length=325

 Score =   188 bits (478),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 105/303 (35%), Positives = 168/303 (55%), Gaps = 4/303 (1%)
 Frame = -1

Query  1322  YGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWL  1143
             +G     E+YK++ I   +          +FT+SW  +    PR ++ MIHGY ++ SW 
Sbjct  22    WGYTPESEYYKQNQIKSTKSTFTTPRNLTLFTRSWLPNPTTPPRALIFMIHGYGNDISWT  81

Query  1142  FELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSAR--AHHPKLP  969
             F+   + +A+ G   +++DL GHG+S+G +  +P +D VV DC+   +S +  ++   LP
Sbjct  82    FQSTPIFLAQMGFACFSLDLQGHGHSQGLKAFVPSVDLVVQDCLSFFNSVKKDSNFFGLP  141

Query  968   AFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNW  789
              FLYGES+GGAI++LI       + G IL  PMC +S K +P WP+ + L   A F P  
Sbjct  142   CFLYGESMGGAISLLIHFADPKGFQGAILVAPMCKISDKVRPKWPIPQILTFLAKFFPTL  201

Query  788   RIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPL  609
              I+ T     +S +   KK +   +P R+   +P   T +ELL+V   +     ++E+P 
Sbjct  202   PIVPTPDLLYKSVKVDHKKVIAQMNPLRY-RGKPRLGTVVELLRVTDILSRKLCDVELPF  260

Query  608   LILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWI  432
             ++L G  D V D    + +++ A S DKT+K+F GM H L+ GE +E+VE+V N  L W+
Sbjct  261   IVLHGSADVVTDPEVSRELYEEARSDDKTIKVFDGMMHSLLFGETDENVEIVRNDILQWL  320

Query  431   QMR  423
               R
Sbjct  321   NAR  323



>emb|CDY20587.1| BnaC08g14710D [Brassica napus]
Length=321

 Score =   187 bits (476),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 106/314 (34%), Positives = 174/314 (55%), Gaps = 5/314 (2%)
 Frame = -1

Query  1334  ETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSW-QHDSCDEPRGVVCMIHGYTS  1158
             E + +GD   ++++    I   + +  +     +FT+SW    S   PRG++ M+HGY +
Sbjct  9     EINFWGDTPEQDYFNLKGITGSKSYFKSPRGLNLFTRSWLPSPSSSPPRGIIFMVHGYGN  68

Query  1157  ESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAH--  984
             + SW F+  A+ +A+ G   +A+D+ GHG S+G R ++P +D VV D I   DS +    
Sbjct  69    DISWTFQSTAIFLAQNGFACFALDIEGHGRSDGVRAYVPSVDLVVDDLISFFDSIKKQPK  128

Query  983   HPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAF  804
             +  LP FL+GES+GGAI++L+       ++G +L  PMC +S K +P WP++  L   + 
Sbjct  129   YQTLPRFLFGESMGGAISLLVHFLDPSGFDGAVLVAPMCKISDKVRPKWPIDRILITISS  188

Query  803   FAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHE  624
               P W I+ T+    +  +   KK +  ++P R+   +P   T +ELL+V  Y+     +
Sbjct  189   LVPTWAIVPTEDLLEKCIKVEEKKPIAKRNPMRY-GGKPRLGTVMELLRVTDYLGKKLKD  247

Query  623   LEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQ-LIGEPNESVELVFNT  447
             + VP L+L G  D V D    + +++SA S+DKTLKI+ GM H  L GE +E+VE+V   
Sbjct  248   VSVPFLVLHGSADVVTDPEVSRELYESAESEDKTLKIYEGMMHSMLFGETDENVEIVRGD  307

Query  446   TLSWIQMRANLARA  405
              + W+  R    R 
Sbjct  308   IVGWLNDRCGGDRT  321



>ref|XP_009123831.1| PREDICTED: caffeoylshikimate esterase [Brassica rapa]
Length=321

 Score =   187 bits (476),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 106/314 (34%), Positives = 174/314 (55%), Gaps = 5/314 (2%)
 Frame = -1

Query  1334  ETSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSW-QHDSCDEPRGVVCMIHGYTS  1158
             E + +GD   ++++    I   + +  +     +FT+SW    S   PRG++ M+HGY +
Sbjct  9     EINFWGDTPEQDYFTLKGITGSKSYFTSPRGLNLFTRSWLPSSSSSPPRGIIFMVHGYGN  68

Query  1157  ESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAH--  984
             + SW F+  A+ +A+ G   +A+D+ GHG S+G R ++P +D VV D I  LDS +    
Sbjct  69    DISWTFQSTAIFLAQNGFACFALDIEGHGRSDGVRAYVPSVDLVVDDLISFLDSIKKQPK  128

Query  983   HPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAF  804
             +   P FL+GES+GGAI++LI       ++G +L  PMC +S K +P WP++  L   + 
Sbjct  129   YQTSPRFLFGESMGGAISLLIHFLDPVAFDGAVLVAPMCKISDKVRPKWPIDRILITISS  188

Query  803   FAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHE  624
               P W I+ T+    +  +   KK +  ++P R+   +P   T +ELL+V  Y+     +
Sbjct  189   LVPTWAIVPTEDLLEKCIKVEEKKPIAKRNPMRY-GGKPRLGTVMELLRVTDYLGKKLKD  247

Query  623   LEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQ-LIGEPNESVELVFNT  447
             + VP L+L G  D V D    + +++SA S+DKTLKI+ GM H  L GE +E++E+V   
Sbjct  248   VSVPFLVLHGSADVVTDPEVSRELYESAKSEDKTLKIYDGMMHSMLFGETDENIEIVRGD  307

Query  446   TLSWIQMRANLARA  405
              + W+  R    R 
Sbjct  308   IVGWLNDRCGGDRT  321



>ref|XP_009418746.1| PREDICTED: caffeoylshikimate esterase [Musa acuminata subsp. 
malaccensis]
Length=336

 Score =   187 bits (474),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 111/318 (35%), Positives = 170/318 (53%), Gaps = 15/318 (5%)
 Frame = -1

Query  1322  YGDLSREE--FYKKHHIIHKEGFVLNENQKKIFTQSW------QHDSCDEPRGVVCMIHG  1167
             +GD   EE  +Y    I     F  +     +FT+SW             PR ++CMIHG
Sbjct  14    WGDDPAEEDDYYAAQGIHGSSSFYTSRRGVTLFTRSWLPQITPTSSPPGRPRALICMIHG  73

Query  1166  YTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARA  987
             Y ++ SW F+   + +A+ G   +A+DLPGHG S+G R  +  +D V  DC+    S R 
Sbjct  74    YGNDISWTFQATPIFLAQHGFACFALDLPGHGRSQGLRAFVSDVDAVACDCLAYFRSVRQ  133

Query  986   HH--PKLPAFLYGESLGGAIAILICLNQK---HVWNGLILSGPMCGVSKKYKPIWPLEEF  822
                   LP FL+GES+GGA+ +LI L ++     W+G +L  PMC +S   +P WP+ E 
Sbjct  134   SPGLQGLPCFLFGESMGGALCLLIHLLEQEGEQGWDGAVLVAPMCKISDSIRPRWPVPEI  193

Query  821   LPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYI  642
             L   A FAP   ++ T     +S +   K+ + A +P R+   RP   T  EL++V   +
Sbjct  194   LTFVAKFAPTLPVVPTADLLEKSVKVEEKRVVAASNPLRYAG-RPRLGTVAELMRVTDRL  252

Query  641   QNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESV  465
              +   E+ +P ++L G  D V D +  +A+  +A SKDKT+KI+ GM H L+ GEP+E++
Sbjct  253   NSRLSEVTIPFIVLHGSADVVTDPSVSRALHDTARSKDKTIKIYDGMLHSLLFGEPDENI  312

Query  464   ELVFNTTLSWIQMRANLA  411
              +V N  L+W+  R   A
Sbjct  313   AMVRNDILAWLNERTGGA  330



>ref|NP_001240171.1| uncharacterized protein LOC100793956 [Glycine max]
 gb|ACU24156.1| unknown [Glycine max]
 gb|KHN46325.1| Monoglyceride lipase [Glycine soja]
Length=324

 Score =   186 bits (472),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/307 (33%), Positives = 166/307 (54%), Gaps = 8/307 (3%)
 Frame = -1

Query  1322  YGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWL  1143
             +G    E++YK+  I     F       K+FT+SW  +    PR ++ M+HGY ++ SW 
Sbjct  17    WGFTPEEDYYKQQGITSTSSFFTTPQGLKLFTRSWLPNPNTPPRALIFMVHGYGNDISWT  76

Query  1142  FELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHHPKLPAF  963
             F+   + +A+     +A+DL GHG+S+G + ++P +    HDC+   +S R  +P LP+F
Sbjct  77    FQSTPIFLAQNSFSCFALDLQGHGHSQGLKAYVPNVHLAAHDCLSFFNSIRTQNPNLPSF  136

Query  962   LYGESLGGAIAILICLNQKHV------WNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFF  801
             LYGES+G AI++LI L           + G +L  PMC +S   +P WP+ + L   + F
Sbjct  137   LYGESMGAAISLLIHLVNSETEPKSQPFQGAVLVAPMCKISDNVRPKWPIPQILTFLSRF  196

Query  800   APNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHEL  621
              P   I+ T     +S +   KK +   +P R+   +P   T +ELL+V   +     ++
Sbjct  197   FPTLPIVPTPDLLYKSVKVDHKKVIADMNPLRY-RGKPRLGTVVELLRVTDLLSRRLCDV  255

Query  620   EVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTT  444
              +P ++L G  D V D N  + +++ A S DKT+K++  M H L+ GE +E+VE+V N  
Sbjct  256   SLPFIVLHGSADVVTDPNVSRELYREARSDDKTIKVYEEMMHSLLFGETDENVEIVRNDI  315

Query  443   LSWIQMR  423
             L W+  R
Sbjct  316   LEWLVAR  322



>ref|XP_010229642.1| PREDICTED: LOW QUALITY PROTEIN: caffeoylshikimate esterase [Brachypodium 
distachyon]
Length=505

 Score =   190 bits (483),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 114/308 (37%), Positives = 173/308 (56%), Gaps = 9/308 (3%)
 Frame = -1

Query  1310  SREEFYKKHHIIHKEGFVL--NENQKKIFTQSWQHDSC--DEPRGVVCMIHGYTSESSWL  1143
             +  E+Y  H    +  +      + +++FT++W+  +     PR +V M+HGY ++ SW 
Sbjct  196   TEAEYYASHGAEGESSYFTPPGASPRRLFTRAWRPAAAGGTPPRALVFMVHGYGNDISWT  255

Query  1142  FELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSA--RAHHPKLP  969
             F+  AV +A++G   +A DLPGHG S G R  +P ++P V D +    S   R  H  LP
Sbjct  256   FQSTAVFLARSGFACFAADLPGHGRSHGLRAFVPALEPAVADLLAFFRSVKQREEHAGLP  315

Query  968   AFLYGESLGGAIAILICLNQ-KHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPN  792
              FL+GES+GGAI +LI L      W G +L  PMC +S + +P WPL + L L A FAP 
Sbjct  316   CFLFGESMGGAICLLIHLRTPPGEWTGAVLVAPMCRISDRIRPPWPLPQILTLVARFAPT  375

Query  791   WRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVP  612
               I+ T     +S +   K+ + A++P R+ N RP   T  ELL+    +     E+ VP
Sbjct  376   LPIVPTADLIEKSVKVPAKRLVSARNPMRY-NGRPRLGTVTELLRATDELGARLGEVSVP  434

Query  611   LLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQ-LIGEPNESVELVFNTTLSW  435
              L++ G  D+V D    +A++++AASKDKTLK++ GM H  L GEP+E++E V    L+W
Sbjct  435   FLVVHGSADEVTDPAVSRALYEAAASKDKTLKMYDGMLHSMLFGEPDENIERVRGDILAW  494

Query  434   IQMRANLA  411
             +  R   A
Sbjct  495   LNERCTPA  502



>dbj|BAJ89543.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=359

 Score =   186 bits (472),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 108/306 (35%), Positives = 170/306 (56%), Gaps = 11/306 (4%)
 Frame = -1

Query  1310  SREEFYKKHHIIHKEGFVLNENQ---KKIFTQSWQ---HDSCDEPRGVVCMIHGYTSESS  1149
             +  E+Y  H    +  +    +    +++FT+SW+     +   PR +V M+HGY ++ S
Sbjct  48    TESEYYAAHGAEGESSYFTTPDDAGARRLFTRSWRPAGGGAGARPRALVFMVHGYGNDIS  107

Query  1148  WLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSA--RAHHPK  975
             W F+  AV +A++G   +A DLPGHG S G +  +P ++  V D +    S   R  H  
Sbjct  108   WTFQATAVFLARSGFACFAADLPGHGRSHGLQAFVPDLEVAVADLLAFFRSVRRREEHAG  167

Query  974   LPAFLYGESLGGAIAILICLNQK-HVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFA  798
             LP FL+GES+GGAI +LI L      W G +L  PMC +S + +P WP+ E L L + FA
Sbjct  168   LPCFLFGESMGGAICLLIHLRTSPEEWAGAVLVAPMCRISDRIRPRWPVPEILTLVSRFA  227

Query  797   PNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELE  618
             P   I+ T     +S +   K+ + A++P R+ N RP   T +ELL+    +     E+ 
Sbjct  228   PTLPIVPTADLIEKSVKVPAKRLIAARNPMRY-NGRPRLGTVMELLRATDELGARLGEIT  286

Query  617   VPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQ-LIGEPNESVELVFNTTL  441
             +P L++ G  D+V D    +A+ ++AAS+DKT+K++ GM H  L GEP E++E V    L
Sbjct  287   IPFLVVHGSADEVTDPAVSRALHEAAASEDKTIKMYDGMLHSMLFGEPEENIERVRGDIL  346

Query  440   SWIQMR  423
             +W+  R
Sbjct  347   AWLSER  352



>ref|XP_006841721.1| hypothetical protein AMTR_s00003p00257040 [Amborella trichopoda]
 gb|ERN03396.1| hypothetical protein AMTR_s00003p00257040 [Amborella trichopoda]
Length=329

 Score =   185 bits (470),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 103/306 (34%), Positives = 181/306 (59%), Gaps = 9/306 (3%)
 Frame = -1

Query  1322  YGDLSREE-FYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSW  1146
             +GD   EE +Y+   +        +     +FT+SW   S    R ++ M+HGY ++ SW
Sbjct  10    WGDTPNEEDYYRFQGVRSTSSLYTSPRSLSLFTRSWLPLSSST-RAIILMLHGYGNDISW  68

Query  1145  LFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHHP---K  975
              F+  A+ +A+ G   +A+DL GHG S+G + ++P +  +  DC+    S  A +P   K
Sbjct  69    TFQATAIHLARNGFACFALDLEGHGRSQGLKAYVPNLPLLAQDCLSFFKSTMASNPDLEK  128

Query  974   LPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAP  795
             LP+FL+GES+GGA+ +LI   +   +NG +L  PMC +S K +P WP+ + L L ++F P
Sbjct  129   LPSFLFGESMGGALCLLIHFLEPDRFNGAVLVAPMCKISDKVRPKWPIPQALTLISWFFP  188

Query  794   NWRIIFTKPPSRESYREVLKKKLVA-KSPNRFPNERPPAATALELLKVCKYIQNNCHELE  618
                ++ T     +S + VL+K++VA ++P R+   RP   T +ELL+   ++     E++
Sbjct  189   TLPVVPTADLLDKSVK-VLEKRVVARRNPTRYAG-RPRLGTVVELLRFTDWLSERLSEVK  246

Query  617   VPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTL  441
             +P L++ G  D+V D    ++++++A S+DK+++++ GM H L+ GE +E+VELV    L
Sbjct  247   LPFLVVHGSADEVTDPEVSRSLYEAARSEDKSIRVYEGMMHSLLFGETDENVELVRGDIL  306

Query  440   SWIQMR  423
             +W++ R
Sbjct  307   AWLKER  312



>dbj|BAJ99600.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=365

 Score =   186 bits (472),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 108/306 (35%), Positives = 170/306 (56%), Gaps = 11/306 (4%)
 Frame = -1

Query  1310  SREEFYKKHHIIHKEGFVLNENQ---KKIFTQSWQ---HDSCDEPRGVVCMIHGYTSESS  1149
             +  E+Y  H    +  +    +    +++FT+SW+     +   PR +V M+HGY ++ S
Sbjct  54    TESEYYAAHGAEGESSYFTTPDDAGARRLFTRSWRPAGGGAGARPRALVFMVHGYGNDIS  113

Query  1148  WLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSA--RAHHPK  975
             W F+  AV +A++G   +A DLPGHG S G +  +P ++  V D +    S   R  H  
Sbjct  114   WTFQATAVFLARSGFACFAADLPGHGRSHGLQAFVPDLEVAVADLLAFFRSVRRREEHAG  173

Query  974   LPAFLYGESLGGAIAILICLNQK-HVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFA  798
             LP FL+GES+GGAI +LI L      W G +L  PMC +S + +P WP+ E L L + FA
Sbjct  174   LPCFLFGESMGGAICLLIHLRTSPEEWAGAVLVAPMCRISDRIRPRWPVPEILTLVSRFA  233

Query  797   PNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELE  618
             P   I+ T     +S +   K+ + A++P R+ N RP   T +ELL+    +     E+ 
Sbjct  234   PTLPIVPTADLIEKSVKVPAKRLIAARNPMRY-NGRPRLGTVMELLRATDELGARLGEIT  292

Query  617   VPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQ-LIGEPNESVELVFNTTL  441
             +P L++ G  D+V D    +A+ ++AAS+DKT+K++ GM H  L GEP E++E V    L
Sbjct  293   IPFLVVHGSADEVTDPAVSRALHEAAASEDKTIKMYDGMLHSMLFGEPEENIERVRGDIL  352

Query  440   SWIQMR  423
             +W+  R
Sbjct  353   AWLSER  358



>ref|XP_006485838.1| PREDICTED: caffeoylshikimate esterase-like, partial [Citrus sinensis]
Length=227

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 128/193 (66%), Gaps = 2/193 (1%)
 Frame = -1

Query  986  HHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAA  807
            H P LPAFLY ESLGGAIA+   L     W+GLIL+G MCG+S+K+KP WP E  L    
Sbjct  6    HAPDLPAFLYSESLGGAIALYFTLRPTGAWDGLILNGAMCGISQKFKPPWPFEHLLFTVV  65

Query  806  FFAPNWRIIFTKPP-SRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNC  630
            +   +WR+  T       S++E  K+KL   SP R P  RP AATALELL+V + +Q   
Sbjct  66   WLVASWRVGPTHGSLPMVSFKEEWKRKLALSSPRR-PVARPRAATALELLRVSRDLQGRF  124

Query  629  HELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLIGEPNESVELVFN  450
             E+EVP+LI  GGDD VCD   V+ ++K AASKDKTL I+ GMWHQLIGEP E+VELVF 
Sbjct  125  EEVEVPMLICHGGDDVVCDPACVEELYKRAASKDKTLSIYPGMWHQLIGEPEENVELVFG  184

Query  449  TTLSWIQMRANLA  411
              + W++ RA+ A
Sbjct  185  EMVEWLRERASSA  197



>ref|XP_010253357.1| PREDICTED: caffeoylshikimate esterase-like [Nelumbo nucifera]
Length=329

 Score =   174 bits (441),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 111/324 (34%), Positives = 171/324 (53%), Gaps = 15/324 (5%)
 Frame = -1

Query  1283  HIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGL  1104
              I ++E F+LN    K+FT  W   +  EP  ++ M HGY  E S   +   + +A  G 
Sbjct  8     RIKYEEEFILNSRGMKLFTCRWL-PATREPTALIFMCHGYAMECSISMKDTGIRLANAGF  66

Query  1103  FVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS--ARAHHPKLPAFLYGESLGGAIA  930
              VY ID  GHG S G   +IP  D +V+DC     S   R  + K   +L GES+GGA+A
Sbjct  67    AVYGIDYEGHGKSSGLDAYIPCFDDLVNDCSDHFTSICERKENSKKLRYLLGESMGGAVA  126

Query  929   ILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESY  750
             +L+   + + W+G +L  PMC ++ + KP   +   L       P W+II TK     + 
Sbjct  127   LLLHRKKPNYWDGAVLVAPMCKIADEMKPHAVVINVLTQLCKIIPTWKIIPTKDIIDIAI  186

Query  749   REVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQ  570
             +E  +++ V  +P  +   RP   T  +LL V   I+ N HE+++P LI+ GGDDKV D 
Sbjct  187   KEPQRREEVRSNPYCYKG-RPRLKTGNQLLAVSLDIEQNLHEVKLPFLIVHGGDDKVTDP  245

Query  569   NavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRANLARAHKF*  393
             +  K++++SA+S DKT K++ GMWH L  GEP E++ +VF   ++W++ R  L  +    
Sbjct  246   SVSKSLYESASSSDKTFKLYPGMWHALTSGEPVENINVVFGDIINWLEERTTLGNSR---  302

Query  392   PIMHRISIEHQTYLFCTTYSSKFK  321
                    +E +  L C T S   +
Sbjct  303   -------LEMEQKLACDTKSKSLQ  319



>ref|XP_007142700.1| hypothetical protein PHAVU_007G009500g [Phaseolus vulgaris]
 gb|ESW14694.1| hypothetical protein PHAVU_007G009500g [Phaseolus vulgaris]
Length=318

 Score =   174 bits (441),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 109/305 (36%), Positives = 163/305 (53%), Gaps = 25/305 (8%)
 Frame = -1

Query  1286  HHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTG  1107
             H II++E ++ N    KIFT  W   S   P+ ++ M HGY  E S       + +AK G
Sbjct  6     HTIIYEEEYIRNSRGLKIFTCRWLPAS-GSPKALIFMCHGYAMECSITMNSTGIRLAKAG  64

Query  1106  LFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSA--RAHHPKLPAFLYGESLGGAI  933
               ++ ID  GHG SEG  G +   D V+ DCI    S   +A + K   FL GES+GGA+
Sbjct  65    FAMFGIDYEGHGKSEGVPGLVMSFDSVIADCIQHFTSVCEKAEYTKKMRFLMGESMGGAV  124

Query  932   AILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRII---------  780
             A+L+   + + W+G IL  PMC ++++ KP   +   L   +  AP+WRI+         
Sbjct  125   ALLLHREKPYYWDGAILVAPMCKIAEEMKPNSMVVSVLSALSKVAPSWRIVPSPDVIDMA  184

Query  779   FTKPPSRESYREVLKKKLVAKSPNRFPNE-RPPAATALELLKVCKYIQNNCHELEVPLLI  603
             F +P  RE  R            NR+  + +P   TA ELL+V   I+    E+ +P L+
Sbjct  185   FKEPKVREEIR-----------ANRYCYKGKPRLRTAYELLRVSTEIEKRLPEVSLPFLV  233

Query  602   LQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQM  426
             L G +D+V D+   K +   AAS DKTLK++  MWH L+ GEP E++++VF+  ++WI+ 
Sbjct  234   LHGEEDQVTDKAVSKELIDVAASTDKTLKMYPEMWHGLLYGEPPENLQIVFSDIIAWIEK  293

Query  425   RANLA  411
             R N  
Sbjct  294   RCNFG  298



>ref|XP_006292693.1| hypothetical protein CARUB_v10018939mg [Capsella rubella]
 gb|EOA25591.1| hypothetical protein CARUB_v10018939mg [Capsella rubella]
Length=310

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 101/291 (35%), Positives = 162/291 (56%), Gaps = 4/291 (1%)
 Frame = -1

Query  1277  IHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFV  1098
             ++KE +VLN    ++FT SW+ +   EP+ ++ + HGY  ESS      A+ +AK G  V
Sbjct  1     MYKEDYVLNSRGIQLFTCSWKPEEQQEPKALIFLCHGYAMESSITMNSTAMRLAKAGFAV  60

Query  1097  YAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS--ARAHHPKLPAFLYGESLGGAIAIL  924
             Y +D  GHG S G  G++ + D +V D      S   R        FL GES+GGA+ +L
Sbjct  61    YGMDYEGHGKSGGLNGYVRKFDDLVLDVSSHYSSICEREESKGKMRFLMGESMGGAVVLL  120

Query  923   ICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYRE  744
             +   +   W+G +L  PMC +++  KP   +  FL     F P W+I+        +++E
Sbjct  121   LARKKPGFWDGAVLVAPMCKLAEDIKPHPMVISFLTKLTRFIPTWKIVPNNDIIDVAFKE  180

Query  743   VLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNa  564
                +K V ++   +   RP   TA +LL V   ++ N H++ +P ++L G DDKV D+N 
Sbjct  181   SHIRKQVRENEYCYKG-RPRLKTAHQLLMVSLDLEKNLHQVSMPFIVLHGEDDKVTDKNV  239

Query  563   vkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRANL  414
              K +++ A+S DKT K++  MWH L+ GEP E++E+VF   +SW+  RA++
Sbjct  240   SKLLYEVASSSDKTFKLYPNMWHGLLYGEPPENLEIVFADIISWLNERASV  290



>ref|XP_006403485.1| hypothetical protein EUTSA_v10010979mg [Eutrema salsugineum]
 gb|ESQ44938.1| hypothetical protein EUTSA_v10010979mg [Eutrema salsugineum]
Length=312

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/292 (33%), Positives = 165/292 (57%), Gaps = 4/292 (1%)
 Frame = -1

Query  1280  IIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLF  1101
             +++KE +V+N    K+FT SW+ +   EP+ ++ + HGY  ESS      A+ +A+ G  
Sbjct  2     VMYKEDYVVNSRGMKLFTCSWKPEKQQEPKALIFLCHGYGMESSITMNSTAMRLAEAGFA  61

Query  1100  VYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSA--RAHHPKLPAFLYGESLGGAIAI  927
             +Y +D  GHG S G  G+I   D +VHD      S   R  +     FL GES+GGA+ +
Sbjct  62    IYGMDYEGHGKSAGLNGYIKNFDGLVHDVSSHYSSVCEREENKGKMRFLMGESMGGAVVL  121

Query  926   LICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYR  747
             L+   + + W+G +L  PMC ++++ KP   +  FL     F P W+I+ +      +++
Sbjct  122   LLARKKPYFWDGAVLVAPMCKLAEEIKPHPMVISFLTKLTRFIPTWKIVPSNDIIDVAFK  181

Query  746   EVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQN  567
             E   +K V ++   +   RP   TA +LL V   ++ N H++ +P ++L G DDKV D++
Sbjct  182   ESHVRKQVRENEYCYKG-RPRLKTAHQLLMVSLDLEKNLHQVSMPFIVLHGEDDKVTDKD  240

Query  566   avkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRANL  414
               K +++ ++S DKT K++  MWH L+ GE   ++E+VF   ++W+  RA++
Sbjct  241   VSKLLYEVSSSSDKTFKLYPKMWHGLLYGESPANLEIVFGDIITWLNERASV  292



>gb|KDP32952.1| hypothetical protein JCGZ_12983 [Jatropha curcas]
Length=380

 Score =   174 bits (442),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 105/284 (37%), Positives = 160/284 (56%), Gaps = 5/284 (2%)
 Frame = -1

Query  1271  KEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVYA  1092
             KE F +N    +IFT+SW  ++   PR VVC  HGY    ++ FE  A  +A +G  V+A
Sbjct  89    KESFQVNSRGLEIFTKSWLPETS-SPRAVVCYCHGYGDTCTFFFEGIARKLASSGYGVFA  147

Query  1091  IDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHHP--KLPAFLYGESLGGAIAILIC  918
             +D PG G SEG  G+IP  D +V D I      +       LP+FL+G+S+GGA+A+ + 
Sbjct  148   MDYPGFGLSEGLHGYIPSFDALVDDVIEHFSKVKEDPSISTLPSFLFGQSMGGAVALKVH  207

Query  917   LNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREVL  738
             L Q + WNG IL  PMC ++    P   ++  L   A F P  +++  K  +  ++REV 
Sbjct  208   LKQPNAWNGAILVAPMCKIADDMVPPLVVKRLLIGVANFLPTKKLVPQKDLAEAAFREVK  267

Query  737   KKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavk  558
             K++L A +   +  ++P   TALELL+  + I+    E+ +PLL L G  D V D +  K
Sbjct  268   KRELTAYNVIAY-KDKPRLKTALELLRTTQEIEKRLEEVSLPLLTLHGEHDIVTDPSVSK  326

Query  557   avfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQ  429
             A+++ A + DK LK++    H L+ GEP+E +  VFN  +SW+ 
Sbjct  327   ALYEKARNPDKKLKLYKDAQHSLLEGEPDEVIIQVFNDIISWLD  370



>ref|XP_003591520.1| Monoglyceride lipase [Medicago truncatula]
 gb|AES61771.1| alpha/beta hydrolase family protein [Medicago truncatula]
Length=324

 Score =   172 bits (435),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 107/304 (35%), Positives = 165/304 (54%), Gaps = 14/304 (5%)
 Frame = -1

Query  1274  HKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVY  1095
             ++EG+  N    ++FT  W   S   P+ +V + HGY  E S   +     +A  G  V+
Sbjct  7     YQEGYWKNSRGMRLFTCKWLPIS-SSPKALVFLCHGYGMECSGFMKEIGEKLASAGYAVF  65

Query  1094  AIDLPGHGYSEGRRGHIPRIDPVVHDC------ILCLDSARAHHPKLPAFLYGESLGGAI  933
              +D  GHG+S G R +I + D VV+DC      I  L   R        FLYGES+GGA+
Sbjct  66    GMDYEGHGHSAGVRCYITKFDNVVNDCSNFYKSICELQEYRGK----AKFLYGESMGGAV  121

Query  932   AILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRES  753
             A+L+       W+G +   PMC +S+K KP       L       P W+I+ TK     +
Sbjct  122   AVLLHKKDPSFWDGAVFVAPMCKISEKVKPHRVAVSMLSGLEHIFPKWKIVPTKDVIDSA  181

Query  752   YREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCD  573
             +++  K++++ K+   +  ++P   TALELL+    ++ N H++ +P L+L G +DKV D
Sbjct  182   FKDHTKREMIRKNKLIY-QDKPRLKTALELLRTSLSVETNLHQVTLPFLVLHGEEDKVTD  240

Query  572   QNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRA-NLARAHK  399
                 KA+++ A+S DKT+K++ GMWH L  GEP+E++ELVF   +SW+  RA    R   
Sbjct  241   PEVSKALYERASSVDKTIKLYPGMWHGLTAGEPDENIELVFGDIISWLDKRAIGKERIES  300

Query  398   F*PI  387
             F PI
Sbjct  301   FLPI  304



>gb|KFK36834.1| hypothetical protein AALP_AA4G177300 [Arabis alpina]
Length=316

 Score =   171 bits (433),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 104/291 (36%), Positives = 157/291 (54%), Gaps = 5/291 (2%)
 Frame = -1

Query  1280  IIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLF  1101
             ++++E FVLN    K+FT  W+ D   EP+ ++ + HGY  ESS      A  +AK G  
Sbjct  2     VMYEEDFVLNSRGMKLFTCVWKPDK-QEPKAMLFLCHGYAVESSISMNSTATRLAKAGFV  60

Query  1100  VYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS--ARAHHPKLPAFLYGESLGGAIAI  927
             VY +D  GHG SEG  G+I   D +V D      +   R  +     FL GES+GGAI +
Sbjct  61    VYGMDYEGHGKSEGLNGYIKNFDDLVDDVSTHYSTICEREKNKGKMRFLLGESMGGAIVL  120

Query  926   LICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYR  747
             L+   +   W+G +L  PMC ++++ KP   +   L   A F P W+I+        + R
Sbjct  121   LLARKKPDFWDGAVLVAPMCKLAEEIKPHPIVISILTKLARFIPTWKIVPGNDIVDIAVR  180

Query  746   EVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQN  567
             E   +  V ++   +   RP   TA ELL V   ++ N HE+ +P ++L G DDKV D+ 
Sbjct  181   EPHIRNQVRENKYCYKG-RPRLKTAYELLMVSLDLEKNLHEVSIPFIVLHGEDDKVTDKG  239

Query  566   avkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRAN  417
               K ++  A+S DKT K++  MWH L+ GE  E+ E+VF   +SW++ RA+
Sbjct  240   VSKMLYTMASSSDKTFKLYPNMWHALLFGETPENTEIVFGDIISWLEDRAS  290



>ref|XP_002876286.1| esterase/lipase/thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH52545.1| esterase/lipase/thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=312

 Score =   171 bits (433),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 99/293 (34%), Positives = 162/293 (55%), Gaps = 4/293 (1%)
 Frame = -1

Query  1280  IIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLF  1101
             + +KE +V N    ++FT SW+ +   EP+ ++ + HGY  ESS      A+ +A  G  
Sbjct  2     VTYKEDYVSNSRGIQLFTCSWKPEEQQEPKALIFLCHGYAMESSITMSSTAMRLANAGFA  61

Query  1100  VYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS--ARAHHPKLPAFLYGESLGGAIAI  927
             VY +D  GHG S G  G++ + D +VHD      S  AR  +     FL GES+GGA+ +
Sbjct  62    VYGMDYEGHGKSGGLNGYVKKFDDLVHDVYSHYSSICAREENKGKMRFLMGESMGGAVVL  121

Query  926   LICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYR  747
             L+   +   W+G +L  PMC +++  KP   +  FL     F P W+I+ +      +++
Sbjct  122   LLERKKPDFWDGAVLVAPMCKLAEDIKPHPMVISFLTKLTRFIPTWKIVPSNDIIDVAFK  181

Query  746   EVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQN  567
             E   +K V  +   +   RP   TA +LL V   ++ N  ++ +P ++L G DDKV D+N
Sbjct  182   ESHIRKQVRDNEYCYKG-RPRLKTAHQLLLVSLDLEKNLDQVSMPFIVLHGEDDKVTDKN  240

Query  566   avkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRANLA  411
               K +++ A+S DKT K++  MWH L+ GE  E++E+VF+  +SW+  RA++ 
Sbjct  241   VSKLLYEVASSSDKTFKLYPNMWHGLLYGESPENLEIVFSDIISWLNERASVT  293



>ref|XP_011097201.1| PREDICTED: caffeoylshikimate esterase isoform X2 [Sesamum indicum]
Length=341

 Score =   171 bits (434),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 102/283 (36%), Positives = 163/283 (58%), Gaps = 5/283 (2%)
 Frame = -1

Query  1268  EGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVYAI  1089
             E + +N    +IFT+SW  DS   P+ VVC  HGY   S++  E  A  +A +G  V+A+
Sbjct  58    ESYEVNSRGLEIFTKSWLPDSG-SPKAVVCFCHGYGDTSTFFVEGIARKLASSGYGVFAM  116

Query  1088  DLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHHP--KLPAFLYGESLGGAIAILICL  915
             D PG G SEG  G+IP  D +V D +      + +    KLP+FL+G+S+GGA+A+ I L
Sbjct  117   DYPGFGLSEGLHGYIPDFDILVDDVMEHYSKVKENPDLHKLPSFLFGQSMGGAVALKIHL  176

Query  914   NQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREVLK  735
              Q   W+G +L  PMC +++   P W + + L   A   P  +++  K  +  ++R+V K
Sbjct  177   KQPDAWSGAVLVAPMCKIAEDMVPPWLVTKILIGVAKVLPKHKLVPQKDLAELAFRDVKK  236

Query  734   KKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavka  555
             ++  A +   +   +P   TALELL+  K I+    ++ +PLLIL G +DKV D +  KA
Sbjct  237   RQQTAYNVVAY-KHKPRLGTALELLRTTKEIEQQLEKVSLPLLILHGKEDKVTDPSVSKA  295

Query  554   vfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQ  429
             +++ A+S DK L ++ G +H L+ GEP+E +  VF   ++W+ 
Sbjct  296   LYEKASSADKKLNLYDGAFHALLEGEPDEMILQVFGDIVTWLD  338



>ref|XP_011097199.1| PREDICTED: caffeoylshikimate esterase isoform X1 [Sesamum indicum]
Length=375

 Score =   171 bits (434),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 102/283 (36%), Positives = 164/283 (58%), Gaps = 5/283 (2%)
 Frame = -1

Query  1268  EGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVYAI  1089
             E + +N    +IFT+SW  DS   P+ VVC  HGY   S++  E  A  +A +G  V+A+
Sbjct  92    ESYEVNSRGLEIFTKSWLPDSG-SPKAVVCFCHGYGDTSTFFVEGIARKLASSGYGVFAM  150

Query  1088  DLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHHP--KLPAFLYGESLGGAIAILICL  915
             D PG G SEG  G+IP  D +V D +      + +    KLP+FL+G+S+GGA+A+ I L
Sbjct  151   DYPGFGLSEGLHGYIPDFDILVDDVMEHYSKVKENPDLHKLPSFLFGQSMGGAVALKIHL  210

Query  914   NQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREVLK  735
              Q   W+G +L  PMC +++   P W + + L   A   P  +++  K  +  ++R+V K
Sbjct  211   KQPDAWSGAVLVAPMCKIAEDMVPPWLVTKILIGVAKVLPKHKLVPQKDLAELAFRDVKK  270

Query  734   KKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavka  555
             ++  A +   + + +P   TALELL+  K I+    ++ +PLLIL G +DKV D +  KA
Sbjct  271   RQQTAYNVVAYKH-KPRLGTALELLRTTKEIEQQLEKVSLPLLILHGKEDKVTDPSVSKA  329

Query  554   vfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQ  429
             +++ A+S DK L ++ G +H L+ GEP+E +  VF   ++W+ 
Sbjct  330   LYEKASSADKKLNLYDGAFHALLEGEPDEMILQVFGDIVTWLD  372



>ref|XP_004963835.1| PREDICTED: monoglyceride lipase-like [Setaria italica]
Length=359

 Score =   170 bits (431),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 103/291 (35%), Positives = 160/291 (55%), Gaps = 5/291 (2%)
 Frame = -1

Query  1280  IIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLF  1101
             I + E +V N +  ++FT  W   S   P+ +V + HGY +E S       + MA  G  
Sbjct  3     IEYHEEYVSNPSGVQLFTCRWLPAS-SSPKALVFLCHGYGAECSEFMRECGIKMATAGYG  61

Query  1100  VYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS--ARAHHPKLPAFLYGESLGGAIAI  927
             V+ ID  GHG S G R +I + D +V DC     S      +     FLYGES+GGA+ +
Sbjct  62    VFGIDYEGHGKSMGARCYIQKFDNLVTDCDQFFKSICEMEDYRNKSRFLYGESMGGAVVL  121

Query  926   LICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYR  747
             L+       W+G +L  PMC +S+K KP   +  FL       P W+I+ TK     +++
Sbjct  122   LLHRKDPAFWDGAVLVAPMCKISEKVKPHPLVVSFLTKVEEIIPKWKIVPTKDIINSTFK  181

Query  746   EVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQN  567
             + +K++ V K+   +  +RP   +ALELL+    +++N  E+ VP L+L G  D V D  
Sbjct  182   DPIKREKVRKNKLIY-QDRPRLKSALELLRTSMDVEDNLSEVRVPFLVLHGEADTVTDPE  240

Query  566   avkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRAN  417
               + +++ +AS DKT+K++ GMWH L  GEP+E+VELVF+  L+W+  R+ 
Sbjct  241   VSRTLYERSASTDKTIKLYPGMWHGLTAGEPDENVELVFSDILAWLDQRSR  291



>gb|ACJ85425.1| unknown [Medicago truncatula]
Length=256

 Score =   167 bits (423),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 94/255 (37%), Positives = 146/255 (57%), Gaps = 4/255 (2%)
 Frame = -1

Query  1178  MIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLD  999
             MIHGY ++ SW F+   + +A+ G   +++DL GHG+S+G +  +P +D VV DC+   +
Sbjct  1     MIHGYGNDISWTFQSTPIFLAQMGFACFSLDLQGHGHSQGLKAFVPSVDLVVQDCLSFFN  60

Query  998   SAR--AHHPKLPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEE  825
             S +  ++   LP FLYGES+GGAI++LI       + G IL  PMC +S K +P WP+ +
Sbjct  61    SVKKDSNFFGLPCFLYGESMGGAISLLIHFADPKGFQGAILVAPMCKISDKVRPKWPIPQ  120

Query  824   FLPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKY  645
              L   A F P   I+ T     +S +   KK +   +P R+   +P   T +ELL+V   
Sbjct  121   ILTFLAKFFPTLPIVPTPDLLYKSVKVDHKKVIAQMNPLRY-RGKPRLGTVVELLRVTDI  179

Query  644   IQNNCHELEVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNES  468
             +     ++E+P ++L G  D V D    + +++ A S DKT+K+F GM H L+ GE +E 
Sbjct  180   LSRKLCDVELPFIVLHGSADVVTDPEVSRGLYEEARSDDKTIKVFDGMMHSLLFGETDED  239

Query  467   VELVFNTTLSWIQMR  423
             VE+V N  L W+  R
Sbjct  240   VEIVRNDILQWLNAR  254



>ref|XP_010504364.1| PREDICTED: caffeoylshikimate esterase-like [Camelina sativa]
Length=310

 Score =   169 bits (427),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 98/292 (34%), Positives = 160/292 (55%), Gaps = 4/292 (1%)
 Frame = -1

Query  1280  IIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLF  1101
             + +KE +VLN    ++FT SW+ +   EP+ ++ + HGY  ESS      A+ +A  G  
Sbjct  2     VTYKEDYVLNSRGIQLFTCSWKPEEQQEPKALIFLCHGYAMESSITMSSTAMRLANVGFA  61

Query  1100  VYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS--ARAHHPKLPAFLYGESLGGAIAI  927
             VY +D  GHG S G  G++ + D +V D      S   R  +     FL GES+GGA+ +
Sbjct  62    VYGMDYEGHGKSGGLNGYVKKFDDLVLDVSSHYSSICEREENKGKKRFLMGESMGGAVVL  121

Query  926   LICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYR  747
             L+   +   W+G +L  PMC +++  KP   +  FL     F P W+I+ +      +++
Sbjct  122   LLARKKPDFWDGAVLVAPMCKLAEDIKPHPMVVSFLTKLTRFIPTWKIVPSNDIIDVAFK  181

Query  746   EVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQN  567
             E   +K V ++   +   RP   TA +LL V   ++ N H++ +P ++L G DDKV DQN
Sbjct  182   ESHIRKQVRENEYCYKG-RPRLKTAHQLLMVSLDLEKNLHQVSMPFIVLHGEDDKVTDQN  240

Query  566   avkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRANL  414
               K +++ A+S DKT K++  MWH L+ GE  E++ +VF   +SW+   A++
Sbjct  241   VSKLLYEVASSSDKTFKLYPNMWHGLLYGESPENLTIVFADIISWLNESASV  292



>ref|XP_006411166.1| hypothetical protein EUTSA_v10016977mg [Eutrema salsugineum]
 gb|ESQ52619.1| hypothetical protein EUTSA_v10016977mg [Eutrema salsugineum]
Length=311

 Score =   169 bits (427),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 101/291 (35%), Positives = 160/291 (55%), Gaps = 5/291 (2%)
 Frame = -1

Query  1280  IIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLF  1101
             + ++E FVLN    K+FT  W+     EP+ ++   HGY  ESS      A  +AK G  
Sbjct  2     LTYEEDFVLNSRDMKLFTCVWKPVE-KEPKALIFFCHGYAVESSITMNSTATRLAKAGFA  60

Query  1100  VYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS--ARAHHPKLPAFLYGESLGGAIAI  927
             VYA+D  GHG SEG  G+I   D +V D  +   +   +  +     FL GES+GGA+ +
Sbjct  61    VYAMDYEGHGKSEGLDGYISNFDDLVDDVSIHYSTICEKEENKGKMRFLLGESMGGAVVL  120

Query  926   LICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYR  747
             L+  N+   W+G +L  PMC ++++ KP   +   L   A+F P W+I+        + R
Sbjct  121   LLARNKPDFWDGAVLVAPMCKLAEEIKPHPVVTSILTKLAWFIPTWKIVPGNDIIDIAIR  180

Query  746   EVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQN  567
             E   +  V ++   +   RP   TA ELL V   ++ N H++ +P ++L G DDKV D++
Sbjct  181   EPHIRNQVRENKYCYKG-RPRLKTAYELLMVSLDLEKNLHQVSIPFIVLHGEDDKVTDKS  239

Query  566   avkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRAN  417
               K +++ A+S DKT K++  MWH L+ GE  E+ E+VF   ++W++ RA+
Sbjct  240   ISKMLYELASSSDKTFKLYPNMWHALLYGETPENSEIVFGDIINWLEKRAS  290



>ref|XP_002977997.1| hypothetical protein SELMODRAFT_14581, partial [Selaginella moellendorffii]
 gb|EFJ20654.1| hypothetical protein SELMODRAFT_14581, partial [Selaginella moellendorffii]
Length=278

 Score =   167 bits (423),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 99/280 (35%), Positives = 156/280 (56%), Gaps = 5/280 (2%)
 Frame = -1

Query  1253  NENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVYAIDLPGH  1074
             N    ++FT  W     D  +G+V + HGY  E S   +     +++ G  V+ ID  GH
Sbjct  1     NSRGTRLFTCRWIPLRQD-VKGLVFLCHGYGMECSRFMKGTGQRLSRAGYAVFGIDYEGH  59

Query  1073  GYSEGRRGHIPRIDPVVHDCILCLDSARA--HHPKLPAFLYGESLGGAIAILICLNQKHV  900
             G SEGRR +I   D +V DCI+   + R    + + P FLYGES+GGA+A+L+       
Sbjct  60    GRSEGRRCYIRSFDYLVDDCIVFFKNVREWPEYRRKPCFLYGESMGGAVALLVQKKTPGE  119

Query  899   WNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREVLKKKLVA  720
             WNG IL  PMC +SK  KP   L   L   A   P W+++  K    +++++ +K++ + 
Sbjct  120   WNGAILVAPMCKISKNMKPHPLLIRVLVKLARTIPTWKVVPIKDVIGQAFKDPVKREEIR  179

Query  719   KSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavfksa  540
              +P  +   RP   TA+E+L     ++   HE+++P L+L G +D V D    + ++ SA
Sbjct  180   DNPYVYQG-RPRLRTAVEMLYTSLNLECQLHEVKLPFLVLHGENDVVTDPAISQELYDSA  238

Query  539   askdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMR  423
              S DK +KI+ GMWH L  GEP+E++++VF   ++W+ MR
Sbjct  239   GSLDKAIKIYPGMWHGLTSGEPDENIDMVFEDIVTWLDMR  278



>ref|NP_191078.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 emb|CAB75752.1| lipase-like protein [Arabidopsis thaliana]
 gb|AEE79350.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=312

 Score =   168 bits (425),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 97/293 (33%), Positives = 162/293 (55%), Gaps = 4/293 (1%)
 Frame = -1

Query  1280  IIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLF  1101
             +++KE +V N    ++FT SW+ +   EP+ ++ + HGY  ESS      AV +A  G  
Sbjct  2     VMYKEDYVSNSRGIQLFTCSWKQEEQQEPKALIFLCHGYAMESSITMSSTAVRLANAGFS  61

Query  1100  VYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS--ARAHHPKLPAFLYGESLGGAIAI  927
             VY +D  GHG S G  G++ + D +V D      S      +     FL GES+GGA+ +
Sbjct  62    VYGMDYEGHGKSGGLNGYVKKFDDLVQDVSSHYSSICELEENKGKMRFLMGESMGGAVVL  121

Query  926   LICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYR  747
             L+   + + W+G +L  PMC +++  KP   +  FL     F P W+I+ +      +++
Sbjct  122   LLERKKPNFWDGAVLVAPMCKLAEDIKPHPMVISFLTKLTRFIPTWKIVPSNDIIDVAFK  181

Query  746   EVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQN  567
             E   +K V  +   +   RP   TA +LL V   ++ N  ++ +P ++L G DDKV D+N
Sbjct  182   ETHIRKQVRDNEYCYKG-RPRLKTAHQLLMVSLDLEKNLDQVSMPFIVLHGEDDKVTDKN  240

Query  566   avkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRANLA  411
               K +++ A+S DKT K++  MWH L+ GE  E++E+VF+  +SW++ RA++ 
Sbjct  241   VSKLLYEVASSSDKTFKLYPNMWHGLLYGESPENLEIVFSDIISWLKERASVT  293



>ref|XP_002966752.1| hypothetical protein SELMODRAFT_85161, partial [Selaginella moellendorffii]
 gb|EFJ32779.1| hypothetical protein SELMODRAFT_85161, partial [Selaginella moellendorffii]
Length=405

 Score =   170 bits (431),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 100/283 (35%), Positives = 158/283 (56%), Gaps = 5/283 (2%)
 Frame = -1

Query  1262  FVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVYAIDL  1083
             F+ N    ++FT  W     D  +G+V + HGY  E S   +     +++ G  V+ ID 
Sbjct  3     FIYNSRGTRLFTCRWIPLRQDV-KGLVFLCHGYGMECSRFMKGTGQRLSRAGYAVFGIDY  61

Query  1082  PGHGYSEGRRGHIPRIDPVVHDCILCLDSARA--HHPKLPAFLYGESLGGAIAILICLNQ  909
              GHG SEGRR +I   D +V DCI+   + R    + + P FLYGES+GGA+A+L+    
Sbjct  62    EGHGRSEGRRCYIRSFDDLVDDCIVFFKNVREWPEYRRKPCFLYGESMGGAVALLVQKKT  121

Query  908   KHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREVLKKK  729
                WNG IL  PMC +SK  KP   L   L   A   P W+++  K    +++++ +K++
Sbjct  122   PGEWNGAILVAPMCKISKNMKPHPLLIRVLVKLARTIPTWKVVPIKDVIGQAFKDPVKRE  181

Query  728   LVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavkavf  549
              +  +P  +   RP   TA+E+L     ++   HE+++P L+L G +D V D    + ++
Sbjct  182   EIRDNPYVY-QGRPRLRTAVEMLYTSLNLECQLHEVKLPFLVLHGENDVVTDPAISQELY  240

Query  548   ksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMR  423
              SA S DK +KI+ GMWH L  GEP+E++++VF   ++W+ MR
Sbjct  241   DSAGSLDKAIKIYPGMWHGLTSGEPDENIDMVFEDIVTWLDMR  283



>ref|XP_006383452.1| hypothetical protein POPTR_0005s15640g [Populus trichocarpa]
 gb|ERP61249.1| hypothetical protein POPTR_0005s15640g [Populus trichocarpa]
Length=385

 Score =   170 bits (430),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 157/288 (55%), Gaps = 5/288 (2%)
 Frame = -1

Query  1271  KEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVYA  1092
             +E + +N    +IFT+SW   S   P+ VVC  HGY    ++  E  A  +A +G   +A
Sbjct  95    EESYEVNSRGLEIFTKSWLPKSS-SPKAVVCFCHGYGDTCTFFVEGIARKLASSGYGFFA  153

Query  1091  IDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARA--HHPKLPAFLYGESLGGAIAILIC  918
             +D PG+G SEG  G+IP  D +V D I      +       LP+FL+GESLGGA+A+ + 
Sbjct  154   MDYPGYGLSEGLHGYIPSFDRLVDDVIEHYSKVKEKPEFRTLPSFLFGESLGGAVALKVH  213

Query  917   LNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREVL  738
             L Q + WNG IL  PMC ++    P W + + L   A   P  +++  K  +  ++R+  
Sbjct  214   LKQPNAWNGAILVAPMCKIADDMTPPWLVTQILIGVANLLPKHKLVPQKDLAEAAFRDPK  273

Query  737   KKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavk  558
              +KL A +   +  ++P   TALE+L+  + I+    E+ +PLLIL G  D V D +  K
Sbjct  274   NRKLAAYNVIAY-KDKPRLKTALEMLRTTQEIERRLEEVSLPLLILHGEADIVTDPSVSK  332

Query  557   avfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRAN  417
              + + A   DK LK++   +H L+ GEP+E +  VFN  +SW+  R+ 
Sbjct  333   TLHEKACCSDKKLKLYKDAYHALLEGEPDEMIIQVFNDIISWLDERSR  380



>gb|ABK24479.1| unknown [Picea sitchensis]
Length=346

 Score =   169 bits (427),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 103/306 (34%), Positives = 165/306 (54%), Gaps = 8/306 (3%)
 Frame = -1

Query  1319  GDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLF  1140
              D+S ++     +I ++E F+ N    K+FT  W   +  E + ++C+ HGY  E S   
Sbjct  4     ADMSGDQL---SNIKYEEEFIQNSRGMKLFTCRWL-PADREAKAIICLCHGYGMECSIFM  59

Query  1139  ELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSA--RAHHPKLPA  966
             E   V +AK G  V+ IDL GHG S G R +I   D +V D +    S      + +   
Sbjct  60    EDTGVRLAKAGYAVFGIDLEGHGKSAGTRCYIKNFDDLVMDSVTFFRSVAESIEYREKAR  119

Query  965   FLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWR  786
             FLYGES+GG +A+LI   Q + WNG +L  PMC ++++ KP   +   L   +   P W+
Sbjct  120   FLYGESMGGVVALLIHRKQPNYWNGAVLVAPMCKIAEEIKPHPLVISILKKLSLIIPTWK  179

Query  785   IIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLL  606
             I+ T+     ++++  K++ +  +P  +  ++P   T  ELL     ++    E+ +P L
Sbjct  180   IVPTENIIDSAFKDPEKRQKIRANPYIY-QDKPRLKTGYELLVTSLDMEKRLDEVSLPFL  238

Query  605   ILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQ  429
             ++ G DDKV D +  K ++ SA S DKTLK++  MWH L  GEP E +ELVF+  ++W+ 
Sbjct  239   VVHGEDDKVTDPSVSKLLYTSAKSSDKTLKLYPDMWHGLTYGEPPEHIELVFSDIVAWLG  298

Query  428   MRANLA  411
              R+  A
Sbjct  299   KRSGAA  304



>gb|ABK25268.1| unknown [Picea sitchensis]
Length=346

 Score =   169 bits (427),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 103/306 (34%), Positives = 165/306 (54%), Gaps = 8/306 (3%)
 Frame = -1

Query  1319  GDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLF  1140
              D+S ++     +I ++E F+ N    K+FT  W   +  E + ++C+ HGY  E S   
Sbjct  4     ADMSGDQL---SNIKYEEEFIQNSRGMKLFTCRWL-PADREAKAIICLCHGYGMECSIFM  59

Query  1139  ELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSA--RAHHPKLPA  966
             E   V +AK G  V+ IDL GHG S G R +I   D +V D +    S      + +   
Sbjct  60    EDTGVRLAKAGYAVFGIDLEGHGKSAGTRCYIKNFDDLVMDSVTFFRSVAESIEYREKAR  119

Query  965   FLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWR  786
             FLYGES+GG +A+LI   Q + WNG +L  PMC ++++ KP   +   L   +   P W+
Sbjct  120   FLYGESMGGVVALLIHRKQPNYWNGAVLVAPMCKIAEEIKPHPLVISILKKLSLIIPTWK  179

Query  785   IIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLL  606
             I+ T+     ++++  K++ +  +P  +  ++P   T  ELL     ++    E+ +P L
Sbjct  180   IVPTENIIDSAFKDPEKRQKIRANPYIY-QDKPRLKTGYELLVTSLDMEKRLDEVSLPFL  238

Query  605   ILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQ  429
             ++ G DDKV D +  K ++ SA S DKTLK++  MWH L  GEP E +ELVF+  ++W+ 
Sbjct  239   VVHGEDDKVTDPSVSKLLYTSAKSSDKTLKLYPDMWHGLTYGEPPEHIELVFSDIVAWLG  298

Query  428   MRANLA  411
              R+  A
Sbjct  299   KRSGAA  304



>ref|XP_004307458.1| PREDICTED: monoglyceride lipase-like isoform 1 [Fragaria vesca 
subsp. vesca]
Length=318

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 99/300 (33%), Positives = 162/300 (54%), Gaps = 10/300 (3%)
 Frame = -1

Query  1283  HIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGL  1104
             ++I++E ++ N    K+FT  W  ++   P+ ++ + HGY  E S      A+ +AK G 
Sbjct  7     NVIYEEEYIFNSRGMKLFTCKWLPENNKPPKALILICHGYGMECSITMNSTAIRLAKAGF  66

Query  1103  FVYAIDLPGHGYSEGRRGHIPRIDPVVHDCI-----LCLDSARAHHPKLPAFLYGESLGG  939
              +Y ID  GHG S G  G +   D VV DC      +C         +   +L GES+GG
Sbjct  67    AIYGIDYEGHGKSAGLAGFVKSFDAVVDDCTSHFTNICESKENKGKTR---YLLGESMGG  123

Query  938   AIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSR  759
             A+A+L+   +   W+G +L  PMC +S + KP   +   L       P W+II T     
Sbjct  124   AVALLVHRKKPEYWDGAVLVAPMCKISDEMKPSPVVVSVLTQLCRVIPTWKIIPTNDVID  183

Query  758   ESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKV  579
              +++    +K V ++P  +   RP   T  ELL+V   ++    E+ +P LIL G +DKV
Sbjct  184   FAFKVPEVRKQVRENPYCYKG-RPRLQTGTELLRVSTELEQRLQEVTLPFLILHGEEDKV  242

Query  578   CDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRANLARAH  402
              D++A K +++ A+S DKTLK++  MWH L+ GEP E++E+VF+  ++W+  R ++A + 
Sbjct  243   TDKSASKQLYEVASSYDKTLKLYPEMWHGLLYGEPLENIEVVFSDMINWLDKRCSMANSR  302



>ref|XP_010908885.1| PREDICTED: caffeoylshikimate esterase-like isoform X1 [Elaeis 
guineensis]
Length=302

 Score =   167 bits (423),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 103/296 (35%), Positives = 164/296 (55%), Gaps = 5/296 (2%)
 Frame = -1

Query  1286  HHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTG  1107
              +I ++E F+ N +  K+FT  W  ++ D P+ ++ + HGY  E S       + +AK G
Sbjct  6     ENIRYEEEFITNPHGLKLFTCRWLPENSD-PKALIFLCHGYGMECSISMRDTGIRLAKAG  64

Query  1106  LFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSA--RAHHPKLPAFLYGESLGGAI  933
               VY +D  GHG S G +G+IP  + +V +C     S   R  + K   FL GES+GGA+
Sbjct  65    YAVYGLDYEGHGKSSGLQGYIPSFNALVDNCSNYFMSVCERQENEKKQRFLIGESMGGAV  124

Query  932   AILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRES  753
             A+L+   +   W G IL  PMC ++ K KP   +   L       P W+I+ T+     +
Sbjct  125   ALLLHRKEPTYWKGAILVAPMCKIADKMKPHPIVVSILRKLCNIVPTWKIVPTQDIINAA  184

Query  752   YREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCD  573
              +   K++ +  +P  +   +P   TA ELL V   I+ N +++ +P L++ GGDD V D
Sbjct  185   VKNPEKREEIRSNPYCYKG-KPRLQTAHELLMVSLDIEKNLNQVSLPFLVMHGGDDAVTD  243

Query  572   QNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRANLAR  408
              +  K +++S++SKDKT K++ GMWH L  GEP E++ELVF+  ++W+  RA   R
Sbjct  244   PSVSKLLYESSSSKDKTFKLYPGMWHALTSGEPLENIELVFSDIVAWLDERATSRR  299



>ref|XP_004307459.1| PREDICTED: monoglyceride lipase-like isoform 2 [Fragaria vesca 
subsp. vesca]
Length=314

 Score =   167 bits (423),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 99/300 (33%), Positives = 162/300 (54%), Gaps = 10/300 (3%)
 Frame = -1

Query  1283  HIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGL  1104
             ++I++E ++ N    K+FT  W  ++   P+ ++ + HGY  E S      A+ +AK G 
Sbjct  3     NVIYEEEYIFNSRGMKLFTCKWLPENNKPPKALILICHGYGMECSITMNSTAIRLAKAGF  62

Query  1103  FVYAIDLPGHGYSEGRRGHIPRIDPVVHDCI-----LCLDSARAHHPKLPAFLYGESLGG  939
              +Y ID  GHG S G  G +   D VV DC      +C         +   +L GES+GG
Sbjct  63    AIYGIDYEGHGKSAGLAGFVKSFDAVVDDCTSHFTNICESKENKGKTR---YLLGESMGG  119

Query  938   AIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSR  759
             A+A+L+   +   W+G +L  PMC +S + KP   +   L       P W+II T     
Sbjct  120   AVALLVHRKKPEYWDGAVLVAPMCKISDEMKPSPVVVSVLTQLCRVIPTWKIIPTNDVID  179

Query  758   ESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKV  579
              +++    +K V ++P  +   RP   T  ELL+V   ++    E+ +P LIL G +DKV
Sbjct  180   FAFKVPEVRKQVRENPYCYKG-RPRLQTGTELLRVSTELEQRLQEVTLPFLILHGEEDKV  238

Query  578   CDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRANLARAH  402
              D++A K +++ A+S DKTLK++  MWH L+ GEP E++E+VF+  ++W+  R ++A + 
Sbjct  239   TDKSASKQLYEVASSYDKTLKLYPEMWHGLLYGEPLENIEVVFSDMINWLDKRCSMANSR  298



>ref|XP_010517285.1| PREDICTED: caffeoylshikimate esterase-like [Camelina sativa]
Length=317

 Score =   167 bits (424),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 99/292 (34%), Positives = 158/292 (54%), Gaps = 11/292 (4%)
 Frame = -1

Query  1274  HKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVY  1095
             ++E F+ N    K+FT  W   + D PR +V + HGY  E S      A  + K G  VY
Sbjct  10    YEESFIKNTRGLKLFTCRWVPTNKD-PRALVFLCHGYGMECSITMNSTARRLVKAGYAVY  68

Query  1094  AIDLPGHGYSEGRRGHIPRIDPVVHD-----CILCLDSARAHHPKLPAFLYGESLGGAIA  930
              +D  GHG S+G   +IP  D +V D       +C    R  + +   F+ GES+GGA+ 
Sbjct  69    GMDYEGHGKSDGLSAYIPNFDNLVDDVSTHYTTIC---EREENKRKMRFMLGESMGGAVV  125

Query  929   ILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESY  750
             +L+C  +   W+G +L  PMC ++++ KP   +   L       P W+II ++     SY
Sbjct  126   VLLCRKKPDFWDGALLVAPMCKIAEEMKPSPFVISILTKLISVIPKWKIIPSQDIIEISY  185

Query  749   REVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQ  570
             +E   +K V ++P  +   RP   TA ELL++   ++    E+ +P ++L G DDKV D+
Sbjct  186   KEPDIRKQVRENPLCYKG-RPRLKTAYELLRISNDLEKRLQEVSLPFMVLHGDDDKVTDK  244

Query  569   NavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRAN  417
                + ++K A S DKTLK++ GMWH L+ GE  E++E+VF   + W++ R++
Sbjct  245   AVSQELYKVALSSDKTLKLYPGMWHGLLNGETQENIEIVFADVIGWLEKRSD  296



>gb|KFK34770.1| hypothetical protein AALP_AA5G191400 [Arabis alpina]
Length=312

 Score =   167 bits (422),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 97/296 (33%), Positives = 162/296 (55%), Gaps = 10/296 (3%)
 Frame = -1

Query  1280  IIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLF  1101
             + +KE +V+N    ++FT SW+ ++  EP+ ++ + HGY  ESS      A+ +   G  
Sbjct  2     VTYKEEYVVNSRGMELFTCSWEPENQQEPKALIFICHGYAMESSITMNSTAMRLVNAGFA  61

Query  1100  VYAIDLPGHGYSEGRRGHIPRIDPVVHDC-----ILCLDSARAHHPKLPAFLYGESLGGA  936
             VY +D  GHG S G  G+I     +VHD       +C    R  +     FL GES+GGA
Sbjct  62    VYGMDYEGHGKSGGLNGYIKNFHGLVHDVSNHYSTIC---EREENKGKMRFLMGESMGGA  118

Query  935   IAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRE  756
             +++L+   +   W+G IL  PMC +++  KP   +  FL       P W+I+ T      
Sbjct  119   VSLLLAREKPDFWDGAILVAPMCKIAEDIKPHPMVISFLAKLTRVIPTWKIVPTNDIIDV  178

Query  755   SYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVC  576
             +++E   +K V ++   +   RP   TA +LL V   ++ N H++ +P ++L G DDKV 
Sbjct  179   AFKESHIRKQVRENDYCYKG-RPRLKTAHQLLLVSMDLEKNLHQVTMPFIVLHGEDDKVT  237

Query  575   DQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRANLA  411
             D++  K +++ ++S DKT K++  MWH L+ GE  E++E+VF   +SW+  RA++ 
Sbjct  238   DKDVSKLLYEVSSSSDKTFKLYPNMWHGLLYGESPENLEIVFGDIISWLNKRASVT  293



>ref|XP_010505610.1| PREDICTED: caffeoylshikimate esterase-like, partial [Camelina 
sativa]
Length=320

 Score =   167 bits (423),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 99/292 (34%), Positives = 158/292 (54%), Gaps = 11/292 (4%)
 Frame = -1

Query  1274  HKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVY  1095
             ++E F+ N    K+FT  W   + D PR +V + HGY  E S      A  + K G  VY
Sbjct  13    YEESFIKNTRGLKLFTCRWVPTNKD-PRALVFLCHGYGMECSITMNSTARRLVKAGYAVY  71

Query  1094  AIDLPGHGYSEGRRGHIPRIDPVVHD-----CILCLDSARAHHPKLPAFLYGESLGGAIA  930
              +D  GHG S+G   +IP  D +V D       +C    R  + +   F+ GES+GGA+ 
Sbjct  72    GMDYEGHGKSDGLSAYIPNFDNLVDDVSTHYTTIC---EREENKRKMRFMLGESMGGAVV  128

Query  929   ILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESY  750
             +L+C  +   W+G +L  PMC ++++ KP   +   L       P W+II ++     SY
Sbjct  129   VLLCRKKPDFWDGALLVAPMCKIAEEMKPSPFVISILTKLISVIPKWKIIPSQDIIEISY  188

Query  749   REVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQ  570
             +E   +K V ++P  +   RP   TA ELL++   ++    E+ +P ++L G DDKV D+
Sbjct  189   KEPDIRKQVRENPLCYKG-RPRLKTAYELLRISNDLEKRLQEVSLPFMVLHGDDDKVTDK  247

Query  569   NavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRAN  417
                + ++K A S DKTLK++ GMWH L+ GE  E++E+VF   + W++ R++
Sbjct  248   AVSQELYKVALSSDKTLKLYPGMWHGLLNGETQENIEIVFADVIGWLEKRSD  299



>ref|XP_010517284.1| PREDICTED: caffeoylshikimate esterase-like [Camelina sativa]
Length=311

 Score =   167 bits (422),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 101/290 (35%), Positives = 161/290 (56%), Gaps = 5/290 (2%)
 Frame = -1

Query  1280  IIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLF  1101
             ++++EGF+LN    K+FT  W+ D  +EP+  + + HGY  ESS     +A  +AK G  
Sbjct  2     VLYEEGFILNSRGMKLFTCVWKPDK-EEPKAFLFLCHGYAMESSITMNSSATRLAKAGFA  60

Query  1100  VYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS--ARAHHPKLPAFLYGESLGGAIAI  927
             VY +D  GHG SEG  G+I   D +V D      S   +  +     FL GES+GGA+A+
Sbjct  61    VYGMDYEGHGKSEGLNGYISDFDRLVDDVSNHYSSICEKEENKGKMRFLLGESMGGALAL  120

Query  926   LICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYR  747
             L+   +   W+G +L  PMC ++ + KP   +   L   A F P W+I+        + +
Sbjct  121   LLARKKPDFWDGAVLVAPMCKLADEVKPHPVVISILIKLAKFIPTWKIVPGNDIIDIAVK  180

Query  746   EVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQN  567
             E   +K V ++   +   RP   TA +LL V   ++ N H++ +P ++L G DDKV D++
Sbjct  181   EAHIRKQVRENKYCYKG-RPRLNTAYQLLLVSLDLEKNLHQVSIPFIVLHGEDDKVTDKS  239

Query  566   avkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRA  420
               K +++ A+S DKT K++  MWH L+ GE  E+ E+VF   ++W++ RA
Sbjct  240   VSKLLYEVASSSDKTFKLYPNMWHALLYGETPENSEIVFGDIINWLEDRA  289



>ref|XP_008368665.1| PREDICTED: caffeoylshikimate esterase-like [Malus domestica]
Length=348

 Score =   167 bits (423),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 102/284 (36%), Positives = 158/284 (56%), Gaps = 7/284 (2%)
 Frame = -1

Query  1271  KEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVYA  1092
             +E + +N    KIF +SW   +   P+ +VC  HGY    ++ FE  A  +A  G  V+A
Sbjct  58    EESYEVNSRGLKIFCKSWL-PATSRPKAIVCYCHGYGXTCTFFFEGIARKLASNGYGVFA  116

Query  1091  IDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHHPKL---PAFLYGESLGGAIAILI  921
             +D PG G SEG  GHIP  D +V D I      +   P+L   P FL+G+SLGGA+A+  
Sbjct  117   MDYPGFGLSEGLHGHIPSFDRLVDDVIEHYSKVK-EQPELRGLPTFLFGQSLGGAVALKA  175

Query  920   CLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREV  741
              L Q   WNG IL  PMC +S+   P W L + L   A F P  +++  K  +  +++++
Sbjct  176   HLKQPSAWNGAILVAPMCKISEDMVPPWILTQILIGVAKFLPKKKLVPQKNLAEAAFKDL  235

Query  740   LKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNav  561
              K+++ A +   +  ++P   TALE+L+  + I+    E+ +PLLIL G  D V D +  
Sbjct  236   KKREMTAYNVISY-KDKPRLQTALEMLRTTEEIERRLEEVSLPLLILHGEADIVTDPSVS  294

Query  560   kavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWI  432
             KA+++ A+S DK L ++   WH L+ GE +  +  VF+  LSW+
Sbjct  295   KALYEKASSSDKKLILYMDAWHSLLEGESDAMINRVFSDILSWL  338



>ref|XP_003579070.1| PREDICTED: caffeoylshikimate esterase-like [Brachypodium distachyon]
Length=337

 Score =   167 bits (422),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 105/313 (34%), Positives = 164/313 (52%), Gaps = 10/313 (3%)
 Frame = -1

Query  1331  TSPYGDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSES  1152
             TS Y  +  E  Y      ++E  V N    K+FT  W        + +V + HGY  E 
Sbjct  2     TSKYTGVVDEGNYS-----YEEEMVNNARGMKLFTCRWLPPKSQPVKALVFICHGYAVEC  56

Query  1151  SWLFELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHHPK-  975
             S       V +A+ G  VY +D  GHG SEG +G++P  D +V+DC     +A A  P  
Sbjct  57    SVTMRGTGVRLAQAGYAVYGVDYEGHGKSEGLQGYVPSFDLLVNDCDAFFAAAVASTPNT  116

Query  974   -LPAFLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFA  798
              LP FL GES+GGA+A+L+   +   W+G +L  PMC ++ + KP   +   L       
Sbjct  117   DLPRFLLGESMGGAVALLLHRARPSYWSGAVLVAPMCKIADEMKPHPVVVSVLRAMTSII  176

Query  797   PNWRIIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNC-HEL  621
             P WRI+ T      +YR   K+  +  +P  + N +P   TA ELL++  +++NN   ++
Sbjct  177   PTWRIVPTADVIDAAYRVQEKRDEIRANPYCY-NAKPRLKTAYELLRISLHVENNILKKV  235

Query  620   EVPLLILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTT  444
              +P LI+ GGDDKV D +    +++SA S+DK L ++  MWH L  GE  +++ +VF   
Sbjct  236   SLPFLIVHGGDDKVTDPSVSDLLYRSAVSQDKKLNLYPAMWHALTSGETVDNINVVFKDI  295

Query  443   LSWIQMRANLARA  405
             ++W+  R+  + A
Sbjct  296   IAWLDQRSGASPA  308



>ref|XP_003635228.1| PREDICTED: caffeoylshikimate esterase isoform X2 [Vitis vinifera]
 emb|CBI33173.3| unnamed protein product [Vitis vinifera]
Length=319

 Score =   166 bits (420),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 161/299 (54%), Gaps = 5/299 (2%)
 Frame = -1

Query  1289  KHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKT  1110
             ++H+ ++E ++LN    K+FT  W   +  +P+ ++ ++HGY  E S         +AK 
Sbjct  2     RNHVKYEEEYILNSRGLKLFTCRW-FPANQDPKALIFILHGYAMECSISMNDTGTRLAKA  60

Query  1109  GLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHHPKLPA--FLYGESLGGA  936
             G  VY ID  GHG S G  G I   D +V DC     +   H   +    +LYGES+GGA
Sbjct  61    GYAVYGIDFEGHGKSSGLGGLISCFDDIVSDCANYFSTICEHKDNIGKMRYLYGESMGGA  120

Query  935   IAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRE  756
             IA+ +       W+G +L  PMC ++   KP   +   L +     P W++I T+     
Sbjct  121   IALNMDRQTPDYWDGAVLVAPMCKIADDMKPNPVVITVLTMLCKVIPTWKMIPTEDVVEM  180

Query  755   SYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVC  576
             +++E  K+  +  +P  +   R    T  ELL+V   ++ N H++++P L++ GGDDKV 
Sbjct  181   AFKEPEKRAEIRSNPYCYKG-RIRLKTGQELLRVSLDLEKNLHKIQMPFLVVHGGDDKVT  239

Query  575   DQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRANLARAH  402
             D +  K + ++AAS DKT K++ GMWH L  GEP E+++ VF+  ++W+  R+ +  + 
Sbjct  240   DPSTSKQLHETAASADKTFKLYPGMWHGLTSGEPPENIDTVFSDIINWLDERSAIGNSR  298



>ref|XP_001765950.1| predicted protein [Physcomitrella patens]
 gb|EDQ69271.1| predicted protein [Physcomitrella patens]
Length=338

 Score =   167 bits (422),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 96/292 (33%), Positives = 158/292 (54%), Gaps = 5/292 (2%)
 Frame = -1

Query  1277  IHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFV  1098
             +H E   +     K+FT  W      E +G++ M HGY  E S       +  A+ G   
Sbjct  13    VHYEEDYIQRRGLKLFTCRWL-PVHQEIKGLIFMCHGYGVECSVFLRPTGIRFAQAGYAA  71

Query  1097  YAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSAR--AHHPKLPAFLYGESLGGAIAIL  924
             + ID  GHG SEGRR ++     +V D I    S R    +   P FLYGES+GGAI + 
Sbjct  72    FGIDQVGHGKSEGRRCYVESFQDLVDDSIAYFKSIRDLEEYRNKPRFLYGESMGGAIVLH  131

Query  923   ICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYRE  744
             I   +   W+G +L  PMC +S+K KP   +   L + + + P W+I+ ++     ++++
Sbjct  132   IHRKEPEEWSGAVLQAPMCKISEKLKPPQIVTSILTMMSNYIPTWKIVPSENIIDNAFKD  191

Query  743   VLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNa  564
              +K+  +  +P  +   RP   TALE+L+  + ++    E+ +P L+L G +D+V D + 
Sbjct  192   PIKRAEIRANPFTYQG-RPRVKTALEMLRASESLEQRLDEVILPFLLLHGEEDRVTDPDI  250

Query  563   vkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRANLA  411
              + +F+++ S DK  K++ GMWH L  GEP+++VELVFN  + W+  R++L 
Sbjct  251   SRELFRTSKSCDKEFKLYPGMWHGLTAGEPDDNVELVFNDIIHWLNKRSSLG  302



>ref|XP_008244512.1| PREDICTED: caffeoylshikimate esterase [Prunus mume]
 ref|XP_008244513.1| PREDICTED: caffeoylshikimate esterase [Prunus mume]
Length=347

 Score =   167 bits (422),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 100/288 (35%), Positives = 161/288 (56%), Gaps = 5/288 (2%)
 Frame = -1

Query  1271  KEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVYA  1092
             +E + +N    KIF +SW  ++   P+ +VC  HGY    ++ FE  A  +A  G  V+A
Sbjct  57    EESYEVNSRGLKIFCKSWLPEAS-RPKAIVCYCHGYGDTCTFFFEGIARKLASYGYGVFA  115

Query  1091  IDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAH--HPKLPAFLYGESLGGAIAILIC  918
             +D PG G S+G   HIP  D +V D I    + + +     LP+FL+G+SLGGAIA+ + 
Sbjct  116   MDYPGFGLSDGLHCHIPSFDILVDDVIEHYSNVKENPEFHTLPSFLFGQSLGGAIALKVH  175

Query  917   LNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREVL  738
             L Q   WNG IL  PMC ++    P W L + L   A F P  +++  K  +  +++++ 
Sbjct  176   LKQPSAWNGAILVAPMCKIADDMVPPWALTQILIGVAKFLPTKKLVPQKNLAEAAFKDLK  235

Query  737   KKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavk  558
             K+++ A +   +  +RP   TA+E+L+  + I+    E+ +PLLIL G  D V D +  K
Sbjct  236   KREMTAYNVIAY-KDRPRLQTAVEMLRTTEEIERQLEEVSLPLLILHGEADIVTDPSVSK  294

Query  557   avfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRAN  417
             A+ + A+S DK L ++   +H L+ GEP+E +  VF   +SW+  R+ 
Sbjct  295   ALHEKASSSDKKLILYMDAYHSLLEGEPDEMIVRVFGDIISWLNERSE  342



>ref|XP_002282295.1| PREDICTED: caffeoylshikimate esterase isoform X1 [Vitis vinifera]
Length=323

 Score =   166 bits (420),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 161/299 (54%), Gaps = 5/299 (2%)
 Frame = -1

Query  1289  KHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKT  1110
             ++H+ ++E ++LN    K+FT  W   +  +P+ ++ ++HGY  E S         +AK 
Sbjct  6     RNHVKYEEEYILNSRGLKLFTCRW-FPANQDPKALIFILHGYAMECSISMNDTGTRLAKA  64

Query  1109  GLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHHPKLPA--FLYGESLGGA  936
             G  VY ID  GHG S G  G I   D +V DC     +   H   +    +LYGES+GGA
Sbjct  65    GYAVYGIDFEGHGKSSGLGGLISCFDDIVSDCANYFSTICEHKDNIGKMRYLYGESMGGA  124

Query  935   IAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRE  756
             IA+ +       W+G +L  PMC ++   KP   +   L +     P W++I T+     
Sbjct  125   IALNMDRQTPDYWDGAVLVAPMCKIADDMKPNPVVITVLTMLCKVIPTWKMIPTEDVVEM  184

Query  755   SYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVC  576
             +++E  K+  +  +P  +   R    T  ELL+V   ++ N H++++P L++ GGDDKV 
Sbjct  185   AFKEPEKRAEIRSNPYCYKG-RIRLKTGQELLRVSLDLEKNLHKIQMPFLVVHGGDDKVT  243

Query  575   DQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRANLARAH  402
             D +  K + ++AAS DKT K++ GMWH L  GEP E+++ VF+  ++W+  R+ +  + 
Sbjct  244   DPSTSKQLHETAASADKTFKLYPGMWHGLTSGEPPENIDTVFSDIINWLDERSAIGNSR  302



>ref|XP_007009573.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY18383.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=324

 Score =   166 bits (419),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 96/290 (33%), Positives = 157/290 (54%), Gaps = 5/290 (2%)
 Frame = -1

Query  1280  IIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLF  1101
             + ++E +++N    K+FT  W   + +EP+G++ + HGY  E S      A+ + K G  
Sbjct  8     VRYEEEYIINSRGLKLFTCKWIPMN-EEPKGLIFICHGYAMECSISMNSTAIRLVKAGFA  66

Query  1100  VYAIDLPGHGYSEGRRGHIPRIDPVVHDC--ILCLDSARAHHPKLPAFLYGESLGGAIAI  927
             VY ID  GHG S G +G++   D VV DC         +  + K   FL GES+GGA+ +
Sbjct  67    VYGIDYEGHGKSSGLQGYVTSFDNVVDDCSNFFTQICEKKENKKKMRFLLGESMGGAVLL  126

Query  926   LICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYR  747
             L+ + +   W+G +L  PMC ++ + KP   +   L     F P W+II +K     ++R
Sbjct  127   LVHMKKPEYWDGAVLVAPMCKIADEMKPHPLVISVLTKLCNFIPTWKIIPSKDVIDAAFR  186

Query  746   EVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQN  567
                 ++ +  +P  +   RP   T  ELLK    ++   +E+ +P ++L GGDDKV D+ 
Sbjct  187   RPEIREQIRANPYCYKG-RPRLKTGNELLKTSMELEQRLNEVSLPFIVLHGGDDKVTDKA  245

Query  566   avkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRA  420
               + ++  AAS DKT K++ GMWH L+ GE  E++E+VF   ++W+  R 
Sbjct  246   VSQQLYDVAASSDKTFKLYPGMWHGLLYGETPENIEIVFADIINWLNQRT  295



>ref|XP_009387315.1| PREDICTED: caffeoylshikimate esterase-like isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009387316.1| PREDICTED: caffeoylshikimate esterase-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=343

 Score =   166 bits (419),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/284 (32%), Positives = 166/284 (58%), Gaps = 5/284 (2%)
 Frame = -1

Query  1271  KEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVYA  1092
             +E + +N    +IFT+SW  ++C + +G+VC  HGY    ++ FE  +  +A  G  V+A
Sbjct  54    EESYEVNSRGLEIFTKSWLPENC-KIKGLVCFCHGYGDTCTFFFEGISKKLASVGYGVFA  112

Query  1091  IDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAH--HPKLPAFLYGESLGGAIAILIC  918
             +D PG G SEG  G+IP  D +V D I C    + +  +  LP+FL+G+S+GGA+A+ + 
Sbjct  113   MDYPGFGLSEGLHGYIPSFDSLVDDVIECFSKIKENPDYEGLPSFLFGQSMGGAVALKVH  172

Query  917   LNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREVL  738
               Q H W+G IL  PMC ++    P WP+++ L   A   P  +++  K  +  +++++ 
Sbjct  173   FKQPHSWDGAILVAPMCKMADDVVPPWPVQQILICIAKILPREKLVPQKDLAEMAFKDIK  232

Query  737   KKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavk  558
             K++  + +   +  ++P   TA+E+L+  + I++   E+ +PL+IL G  D V D +  K
Sbjct  233   KREQCSYNVIAY-KDKPRLRTAVEMLRTTQEIEHRLEEISLPLIILHGEADIVTDPSVSK  291

Query  557   avfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQ  429
             A+++ A S DK L+++   +H ++ GE +E +  V +  +SW++
Sbjct  292   ALYEKATSLDKKLRLYKDAYHSILEGESDEMIFKVLDDIISWLE  335



>ref|XP_009420077.1| PREDICTED: caffeoylshikimate esterase-like [Musa acuminata subsp. 
malaccensis]
Length=317

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 99/290 (34%), Positives = 162/290 (56%), Gaps = 5/290 (2%)
 Frame = -1

Query  1283  HIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGL  1104
             ++ ++E F+ N   ++IFT  W   + +EP+ ++ + HGY  E S   +     +AK G 
Sbjct  7     NVRYEEEFIKNPRGQRIFTCKWLPQN-EEPKALIFLCHGYAMECSISMKDTGTRLAKAGY  65

Query  1103  FVYAIDLPGHGYSEGRRGHIPRIDPVVHDCI--LCLDSARAHHPKLPAFLYGESLGGAIA  930
              V+ +D  GHG S G +G+IPR   ++ DC         R  + K   FL GES+GGA+A
Sbjct  66    AVHGMDYEGHGKSSGLQGYIPRFKNLIDDCFEHFVAICERHENKKKARFLLGESMGGAVA  125

Query  929   ILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESY  750
             IL+     + WNG +L  PMC ++   KP   +   L   +   P WRI+ TK     ++
Sbjct  126   ILLHRRNPYYWNGAVLVAPMCKIADDMKPHPAMNIILRKLSNIIPTWRIVPTKDIIDIAF  185

Query  749   REVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQ  570
             +   K++ + +S     N +P   T +ELL V   I+   H++ +P LI+ GG+D V D 
Sbjct  186   KCPEKRQEI-RSNQYCYNGKPRLKTGVELLMVSLDIEQKLHQVSLPFLIVHGGEDIVIDP  244

Query  569   NavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMR  423
             +  K ++++A+S+DKT K++ GMWH L  GEP E+++LVF+  ++W+  R
Sbjct  245   SVSKLLYETASSEDKTFKLYPGMWHALTSGEPPENIDLVFSDIVAWLDRR  294



>ref|XP_010516079.1| PREDICTED: caffeoylshikimate esterase-like [Camelina sativa]
Length=314

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 162/294 (55%), Gaps = 6/294 (2%)
 Frame = -1

Query  1280  IIHKEGFVLNENQKKIFTQSWQHDS--CDEPRGVVCMIHGYTSESSWLFELNAVAMAKTG  1107
             +++KE +VLN    ++FT SW+ +     EP+ ++ + HGY  ESS      A+ +A  G
Sbjct  2     VMYKEDYVLNSRGIQLFTCSWKPEVELQQEPKALIFLCHGYAMESSITMSSTAMRLANAG  61

Query  1106  LFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS--ARAHHPKLPAFLYGESLGGAI  933
               VY +D  GHG S G  G++ + D +V D      S   R  +     FL GES+GGA+
Sbjct  62    FAVYGMDYEGHGKSGGLNGYVKKFDDLVLDVSSHYSSICEREENKGKMRFLIGESMGGAV  121

Query  932   AILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRES  753
              +L+   +   W+G +L  PMC +++  KP   +  FL     F P W+I+ +      +
Sbjct  122   VLLLARKKPDFWDGAVLVAPMCKLAEDIKPHPMVISFLTKLTRFIPTWKIVPSNDIIDVA  181

Query  752   YREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCD  573
             ++E   +K V ++   +   RP   TA +LL V   ++ N H++ +P ++L G DDKV D
Sbjct  182   FKESHIRKQVRENEYCYKG-RPRLKTAHQLLMVSLDLEKNLHQVSMPFIVLHGEDDKVTD  240

Query  572   QNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRANL  414
             QN  K +++ A+S DKT K++  MWH L+ GE  E++ +VF+  + W+  RA++
Sbjct  241   QNVSKLLYEVASSSDKTFKLYPNMWHGLLYGESPENLTIVFSDIIKWLNERASV  294



>ref|XP_009758203.1| PREDICTED: caffeoylshikimate esterase-like [Nicotiana sylvestris]
Length=351

 Score =   166 bits (419),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 101/289 (35%), Positives = 160/289 (55%), Gaps = 6/289 (2%)
 Frame = -1

Query  1280  IIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLF  1101
             + + E ++ N    ++FT  W   S   P+ +V + HGY  E S         +A  G  
Sbjct  3     VEYHEEYIRNSRGVQLFTCRWLPFS--SPKALVFLCHGYGMECSGFMRGVGTKLANHGYA  60

Query  1100  VYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS--ARAHHPKLPAFLYGESLGGAIAI  927
             V+ ID  GHG S G R +I R D +V+DC     S  AR  + +   FLYGES+GGA+A+
Sbjct  61    VFGIDYEGHGRSMGSRCYIKRFDNIVNDCSDFFKSVCAREEYREKTRFLYGESMGGAVAL  120

Query  926   LICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYR  747
             LI       WNG +L  PMC +S+K KP   +   L       P W+I+ TK     +++
Sbjct  121   LIHKKDPSFWNGALLVAPMCKISEKVKPHPMVISLLTKVEDVIPRWKIVPTKDVIDSAFK  180

Query  746   EVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQN  567
             + ++++ V +       E+P   TALE+L+   +++ + HE+ +P L+L G  D V D  
Sbjct  181   DPVRREEV-RGNKLIYQEKPRLKTALEMLRTSMHLEESLHEVTLPFLVLHGEADIVTDPE  239

Query  566   avkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMR  423
               KA+++ A+SKDKT+K++ GMWH L  GEP +++++VF+  +SW+  R
Sbjct  240   VSKALYEQASSKDKTIKLYPGMWHGLTYGEPEDNIDIVFSDIISWLDKR  288



>gb|EYU44635.1| hypothetical protein MIMGU_mgv1a021899mg [Erythranthe guttata]
Length=344

 Score =   165 bits (418),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 97/283 (34%), Positives = 159/283 (56%), Gaps = 5/283 (2%)
 Frame = -1

Query  1268  EGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVYAI  1089
             E + +N    +IF++SW  +    P+ V+C  HGY    ++ FE  A  +A +G  V+A+
Sbjct  61    ESYEVNSRGLEIFSKSWLPEEV-SPKAVLCFCHGYGDTCTFFFEGIARKLACSGYGVFAM  119

Query  1088  DLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAH--HPKLPAFLYGESLGGAIAILICL  915
             D PG G SEG  G++P+ D +V D I      + +     LP+F++GES+GGA+A+ + L
Sbjct  120   DYPGFGLSEGLHGYVPKFDWIVDDVIEHYSKVKGNPNFRTLPSFIFGESMGGAVALKVHL  179

Query  914   NQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREVLK  735
              Q   WNG +L  PMC ++    P W + + L   A   P  +++  K  +  ++R+V K
Sbjct  180   KQPDSWNGAVLVAPMCKIADDMVPPWLVTQILTGVAKLLPKHKLVPQKDLAELAFRDVKK  239

Query  734   KKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavka  555
             ++  A +   + + +P   TALELLK  + I+    ++ +PLLIL G +DKV D +  K 
Sbjct  240   REQTAYNVVAYKH-KPRLRTALELLKTTQEIEQQLDKVSLPLLILHGKNDKVTDPSVSKE  298

Query  554   vfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQ  429
             +++ A S DKTL ++    H L+ GEP+E +  VF   +SW+ 
Sbjct  299   LYEKAKSTDKTLNLYEDASHSLLEGEPDEMILRVFGDIISWLD  341



>ref|XP_011082467.1| PREDICTED: caffeoylshikimate esterase-like [Sesamum indicum]
Length=348

 Score =   165 bits (418),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 97/287 (34%), Positives = 159/287 (55%), Gaps = 6/287 (2%)
 Frame = -1

Query  1268  EGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVYAI  1089
             E + +N    ++FT  W   SC  P+ +V + HGY  E         + +A  G  V+ I
Sbjct  7     EEYRMNSRGVRLFTCRWLPFSC--PKALVFLCHGYGMECGNFMRGVGIKLASHGYGVFGI  64

Query  1088  DLPGHGYSEGRRGHIPRIDPVVHDCILCLDS--ARAHHPKLPAFLYGESLGGAIAILICL  915
             D  GHG S G R +I R D +++DC     S  A+  + +   FLYGES+GGA+A+L   
Sbjct  65    DYEGHGRSSGARCYIKRFDNIINDCSEYFKSICAQEEYREKKRFLYGESMGGAVALLTHK  124

Query  914   NQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREVLK  735
                  W+G +L  PMC +S+K KP   +   L       P W+I+ TK     ++++ +K
Sbjct  125   KDPGFWDGAVLVAPMCKISEKVKPHPVVISLLTRVEDVIPKWKIVPTKDVIDSAFKDPVK  184

Query  734   KKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavka  555
             ++ + +       E+P   TALELL+    ++++ +E+ +P  +L G  D V D +  +A
Sbjct  185   REKI-RGNKLIYQEKPRLKTALELLRTSMNLEDSLNEVTLPFFVLHGEADTVTDPDVSRA  243

Query  554   vfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRAN  417
             ++  A+SKDKT+K++ GMWH L  GEP++++E+VF+  LSW+  R+ 
Sbjct  244   LYDRASSKDKTIKLYPGMWHGLTSGEPDDNIEIVFSDILSWLDKRSG  290



>ref|XP_002521224.1| Monoglyceride lipase, putative [Ricinus communis]
 gb|EEF41176.1| Monoglyceride lipase, putative [Ricinus communis]
Length=375

 Score =   166 bits (419),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 98/284 (35%), Positives = 160/284 (56%), Gaps = 5/284 (2%)
 Frame = -1

Query  1271  KEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVYA  1092
             KE + +N    +IFT+SW   +   PR VVC  HGY    ++ FE  A  +A +G  V+A
Sbjct  86    KESYEVNSRGLEIFTKSWLPGTS-SPRAVVCYCHGYGDTCTFYFEGIARKLASSGYAVFA  144

Query  1091  IDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHHP--KLPAFLYGESLGGAIAILIC  918
             +D PG G SEG   +IP  D +V D +      +       LP+FL+G+S+GGA+ + + 
Sbjct  145   MDYPGFGLSEGLHCYIPSFDRLVDDVMEHFSKVKEDPAICNLPSFLFGQSMGGAVTLKLH  204

Query  917   LNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREVL  738
             L Q + WNG IL  PMC ++    P   +++FL   A   P  +++  K  +  ++R+  
Sbjct  205   LKQPNAWNGAILVAPMCKIADDMLPPMLVKQFLIGVANVLPTKKLVPQKDLAEAAFRDSK  264

Query  737   KKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavk  558
             K+++ + +   +  ++P   TALE+L+  + I+    E+ +PLLIL GG D V D +  K
Sbjct  265   KREMTSYNVIAY-KDKPRLKTALEMLRTTQEIEQRLEEVSLPLLILHGGADIVTDPSVSK  323

Query  557   avfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQ  429
             A+++ A S DK  K++   +H L+ GEP+E++  VFN  +SW+ 
Sbjct  324   ALYEKARSSDKKFKLYKDSYHSLLEGEPDEAIIQVFNDIVSWLD  367



>ref|XP_004238932.1| PREDICTED: caffeoylshikimate esterase [Solanum lycopersicum]
Length=397

 Score =   166 bits (421),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 99/302 (33%), Positives = 162/302 (54%), Gaps = 15/302 (5%)
 Frame = -1

Query  1319  GDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLF  1140
             GD+  EE+Y+            N   ++IF +SW        +G +C  HGY    ++ F
Sbjct  104   GDIRLEEWYET-----------NSKGQQIFCKSWLPKPGIRIKGALCFSHGYGDTCTFFF  152

Query  1139  ELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDC--ILCLDSARAHHPKLPA  966
             E  A  +A  G  VYAID PG G S+G  G+IP  D +V +          R     LP 
Sbjct  153   EGIAKHIAAAGYAVYAIDHPGFGLSDGLHGYIPEFDGIVDNVNEQYVKIKGRPEVRGLPH  212

Query  965   FLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWR  786
             F++G+S+GGAIA+   L + H W+G++L  PMC +++   P  PL++ L   +   P  +
Sbjct  213   FIFGQSMGGAIALKALLKEPHEWDGIVLVAPMCKIAEDMTPPVPLQKVLIFLSNIMPQAK  272

Query  785   IIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLL  606
             I+ TK  +  + RE  K+K+   +   + +++    TA+ELL   KYI+ +  ++  P+L
Sbjct  273   IVPTKDLAELAIREFKKRKMAPYNVISY-SDKTRVKTAVELLNATKYIEQHVDKVASPML  331

Query  605   ILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQ  429
             IL G DD+V D    + ++  ++S DKTLK++ G +H ++ GEP++ +  V N  +SW+ 
Sbjct  332   ILHGADDRVTDPRVSQYLYDKSSSSDKTLKLYDGGFHCILEGEPDDRILTVLNDIISWLD  391

Query  428   MR  423
              R
Sbjct  392   TR  393



>ref|XP_006294629.1| hypothetical protein CARUB_v10023666mg [Capsella rubella]
 gb|EOA27527.1| hypothetical protein CARUB_v10023666mg [Capsella rubella]
Length=317

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 101/294 (34%), Positives = 157/294 (53%), Gaps = 11/294 (4%)
 Frame = -1

Query  1280  IIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLF  1101
             I ++E F+ N    K+FT  W   +  EPR +V + HGY  E S      A  + K G  
Sbjct  8     IKYEESFIKNTRGLKLFTCGWLP-TNKEPRALVFLCHGYGMECSITMNSTARRIVKAGYA  66

Query  1100  VYAIDLPGHGYSEGRRGHIPRIDPVVHD-----CILCLDSARAHHPKLPAFLYGESLGGA  936
             VY +D  GHG S+G R +IP  D +V D       +C    R  +     F+ GES+GGA
Sbjct  67    VYGMDYEGHGKSDGLRAYIPNFDHLVDDVSTHYTTIC---EREENKWKMRFMLGESMGGA  123

Query  935   IAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRE  756
             + +L+   +   W+G +L  PMC ++++ KP   L   L       P W+II ++     
Sbjct  124   VVLLLNRKKPDFWDGALLVAPMCKIAEEMKPSPFLISILTKLVSVIPKWKIIPSQDIIDI  183

Query  755   SYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVC  576
             SY+E   +K V ++P  +   RP   T  ELL++   ++    E  +P ++L G DDKV 
Sbjct  184   SYKEPEIRKQVRENPLCYKG-RPRLKTGYELLRISNDLEKRLQEFSLPFMVLHGDDDKVT  242

Query  575   DQNavkavfksaaskdKTLKIFAGMWHQL-IGEPNESVELVFNTTLSWIQMRAN  417
             D+   + ++K A S DKTLK++ GMWH L IGE  E++E+VF   + W+++R++
Sbjct  243   DKAVSQELYKVALSSDKTLKLYPGMWHGLTIGETQENIEIVFADIIGWLEIRSD  296



>ref|XP_008783604.1| PREDICTED: caffeoylshikimate esterase-like [Phoenix dactylifera]
Length=345

 Score =   165 bits (417),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 100/291 (34%), Positives = 164/291 (56%), Gaps = 5/291 (2%)
 Frame = -1

Query  1280  IIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLF  1101
             I ++E F+LN    K+FT  W  ++  EP+ ++ + HGY  E S   +   + +AK G  
Sbjct  4     IKYEEEFLLNSRGLKLFTCRWLPEN-REPKALIFLCHGYAMECSISMKGTGIQLAKAGFA  62

Query  1100  VYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS--ARAHHPKLPAFLYGESLGGAIAI  927
             VY ID  GHG S G +G+I   D +V+DC     S   R  +     FL GES+GGA+ +
Sbjct  63    VYGIDYEGHGKSSGLQGYIRSFDGLVNDCSDYFTSICERRENRMKKRFLLGESMGGAMVL  122

Query  926   LICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYR  747
             L+   +   W+G +L  PMC ++++ KP   + + L   +   P W++I TK     + +
Sbjct  123   LLHRKRPTYWDGAVLVAPMCKIAEEMKPPPIIIKILTQLSKIIPTWKLIPTKDIIDSAIK  182

Query  746   EVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQN  567
                 ++ V  +P  +   +P   T  ELL V   I+ N H++ +P +++ GGDD V D +
Sbjct  183   NPEWREQVRSNPYCYKG-KPRLKTGYELLMVSLDIEKNLHQVTLPFIVVHGGDDIVTDPS  241

Query  566   avkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRAN  417
               ++++++A+SKDKT K++ GMWH L  GEP ES++LVF+  ++W+  RA 
Sbjct  242   VSRSLYETASSKDKTFKLYPGMWHALTSGEPQESIDLVFSDIIAWLDDRAT  292



>ref|XP_010505609.1| PREDICTED: caffeoylshikimate esterase-like [Camelina sativa]
Length=311

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 162/293 (55%), Gaps = 11/293 (4%)
 Frame = -1

Query  1280  IIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLF  1101
             ++++E FVLN    K+FT  W+ D  +EP+ ++ + HGY  ESS     +A  +AK G  
Sbjct  2     VLYEEDFVLNSRGMKLFTCVWKPDK-EEPKALLFLCHGYAMESSITMNSSATRLAKAGFA  60

Query  1100  VYAIDLPGHGYSEGRRGHIPRIDPVVHDC-----ILCLDSARAHHPKLPAFLYGESLGGA  936
             VY +D  GHG SEG  G+I   D +V D       +C    +  +     FL GES+GGA
Sbjct  61    VYGMDYEGHGKSEGLNGYISDFDRLVDDVSNHYSTIC---EKEENKGKMRFLLGESMGGA  117

Query  935   IAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRE  756
             +A+L+   +   W+G +L  PMC ++ + KP   +   L   A F P W+I+        
Sbjct  118   LALLLARKKPDFWDGAVLVAPMCKLADEIKPHPVVISILIKLAKFIPTWKIVPGNDIIDI  177

Query  755   SYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVC  576
             + +E   +K V ++   +   RP   TA +LL V   ++ N H++ +P ++L G DDKV 
Sbjct  178   AVKEPHIRKQVRENKYCYKG-RPRLNTAYQLLLVSLDLEKNLHQVSIPFIVLHGEDDKVT  236

Query  575   DQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRA  420
             D++  K +++ A+S DKT K++  MWH L+ GE  E+ E+VF   ++W++ RA
Sbjct  237   DKSVSKLLYEVASSSDKTFKLYPNMWHALLYGETPENSEIVFGDIINWLEDRA  289



>ref|XP_010263962.1| PREDICTED: caffeoylshikimate esterase isoform X3 [Nelumbo nucifera]
 ref|XP_010263965.1| PREDICTED: caffeoylshikimate esterase isoform X3 [Nelumbo nucifera]
Length=343

 Score =   165 bits (417),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 97/287 (34%), Positives = 164/287 (57%), Gaps = 5/287 (2%)
 Frame = -1

Query  1271  KEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVYA  1092
             KE + +N    +IF++SW  +     + VVC  HGY    ++  E  A  +A +G  V+A
Sbjct  53    KESYEVNSRGLEIFSKSWLPE-ISPLKAVVCFCHGYGDTCTFFVEGIARKLASSGYGVFA  111

Query  1091  IDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAH--HPKLPAFLYGESLGGAIAILIC  918
             +D PG G SEG  G+IP  D +V D I      + +  +  LP+FL+G+S+GGA+A+ + 
Sbjct  112   MDYPGFGLSEGLHGYIPSFDRIVDDVIEHFSKVKENPEYQSLPSFLFGQSMGGAVALKVH  171

Query  917   LNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREVL  738
             L Q   WNG IL  PMC +++   P W +++ L   A   P  +++  K  +  ++R++ 
Sbjct  172   LKQPKAWNGAILLAPMCKIAEDMVPPWLVKQILIGVAKILPKEKLVPQKDMAEMAFRDLN  231

Query  737   KKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavk  558
             K+KL + +   +  ++P   TA+ELLK  + I+    E+ +PLLIL G  D + D +  K
Sbjct  232   KRKLTSYNVIAY-KDKPRLGTAVELLKTTQEIEYRLGEVSLPLLILHGEADTITDSSVSK  290

Query  557   avfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRA  420
             A++  A+S DK L ++   +H L+ GEP++++  VF+  +SW+  R+
Sbjct  291   ALYDKASSSDKKLCLYKDAFHALLEGEPDDAIFQVFDDIISWLDERS  337



>gb|KFK35464.1| hypothetical protein AALP_AA5G287400 [Arabis alpina]
Length=350

 Score =   165 bits (417),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 97/288 (34%), Positives = 158/288 (55%), Gaps = 5/288 (2%)
 Frame = -1

Query  1274  HKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVY  1095
             ++E F+ N    ++F   W   S   PR +V + HGY  E S       + MA  G  V+
Sbjct  8     YEEEFIRNSRGVELFACRWV-PSSSSPRALVFLCHGYAMECSGFMRECGIRMASAGYAVF  66

Query  1094  AIDLPGHGYSEGRRGHIPRIDPVVHDCI--LCLDSARAHHPKLPAFLYGESLGGAIAILI  921
              +D  GHG S+G R +I +   +V+DC       SAR  + +   FLYGES+GGA+++L+
Sbjct  67    GMDYEGHGRSKGARCYIKKFANIVNDCYDYYTSISARDEYKEKARFLYGESMGGAVSLLL  126

Query  920   CLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREV  741
                    WNG IL  PMC +S+K KP   +   L       P W+I+ TK     ++++ 
Sbjct  127   HKKDPSFWNGAILVAPMCKISEKVKPHPVVVNLLTRIEEIIPKWKIVPTKDVIDAAFKDP  186

Query  740   LKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNav  561
             +K++ + ++      ++P   TALE+L+    ++   HE+ +P  +L G  D V D    
Sbjct  187   IKREEI-RNNKLIYQDKPRLKTALEMLRTSMNLEETLHEITLPFFVLHGEADTVTDPEIS  245

Query  560   kavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRA  420
             KA+F+ A+++DKT+K++ GMWH L  GEP+ +V+LVF   ++W+ +R 
Sbjct  246   KALFEKASTRDKTIKLYPGMWHGLTSGEPDANVDLVFADIITWLDVRT  293



>ref|XP_010922433.1| PREDICTED: caffeoylshikimate esterase-like isoform X1 [Elaeis 
guineensis]
Length=324

 Score =   164 bits (415),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 99/291 (34%), Positives = 164/291 (56%), Gaps = 7/291 (2%)
 Frame = -1

Query  1280  IIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLF  1101
             I ++E F+LN    K+FT  W  D+  EP+ ++ + HGY  E S   +     +AK G  
Sbjct  8     IKYEEEFILNPRGLKLFTCRWLPDN-REPKALIFLCHGYAMECSISMKGTGTQLAKAGFA  66

Query  1100  VYAIDLPGHGYSEGRRGHIPRIDPVVHDC---ILCLDSARAHHPKLPAFLYGESLGGAIA  930
             VY ID  GHG S G +G+I   D +V+DC     C+   R +  K+  +L GES+GGA+ 
Sbjct  67    VYGIDYEGHGKSSGLQGYIRSFDSLVNDCSDYFTCVCERRENKMKM-RYLLGESMGGAVV  125

Query  929   ILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESY  750
             +L+   +   W+G +L  PMC ++++ KP   +   L   +   P W++I T+     + 
Sbjct  126   LLLHRKKPTYWDGAVLVAPMCKIAEEMKPHPIVINVLTQLSKIIPTWKLIPTQDIIDSAI  185

Query  749   REVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQ  570
             +    ++ V  +P  +   +P   T  ELL V   I+ N H++ +P +++ GGDD V D 
Sbjct  186   KNPEWREEVRNNPYCYKG-KPRLKTGYELLMVSLDIEKNLHQVTLPFIVVHGGDDIVTDP  244

Query  569   NavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRA  420
             +  ++++++A+SKDKT  ++ GMWH L  GEP ES++LVF+  ++W+  RA
Sbjct  245   SVSRSLYETASSKDKTFNLYPGMWHALTSGEPQESIDLVFSDIIAWLDERA  295



>ref|XP_007216459.1| hypothetical protein PRUPE_ppa023287mg [Prunus persica]
 gb|EMJ17658.1| hypothetical protein PRUPE_ppa023287mg [Prunus persica]
Length=347

 Score =   164 bits (416),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 100/285 (35%), Positives = 162/285 (57%), Gaps = 7/285 (2%)
 Frame = -1

Query  1271  KEGFVLNENQKKIFTQSWQHD-SCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVY  1095
             +E + +N    +IF +SW  + SC  P+ +VC  HGY    ++ FE  A  +A  G  V+
Sbjct  57    EESYEVNSRGLEIFCKSWLPEASC--PKAIVCYCHGYGDTCTFFFEGIARKLASYGYGVF  114

Query  1094  AIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAH--HPKLPAFLYGESLGGAIAILI  921
             A+D PG G SEG   HIP  D +V D I    + + +     LP+FL+G+SLGGA+A+ +
Sbjct  115   AMDYPGFGLSEGLHCHIPSFDILVDDVIEHYSNVKENPEFHTLPSFLFGQSLGGAVALKV  174

Query  920   CLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREV  741
              L Q   WNG IL  PMC ++    P W L + L  AA F P  +++  K  +  +++++
Sbjct  175   HLKQPRAWNGAILVAPMCKIADDMVPPWALTQILIGAAKFLPTKKLVPQKNLAEAAFKDL  234

Query  740   LKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNav  561
              K+++ A +   +  ++P   TA+E+L+  + I+    E+ +PLLIL G  D V D +  
Sbjct  235   KKREMTAYNVIAY-KDKPRLQTAVEMLRTTEEIERRLEEVSLPLLILHGEADIVTDPSVS  293

Query  560   kavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQ  429
             KA+ + A+S DK L ++   +H L+ GEP+E +  VF+  +SW+ 
Sbjct  294   KALHEKASSSDKKLILYMDAYHSLLEGEPDEMIVRVFDDIISWLN  338



>ref|XP_010509020.1| PREDICTED: caffeoylshikimate esterase-like [Camelina sativa]
Length=309

 Score =   163 bits (413),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 98/292 (34%), Positives = 157/292 (54%), Gaps = 11/292 (4%)
 Frame = -1

Query  1274  HKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVY  1095
             ++E F+ N    K+FT  W   + D P  +V + HGY  E S      A  + K G  VY
Sbjct  10    YEESFIKNTRGLKLFTCRWVPTNKD-PGALVFLCHGYGMECSITMNSTARRLVKAGYAVY  68

Query  1094  AIDLPGHGYSEGRRGHIPRIDPVVHD-----CILCLDSARAHHPKLPAFLYGESLGGAIA  930
              +D  GHG S+G   +I   D +V D       +C    R  + +   F+ GES+GGA+ 
Sbjct  69    GMDYEGHGKSDGLSAYISNFDNLVDDVSTHYTTIC---EREENKRKMRFMLGESMGGAVV  125

Query  929   ILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESY  750
             +L+C  +   W+G +L  PMC ++++ KP   +   L       P W+II ++     SY
Sbjct  126   VLLCRKKPDFWDGALLVAPMCKIAEEMKPSPFVISILTKLISVIPKWKIIPSQDIIEISY  185

Query  749   REVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQ  570
             +E   +K V ++P  + N RP   TA ELL++   ++    E+ +P ++L G DDKV D+
Sbjct  186   KEPKIRKQVRENPLCY-NGRPRLKTAYELLRISNDLEKRLQEVSLPFMVLHGDDDKVTDK  244

Query  569   NavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRAN  417
                + ++K A S DKTLK++ GMWH L+ GE  E++E+VF   + W++ R++
Sbjct  245   AVSQELYKVALSSDKTLKLYPGMWHGLLNGETQENIEIVFADVIGWLEKRSD  296



>ref|XP_010545011.1| PREDICTED: caffeoylshikimate esterase isoform X2 [Tarenaya hassleriana]
Length=361

 Score =   165 bits (417),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 105/310 (34%), Positives = 166/310 (54%), Gaps = 7/310 (2%)
 Frame = -1

Query  1274  HKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVY  1095
             + E ++ N    ++F  SW   S   PR +V + HGY  E S       + MA  G  V+
Sbjct  23    YHEEYIRNSRGVELFACSWVPPS--SPRALVFLCHGYGMECSRFMRECGMRMASAGYAVF  80

Query  1094  AIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS--ARAHHPKLPAFLYGESLGGAIAILI  921
              +D  GHG S+G R +I +   ++ DC     S  A+  + +   FLYGES+GGA+A+L+
Sbjct  81    GMDYEGHGQSKGARCYIKKFSNIIDDCYGYYTSICAQEGYREKGRFLYGESMGGAVALLL  140

Query  920   CLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREV  741
                    WNG IL  PMC +S+K KP   +   L       P W+I+ +K     ++++ 
Sbjct  141   HKKDPSFWNGAILLAPMCKISEKVKPHPVVINLLTRVEEIIPKWKIVPSKDVIDSAFKDP  200

Query  740   LKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNav  561
              K++ V ++      ++P   TALE+L+    +++  HE+  P L+L G  D V D    
Sbjct  201   FKREEV-RNNKLIYQDKPRLKTALEMLRTSINLEDTLHEITTPFLVLHGEADIVTDPEIS  259

Query  560   kavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRANLARAHKF*PIM  384
             K++++ A+SKDKT+K++ GMWH L  GEP+ +V+LVF   +SW+ +R   A +    PI 
Sbjct  260   KSLYEKASSKDKTIKMYPGMWHALTSGEPDHNVDLVFADIISWLDVRTGDAASLAVTPIR  319

Query  383   H-RISIEHQT  357
             H   S+E  T
Sbjct  320   HFSFSVEKVT  329



>ref|XP_006344132.1| PREDICTED: caffeoylshikimate esterase-like [Solanum tuberosum]
Length=397

 Score =   165 bits (418),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 99/302 (33%), Positives = 162/302 (54%), Gaps = 15/302 (5%)
 Frame = -1

Query  1319  GDLSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLF  1140
             GD+  EE+Y+            N   ++IF +SW        +G +C  HGY    ++ F
Sbjct  104   GDIRLEEWYET-----------NSKGQQIFCKSWLPKPGIRIKGALCFSHGYGDTCTFFF  152

Query  1139  ELNAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDC--ILCLDSARAHHPKLPA  966
             E  A  +A  G  VYAID PG G S+G  G+IP  D +V +         +R     LP 
Sbjct  153   EGIAKHIAAAGYAVYAIDHPGFGLSDGLHGYIPEFDGIVDNVNEQYVKIKSRPEVRGLPH  212

Query  965   FLYGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWR  786
             F++G+S+GGAIA+   L +   W+G++L  PMC +++   P  PL++ L   +   P  +
Sbjct  213   FIFGQSMGGAIALKALLKEPREWDGIVLVAPMCKIAEDMTPPVPLQKVLIFLSNIMPQAK  272

Query  785   IIFTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLL  606
             I+ TK  +  + RE  K+K+   +   + +++    TA+ELL   KYI++   ++  P+L
Sbjct  273   IVPTKDLAELAIREFKKRKMAPYNVISY-SDKTRVKTAVELLNATKYIESQVDKVASPML  331

Query  605   ILQGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQ  429
             IL G DDKV D    + ++  ++S DKTLK++ G +H ++ GEP++ +  V N  +SW+ 
Sbjct  332   ILHGADDKVTDPRVSQYLYDKSSSSDKTLKLYDGGYHCILEGEPDDRILTVLNDIISWLD  391

Query  428   MR  423
              R
Sbjct  392   TR  393



>ref|XP_010263959.1| PREDICTED: caffeoylshikimate esterase isoform X1 [Nelumbo nucifera]
Length=380

 Score =   165 bits (417),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 97/287 (34%), Positives = 164/287 (57%), Gaps = 5/287 (2%)
 Frame = -1

Query  1271  KEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVYA  1092
             KE + +N    +IF++SW  +     + VVC  HGY    ++  E  A  +A +G  V+A
Sbjct  90    KESYEVNSRGLEIFSKSWLPE-ISPLKAVVCFCHGYGDTCTFFVEGIARKLASSGYGVFA  148

Query  1091  IDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAH--HPKLPAFLYGESLGGAIAILIC  918
             +D PG G SEG  G+IP  D +V D I      + +  +  LP+FL+G+S+GGA+A+ + 
Sbjct  149   MDYPGFGLSEGLHGYIPSFDRIVDDVIEHFSKVKENPEYQSLPSFLFGQSMGGAVALKVH  208

Query  917   LNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREVL  738
             L Q   WNG IL  PMC +++   P W +++ L   A   P  +++  K  +  ++R++ 
Sbjct  209   LKQPKAWNGAILLAPMCKIAEDMVPPWLVKQILIGVAKILPKEKLVPQKDMAEMAFRDLN  268

Query  737   KKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavk  558
             K+KL + +   +  ++P   TA+ELLK  + I+    E+ +PLLIL G  D + D +  K
Sbjct  269   KRKLTSYNVIAY-KDKPRLGTAVELLKTTQEIEYRLGEVSLPLLILHGEADTITDSSVSK  327

Query  557   avfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRA  420
             A++  A+S DK L ++   +H L+ GEP++++  VF+  +SW+  R+
Sbjct  328   ALYDKASSSDKKLCLYKDAFHALLEGEPDDAIFQVFDDIISWLDERS  374



>ref|XP_008797826.1| PREDICTED: caffeoylshikimate esterase-like isoform X3 [Phoenix 
dactylifera]
 ref|XP_008797827.1| PREDICTED: caffeoylshikimate esterase-like isoform X3 [Phoenix 
dactylifera]
 ref|XP_008797828.1| PREDICTED: caffeoylshikimate esterase-like isoform X3 [Phoenix 
dactylifera]
Length=348

 Score =   164 bits (415),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 94/286 (33%), Positives = 166/286 (58%), Gaps = 5/286 (2%)
 Frame = -1

Query  1280  IIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLF  1101
             +I KE + +N    +IF++SW  +   + + ++C  HGY    ++ FE  A  +A +G  
Sbjct  55    VIMKESYEVNSRGLEIFSKSWLPEG-SKTKALICFCHGYGDTCTFFFEGIAKKLASSGYG  113

Query  1100  VYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSAR--AHHPKLPAFLYGESLGGAIAI  927
             V+A+D PG G SEG  G+IP  D +V+D        +  + +  LP+FL+G+S+GGA+A+
Sbjct  114   VFALDYPGFGLSEGLHGYIPSFDTLVNDVAEHFSKIKENSEYQGLPSFLFGQSMGGAVAL  173

Query  926   LICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYR  747
              + L Q HVW+G IL  PMC +++   P WP+++ L   A   P  +++  K  +  +++
Sbjct  174   KVHLKQPHVWDGAILVAPMCKMAEDVVPPWPVQQILICIAKILPKEKLVPQKDLAEMAFK  233

Query  746   EVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQN  567
             ++ K++  + +   +  ++P   TALELL+  + I+    E+ +PL+IL G  D V D +
Sbjct  234   DIKKRQQCSYNVIAY-KDKPRLRTALELLRTTQEIERRLEEVSLPLIILHGEADIVTDPS  292

Query  566   avkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWI  432
               KA+++ A+S DK L ++   +H L+ GE +E +  V N  +SW+
Sbjct  293   VSKALYEKASSSDKKLCLYKDAYHSLLEGESDEMIFKVLNDIISWL  338



>ref|XP_009357817.1| PREDICTED: caffeoylshikimate esterase-like isoform X1 [Pyrus 
x bretschneideri]
Length=389

 Score =   165 bits (418),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 100/284 (35%), Positives = 158/284 (56%), Gaps = 7/284 (2%)
 Frame = -1

Query  1271  KEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVYA  1092
             +E + +N    +IF +SW   +   P+ +VC  HGY    ++ FE  A  +A  G  V+A
Sbjct  99    EESYEVNSRGLEIFCKSWL-PATSRPKAIVCYCHGYGDTCTFFFEGIARKLASNGYGVFA  157

Query  1091  IDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHHPKL---PAFLYGESLGGAIAILI  921
             +D PG G SEG   HIPR D +V D I      +   P+L   P FL+G+SLGGA+A+  
Sbjct  158   MDYPGFGLSEGLHCHIPRFDRLVDDVIEHYSKVK-EQPELRTLPTFLFGQSLGGAVALKA  216

Query  920   CLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREV  741
              L Q   WNG IL  PMC ++    P W L + L   A F P  +++  K  +  ++R++
Sbjct  217   HLKQPSAWNGAILVAPMCKIADDMVPPWLLTQILIGVAKFLPKQKLVPQKNLAEAAFRDL  276

Query  740   LKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNav  561
              K+++ A +   +  ++P   TALE+L+  + I++   E+ +PLLIL G  D V D +  
Sbjct  277   KKREMTAYNVIAY-KDKPRLETALEMLRTTEEIEHQLEEVSLPLLILHGEADIVTDPSVS  335

Query  560   kavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWI  432
             K + + A+S DK L ++   +H L+ GEP+E +  VF+  +SW+
Sbjct  336   KVLHEKASSSDKKLILYMDAYHSLLEGEPDEMIIRVFSDIISWL  379



>ref|XP_004291688.1| PREDICTED: monoglyceride lipase-like [Fragaria vesca subsp. vesca]
Length=383

 Score =   164 bits (416),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 97/283 (34%), Positives = 161/283 (57%), Gaps = 5/283 (2%)
 Frame = -1

Query  1271  KEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVYA  1092
             KE + +N    +IF++SW  ++  +P+ ++C  HGY    ++ FE  A  +A  G  V+A
Sbjct  93    KESYEVNSRGLEIFSKSWLPETS-QPKAILCYCHGYGDTCTFFFEGIARKLASFGYGVFA  151

Query  1091  IDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAH--HPKLPAFLYGESLGGAIAILIC  918
             +D PG G SEG   +IP  + +V D I      +       LP+FL+G+S+GGA+A+ I 
Sbjct  152   MDYPGFGLSEGLHCYIPSFERLVDDVIEHFSKVKTQPEFSTLPSFLFGQSMGGAVALKIH  211

Query  917   LNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREVL  738
             L Q   WNG IL  PMC ++    P W L + L   A F P  +++  K  +  +++++ 
Sbjct  212   LKQPSGWNGAILVAPMCRIADDMAPPWLLAQVLIGVAKFLPKQKLVPQKNLAEAAFKDLK  271

Query  737   KKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavk  558
             K++L A +   +  + P   TA+E+L   + I++   E+ +PLLIL G DD V D +  K
Sbjct  272   KRELTAYNVIAY-RDNPRLQTAVEMLHTTQEIESRLEEVSLPLLILHGEDDIVTDPSVSK  330

Query  557   avfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWI  432
             A+++ A+S +K L ++   +H L+ GEP+E +  VFN  +SW+
Sbjct  331   ALYEKASSSNKKLILYEDAYHSLLEGEPDEMIVQVFNDIISWL  373



>ref|XP_009387314.1| PREDICTED: caffeoylshikimate esterase-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=415

 Score =   165 bits (418),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 91/284 (32%), Positives = 166/284 (58%), Gaps = 5/284 (2%)
 Frame = -1

Query  1271  KEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVYA  1092
             +E + +N    +IFT+SW  ++C + +G+VC  HGY    ++ FE  +  +A  G  V+A
Sbjct  126   EESYEVNSRGLEIFTKSWLPENC-KIKGLVCFCHGYGDTCTFFFEGISKKLASVGYGVFA  184

Query  1091  IDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAH--HPKLPAFLYGESLGGAIAILIC  918
             +D PG G SEG  G+IP  D +V D I C    + +  +  LP+FL+G+S+GGA+A+ + 
Sbjct  185   MDYPGFGLSEGLHGYIPSFDSLVDDVIECFSKIKENPDYEGLPSFLFGQSMGGAVALKVH  244

Query  917   LNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREVL  738
               Q H W+G IL  PMC ++    P WP+++ L   A   P  +++  K  +  +++++ 
Sbjct  245   FKQPHSWDGAILVAPMCKMADDVVPPWPVQQILICIAKILPREKLVPQKDLAEMAFKDIK  304

Query  737   KKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavk  558
             K++  + +   +  ++P   TA+E+L+  + I++   E+ +PL+IL G  D V D +  K
Sbjct  305   KREQCSYNVIAY-KDKPRLRTAVEMLRTTQEIEHRLEEISLPLIILHGEADIVTDPSVSK  363

Query  557   avfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQ  429
             A+++ A S DK L+++   +H ++ GE +E +  V +  +SW++
Sbjct  364   ALYEKATSLDKKLRLYKDAYHSILEGESDEMIFKVLDDIISWLE  407



>ref|XP_010069910.1| PREDICTED: caffeoylshikimate esterase [Eucalyptus grandis]
 gb|KCW58428.1| hypothetical protein EUGRSUZ_H01110 [Eucalyptus grandis]
Length=356

 Score =   164 bits (414),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 96/295 (33%), Positives = 163/295 (55%), Gaps = 5/295 (2%)
 Frame = -1

Query  1292  KKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAK  1113
             K   I+++E ++ N    ++FT  W   S   P+ +V + HGY  E S         +A+
Sbjct  2     KMKEIVYQEEYIENARGVQLFTCGWWLCS-SSPKALVFICHGYGMECSGFMRECGTRLAR  60

Query  1112  TGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS--ARAHHPKLPAFLYGESLGG  939
              G  V+ ID  GHG S G R +I + + +V+DC     S  A+  +     FLYGES+GG
Sbjct  61    AGYGVFGIDYEGHGRSMGARCYIKKFENIVNDCDDFFKSVCAQDEYRGKSRFLYGESMGG  120

Query  938   AIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSR  759
             A+A+L+       W G +L  PMC +S+K KP   +   L       P W+I+ TK    
Sbjct  121   AVALLLHKKDPAFWTGALLVAPMCKISEKVKPHPVVVNLLTRVEEIIPKWKIVPTKDVID  180

Query  758   ESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKV  579
              ++++ +K++ V +S      ++P   TALE+L+    +++  HE+ +P  +L G  D V
Sbjct  181   SAFKDPIKREQV-RSNKLIYQDKPRLKTALEMLRASMRLEDTLHEVTLPFFVLHGEADVV  239

Query  578   CDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRAN  417
              D    KA+++ A+S+DKT++++ GMWH L  GEP++++++VF+  ++W+  R N
Sbjct  240   TDPEVSKALYEQASSRDKTIRLYPGMWHGLTSGEPDDNIDIVFSDIIAWLDRRCN  294



>ref|XP_009613832.1| PREDICTED: caffeoylshikimate esterase isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009613840.1| PREDICTED: caffeoylshikimate esterase isoform X1 [Nicotiana tomentosiformis]
Length=351

 Score =   164 bits (414),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 99/289 (34%), Positives = 160/289 (55%), Gaps = 6/289 (2%)
 Frame = -1

Query  1280  IIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLF  1101
             + + E ++ N    ++FT  W   S   P+ +V + HGY  E S         +A  G  
Sbjct  3     VEYHEEYIRNSRGVQLFTCRWLPFS--SPKALVFLCHGYGMECSGFMRGVGTKLANHGYA  60

Query  1100  VYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS--ARAHHPKLPAFLYGESLGGAIAI  927
             V+ ID  GHG S G R +I R D +V+DC     S  AR  + +   FLYGES+GGA+A+
Sbjct  61    VFGIDYEGHGRSMGSRCYIKRFDNIVNDCSDFFKSVCAREEYREKTRFLYGESMGGAVAL  120

Query  926   LICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYR  747
             LI       W+G +L  PMC +S+K KP   +   L       P W+I+ TK     +++
Sbjct  121   LIHKKDPSFWHGALLVAPMCKISEKVKPHPMVISLLTKVEDVIPRWKIVPTKDVIDSAFK  180

Query  746   EVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQN  567
             + ++++ V +       E+P   TALE+L+   +++ + HE+ +P L+L G  D V D  
Sbjct  181   DPVRREEV-RGNKLIYQEKPRLKTALEMLRTSMHLEESLHEVTLPFLVLHGEADIVTDPE  239

Query  566   avkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMR  423
               KA+++ ++SKDKT+K++ GMWH L  GEP +++++VF+  +SW+  R
Sbjct  240   VSKALYEQSSSKDKTIKLYPGMWHGLTYGEPEDNIDIVFSDIISWLDKR  288



>ref|XP_010427279.1| PREDICTED: caffeoylshikimate esterase-like [Camelina sativa]
Length=314

 Score =   162 bits (411),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 97/294 (33%), Positives = 162/294 (55%), Gaps = 6/294 (2%)
 Frame = -1

Query  1280  IIHKEGFVLNENQKKIFTQSWQHDS--CDEPRGVVCMIHGYTSESSWLFELNAVAMAKTG  1107
             + +KE +VLN    ++FT SW+ ++    EP+ ++ + HGY  ESS      A+ +A  G
Sbjct  2     VTYKEDYVLNSRGIQLFTCSWKPEAELHQEPKALIFLCHGYAMESSITMSSTAMRLANAG  61

Query  1106  LFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS--ARAHHPKLPAFLYGESLGGAI  933
               VY +D  GHG S G  G++ + D +V D      S      +     FL GES+GGA+
Sbjct  62    FAVYGMDYEGHGKSGGLNGYVKKFDDLVLDVSSHYSSICEMEENKGKMRFLMGESMGGAV  121

Query  932   AILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRES  753
              +L+   +   W+G +L  PMC +++  KP   +  FL     F P W+I+ +      +
Sbjct  122   VLLLARKKPDFWDGAVLVAPMCKLAEDIKPHPMVISFLTKLTRFIPTWKIVPSNDIIDVA  181

Query  752   YREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCD  573
             ++E   +K V ++   +   RP   TA +LL V   ++ N H++ +P ++L G DDKV D
Sbjct  182   FKESHIRKQVRENEYCYKG-RPRLKTAHQLLMVSLDLEKNLHQVSMPFIVLHGEDDKVTD  240

Query  572   QNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRANL  414
             QN  K +++ A+S DKT K++  MWH L+ GE  E++ +VF+  ++W+  RA++
Sbjct  241   QNVSKLLYEVASSSDKTFKLYPNMWHGLLYGESPENLTIVFSDIINWLNERASV  294



>ref|XP_010916379.1| PREDICTED: caffeoylshikimate esterase-like isoform X3 [Elaeis 
guineensis]
 ref|XP_010916380.1| PREDICTED: caffeoylshikimate esterase-like isoform X3 [Elaeis 
guineensis]
 ref|XP_010916381.1| PREDICTED: caffeoylshikimate esterase-like isoform X3 [Elaeis 
guineensis]
Length=348

 Score =   163 bits (413),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 94/287 (33%), Positives = 164/287 (57%), Gaps = 5/287 (2%)
 Frame = -1

Query  1280  IIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLF  1101
             +I KE + +N    +IF++SW  +   + + ++C  HGY    ++ FE  A  +A +G  
Sbjct  55    VIMKESYEVNSRGLEIFSKSWLPEGS-KMKALICFCHGYGDTCTFFFEGIAKKLATSGYG  113

Query  1100  VYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSAR--AHHPKLPAFLYGESLGGAIAI  927
             V+A+D PG G SEG  G+IP  D +V+D        +  + +  LP+FL+G+SLGGA+A+
Sbjct  114   VFALDYPGFGLSEGLHGYIPSFDTLVNDVAEHFSKIKENSEYQGLPSFLFGQSLGGAVAL  173

Query  926   LICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYR  747
              + L Q H W+G IL  PMC +++   P WP+++ L   A   P  +++  K  +  +++
Sbjct  174   KVHLKQLHAWDGAILVAPMCKMAEDVVPAWPIQQILICIAKILPKEKLVPQKDLAEMAFK  233

Query  746   EVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQN  567
             ++ K++  + +   +  ++P   TALELL+  + I+    E+ +PL+IL G  D V D +
Sbjct  234   DIKKREQCSYNVIAY-KDKPRLRTALELLRTTQEIERRLEEVSLPLIILHGEADIVTDPS  292

Query  566   avkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQ  429
               KA+++ A S DK L ++   +H L+ GE +E +  V N  +SW+ 
Sbjct  293   VSKALYEKARSLDKKLCLYKDAYHSLLEGESDEMIFKVLNDIISWLD  339



>ref|XP_010520167.1| PREDICTED: caffeoylshikimate esterase-like isoform X1 [Tarenaya 
hassleriana]
Length=299

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 96/294 (33%), Positives = 157/294 (53%), Gaps = 11/294 (4%)
 Frame = -1

Query  1286  HHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTG  1107
              +I+++E F+ N    K FT  W+  +  EP+ ++ + HGY  E S      A+ +AK G
Sbjct  6     ENIVYEEEFISNAKGVKFFTCRWRQMNI-EPKALIFLCHGYAMECSITMNSTAMRLAKAG  64

Query  1106  LFVYAIDLPGHGYSEGRRGHIPRIDPVVHD-----CILCLDSARAHHPKLPAFLYGESLG  942
               VY +D  GHG S+G +G I   D ++ D       +C     A   +   FL GES+G
Sbjct  65    FAVYGMDYGGHGKSDGLQGFISSFDDLIDDVSSHYTSICEKDENAGKKR---FLLGESMG  121

Query  941   GAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPS  762
             GA+ +L+   +   W+G +L  PMC +++  +P   +   L       P W+I+ TK   
Sbjct  122   GAVVLLLHRKKPGFWDGAVLVAPMCKIAEDLRPHPLMISVLTKLMKVVPKWKIVPTKDVI  181

Query  761   RESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDK  582
               +++    +  V ++P  +   RP   T  ELL+V   ++   +E+ +P L+L GGDD 
Sbjct  182   DSAFKVAEVRSQVRENPYCYKG-RPRLKTGYELLRVSMDLEKRLNEVTIPFLVLHGGDDV  240

Query  581   VCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMR  423
             V D+ A + + + A S DKTLK++ GMWH L+ GEP E+ ++VF+  +SW+  R
Sbjct  241   VTDKGASQQLHEVAQSSDKTLKLYPGMWHGLLYGEPPENTQIVFSDIVSWLDER  294



>ref|NP_001242740.1| uncharacterized protein LOC100819669 [Glycine max]
 gb|ACU23082.1| unknown [Glycine max]
Length=396

 Score =   164 bits (415),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 103/290 (36%), Positives = 160/290 (55%), Gaps = 6/290 (2%)
 Frame = -1

Query  1271  KEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVYA  1092
             +EG+  N    +IF +SW  +S    +  +C  HGY S  ++ FE  A  +A +G  VYA
Sbjct  108   EEGYERNSRGLEIFCKSWMPESGVPLKAALCFCHGYGSTCTFFFEGIAKRIAASGYGVYA  167

Query  1091  IDLPGHGYSEGRRGHIPRIDPVVHDCI--LCLDSARAHHPKLPAFLYGESLGGAIAILIC  918
             +D PG G SEG  G+IP  D +V D I       AR     LP F+ G+S+GGAIA+ + 
Sbjct  168   MDYPGFGLSEGLHGYIPNFDDLVDDVIEHFTKIKARPEVRGLPRFILGQSMGGAIALKVH  227

Query  917   LNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREVL  738
             L +++ W+G+IL  PMC +++   P   L   L L +   P  ++   K  S  ++RE  
Sbjct  228   LKEQNTWDGVILVAPMCKIAEGMLPPTALLRVLNLLSKVMPKAKLFPHKDLSALTFREPG  287

Query  737   KKKLVAKSPNRFPNERPPA-ATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNav  561
             K+K+     N    + P    T +ELL   + I++  H++  PLLIL G  D+V D    
Sbjct  288   KRKVAGY--NVISYDHPTRLKTGMELLSATQEIESQLHKVSAPLLILHGAADQVTDPLVS  345

Query  560   kavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRANL  414
             + +++ A+SKDKTLKI+ G +H ++ GEP++ +  V N  +SW+  R +L
Sbjct  346   QFLYEKASSKDKTLKIYEGSYHGILEGEPDDRISAVHNDIISWLDFRCSL  395



>ref|XP_001768097.1| predicted protein [Physcomitrella patens]
 gb|EDQ66970.1| predicted protein [Physcomitrella patens]
Length=296

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 104/289 (36%), Positives = 158/289 (55%), Gaps = 6/289 (2%)
 Frame = -1

Query  1268  EGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVYAI  1089
             + +V N    +IF +SW   +   P+G++ + HGY    S+ FE  A A A  G  VY +
Sbjct  3     QTYVKNSRNLEIFVKSWIP-AEKRPKGLLFLCHGYGDTVSFFFEGLARAFAIAGYAVYGM  61

Query  1088  DLPGHGYSEGRRGHIPRIDPVVHDCI--LCLDSARAHHPKLPAFLYGESLGGAIAILICL  915
             D PG G SEG  G+IP  D +V D +        R+ +  LP FLYGES+GGA+A L  L
Sbjct  62    DYPGFGLSEGLHGYIPNFDILVDDVMEQYIKIKERSENKGLPCFLYGESMGGAVA-LKAL  120

Query  914   NQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREVLK  735
                 +W+G IL  PMC ++    P W L + L + A   P  +++ +   +    R++ K
Sbjct  121   KNSSMWDGAILVAPMCKIADSMIPPWYLVKILIVLAHIIPKAKLVSSNDIAEIGLRDLEK  180

Query  734   KKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavka  555
             +K    +P  +    P   TAL+LL+    I+ N  E+ +PLLIL G  D+V D    KA
Sbjct  181   RKRANNNPVAYIG-NPRLGTALQLLQTTDLIEKNLTEVSLPLLILHGAADEVTDPAVSKA  239

Query  554   vfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRANLA  411
             +++ A SKDKTL+++ G WH L+ GEP++ V+ V    +SW+   ++ A
Sbjct  240   LYEKAKSKDKTLRLYDGAWHCLLQGEPDDVVKNVMMDIISWLDATSHDA  288



>ref|XP_008784749.1| PREDICTED: caffeoylshikimate esterase-like isoform X2 [Phoenix 
dactylifera]
Length=356

 Score =   163 bits (413),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 97/298 (33%), Positives = 163/298 (55%), Gaps = 5/298 (2%)
 Frame = -1

Query  1301  EFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVA  1122
             EF     ++++E F+ N    K+FT  W   S   P+ +V + HGY  E S   ++    
Sbjct  2     EFGHHKEVVYQEEFIRNSRGVKLFTCRWL-PSSSSPKALVFLCHGYGMECSEFMKVVGSR  60

Query  1121  MAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS--ARAHHPKLPAFLYGES  948
             +   G  VY +D  GHG SEGRR +I R   +V DC     S   +  +     FLYGES
Sbjct  61    LGGAGYAVYGMDYEGHGKSEGRRCYIKRFGNLVADCERFFKSICVKEEYVNKSRFLYGES  120

Query  947   LGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKP  768
             +GGA+A+L+       W+G +L+ PMC +S++ KP   +   L       P W+I+ TK 
Sbjct  121   MGGAVALLLHKRDPTFWDGAVLAAPMCKISEEMKPSPIVVNILTQVEDIIPAWKIVPTKD  180

Query  767   PSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGD  588
                 ++++ +K++++  +   +  ++P   TALELL+    ++++  ++ +P L+L G  
Sbjct  181   IVDTAFKDPVKREVIRHNKLIY-KDKPRLKTALELLRTSMDLEDSLSKVNLPFLVLHGEA  239

Query  587   DKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRAN  417
             D V D    +A++  A+S DKT+ ++ GMWH L  GEP+ +VE VF+  ++W+  RA+
Sbjct  240   DLVTDPEVSRALYDRASSVDKTITLYPGMWHGLTSGEPDINVEKVFSDVIAWLDHRAH  297



>ref|XP_004495953.1| PREDICTED: monoglyceride lipase-like isoform X1 [Cicer arietinum]
Length=322

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 100/297 (34%), Positives = 160/297 (54%), Gaps = 7/297 (2%)
 Frame = -1

Query  1274  HKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVY  1095
             ++EG+  N    ++FT  W   S   P+ +V + HGY  E S         +A  G  V+
Sbjct  7     YQEGYWKNSRGIQLFTSKWLPIS--SPKALVFLCHGYGMECSTFMREIGEKLASVGYAVF  64

Query  1094  AIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS--ARAHHPKLPAFLYGESLGGAIAILI  921
              +D  GHG S G R +I + D +V+DC     S      +     FLYGES+GGA+++L+
Sbjct  65    GMDYEGHGRSAGVRCYITKFDNIVNDCFNFYKSICELQEYKGKAKFLYGESMGGAVSLLL  124

Query  920   CLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREV  741
                    W+G +   PMC +S+K KP   +   L       P W+I+ TK     ++++ 
Sbjct  125   HKKDPSFWDGAVFVAPMCKISEKVKPHPVVVSVLTGLEEIIPRWKIVPTKDVIDSAFKDR  184

Query  740   LKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNav  561
              K++ + K+   +  E+P   TALELL+    +++  H++ +P ++L G +D V D    
Sbjct  185   AKRESIRKNKLIY-QEKPRLKTALELLRTSLSLESCLHQVTLPFIVLHGANDTVTDPEVS  243

Query  560   kavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRANL-ARAHKF  396
             KA++  A+S DKT+K++ GMWH L  GEP+E++ELVF   +SW+  RA+  AR   F
Sbjct  244   KALYDRASSVDKTMKLYPGMWHGLTSGEPDENIELVFGDIISWLDKRASSKARLESF  300



>ref|XP_010506801.1| PREDICTED: caffeoylshikimate esterase-like isoform X2 [Camelina 
sativa]
Length=360

 Score =   163 bits (413),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 99/301 (33%), Positives = 164/301 (54%), Gaps = 5/301 (2%)
 Frame = -1

Query  1313  LSREEFYKKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFEL  1134
             L  ++  K     + E ++ NE   ++F   W   S   P+ +V + HGY  E S   + 
Sbjct  3     LRSQKNVKSSEFQYHEEYIRNERGVELFACRWIPSS-SSPKALVFLCHGYGMECSDFMKE  61

Query  1133  NAVAMAKTGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS--ARAHHPKLPAFL  960
               + +A  G  V+ +D  GHG S G R +I + + VV+DC     S  A+  + +   FL
Sbjct  62    CGIRLASAGYAVFGLDYEGHGRSMGSRCYIKKFENVVNDCYDYYTSICAQEEYMEKGRFL  121

Query  959   YGESLGGAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRII  780
             YGES+GGA+ +L+       WNG IL  PMC +S+K KP   +   L       P W+I+
Sbjct  122   YGESMGGAVTLLLHKKDPSFWNGAILVAPMCKISEKVKPHPVVISVLTRVEEIIPKWKIV  181

Query  779   FTKPPSRESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLIL  600
              TK     ++++++K++ V ++      E+P   TALE+L+    +++  HE+ +P  +L
Sbjct  182   PTKNVIDAAFKDLVKREEV-RNNKLIYQEKPRLKTALEMLRTSMNLEDTLHEITMPFFVL  240

Query  599   QGGDDKVCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMR  423
              G  D V D    KA+++ A+++DKTLK++ GMWH L  GEP+ +V+LVF   ++W+ +R
Sbjct  241   HGEADTVTDPEISKALYEKASTRDKTLKLYPGMWHALTSGEPDCNVDLVFADIITWLDLR  300

Query  422   A  420
              
Sbjct  301   T  301



>ref|XP_011070793.1| PREDICTED: caffeoylshikimate esterase [Sesamum indicum]
Length=393

 Score =   164 bits (415),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 99/292 (34%), Positives = 165/292 (57%), Gaps = 4/292 (1%)
 Frame = -1

Query  1280  IIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLF  1101
             I  +E + +N N ++IF +SW        +G +C  HGY    ++ FE  A  +A +G  
Sbjct  102   IRTEEWYEMNSNGQEIFCKSWLPKPGVRIKGALCFCHGYGDTCTFFFEGIAKHIAASGYG  161

Query  1100  VYAIDLPGHGYSEGRRGHIPRIDPVVHDCI--LCLDSARAHHPKLPAFLYGESLGGAIAI  927
             VYAID PG G SEG  G++P  D VV + I    +   R     LP FL+G+S+GGAIA+
Sbjct  162   VYAIDHPGFGLSEGLHGYVPSFDAVVDNVIEQYRIMKGRPEIRGLPRFLFGQSMGGAIAL  221

Query  926   LICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYR  747
                L   + W+G++L  PMC +S++  P  PL++ L   +   P  +++  K  +  ++R
Sbjct  222   KALLKTPNEWDGIVLVAPMCKISEEMTPPVPLQKVLIFLSKLMPQAKLVPQKDLADLAFR  281

Query  746   EVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQN  567
             E+ KK++   +   + +++    TA+ELL   KYI++   ++   +LIL G  DKV D  
Sbjct  282   ELKKKQMAPYNVISY-SDQTRLRTAVELLNATKYIESQVEKVGSAMLILHGAADKVTDPR  340

Query  566   avkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRANL  414
               + ++  A+SKDKTLK++ G +H ++ GEP++ +  V +  +SW+  R +L
Sbjct  341   VSQFLYDKASSKDKTLKLYEGGFHCILEGEPDDRILAVLSDIISWLDSRTSL  392



>ref|XP_010678840.1| PREDICTED: caffeoylshikimate esterase-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=350

 Score =   162 bits (411),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 101/284 (36%), Positives = 159/284 (56%), Gaps = 8/284 (3%)
 Frame = -1

Query  1268  EGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVYAI  1089
             E +  N    +IF++SW  DS   P+ V+C  HGY    ++ FE  A  +A  G  VYA+
Sbjct  61    EKYEKNSRGVEIFSKSWVPDS-HPPKAVICYCHGYGESCTFFFEGTARKLALAGYGVYAM  119

Query  1088  DLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAHHPK---LPAFLYGESLGGAIAILIC  918
             D  G G S+G  G+IP  + +V D I      +A  P+   LP+FL+G+S+GGA+A+ + 
Sbjct  120   DYQGFGLSDGLHGYIPSFERLVDDVIEHYSKVKAEKPEFDALPSFLFGQSMGGAVALKVH  179

Query  917   LNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREVL  738
             L Q   W+G IL  PMC ++   +P + +   L   +   P  +++ TK     ++RE  
Sbjct  180   LKQPKAWSGAILLAPMCKIADDLRPSFIMTRILIALSKALPKSKLVPTKDLDDIAFRE--  237

Query  737   KKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavk  558
             KK+L A +   +  ++P   TA+ELL+    I+    E+ +P+LIL G  D V D +  K
Sbjct  238   KKELTAYNIIAY-KDKPRLKTAVELLRTTDEIERRMQEVYLPMLILHGEADAVTDPSVSK  296

Query  557   avfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQ  429
             A+++ A+S DK L I+   +HQL+ GEP+E +  VFN  +SW+ 
Sbjct  297   ALYEKASSTDKKLNIYKDSYHQLLEGEPDEVIFGVFNDIISWLD  340



>ref|XP_006479967.1| PREDICTED: caffeoylshikimate esterase-like [Citrus sinensis]
Length=367

 Score =   163 bits (413),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 98/299 (33%), Positives = 162/299 (54%), Gaps = 6/299 (2%)
 Frame = -1

Query  1274  HKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVY  1095
             ++E +V N    ++FT  W   S   P+ VV + HGY  E S         +A  G  V+
Sbjct  27    YQEEYVRNARGVQLFTCRWLPFST--PKAVVFLCHGYGMECSGFMRECGTRLASAGYAVF  84

Query  1094  AIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS--ARAHHPKLPAFLYGESLGGAIAILI  921
              ID  GHG S G R +I + + +V+DC     S  A+  +     FLYGES+GGA+ +L+
Sbjct  85    GIDYEGHGRSRGARCYIKKFENIVNDCDDFFKSVCAQEEYTDKARFLYGESMGGAVTLLL  144

Query  920   CLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREV  741
                    WNG +L  PMC +S+K KP   L   L       P W+I+ TK     ++++ 
Sbjct  145   HKKDPSFWNGAVLVAPMCKISEKVKPHPVLVNILTRVEEIIPKWKIVPTKDVIDSAFKDS  204

Query  740   LKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNav  561
             +K++ + ++      ++P   TALE+L+    ++++  ++ +P  +L G  D V D    
Sbjct  205   IKREEI-RNNKLIYQDKPRLKTALEMLRTSMSLEDSLSKVMIPFFVLHGEADTVTDPEVS  263

Query  560   kavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRANLARAHKF*PI  387
             KA+++ A+S+DKT+K++ GMWH L  GEP+E++++VF   ++W+  R + A A    PI
Sbjct  264   KALYERASSRDKTIKLYPGMWHALTSGEPDENIDIVFGDIIAWLDERMSDANAIAVTPI  322



>emb|CDY40205.1| BnaA09g34870D [Brassica napus]
Length=304

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/293 (32%), Positives = 158/293 (54%), Gaps = 4/293 (1%)
 Frame = -1

Query  1280  IIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLF  1101
             + + E +VLN    K+FT SW+ +   EP+ ++ + HGY  ESS      A+ +   G  
Sbjct  2     VKYGEDYVLNSRGMKLFTCSWRPEEQQEPKAMIFLCHGYGMESSITMNSTAIRLVNAGFV  61

Query  1100  VYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSA--RAHHPKLPAFLYGESLGGAIAI  927
             VY ID  GHG S G  G+I   D +V D      S   +  +     FL GES+GGA+ +
Sbjct  62    VYGIDYEGHGKSGGLNGYIKNFDHLVDDVSSHFSSICDKEENKGKMRFLMGESMGGAVVL  121

Query  926   LICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYR  747
             L+   +   W+G +L  PMC ++++ KP   + +FL       P W+I+ +      +++
Sbjct  122   LLARKKPEFWDGAVLVAPMCKLAEEIKPHPMVIKFLTKLTRVIPTWKIVPSNDIIDVAFK  181

Query  746   EVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQN  567
             E   +K V ++   +   RP   TA +LL     ++ N H++ +P ++L G DDKV D++
Sbjct  182   ESHIRKQVRENEYCYKG-RPRLKTAHQLLTTSLDLEKNLHQVAMPFIVLHGEDDKVTDKD  240

Query  566   avkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRANLA  411
               K +++ ++S DKT K++  MWH L+ GE  +++E+VF   + W+  RA++ 
Sbjct  241   VSKLLYEVSSSSDKTFKLYPNMWHGLLYGESPQNLEIVFGDIIGWLNERASVT  293



>ref|XP_008776304.1| PREDICTED: caffeoylshikimate esterase-like [Phoenix dactylifera]
Length=325

 Score =   162 bits (409),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 100/295 (34%), Positives = 162/295 (55%), Gaps = 5/295 (2%)
 Frame = -1

Query  1286  HHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTG  1107
              +I ++E F+ N +  K+F   W  ++ + P+ ++ + HGY  E S         +AK G
Sbjct  6     ENIGYEEEFITNPHGLKLFACRWLPENRN-PKALIFLCHGYGMECSISLRDTGTRLAKAG  64

Query  1106  LFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSA--RAHHPKLPAFLYGESLGGAI  933
               VY +D  GHG S G +G+IP  + +V  C     S   R  + K   FL GES+GGA+
Sbjct  65    YAVYGLDYEGHGKSSGLQGYIPSFNALVDSCSNYFMSVCERQENKKKQRFLLGESMGGAV  124

Query  932   AILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRES  753
              +L+   +   WNG IL  PMC ++ K KP   +   L       P W+++ T+     +
Sbjct  125   VLLLHRKEPTYWNGAILVAPMCKIADKMKPRPIVVSILKKLCNIIPTWKVVPTQDIIDAA  184

Query  752   YREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCD  573
             ++ + K++ +  +P  +   +P   TA ELL V   I+ N +++ +P L++ GGDD V D
Sbjct  185   FKNLEKREEIRSNPYCYKG-KPRLKTAYELLMVSLDIEKNLNQVSLPFLVVHGGDDIVTD  243

Query  572   QNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRANLA  411
              +  K +++SA+SKDKT K++ GMWH L  GEP E++ELVF+  ++W+  R  L 
Sbjct  244   PSVSKLLYESASSKDKTFKLYPGMWHALTSGEPLENIELVFSDIVAWLDERTPLG  298



>emb|CDX73397.1| BnaC08g26060D [Brassica napus]
Length=304

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/293 (32%), Positives = 158/293 (54%), Gaps = 4/293 (1%)
 Frame = -1

Query  1280  IIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLF  1101
             + + E +VLN    K+FT SW+ +   EP+ ++ + HGY  ESS      A+ +   G  
Sbjct  2     VKYGEDYVLNSRGMKLFTCSWRPEEQQEPKAMIFLCHGYGMESSITMNSTAIRLVNAGFV  61

Query  1100  VYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS--ARAHHPKLPAFLYGESLGGAIAI  927
             VY ID  GHG S G  G+I   D +V D      S   +  +     FL GES+GGA+ +
Sbjct  62    VYGIDYEGHGKSGGLNGYIQNFDHLVDDVSSHFSSICDKEENKGKMRFLMGESMGGAVVL  121

Query  926   LICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYR  747
             L+   +   W+G +L  PMC ++++ KP   + +FL       P W+I+ +      +++
Sbjct  122   LLARKKPEFWDGAVLVAPMCKLAEEIKPHPMVIKFLTKLTRVIPTWKIVPSNDIIDVAFK  181

Query  746   EVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQN  567
             E   +K V ++   +   RP   TA +LL     ++ N H++ +P ++L G DDKV D++
Sbjct  182   ESHIRKQVRENEYCYKG-RPRLKTAHQLLTTSLDLEKNLHQVAMPFIVLHGEDDKVTDKD  240

Query  566   avkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRANLA  411
               K +++ ++S DKT K++  MWH L+ GE  +++E+VF   + W+  RA++ 
Sbjct  241   VSKLLYEVSSSSDKTFKLYPNMWHGLLYGESPQNLEIVFGDIIGWLNERASVT  293



>ref|XP_006444359.1| hypothetical protein CICLE_v10020811mg [Citrus clementina]
 gb|ESR57599.1| hypothetical protein CICLE_v10020811mg [Citrus clementina]
 gb|KDO87207.1| hypothetical protein CISIN_1g018375mg [Citrus sinensis]
Length=357

 Score =   162 bits (411),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 162/299 (54%), Gaps = 6/299 (2%)
 Frame = -1

Query  1274  HKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVY  1095
             ++E ++ N    ++FT  W   S   P+ VV + HGY  E S         +A  G  V+
Sbjct  17    YQEEYIRNARGVQLFTCRWLPFST--PKAVVFLCHGYGMECSGFMRECGTRLASAGYAVF  74

Query  1094  AIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS--ARAHHPKLPAFLYGESLGGAIAILI  921
              ID  GHG S G R +I + + +V+DC     S  A+  +     FLYGES+GGA+ +L+
Sbjct  75    GIDYEGHGRSRGARCYIKKFENIVNDCDDFFKSVCAQEEYTDKARFLYGESMGGAVTLLL  134

Query  920   CLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREV  741
                    WNG +L  PMC +S+K KP   L   L       P W+I+ TK     ++++ 
Sbjct  135   HKKDPSFWNGAVLVAPMCKISEKVKPHPVLVNILTRVEEIIPKWKIVPTKDVIDSAFKDS  194

Query  740   LKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNav  561
             +K++ + ++      ++P   TALE+L+    ++++  ++ +P  +L G  D V D    
Sbjct  195   IKREEI-RNNKLIYQDKPRLKTALEMLRTSMSLEDSLSKVMIPFFVLHGEADTVTDPEVS  253

Query  560   kavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRANLARAHKF*PI  387
             KA+++ A+S+DKT+K++ GMWH L  GEP+E++++VF   ++W+  R + A A    PI
Sbjct  254   KALYERASSRDKTIKLYPGMWHALTSGEPDENIDIVFGDIIAWLDERMSDANAIAVTPI  312



>ref|XP_003592661.1| Monoglyceride lipase [Medicago truncatula]
Length=321

 Score =   162 bits (409),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 103/291 (35%), Positives = 161/291 (55%), Gaps = 4/291 (1%)
 Frame = -1

Query  1280  IIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLF  1101
             II +E +  N    +IF +SW  +     +G +   HGY S  ++ FE  A  +A +G  
Sbjct  31    IITQEWYERNSRGLEIFCKSWMPEHGVPIKGALFFCHGYGSTCTFFFEGIARRIAASGFG  90

Query  1100  VYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLD--SARAHHPKLPAFLYGESLGGAIAI  927
             VYA+D PG G SEG  G+IP  D +V D I       AR     LP F++G+S+GGAIA+
Sbjct  91    VYAMDFPGFGLSEGLHGYIPSFDDLVDDVIEYYTKIKARPEARDLPQFIFGQSMGGAIAL  150

Query  926   LICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYR  747
                L + +VW+G+IL  PMC +S+   P   + + L L +   P  ++   K  S   +R
Sbjct  151   KAHLKEPNVWDGVILVAPMCKISEGMLPPTTILKALTLLSKMMPKAKLFPYKDLSELIFR  210

Query  746   EVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQN  567
             E  K+KL   +   + +++    T +ELL   + I++   ++  PLLIL G +DKV D  
Sbjct  211   EPGKRKLAVYNVISY-DDQTRLRTGMELLSATQDIESQLEKVSAPLLILHGAEDKVTDPL  269

Query  566   avkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRAN  417
               + +++ A+SKDKTLKI+ G +H ++ GEP+E +  V N  +SW+  R +
Sbjct  270   VSQFLYEKASSKDKTLKIYEGGYHGILEGEPDERISSVHNDIISWLDNRCS  320



>ref|XP_008797823.1| PREDICTED: caffeoylshikimate esterase-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008797824.1| PREDICTED: caffeoylshikimate esterase-like isoform X1 [Phoenix 
dactylifera]
Length=406

 Score =   164 bits (414),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/287 (33%), Positives = 166/287 (58%), Gaps = 5/287 (2%)
 Frame = -1

Query  1280  IIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLF  1101
             +I KE + +N    +IF++SW  +   + + ++C  HGY    ++ FE  A  +A +G  
Sbjct  113   VIMKESYEVNSRGLEIFSKSWLPEG-SKTKALICFCHGYGDTCTFFFEGIAKKLASSGYG  171

Query  1100  VYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSAR--AHHPKLPAFLYGESLGGAIAI  927
             V+A+D PG G SEG  G+IP  D +V+D        +  + +  LP+FL+G+S+GGA+A+
Sbjct  172   VFALDYPGFGLSEGLHGYIPSFDTLVNDVAEHFSKIKENSEYQGLPSFLFGQSMGGAVAL  231

Query  926   LICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYR  747
              + L Q HVW+G IL  PMC +++   P WP+++ L   A   P  +++  K  +  +++
Sbjct  232   KVHLKQPHVWDGAILVAPMCKMAEDVVPPWPVQQILICIAKILPKEKLVPQKDLAEMAFK  291

Query  746   EVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQN  567
             ++ K++  + +   +  ++P   TALELL+  + I+    E+ +PL+IL G  D V D +
Sbjct  292   DIKKRQQCSYNVIAY-KDKPRLRTALELLRTTQEIERRLEEVSLPLIILHGEADIVTDPS  350

Query  566   avkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQ  429
               KA+++ A+S DK L ++   +H L+ GE +E +  V N  +SW+ 
Sbjct  351   VSKALYEKASSSDKKLCLYKDAYHSLLEGESDEMIFKVLNDIISWLD  397



>ref|XP_002879794.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56053.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=317

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 102/296 (34%), Positives = 157/296 (53%), Gaps = 11/296 (4%)
 Frame = -1

Query  1286  HHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTG  1107
               I ++E F+ N    K+FT  W   +  EPR +V + HGY  E S      A  + K G
Sbjct  6     EDIKYEESFIKNTRGFKLFTCRWIP-ANQEPRALVFLCHGYGMECSITMNSTARRIVKAG  64

Query  1106  LFVYAIDLPGHGYSEGRRGHIPRIDPVVHD-----CILCLDSARAHHPKLPAFLYGESLG  942
               VY +D  GHG S+G   +IP  D +V D       +C    R  +     FL GES+G
Sbjct  65    FAVYGMDYEGHGKSDGLSAYIPNFDHLVDDVSTHYTTIC---EREENKWKMRFLLGESMG  121

Query  941   GAIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPS  762
             GA+ +L+       W+G IL  PMC ++++ KP   +   L       P W+II ++   
Sbjct  122   GAVVLLLRRKNPDFWDGAILVAPMCKIAEEMKPSPFVISILTKLISIIPKWKIIPSQDII  181

Query  761   RESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDK  582
               SY+E   +K V ++P      RP   TA ELL++   ++ +  E+ +P ++L GGDDK
Sbjct  182   EISYKEPEIRKQVRENP-LCSKGRPRLKTAYELLRISNDLEKSLKEVSLPFMVLHGGDDK  240

Query  581   VCDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRAN  417
             V D+   + ++K A S DKTLK++ GMWH L+ GE  E++E+VF   + W++ R++
Sbjct  241   VTDKAVSQELYKVALSADKTLKLYPGMWHGLLNGETPENIEIVFADVIGWLEKRSD  296



>ref|XP_009116220.1| PREDICTED: caffeoylshikimate esterase [Brassica rapa]
Length=304

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/293 (32%), Positives = 158/293 (54%), Gaps = 4/293 (1%)
 Frame = -1

Query  1280  IIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLF  1101
             + + E +VLN    K+FT SW+ +   EP+ ++ + HGY  ESS      A+ +   G  
Sbjct  2     VKYGEDYVLNSRGMKLFTCSWRPEEHQEPKAMIFLCHGYGMESSITMNSTAIRLVNAGFV  61

Query  1100  VYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS--ARAHHPKLPAFLYGESLGGAIAI  927
             VY ID  GHG S G  G+I   D +V D      S   +  +     FL GES+GGA+ +
Sbjct  62    VYGIDYEGHGKSGGLNGYIKNFDHLVDDVSSHFSSICDKEENKGKMRFLMGESMGGAVVL  121

Query  926   LICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYR  747
             L+   +   W+G +L  PMC ++++ KP   + +FL       P W+I+ +      +++
Sbjct  122   LLARKKPEFWDGAVLVAPMCKLAEEIKPHPMVIKFLTKLTRVIPTWKIVPSNDIIDVAFK  181

Query  746   EVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQN  567
             E   +K V ++   +   RP   TA +LL     ++ N H++ +P ++L G DDKV D++
Sbjct  182   ESHIRKQVRENEYCYKG-RPRLKTAHQLLTTSLDLEKNLHQVAMPFIVLHGEDDKVTDKD  240

Query  566   avkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRANLA  411
               K +++ ++S DKT K++  MWH L+ GE  +++E+VF   + W+  RA++ 
Sbjct  241   VSKLLYEVSSSSDKTFKLYPNMWHGLLYGESPQNLEIVFGDIIGWLNERASVT  293



>ref|XP_010921664.1| PREDICTED: caffeoylshikimate esterase-like isoform X1 [Elaeis 
guineensis]
Length=354

 Score =   162 bits (410),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 96/292 (33%), Positives = 161/292 (55%), Gaps = 5/292 (2%)
 Frame = -1

Query  1283  HIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGL  1104
              + ++E F+ N    ++FT  W   S   P+ +V + HGY  E S   +     +A  G 
Sbjct  11    EVEYQEEFIRNSRGVQLFTCRWL-PSSSSPKALVFLCHGYGMECSEFMKAVGTGLAGAGY  69

Query  1103  FVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS--ARAHHPKLPAFLYGESLGGAIA  930
              VY +D  GHG S+GRR +I +   VV DC     S   +  +     FLYGES+GGA+A
Sbjct  70    AVYGMDYEGHGKSDGRRCYIRKFGNVVADCDRFFKSICVKEDYINKSRFLYGESMGGAVA  129

Query  929   ILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESY  750
             +L+       W+G +L  PMC +S++ KP   +   L       P W+I+ TK     ++
Sbjct  130   LLLHKRDPTFWDGAVLVAPMCKISEEMKPSPLVVNILTQVEDIIPTWKIVPTKQIVDTAF  189

Query  749   REVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQ  570
             R+ +K++ +  +   +  ++P   TALELL+    ++++  ++ +P L+L G  D V D 
Sbjct  190   RDPVKREEIRHNKLIY-QDKPRLKTALELLRTSMELEDSLSKVSLPFLVLHGEADTVTDP  248

Query  569   NavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRAN  417
                +A+++ A+S DKT+ ++AGMWH L  GEP+++VE VF+  ++W+  RA+
Sbjct  249   EVSRALYERASSVDKTITLYAGMWHGLTSGEPDDNVEKVFSDVITWLDHRAH  300



>ref|XP_008459474.1| PREDICTED: caffeoylshikimate esterase isoform X2 [Cucumis melo]
Length=342

 Score =   162 bits (410),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 94/286 (33%), Positives = 160/286 (56%), Gaps = 5/286 (2%)
 Frame = -1

Query  1271  KEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVYA  1092
             +E + +N     IF++SW  ++   P+ +V   HGY    ++ FE  A  +A +G  V++
Sbjct  57    EETYEVNSRGLSIFSKSWIPETV-RPKAMVYYCHGYGDTCTFFFEGIARKLAMSGYGVFS  115

Query  1091  IDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSARAH--HPKLPAFLYGESLGGAIAILIC  918
             +D PG G SEG  G IP  D +V D I      + +     LP+FL+G+SLGGA+A+ + 
Sbjct  116   MDYPGFGLSEGLHGFIPSFDRIVDDVIERYSKVKENPAFSALPSFLFGQSLGGAVALKVH  175

Query  917   LNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREVL  738
             L Q   W+G +L  PMC ++    P W L + L   + F P ++++  K  +  ++R++ 
Sbjct  176   LKQPRSWSGAVLVAPMCKIADDMVPPWALAQVLIGISKFLPKYKLVPQKDLAELAFRDLK  235

Query  737   KKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavk  558
              ++L A +   +  ++P   TA+E+LK  + I+    E+ +PLLIL G  D V D +  K
Sbjct  236   YRELTAYNVIAY-KDKPRLQTAVEMLKTTQEIERRLKEISLPLLILHGEADTVTDPSVSK  294

Query  557   avfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMR  423
              +++ A+S DK +K++   +H L+ GEP+E +  VFN   +W+  R
Sbjct  295   VLYEKASSSDKKIKLYKDAYHSLLEGEPDEVILEVFNDIFTWLDER  340



>ref|XP_006291395.1| hypothetical protein CARUB_v10017533mg [Capsella rubella]
 gb|EOA24293.1| hypothetical protein CARUB_v10017533mg [Capsella rubella]
Length=353

 Score =   162 bits (410),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 161/294 (55%), Gaps = 6/294 (2%)
 Frame = -1

Query  1292  KKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAK  1113
             KK    ++E ++ N    ++F   W   S   PR +V + HGY  E S       + +A 
Sbjct  2     KKLRFEYEEEYIKNSRGVELFACRWVPSS--SPRALVFLCHGYAMECSSFMRECGIRLAA  59

Query  1112  TGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCI--LCLDSARAHHPKLPAFLYGESLGG  939
              G  V+ +D  GHG S+G R +I +   +V+DC       SA+  + +   FLYGES+GG
Sbjct  60    AGYAVFGMDYEGHGRSKGARCYIKKFSNIVNDCYDYYTFISAQEEYKEKGRFLYGESMGG  119

Query  938   AIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSR  759
             A+A+L+       WNG IL  PMC +S+K KP   +   L       P W+I+ TK    
Sbjct  120   AVALLLHKKYPSFWNGAILVAPMCKISEKVKPHPVVINLLTRVEDIIPKWKIVPTKDVID  179

Query  758   ESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKV  579
              ++++ +K++ + ++      ++P   TALE+L+    ++   HE+ +P L+L G  D V
Sbjct  180   AAFKDPVKREEI-RNNKLIYQDKPRLKTALEMLRTSMDLEETLHEITLPFLVLHGEADIV  238

Query  578   CDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRA  420
              D    KA+F+ A+++DKT+K++ GMWH L  GEP+ +V+LVF   ++W+ +R 
Sbjct  239   TDPEISKALFEKASTRDKTIKLYPGMWHGLTSGEPDANVDLVFADIVNWLDVRT  292



>ref|XP_004247416.1| PREDICTED: caffeoylshikimate esterase isoform X2 [Solanum lycopersicum]
Length=352

 Score =   162 bits (410),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 101/289 (35%), Positives = 159/289 (55%), Gaps = 6/289 (2%)
 Frame = -1

Query  1280  IIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLF  1101
             + + E F+ N    ++FT  W   S   P+ +V + HGY  E S         +A  G  
Sbjct  3     VEYHEVFIRNSRGVQLFTCRWLPFS--SPKALVFLCHGYGMECSRFMRGVGTKLADNGYA  60

Query  1100  VYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS--ARAHHPKLPAFLYGESLGGAIAI  927
             V+ ID  GHG S G R +I + D +V+DC     S  A+  + +   FLYGES+GGA+A+
Sbjct  61    VFGIDYEGHGRSAGARCYIKKFDNIVNDCSEFFKSVCAQEEYREKKRFLYGESMGGAVAL  120

Query  926   LICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYR  747
             L        W+G +L  PMC +S+K KP   +   L       P W+I+ TK     +++
Sbjct  121   LTHKKDPSFWHGALLVAPMCKISEKVKPHPVVISLLTKVEDVIPRWKIVPTKDVIDSAFK  180

Query  746   EVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQN  567
             +  K++ V ++   +   +P   TALE+L+   +++ + HE+ VP L+L G  D V D  
Sbjct  181   DPAKREEVRENKLIY-QAKPRLKTALEMLRTSMHLEESLHEVTVPFLVLHGEADIVTDPE  239

Query  566   avkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMR  423
               KA+++ A+SKDKT+K++ GMWH L  GEP E++E+VF+  +SW+  R
Sbjct  240   ISKALYEQASSKDKTIKLYPGMWHGLTYGEPEENIEIVFSDIISWLDKR  288



>ref|XP_010506800.1| PREDICTED: caffeoylshikimate esterase-like isoform X1 [Camelina 
sativa]
Length=363

 Score =   162 bits (411),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 161/294 (55%), Gaps = 5/294 (2%)
 Frame = -1

Query  1292  KKHHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAK  1113
             K     + E ++ NE   ++F   W   S   P+ +V + HGY  E S   +   + +A 
Sbjct  13    KSSEFQYHEEYIRNERGVELFACRWIPSS-SSPKALVFLCHGYGMECSDFMKECGIRLAS  71

Query  1112  TGLFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS--ARAHHPKLPAFLYGESLGG  939
              G  V+ +D  GHG S G R +I + + VV+DC     S  A+  + +   FLYGES+GG
Sbjct  72    AGYAVFGLDYEGHGRSMGSRCYIKKFENVVNDCYDYYTSICAQEEYMEKGRFLYGESMGG  131

Query  938   AIAILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSR  759
             A+ +L+       WNG IL  PMC +S+K KP   +   L       P W+I+ TK    
Sbjct  132   AVTLLLHKKDPSFWNGAILVAPMCKISEKVKPHPVVISVLTRVEEIIPKWKIVPTKNVID  191

Query  758   ESYREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKV  579
              ++++++K++ V ++      E+P   TALE+L+    +++  HE+ +P  +L G  D V
Sbjct  192   AAFKDLVKREEV-RNNKLIYQEKPRLKTALEMLRTSMNLEDTLHEITMPFFVLHGEADTV  250

Query  578   CDQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRA  420
              D    KA+++ A+++DKTLK++ GMWH L  GEP+ +V+LVF   ++W+ +R 
Sbjct  251   TDPEISKALYEKASTRDKTLKLYPGMWHALTSGEPDCNVDLVFADIITWLDLRT  304



>gb|KDO67800.1| hypothetical protein CISIN_1g021023mg [Citrus sinensis]
Length=318

 Score =   161 bits (408),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 97/292 (33%), Positives = 158/292 (54%), Gaps = 5/292 (2%)
 Frame = -1

Query  1286  HHIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTG  1107
             H+I + E F+LN  + K+FT SW   +  EP+ ++ + HGY  E S      A+ +A  G
Sbjct  7     HNIKYDEEFILNSRRVKLFTCSWIPQN-QEPKALIFICHGYAMECSIGMNSTAIRLANEG  65

Query  1106  LFVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDS--ARAHHPKLPAFLYGESLGGAI  933
                Y ID  GHG S G  G+I   D +V DC     S   +  + +   +L GES+GGA+
Sbjct  66    YACYGIDYQGHGKSAGLSGYIDNFDDLVDDCFNHFTSICEKEENKEKMRYLLGESMGGAM  125

Query  932   AILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRES  753
              +L+   +   ++G +L  PMC +++  KP   +   L     F P W+II ++     +
Sbjct  126   VLLLHRKKPDYFDGAVLVAPMCKIAENVKPHPLVISVLTKLCKFIPTWKIIPSQDIVDVA  185

Query  752   YREVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCD  573
             ++   K+K +  +P  +   RP   T  EL++V   ++N   E+ +P ++L G +DKV D
Sbjct  186   FKLPEKRKEIRANPYCYKG-RPRLKTGYELMRVSMDLENRLDEVSIPFIVLHGEEDKVTD  244

Query  572   QNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRA  420
             +     +FK A+S DKT+K++ GMWH L+ GEP E+ ++VF   L+W+  R 
Sbjct  245   KAVSVQLFKVASSSDKTMKLYEGMWHGLLYGEPEENTQIVFRDILNWLDERV  296



>ref|XP_009407468.1| PREDICTED: caffeoylshikimate esterase-like [Musa acuminata subsp. 
malaccensis]
Length=323

 Score =   161 bits (408),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 99/294 (34%), Positives = 158/294 (54%), Gaps = 11/294 (4%)
 Frame = -1

Query  1280  IIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLF  1101
             + ++E ++ N    K+FT  W  ++ D P+ ++ + HGY  E S      A   AK G  
Sbjct  8     VRYEEEYIDNPRGVKLFTCRWLPENKD-PKALIFLCHGYAMECSISMRDTATRCAKAGYA  66

Query  1100  VYAIDLPGHGYSEGRRGHIPRIDPVVHDC--ILCLDSARAHHPKLPAFLYGESLGGAIAI  927
             VY ID  GHG S G +G++P    +V+DC         R  + K   +L GES+GGA A+
Sbjct  67    VYGIDYEGHGKSSGLQGYVPSFQHIVNDCSDFFVGVCERPENKKKARYLLGESMGGATAL  126

Query  926   LICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYR  747
             L+   +   WNG +L  PMC ++ + KP   +   L   ++  P W+I+    P+R+   
Sbjct  127   LLHRKEPSYWNGAVLVAPMCKIADELKPHPFVVSILKKLSYIIPTWKIV----PTRDIID  182

Query  746   EVLK---KKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVC  576
               +K   K+   +S       +P   TA ELL     I+ N H++ +P L++ GGDD V 
Sbjct  183   IAIKTPEKREEVRSNQYCYKGKPRLKTAHELLMASLDIEQNLHQVSLPFLVVHGGDDIVT  242

Query  575   DQNavkavfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRAN  417
             D +  K ++++A+S+DKT K++ GMWH L  GEP ES++LVF+  ++W+  R  
Sbjct  243   DPSVSKLLYETASSEDKTFKLYPGMWHALTSGEPPESIDLVFSDIIAWLDQRTT  296



>emb|CDP00629.1| unnamed protein product [Coffea canephora]
Length=395

 Score =   163 bits (412),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 95/288 (33%), Positives = 166/288 (58%), Gaps = 4/288 (1%)
 Frame = -1

Query  1268  EGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGLFVYAI  1089
             E + +N   ++IF +SW        +G +C  HGY    ++ FE  A  +A +G  VYAI
Sbjct  107   EWYEINSKGQEIFCKSWLPKPGVRIKGALCFCHGYGDTCTFFFEGIAKYIAASGYGVYAI  166

Query  1088  DLPGHGYSEGRRGHIPRIDPVVHDCILCLD--SARAHHPKLPAFLYGESLGGAIAILICL  915
             D PG G SEG  G++P  D +V++ +   +    R     LP F++G+S+GGAIA+   L
Sbjct  167   DHPGFGLSEGLHGYVPSFDGIVNNALELYNIIKGRPEIVGLPRFVFGQSMGGAIALKALL  226

Query  914   NQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESYREVLK  735
                + W+G+IL  PMC ++++  P  PL++ L L +   P  +++  K  +  ++RE+ K
Sbjct  227   KDPNEWDGIILVAPMCKIAEEMTPPVPLQKILILLSKVMPTAKLVPQKDLAELAFRELKK  286

Query  734   KKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQNavka  555
             +K+   +   + +++    TA+ELL   +YI++   ++  P+LIL G  DKV D    K 
Sbjct  287   RKMADYNVICY-SDQTRLKTAVELLNATRYIESQVDKVASPMLILHGAADKVTDPQVSKF  345

Query  554   vfksaaskdKTLKIFAGMWHQLI-GEPNESVELVFNTTLSWIQMRANL  414
             +++ A+SKDKTLK++ G +H ++ GEP++ +  V +  +SW+  R ++
Sbjct  346   LYERASSKDKTLKLYEGAYHSILEGEPDDRILEVLSDIISWLDSRCSM  393



>ref|XP_009407471.1| PREDICTED: caffeoylshikimate esterase-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=306

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 99/291 (34%), Positives = 158/291 (54%), Gaps = 5/291 (2%)
 Frame = -1

Query  1283  HIIHKEGFVLNENQKKIFTQSWQHDSCDEPRGVVCMIHGYTSESSWLFELNAVAMAKTGL  1104
             ++ ++E F+ N+   ++FT  +   +  EP+ ++ + HGY SE S      A  +AK G 
Sbjct  7     NVEYEEEFIENQRGARLFTCRFVQRNV-EPKALIFLCHGYGSECSISMRDIATRLAKAGY  65

Query  1103  FVYAIDLPGHGYSEGRRGHIPRIDPVVHDCILCLDSA--RAHHPKLPAFLYGESLGGAIA  930
              V  +D  GHG S G RG+I   D +V DC     S   R  + K P +L+G S+GGA+A
Sbjct  66    AVRGVDYEGHGKSSGLRGYISSFDDLVSDCSDYFMSVCERRENKKKPRYLFGLSMGGAVA  125

Query  929   ILICLNQKHVWNGLILSGPMCGVSKKYKPIWPLEEFLPLAAFFAPNWRIIFTKPPSRESY  750
             +L+ L     W+G +L  PMC +  K KP   +   L       P W++I  K     + 
Sbjct  126   LLLHLKAPTYWSGAVLVSPMCKIDGKMKPHPLVISILKKLCSIIPTWKMIPAKDMIDIAI  185

Query  749   REVLKKKLVAKSPNRFPNERPPAATALELLKVCKYIQNNCHELEVPLLILQGGDDKVCDQ  570
             ++  K++ V  +P  +        T  ELL+V   I+ N H++ +P L++ GGDDK+ D 
Sbjct  186   KDPEKRQEVRSNPYNYRGSL-RLGTGHELLRVSLAIERNLHQVTLPFLVMHGGDDKIFDP  244

Query  569   NavkavfksaaskdKTLKIFAGMWHQL-IGEPNESVELVFNTTLSWIQMRA  420
             ++ + ++KSA+S DKT K++ GMWH    GE  E VELVF+  ++W++ R 
Sbjct  245   SSSELLYKSASSTDKTFKVYDGMWHAFTFGEAPERVELVFSDMVAWLEQRT  295



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4330126156944