BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c122671_g1_i1 len=107 path=[85:0-106]

Length=107
                                                                      Score     E

gb|EKC27238.1|  Glutathione S-transferase theta-1                     55.1    6e-08   
gb|AEY80033.1|  glutathione S-transferase T1                          53.9    2e-07   
gb|AFJ75807.1|  glutathione s-transferase T1                          53.1    3e-07   
ref|XP_004346352.1|  glutathione S-transferase domain-containing ...  52.4    6e-07   
gb|AFJ75812.1|  glutathione s-transferase T1                          51.6    1e-06   
gb|EFZ11716.1|  hypothetical protein SINV_06674                       50.8    2e-06   
ref|XP_001238234.1|  AGAP009191-PA                                    50.8    2e-06   Anopheles gambiae str. PEST
gb|AAL59655.1|  glutathione S-transferase E6                          50.8    2e-06   Anopheles gambiae
gb|AGV08610.1|  glutathione S-transferase                             50.1    4e-06   
ref|XP_011066602.1|  PREDICTED: glutathione S-transferase 1-1-like    49.7    4e-06   
ref|XP_002436292.1|  glutathione S-transferase, putative              50.1    5e-06   Ixodes scapularis [blacklegged tick]
gb|EGI57919.1|  Glutathione S-transferase 1-1                         49.7    5e-06   
ref|WP_009628830.1|  Glutathione S-transferase domain protein         48.5    6e-06   
dbj|BAN21522.1|  glutathionetransferase                               48.1    7e-06   
ref|XP_001959214.1|  GF12164                                          49.3    7e-06   Drosophila ananassae
gb|KFM78123.1|  Glutathione S-transferase theta-1                     48.9    9e-06   
gb|KDR15740.1|  Glutathione S-transferase theta-1                     48.9    1e-05   
ref|XP_002410551.1|  glutathione S-transferase, putative              48.9    1e-05   Ixodes scapularis [blacklegged tick]
gb|AHW45898.1|  glutathione S-transferase                             47.8    1e-05   
gb|AEJ87234.1|  glutathione s-transferase E6                          48.9    1e-05   
gb|AIN59813.1|  glutathione S-transferase                             48.5    1e-05   
pdb|3WYW|A  Chain A, Structural Characterization Of Catalytic Sit...  48.5    1e-05   
gb|EFX81632.1|  hypothetical protein DAPPUDRAFT_230826                48.5    1e-05   
ref|WP_028692248.1|  glutathione S-transferase                        48.5    1e-05   
gb|AAT39512.2|  glutathione-S-transferase 1                           47.8    1e-05   Apis mellifera ligustica [common honeybee]
ref|NP_956815.1|  glutathione S-transferase theta-like                48.5    2e-05   Danio rerio [leopard danio]
ref|XP_008482406.1|  PREDICTED: glutathione S-transferase 1, isof...  46.6    2e-05   
ref|WP_034922265.1|  glutathione S-transferase                        48.1    2e-05   
ref|WP_034895185.1|  glutathione S-transferase                        48.1    2e-05   
ref|WP_015768649.1|  glutathione S-transferase                        48.1    2e-05   
gb|AFJ75818.1|  glutathione s-transferase D2                          48.1    2e-05   
ref|XP_002405467.1|  glutathione S-transferase, putative              48.1    2e-05   Ixodes scapularis [blacklegged tick]
gb|AIR95620.1|  GST D2                                                47.8    3e-05   
ref|XP_002400351.1|  glutathione S-transferase, putative              46.6    3e-05   Ixodes scapularis [blacklegged tick]
gb|AFD34184.1|  glutathione S-transferase                             47.8    3e-05   
ref|XP_006563394.1|  PREDICTED: glutathione S-transferase D1 isof...  47.8    3e-05   
gb|AAR09894.1|  similar to Drosophila melanogaster CG17524            47.4    3e-05   Drosophila yakuba
ref|XP_006620744.1|  PREDICTED: glutathione S-transferase 1-like      48.5    3e-05   
ref|NP_001171499.1|  glutathione S-transferase D1                     47.4    3e-05   Apis mellifera [bee]
gb|EFN65389.1|  Glutathione S-transferase 1, isoform D                47.4    3e-05   
ref|XP_008554401.1|  PREDICTED: glutathione S-transferase 1-1-like    47.4    4e-05   
ref|WP_034950057.1|  glutathione S-transferase                        47.0    4e-05   
ref|XP_002091929.1|  GstE3                                            47.4    4e-05   Drosophila yakuba
gb|EFN65388.1|  Glutathione S-transferase 1-1                         47.0    5e-05   
ref|XP_008473050.1|  PREDICTED: glutathione S-transferase 1, isof...  47.0    5e-05   
gb|AAL48992.1|  RE40129p                                              45.8    5e-05   Drosophila melanogaster
ref|XP_006563391.1|  PREDICTED: glutathione S-transferase D1 isof...  47.4    5e-05   
ref|XP_006563392.1|  PREDICTED: glutathione S-transferase D1 isof...  47.4    5e-05   
ref|XP_006563393.1|  PREDICTED: glutathione S-transferase D1 isof...  47.4    5e-05   
ref|WP_027918037.1|  glutathione S-transferase                        46.6    6e-05   
gb|ETN60208.1|  glutathione S-transferase, epsilon class              46.6    7e-05   
ref|WP_008095951.1|  glutathione S-transferase                        46.6    7e-05   
gb|AIL29308.1|  glutathione S-transferase delta 1                     47.0    7e-05   
gb|ETN60211.1|  glutathione S-transferase, epsilon class              46.6    7e-05   
ref|WP_033699908.1|  glutathione S-transferase                        46.6    7e-05   
ref|WP_016391639.1|  glutathione S-transferase domain-containing ...  46.2    8e-05   
ref|XP_003397510.1|  PREDICTED: glutathione S-transferase theta-1...  46.6    8e-05   
ref|WP_014087751.1|  glutathione S-transferase                        46.6    8e-05   
ref|WP_008953504.1|  glutathione S-transferase                        46.6    8e-05   
ref|XP_003485831.1|  PREDICTED: glutathione S-transferase theta-1...  46.6    8e-05   
ref|WP_035817008.1|  glutathione S-transferase                        45.1    9e-05   
gb|KDR15741.1|  Glutathione S-transferase theta-2                     44.7    1e-04   
ref|XP_009062390.1|  hypothetical protein LOTGIDRAFT_207042           46.2    1e-04   
gb|ABV60339.1|  putative glutathione s-transferase                    46.2    1e-04   Lutzomyia longipalpis
gb|ACO09513.1|  Glutathione S-transferase theta-1                     46.2    1e-04   Osmerus mordax
ref|XP_001959215.1|  GF12163                                          45.8    1e-04   Drosophila ananassae
ref|XP_001974673.1|  GG21883                                          45.8    1e-04   Drosophila erecta
gb|AIR95621.1|  GST D3                                                45.8    1e-04   
ref|XP_004085257.1|  PREDICTED: glutathione S-transferase theta-1...  45.8    1e-04   
gb|ACX47897.1|  glutathione S-transferase                             46.2    1e-04   Amyelois transitella
ref|WP_025163684.1|  glutathione S-transferase                        45.8    1e-04   
ref|WP_009682587.1|  glutathione S-transferase                        44.3    1e-04   
gb|EHJ64798.1|  glutathione S-transferase delta 1                     45.8    1e-04   
ref|XP_007299595.1|  glutathione S-transferase-like protein           45.4    2e-04   
ref|WP_020193035.1|  hypothetical protein                             43.9    2e-04   
gb|AHH29555.1|  glutathione S-transferase                             45.4    2e-04   
ref|WP_019098133.1|  MULTISPECIES: glutathione S-transferase          45.4    2e-04   
ref|WP_016712045.1|  glutathione S-transferase                        45.4    2e-04   
ref|WP_016498284.1|  glutathione S-transferase family protein         45.4    2e-04   
ref|XP_003487027.1|  PREDICTED: glutathione S-transferase D5-like     45.4    2e-04   
ref|WP_027594713.1|  glutathione S-transferase                        45.4    2e-04   
gb|AFB83399.1|  theta class glutathione S-transferase                 45.4    2e-04   
ref|WP_023536266.1|  hypothetical protein                             45.4    2e-04   
ref|WP_016488698.1|  MULTISPECIES: glutathione S-transferase          45.4    2e-04   
ref|XP_006463830.1|  hypothetical protein AGABI2DRAFT_194526          45.4    2e-04   
gb|AEE62835.1|  unknown                                               43.9    2e-04   
ref|WP_039613945.1|  glutathione S-transferase                        45.4    2e-04   
gb|AIR95622.1|  GST D4                                                45.4    2e-04   
gb|AGE34482.1|  glutathione S-transferase                             45.4    2e-04   
gb|ABQ82132.1|  glutathione S-transferase theta                       45.4    2e-04   
ref|WP_011532620.1|  glutathione S-transferase                        45.1    2e-04   
ref|WP_029885569.1|  glutathione S-transferase                        45.1    2e-04   
gb|KGU82257.1|  glutathione S-transferase                             45.1    2e-04   
ref|WP_012273814.1|  glutathione S-transferase                        45.1    2e-04   
ref|XP_313665.4|  AGAP004378-PA                                       45.1    2e-04   Anopheles gambiae str. PEST
ref|XP_004466465.1|  PREDICTED: glutathione S-transferase theta-1...  45.8    2e-04   
gb|AAM53609.1|AF513637_1  glutathione S-transferase D11               45.1    2e-04   Anopheles gambiae
ref|WP_008528814.1|  glutathione S-transferase                        45.1    2e-04   
ref|WP_015271508.1|  MULTISPECIES: glutathione S-transferase doma...  45.1    2e-04   
ref|XP_002034438.1|  GM21876                                          45.1    2e-04   Drosophila sechellia
ref|XP_003692160.1|  PREDICTED: uncharacterized protein LOC100872123  46.2    2e-04   
ref|WP_013973895.1|  glutathione S-transferase                        45.1    2e-04   
gb|AHD16018.1|  glutathione S-transferase                             45.1    3e-04   
ref|WP_023443797.1|  hypothetical protein                             45.1    3e-04   
ref|WP_003254843.1|  glutathione S-transferase                        45.1    3e-04   
ref|WP_030139060.1|  glutathione S-transferase                        45.1    3e-04   
ref|WP_021784471.1|  MULTISPECIES: glutathione S-transferase          45.1    3e-04   
gb|AFD36890.1|  glutathione S-transferase delta2                      45.1    3e-04   
ref|WP_010952317.1|  glutathione S-transferase                        45.1    3e-04   
ref|WP_012051444.1|  glutathione S-transferase                        45.1    3e-04   
ref|WP_014589965.1|  glutathione S-transferase                        45.1    3e-04   
ref|NP_611325.2|  glutathione S transferase E3                        45.1    3e-04   Drosophila melanogaster
ref|XP_002425266.1|  GSTD1-5 protein, putative                        45.1    3e-04   Pediculus humanus corporis [human body lice]
gb|KFB39335.1|  glutathione s-transferase E6                          45.1    3e-04   
gb|AEJ87232.1|  glutathione s-transferase E4                          45.1    3e-04   
ref|XP_003705339.1|  PREDICTED: glutathione S-transferase 1, isof...  45.8    3e-04   
gb|AGE34481.1|  glutathione S-transferase                             44.7    3e-04   
gb|ELT90456.1|  hypothetical protein CAPTEDRAFT_173236                45.1    3e-04   
gb|AIR95619.1|  GST D1                                                44.7    3e-04   
gb|AAB26517.1|  glutathione S-transferase D23, DmGST23 {EC 2.5.1.18}  44.7    3e-04   
emb|CAH58743.1|  putative glutahione S-transferase, delta class       44.7    3e-04   Episyrphus balteatus
ref|NP_524913.1|  glutathione S transferase D4                        44.7    3e-04   Drosophila melanogaster
ref|XP_002031488.1|  GM24018                                          44.7    3e-04   Drosophila sechellia
ref|WP_039593216.1|  glutathione S-transferase                        44.7    4e-04   
gb|AFX97454.1|  glutathione-S-transferase e2                          44.7    4e-04   
gb|AFX97452.1|  glutathione-S-transferase e2                          44.7    4e-04   
gb|AEJ87231.1|  glutathione s-transferase E2                          44.7    4e-04   
ref|XP_002103730.1|  GD18817                                          44.7    4e-04   Drosophila simulans
ref|WP_027914188.1|  MULTISPECIES: glutathione S-transferase          44.7    4e-04   
ref|WP_023379104.1|  glutathione S-transferase domain-containing ...  44.7    4e-04   
gb|AFX97445.1|  glutathione-S-transferase e2                          44.3    4e-04   
ref|WP_028733894.1|  glutathione S-transferase                        44.3    4e-04   
ref|WP_027685378.1|  glutathione S-transferase                        44.3    4e-04   
ref|WP_018446211.1|  glutathione S-transferase                        44.3    4e-04   
gb|AFW99927.1|  glutathione-S-transferase e2                          44.7    4e-04   
gb|AFX97458.1|  glutathione-S-transferase e2                          44.3    4e-04   
gb|AFQ61039.1|  glutathione S-transferase delta/epsilon               44.7    4e-04   
gb|AFX97461.1|  glutathione-S-transferase e2                          44.3    4e-04   
ref|WP_039011738.1|  glutathione S-transferase                        44.3    4e-04   
ref|WP_027912298.1|  glutathione S-transferase                        44.3    4e-04   
ref|WP_014338513.1|  glutathione S-transferase                        44.3    4e-04   
ref|WP_003201089.1|  MULTISPECIES: glutathione S-transferase          44.3    4e-04   
gb|AGK30036.1|  glutathione S transferase class epsilon               44.7    4e-04   
gb|AFX97442.1|  glutathione-S-transferase e2                          44.3    4e-04   
gb|KFB52547.1|  glutathione s-transferase E2                          44.3    4e-04   
ref|XP_002074757.1|  GK22981                                          44.7    4e-04   Drosophila willistoni
gb|AFW99926.1|  glutathione-S-transferase e2                          44.7    4e-04   
gb|AGK30026.1|  glutathione S transferase class epsilon               44.7    4e-04   
ref|WP_027840732.1|  glutathione S-transferase                        44.3    4e-04   
gb|AFX97460.1|  glutathione-S-transferase e2                          44.3    4e-04   
gb|AFX97449.1|  glutathione-S-transferase e2                          44.3    4e-04   
gb|AFX97451.1|  glutathione-S-transferase e2                          44.3    4e-04   
gb|AFX97450.1|  glutathione-S-transferase e2                          44.3    4e-04   
gb|AFX97448.1|  glutathione-S-transferase e2                          44.3    4e-04   
gb|AFX97447.1|  glutathione-S-transferase e2                          44.3    4e-04   
gb|AFX97446.1|  glutathione-S-transferase e2                          44.3    4e-04   
gb|AFX97443.1|  glutathione-S-transferase e2                          44.3    4e-04   
ref|WP_039603785.1|  glutathione S-transferase                        44.3    4e-04   
ref|XP_002097368.1|  GE26177                                          44.3    4e-04   Drosophila yakuba
gb|AHC08049.1|  epsilon glutathione S-transferase                     44.3    5e-04   
gb|AAG45164.1|AF316636_1  glutathione S-transferase E2                44.3    5e-04   Anopheles gambiae
gb|AFW99928.1|  glutathione-S-transferase e2                          44.3    5e-04   
ref|XP_319968.3|  AGAP009194-PA                                       44.3    5e-04   Anopheles gambiae str. PEST
gb|AGK30032.1|  glutathione S transferase class epsilon               44.3    5e-04   
ref|NP_001279515.1|  glutathione S-transferase theta-1-like           44.7    5e-04   
gb|AGK30029.1|  glutathione S transferase class epsilon               44.3    5e-04   
ref|XP_001868773.1|  glutathione S-transferase 1-1                    44.3    5e-04   Culex quinquefasciatus
gb|AFX97444.1|  glutathione-S-transferase e2                          44.3    5e-04   
pdb|4GSN|A  Chain A, Crystal Structure Of Gste2 Zan/u Variant Fro...  44.3    5e-04   
gb|AGK30035.1|  glutathione S transferase class epsilon               44.3    5e-04   
gb|AGK30033.1|  glutathione S transferase class epsilon               44.3    5e-04   
gb|AGK30038.1|  glutathione S transferase class epsilon               44.3    5e-04   
gb|AGK30034.1|  glutathione S transferase class epsilon               43.9    5e-04   
ref|WP_012313095.1|  glutathione S-transferase                        44.3    5e-04   
gb|AGK30030.1|  glutathione S transferase class epsilon               44.3    5e-04   
ref|XP_007304092.1|  glutathione S-transferase-like protein           44.3    5e-04   
gb|AAV36537.1|  glutathione S-transferase                             43.5    5e-04   Paxillus involutus
gb|EKC37978.1|  Glutathione S-transferase theta-1                     43.1    5e-04   
gb|AGK30028.1|  glutathione S transferase class epsilon               44.3    6e-04   
ref|XP_010752736.1|  PREDICTED: glutathione S-transferase theta-1...  44.3    6e-04   
gb|AGK30025.1|  glutathione S transferase class epsilon               43.9    6e-04   
gb|AIH07595.1|  glutathione S-transferase delta 2                     43.1    6e-04   
gb|AGK30024.1|  glutathione S transferase class epsilon               43.9    6e-04   
ref|NP_001037183.1|  glutathione S-transferase delta 1                44.3    6e-04   Bombyx mori [silk moth]
pdb|4E8E|A  Chain A, Structural Characterization Of Bombyx Mori G...  44.3    6e-04   
ref|NP_001165927.1|  glutathione S-transferase T3                     44.3    6e-04   Nasonia vitripennis
ref|WP_029875264.1|  glutathione S-transferase                        43.9    6e-04   
ref|WP_028741515.1|  glutathione S-transferase                        43.9    6e-04   
ref|WP_027665146.1|  glutathione S-transferase                        43.9    6e-04   
ref|WP_026238929.1|  glutathione S-transferase                        43.9    6e-04   
ref|WP_026236812.1|  glutathione S-transferase                        43.9    6e-04   
gb|AHF83169.1|  glutathione S-transferase                             43.9    6e-04   
ref|WP_020049227.1|  glutathione S-transferase                        43.9    6e-04   
ref|WP_017990845.1|  glutathione S-transferase                        43.9    6e-04   
ref|WP_017959678.1|  glutathione S-transferase                        43.9    6e-04   
ref|WP_018241299.1|  glutathione S-transferase                        43.9    6e-04   
ref|WP_003557912.1|  glutathione S-transferase                        43.9    6e-04   
ref|WP_003546723.1|  glutathione S-transferase                        43.9    6e-04   
ref|WP_012756702.1|  glutathione S-transferase                        43.9    6e-04   
ref|WP_011651126.1|  glutathione S-transferase                        43.9    6e-04   
gb|EHJ70012.1|  glutathione S-transferase theta 1                     44.3    6e-04   
gb|ACE81253.1|  glutathione S-transferase theta 1                     44.3    6e-04   Tigriopus japonicus
ref|WP_024322853.1|  glutathione S-transferase                        43.9    6e-04   
ref|WP_018070961.1|  glutathione S-transferase                        43.9    6e-04   
ref|XP_003487026.1|  PREDICTED: glutathione S-transferase 1-like      43.9    7e-04   
gb|EYF01001.1|  Glutathione S-transferase, phi                        43.9    7e-04   
ref|XP_007769415.1|  glutathione S-transferase                        43.9    7e-04   
ref|NP_001156289.1|  glutathione S-transferase, theta class-like      43.9    7e-04   Acyrthosiphon pisum
gb|AGK30023.1|  glutathione S transferase class epsilon               43.9    7e-04   
ref|NP_001165915.1|  glutathione S-transferase D5                     43.9    7e-04   Nasonia vitripennis
gb|AGK30027.1|  glutathione S transferase class epsilon               43.9    7e-04   
gb|AEJ87244.1|  glutathione s-transferase E4                          43.9    7e-04   
gb|KHQ54600.1|  putative glutathione S-transferase                    43.9    7e-04   
ref|XP_004466462.1|  PREDICTED: glutathione S-transferase theta-1...  44.3    8e-04   
ref|XP_008301352.1|  PREDICTED: glutathione S-transferase theta-1...  43.5    8e-04   
ref|XP_004466464.1|  PREDICTED: glutathione S-transferase theta-1...  44.3    8e-04   
gb|ABC46449.1|  GST                                                   43.9    8e-04   Lygus lineolaris
gb|AHC08059.1|  delta glutathione S-transferase                       43.9    8e-04   
gb|AEE63346.1|  unknown                                               43.9    8e-04   
ref|XP_003630525.1|  Glutathione transferase                          43.1    8e-04   
ref|XP_001868772.1|  glutathione-s-transferase theta, gst             43.5    9e-04   Culex quinquefasciatus
gb|AHG44619.1|  glutathione S-transferase                             43.5    9e-04   
ref|XP_008695826.1|  PREDICTED: glutathione S-transferase theta-1...  43.9    9e-04   
ref|WP_015158039.1|  glutathione S-transferase                        43.1    0.001   
ref|WP_026154078.1|  glutathione S-transferase                        43.5    0.001   
gb|AAG38507.1|AF273041_1  glutathione transferase GST1-1              43.5    0.001   Anopheles dirus
ref|WP_037168816.1|  glutathione S-transferase                        43.5    0.001   



>gb|EKC27238.1| Glutathione S-transferase theta-1 [Crassostrea gigas]
Length=230

 Score = 55.1 bits (131),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + +  G+H Q EFRKINPFR+VPVIDDNGF+L E
Sbjct  33   VSIGAGEHRQEEFRKINPFRRVPVIDDNGFVLTE  66



>gb|AEY80033.1| glutathione S-transferase T1 [Laodelphax striatella]
Length=236

 Score = 53.9 bits (128),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+++ +G+HLQPEF  INPF+KVP I  NGFIL E
Sbjct  37   EVQLAQGEHLQPEFEAINPFKKVPCISHNGFILTE  71



>gb|AFJ75807.1| glutathione s-transferase T1 [Nilaparvata lugens]
Length=236

 Score = 53.1 bits (126),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+++ +G+HLQPEF  INPF+KVPVI  N FIL E
Sbjct  37   EVQLAQGEHLQPEFEAINPFKKVPVISHNNFILTE  71



>ref|XP_004346352.1| glutathione S-transferase domain-containing protein [Capsaspora 
owczarzaki ATCC 30864]
 gb|EFW47741.1| glutathione S-transferase domain-containing protein [Capsaspora 
owczarzaki ATCC 30864]
Length=231

 Score = 52.4 bits (124),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I VVKG   +PEF+KINP +K+PVIDDNGF+L E
Sbjct  35   INVVKGDQYKPEFKKINPNKKIPVIDDNGFVLFE  68



>gb|AFJ75812.1| glutathione s-transferase T1 [Sogatella furcifera]
Length=235

 Score = 51.6 bits (122),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+++ +G+HLQPEF  INPF+KVP I  +GF+L E
Sbjct  37   EVQLAQGEHLQPEFEAINPFKKVPCISHDGFVLTE  71



>gb|EFZ11716.1| hypothetical protein SINV_06674 [Solenopsis invicta]
Length=220

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + ++KG+H+ PEF +INP   +P IDDNGF+L E
Sbjct  33   VNIMKGEHMMPEFLQINPLHTIPTIDDNGFVLYE  66



>ref|XP_001238234.1| AGAP009191-PA [Anopheles gambiae str. PEST]
 gb|EAU75969.1| AGAP009191-PA [Anopheles gambiae str. PEST]
Length=227

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 18/33 (55%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFIL  99
           E+ V KGQH+  EF+K+NP + +P +DDNGF+L
Sbjct  34  EMNVFKGQHMSDEFKKLNPVQTIPTLDDNGFVL  66



>gb|AAL59655.1| glutathione S-transferase E6 [Anopheles gambiae]
Length=227

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 18/33 (55%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFIL  99
           E+ V KGQH+  EF+K+NP + +P +DDNGF+L
Sbjct  34  EMNVFKGQHMSDEFKKLNPVQTIPTLDDNGFVL  66



>gb|AGV08610.1| glutathione S-transferase [Nephotettix cincticeps]
Length=217

 Score = 50.1 bits (118),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            ++ ++KG+HL+PEF KINP   VP +DDNGF + E
Sbjct  32   QLDLMKGEHLKPEFVKINPQHNVPTLDDNGFAINE  66



>ref|XP_011066602.1| PREDICTED: glutathione S-transferase 1-1-like [Acromyrmex echinatior]
Length=221

 Score = 49.7 bits (117),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + V  G+HL+PEF +INP   +PVIDDNGFIL E
Sbjct  33   VNVPMGEHLKPEFLQINPQHTIPVIDDNGFILWE  66



>ref|XP_002436292.1| glutathione S-transferase, putative [Ixodes scapularis]
 gb|EEC09122.1| glutathione S-transferase, putative [Ixodes scapularis]
Length=246

 Score = 50.1 bits (118),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            ++ +++G+HL P++ K+NPF +VP IDDNGF+L E
Sbjct  63   DLNLLEGEHLTPDYLKLNPFHRVPTIDDNGFVLYE  97



>gb|EGI57919.1| Glutathione S-transferase 1-1 [Acromyrmex echinatior]
Length=216

 Score = 49.7 bits (117),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + V  G+HL+PEF +INP   +PVIDDNGFIL E
Sbjct  33   VNVPMGEHLKPEFLQINPQHTIPVIDDNGFILWE  66



>ref|WP_009628830.1| Glutathione S-transferase domain protein [Pseudanabaena biceps]
 gb|ELS31088.1| Glutathione S-transferase domain protein [Pseudanabaena biceps 
PCC 7429]
Length=152

 Score = 48.5 bits (114),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +1

Query  16   KGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            +G+HLQPEF  INPF KVP IDD+G I+ E
Sbjct  3    EGEHLQPEFLAINPFGKVPAIDDDGSIVWE  32



>dbj|BAN21522.1| glutathionetransferase, partial [Riptortus pedestris]
Length=150

 Score = 48.1 bits (113),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  10   VVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            ++KG HL+PEF K+NP   VP +DDNGF+L E
Sbjct  35   LMKGDHLKPEFIKLNPQHTVPTLDDNGFVLNE  66



>ref|XP_001959214.1| GF12164 [Drosophila ananassae]
 gb|EDV36036.1| GF12164 [Drosophila ananassae]
Length=220

 Score = 49.3 bits (116),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  4   IRVVKGQHLQPEFRKINPFRKVPVIDDNGFIL  99
           + ++ G+HLQPEF K+NP   VPV+DD+GFIL
Sbjct  34  VNLLTGEHLQPEFLKLNPLHTVPVLDDDGFIL  65



>gb|KFM78123.1| Glutathione S-transferase theta-1, partial [Stegodyphus mimosarum]
Length=218

 Score = 48.9 bits (115),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I + +G+HL PEF+KIN F+KVPVID +GF+L E
Sbjct  33   IALRRGEHLAPEFKKINTFQKVPVIDHDGFVLTE  66



>gb|KDR15740.1| Glutathione S-transferase theta-1 [Zootermopsis nevadensis]
Length=226

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG+HL  E+ K+NP +KVPVI+DNGFIL+E
Sbjct  37   VDMAKGEHLSEEYEKLNPLKKVPVIEDNGFILRE  70



>ref|XP_002410551.1| glutathione S-transferase, putative [Ixodes scapularis]
 gb|EEC12950.1| glutathione S-transferase, putative [Ixodes scapularis]
Length=215

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+   K +HL PE+ KINPF KVP I D+GF++ E
Sbjct  32   EVNFFKKEHLSPEYLKINPFHKVPTISDDGFVIYE  66



>gb|AHW45898.1| glutathione S-transferase, partial [Plutella xylostella]
Length=149

 Score = 47.8 bits (112),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  10   VVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            +++G+H+ PEF K+NP   +P IDDNGFIL E
Sbjct  64   IIEGEHMTPEFLKMNPQHTIPTIDDNGFILWE  95



>gb|AEJ87234.1| glutathione s-transferase E6, partial [Anopheles stephensi]
Length=222

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 17/33 (52%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFIL  99
           E+ V KGQH+  EF+K+NP + +P +DDNGF++
Sbjct  34  EMNVFKGQHMTDEFKKLNPVQTIPTLDDNGFLV  66



>gb|AIN59813.1| glutathione S-transferase [Pseudomonas mosselii SJ10]
Length=209

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG+H QPEF  INPF +VPVIDDNG ++ +
Sbjct  35   VDLAKGEHKQPEFLAINPFGQVPVIDDNGIVIAD  68



>pdb|3WYW|A Chain A, Structural Characterization Of Catalytic Site Of A Nilaparvata 
Lugens Delta-class Glutathione Transferase
 pdb|3WYW|B Chain B, Structural Characterization Of Catalytic Site Of A Nilaparvata 
Lugens Delta-class Glutathione Transferase
 gb|AAM21563.1|AF448500_1 glutathione S-transferase [Nilaparvata lugens]
 gb|AFJ75802.1| glutathione s-transferase D2 [Nilaparvata lugens]
Length=216

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 19/29 (66%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  19   GQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            GQHL PEF K+NP   VP +DDNGF+L E
Sbjct  38   GQHLTPEFIKLNPQHNVPTLDDNGFVLNE  66



>gb|EFX81632.1| hypothetical protein DAPPUDRAFT_230826 [Daphnia pulex]
Length=220

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I +++G+H+QPEF KINP   VP +DD+GF++ E
Sbjct  33   INLMQGEHMQPEFLKINPQHTVPCLDDSGFVVTE  66



>ref|WP_028692248.1| glutathione S-transferase [Pseudomonas mosselii]
Length=209

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG+H QPEF  INPF +VPVIDDNG ++ +
Sbjct  35   VDLAKGEHKQPEFLAINPFGQVPVIDDNGIVIAD  68



>gb|AAT39512.2| glutathione-S-transferase 1 [Apis mellifera ligustica]
Length=175

 Score = 47.8 bits (112),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            ++ ++ G+HL+PEF KINP   +P IDDNGF L E
Sbjct  69   QVNLMNGEHLKPEFLKINPQHTIPTIDDNGFRLWE  103



>ref|NP_956815.1| glutathione S-transferase theta-like [Danio rerio]
 gb|AAH55612.1| Zgc:66350 [Danio rerio]
 gb|AAI65095.1| Zgc:66350 protein [Danio rerio]
Length=242

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            +I + KG+   PEF K+NP +KVPV++DNGF+L E
Sbjct  36   QIAIRKGEQKTPEFTKLNPMQKVPVLEDNGFVLTE  70



>ref|XP_008482406.1| PREDICTED: glutathione S-transferase 1, isoform D-like [Diaphorina 
citri]
Length=67

 Score = 46.6 bits (109),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  10   VVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            ++KG+HL PEF K+NP   VP +DDNG+ L E
Sbjct  35   LMKGEHLTPEFLKLNPQHTVPTMDDNGYTLSE  66



>ref|WP_034922265.1| glutathione S-transferase [Candidatus Accumulibacter sp. SK-01]
 gb|KFB69600.1| Disulfide-bond oxidoreductase YfcG [Candidatus Accumulibacter 
sp. SK-01]
Length=211

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            ++ ++KG H QPEF  +NPF +VPVIDDNG I+ +
Sbjct  38   DVDLMKGAHKQPEFLALNPFGQVPVIDDNGTIVAD  72



>ref|WP_034895185.1| glutathione S-transferase [Candidatus Accumulibacter sp. SK-11]
 gb|EXI74028.1| Disulfide-bond oxidoreductase YfcG [Candidatus Accumulibacter 
sp. SK-11]
Length=211

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            ++ ++KG H QPEF  +NPF +VPVIDDNG I+ +
Sbjct  38   DVDLMKGAHKQPEFLALNPFGQVPVIDDNGTIVAD  72



>ref|WP_015768649.1| glutathione S-transferase [Candidatus Accumulibacter phosphatis]
 ref|YP_003169417.1| glutathione S-transferase domain-containing protein [Candidatus 
Accumulibacter phosphatis clade IIA str. UW-1]
 gb|ACV37488.1| Glutathione S-transferase domain protein [Candidatus Accumulibacter 
phosphatis clade IIA str. UW-1]
Length=211

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            ++ ++KG H QPEF  +NPF +VPVIDDNG I+ +
Sbjct  38   DVDLMKGAHKQPEFLALNPFGQVPVIDDNGTIVAD  72



>gb|AFJ75818.1| glutathione s-transferase D2 [Sogatella furcifera]
Length=216

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 19/29 (66%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  19   GQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            GQHL PEF K+NP   VP +DDNGF+L E
Sbjct  38   GQHLTPEFIKLNPQHNVPTLDDNGFVLNE  66



>ref|XP_002405467.1| glutathione S-transferase, putative [Ixodes scapularis]
 gb|EEC10120.1| glutathione S-transferase, putative [Ixodes scapularis]
Length=216

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+   K +HL PEF KINPF KVP + D+GF++ E
Sbjct  32   EVNFTKNEHLSPEFFKINPFHKVPTLCDDGFVVYE  66



>gb|AIR95620.1| GST D2 [Tetranychus cinnabarinus]
Length=216

 Score = 47.8 bits (112),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + V+KG+HL+PEF KINPF  +P + D+GF L E
Sbjct  33   VDVLKGEHLKPEFVKINPFHCIPTLVDDGFALWE  66



>ref|XP_002400351.1| glutathione S-transferase, putative [Ixodes scapularis]
 gb|EEC20195.1| glutathione S-transferase, putative [Ixodes scapularis]
Length=154

 Score = 46.6 bits (109),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            ++   K +HL PE+ KINPF KVP I+D GF++ E
Sbjct  32   DLNFAKKEHLTPEYLKINPFHKVPTINDGGFLVYE  66



>gb|AFD34184.1| glutathione S-transferase [Argyresthia conjugella]
Length=244

 Score = 47.8 bits (112),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  10   VVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            +++G+HL+PEF K+NP   +P IDDNGFIL E
Sbjct  64   LMEGEHLKPEFLKMNPQHTLPTIDDNGFILWE  95



>ref|XP_006563394.1| PREDICTED: glutathione S-transferase D1 isoform X4 [Apis mellifera]
Length=240

 Score = 47.8 bits (112),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            ++ ++ G+HL+PEF KINP   +P IDDNGF L E
Sbjct  55   QVNLMNGEHLKPEFLKINPQHTIPTIDDNGFRLWE  89



>gb|AAR09894.1| similar to Drosophila melanogaster CG17524, partial [Drosophila 
yakuba]
Length=209

 Score = 47.4 bits (111),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + +++ +HL+PEF KINP   VPV+DDNGF L +
Sbjct  34   VNLLEKEHLKPEFLKINPLHTVPVLDDNGFYLSD  67



>ref|XP_006620744.1| PREDICTED: glutathione S-transferase 1-like [Apis dorsata]
Length=403

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            ++ ++ G+HL+PEF KINP   +P IDDNGF L E
Sbjct  218  QVNLMNGEHLKPEFLKINPQHTIPTIDDNGFYLWE  252



>ref|NP_001171499.1| glutathione S-transferase D1 [Apis mellifera]
 ref|XP_006563395.1| PREDICTED: glutathione S-transferase D1 isoform X5 [Apis mellifera]
 ref|XP_006563396.1| PREDICTED: glutathione S-transferase D1 isoform X6 [Apis mellifera]
Length=217

 Score = 47.4 bits (111),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            ++ ++ G+HL+PEF KINP   +P IDDNGF L E
Sbjct  32   QVNLMNGEHLKPEFLKINPQHTIPTIDDNGFRLWE  66



>gb|EFN65389.1| Glutathione S-transferase 1, isoform D [Camponotus floridanus]
Length=221

 Score = 47.4 bits (111),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I V  G+H+ PEF +INP   +P IDDNGFIL E
Sbjct  33   INVSNGEHMNPEFLQINPQHVIPTIDDNGFILWE  66



>ref|XP_008554401.1| PREDICTED: glutathione S-transferase 1-1-like [Microplitis demolitor]
Length=219

 Score = 47.4 bits (111),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I V KG+ L PEF KINP   +P IDDNGFIL E
Sbjct  33   IDVSKGEQLSPEFIKINPQHTLPTIDDNGFILTE  66



>ref|WP_034950057.1| glutathione S-transferase [Candidatus Accumulibacter sp. SK-02]
 gb|KFB76205.1| Disulfide-bond oxidoreductase YfcG [Candidatus Accumulibacter 
sp. SK-02]
Length=211

 Score = 47.0 bits (110),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            ++ ++KG H QPEF  +NPF +VPV+DDNG I+ +
Sbjct  38   DVDLMKGAHKQPEFLALNPFGQVPVLDDNGTIVAD  72



>ref|XP_002091929.1| GstE3 [Drosophila yakuba]
 gb|EDW91641.1| GstE3 [Drosophila yakuba]
Length=220

 Score = 47.4 bits (111),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + +++ +HL+PEF KINP   VPV+DDNGF L +
Sbjct  34   VNLLEKEHLKPEFLKINPLHTVPVLDDNGFYLSD  67



>gb|EFN65388.1| Glutathione S-transferase 1-1 [Camponotus floridanus]
Length=217

 Score = 47.0 bits (110),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E  ++ G HL+PEF KINP   +P +DDNGF L E
Sbjct  32   ETSILDGDHLKPEFVKINPQHTIPTMDDNGFYLWE  66



>ref|XP_008473050.1| PREDICTED: glutathione S-transferase 1, isoform D-like [Diaphorina 
citri]
 ref|XP_008473051.1| PREDICTED: glutathione S-transferase 1, isoform D-like [Diaphorina 
citri]
Length=216

 Score = 47.0 bits (110),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  10   VVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            ++KG+HL PEF K+NP   VP +DDNG+ L E
Sbjct  35   LMKGEHLTPEFLKLNPQHTVPTMDDNGYTLSE  66



>gb|AAL48992.1| RE40129p [Drosophila melanogaster]
Length=106

 Score = 45.8 bits (107),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + +++ +HL+PEF KINP   VP +DDNGF L +
Sbjct  34   VNLMEKEHLKPEFLKINPLHTVPALDDNGFYLAD  67



>ref|XP_006563391.1| PREDICTED: glutathione S-transferase D1 isoform X1 [Apis mellifera]
Length=255

 Score = 47.4 bits (111),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            ++ ++ G+HL+PEF KINP   +P IDDNGF L E
Sbjct  70   QVNLMNGEHLKPEFLKINPQHTIPTIDDNGFRLWE  104



>ref|XP_006563392.1| PREDICTED: glutathione S-transferase D1 isoform X2 [Apis mellifera]
Length=252

 Score = 47.4 bits (111),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            ++ ++ G+HL+PEF KINP   +P IDDNGF L E
Sbjct  67   QVNLMNGEHLKPEFLKINPQHTIPTIDDNGFRLWE  101



>ref|XP_006563393.1| PREDICTED: glutathione S-transferase D1 isoform X3 [Apis mellifera]
Length=249

 Score = 47.4 bits (111),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            ++ ++ G+HL+PEF KINP   +P IDDNGF L E
Sbjct  64   QVNLMNGEHLKPEFLKINPQHTIPTIDDNGFRLWE  98



>ref|WP_027918037.1| glutathione S-transferase [Pseudomonas sp. URMO17WK12:I8]
Length=207

 Score = 46.6 bits (109),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG H QPEF  +NPF +VPVIDDNG ++ +
Sbjct  32   VDLAKGAHKQPEFLALNPFGQVPVIDDNGTVIAD  65



>gb|ETN60208.1| glutathione S-transferase, epsilon class [Anopheles darlingi]
Length=217

 Score = 46.6 bits (109),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            EI ++ G+HL+PEF K+NP   +PV+DD+G I+ E
Sbjct  33   EINLLTGEHLKPEFLKLNPQHTIPVLDDDGTIITE  67



>ref|WP_008095951.1| glutathione S-transferase [Pseudomonas sp. GM84]
 gb|EJN37216.1| glutathione S-transferase [Pseudomonas sp. GM84]
Length=207

 Score = 46.6 bits (109),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG H QPEF  +NPF +VPVIDDNG ++ +
Sbjct  32   VDLAKGAHKQPEFLALNPFGQVPVIDDNGTVIAD  65



>gb|AIL29308.1| glutathione S-transferase delta 1 [Cnaphalocrocis medinalis]
Length=247

 Score = 47.0 bits (110),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  10   VVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            +++G+HL+PEF K+NP   +P +DD+GFIL E
Sbjct  65   IMEGEHLRPEFMKMNPQHTIPTMDDSGFILWE  96



>gb|ETN60211.1| glutathione S-transferase, epsilon class [Anopheles darlingi]
Length=229

 Score = 46.6 bits (109),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 17/33 (52%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFIL  99
           E+ V +GQHL  EF+++NP + +P +DDNGF+L
Sbjct  34  EMNVFQGQHLNDEFKRLNPAQTIPTLDDNGFLL  66



>ref|WP_033699908.1| glutathione S-transferase [Pseudomonas sp. WCS358]
 gb|KEY89962.1| glutathione S-transferase [Pseudomonas sp. WCS358]
 gb|KGI92539.1| glutathione S-transferase [Pseudomonas sp. H2]
Length=209

 Score = 46.6 bits (109),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG H QPEF  +NPF +VPVIDDNG ++ +
Sbjct  35   VDLAKGAHKQPEFLALNPFGQVPVIDDNGTVVAD  68



>ref|WP_016391639.1| glutathione S-transferase domain-containing protein [Pseudomonas 
plecoglossicida]
 gb|EPB97465.1| glutathione S-transferase domain-containing protein [Pseudomonas 
plecoglossicida NB2011]
Length=207

 Score = 46.2 bits (108),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG H QPEF  +NPF +VPVIDDNG ++ +
Sbjct  32   VDLAKGAHKQPEFLALNPFGQVPVIDDNGTVIAD  65



>ref|XP_003397510.1| PREDICTED: glutathione S-transferase theta-1-like [Bombus terrestris]
Length=239

 Score = 46.6 bits (109),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG+HL PE+++I+PF+KVP I+ NGF + E
Sbjct  33   VNLAKGEHLNPEYQRIHPFQKVPAIEHNGFNMME  66



>ref|WP_014087751.1| glutathione S-transferase [Pseudogulbenkiania sp. NH8B]
 ref|YP_004847944.1| glutathione S-transferase [Pseudogulbenkiania sp. NH8B]
 dbj|BAK77530.1| glutathione S-transferase domain protein [Pseudogulbenkiania 
sp. NH8B]
Length=224

 Score = 46.6 bits (109),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + ++ G+HL+PEF+ INP   VPV+DD+GF+L E
Sbjct  31   VDLMTGEHLKPEFQAINPSCLVPVLDDDGFVLTE  64



>ref|WP_008953504.1| glutathione S-transferase [Pseudogulbenkiania ferrooxidans]
 gb|EEG08724.1| Glutathione S-transferase  domain protein [Pseudogulbenkiania 
ferrooxidans 2002]
Length=224

 Score = 46.6 bits (109),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + ++ G+HL+PEF+ INP   VPV+DD+GF+L E
Sbjct  31   VDLMTGEHLKPEFQAINPSCLVPVLDDDGFVLTE  64



>ref|XP_003485831.1| PREDICTED: glutathione S-transferase theta-1-like [Bombus impatiens]
Length=239

 Score = 46.6 bits (109),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG+HL PE+++I+PF+KVP I+ NGF + E
Sbjct  33   VNLAKGEHLNPEYQRIHPFQKVPAIEHNGFNMME  66



>ref|WP_035817008.1| glutathione S-transferase, partial [Cupriavidus basilensis]
Length=119

 Score = 45.1 bits (105),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 17/29 (59%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  19   GQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            G+HL+  FR++NPF +VPV+DDNG IL +
Sbjct  46   GEHLREPFRRLNPFGQVPVLDDNGTILAD  74



>gb|KDR15741.1| Glutathione S-transferase theta-2 [Zootermopsis nevadensis]
Length=97

 Score = 44.7 bits (104),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I V+K  H   +F K+NPF K+PVIDD+GF+L+E
Sbjct  35   INVLKEDHKSDKFLKLNPFNKIPVIDDDGFVLKE  68



>ref|XP_009062390.1| hypothetical protein LOTGIDRAFT_207042 [Lottia gigantea]
 gb|ESO86995.1| hypothetical protein LOTGIDRAFT_207042 [Lottia gigantea]
Length=230

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 18/30 (60%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +1

Query  16   KGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            KG+H   +F+K+NP  KVP +DDNGFIL E
Sbjct  38   KGEHFSEDFKKLNPMSKVPFVDDNGFILTE  67



>gb|ABV60339.1| putative glutathione s-transferase [Lutzomyia longipalpis]
Length=221

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++KG+ L PEF  +NP   +P IDDNGFIL E
Sbjct  34   IDILKGEQLTPEFISMNPQHMIPTIDDNGFILWE  67



>gb|ACO09513.1| Glutathione S-transferase theta-1 [Osmerus mordax]
Length=228

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +1

Query  16   KGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            KG+   P+F K+NP +KVPVIDDNGF+L E
Sbjct  41   KGEQKTPDFAKLNPMQKVPVIDDNGFVLTE  70



>ref|XP_001959215.1| GF12163 [Drosophila ananassae]
 gb|EDV36037.1| GF12163 [Drosophila ananassae]
Length=220

 Score = 45.8 bits (107),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + +++ +HL+PEF KINP   VP +DDNGF L +
Sbjct  34   VNLLEKEHLKPEFLKINPLHTVPTLDDNGFYLYD  67



>ref|XP_001974673.1| GG21883 [Drosophila erecta]
 gb|EDV55073.1| GG21883 [Drosophila erecta]
Length=220

 Score = 45.8 bits (107),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + +++ +HL+PEF KINP   VP +DDNGF L +
Sbjct  34   VNLMEKEHLKPEFLKINPLHTVPALDDNGFYLSD  67



>gb|AIR95621.1| GST D3 [Tetranychus cinnabarinus]
Length=216

 Score = 45.8 bits (107),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + ++KG+HL+PEF K+NPF  +P + D+GF L E
Sbjct  33   VHLMKGEHLKPEFLKMNPFHCIPTLVDDGFALWE  66



>ref|XP_004085257.1| PREDICTED: glutathione S-transferase theta-1-like [Oryzias latipes]
Length=227

 Score = 45.8 bits (107),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +1

Query  16   KGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            KG+H  PEF K+NP +KVPV+ DNGF+L E
Sbjct  40   KGEHRTPEFTKLNPMQKVPVMVDNGFVLTE  69



>gb|ACX47897.1| glutathione S-transferase [Amyelois transitella]
Length=246

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  10   VVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            +++G H+ PEF K+NP   +P +DDNGFIL E
Sbjct  66   IMEGAHMTPEFLKMNPQHTIPTMDDNGFILWE  97



>ref|WP_025163684.1| glutathione S-transferase [Pseudomonas taeanensis]
 gb|KFX70862.1| glutathione S-transferase [Pseudomonas taeanensis MS-3]
Length=208

 Score = 45.8 bits (107),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG H  PEF  +NPF +VPVIDDNG +L +
Sbjct  36   VDLTKGAHKHPEFLAMNPFGQVPVIDDNGTVLAD  69



>ref|WP_009682587.1| glutathione S-transferase, partial [Pseudomonas sp. TJI-51]
 gb|EGB99570.1| glutathione S-transferase [Pseudomonas sp. TJI-51]
Length=72

 Score = 44.3 bits (103),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG H QP+F  +NPF +VPVIDDNG ++ +
Sbjct  35   VDLAKGAHKQPDFLALNPFGQVPVIDDNGTVIAD  68



>gb|EHJ64798.1| glutathione S-transferase delta 1 [Danaus plexippus]
Length=218

 Score = 45.8 bits (107),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  10   VVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            +++GQH+ PEF K+NP   +P +DD+GFIL E
Sbjct  38   IMEGQHMTPEFLKMNPQHTIPTMDDSGFILWE  69



>ref|XP_007299595.1| glutathione S-transferase-like protein [Stereum hirsutum FP-91666 
SS1]
 gb|EIM90669.1| glutathione S-transferase-like protein [Stereum hirsutum FP-91666 
SS1]
Length=211

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            EI  +KG+H  P+F +  PF +VP IDDNGFIL E
Sbjct  32   EIDWMKGEHKSPDFLEKQPFGQVPYIDDNGFILFE  66



>ref|WP_020193035.1| hypothetical protein, partial [Pseudomonas putida]
Length=80

 Score = 43.9 bits (102),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG H QP+F  +NPF +VPVIDDNG ++ +
Sbjct  35   VDLAKGAHKQPDFLALNPFGQVPVIDDNGTVIAD  68



>gb|AHH29555.1| glutathione S-transferase [Rhipicephalus microplus]
Length=216

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            EI   KG+H   EF K NPF KVP IDD G I+ E
Sbjct  32   EINCAKGEHRSAEFIKKNPFHKVPTIDDGGLIVYE  66



>ref|WP_019098133.1| MULTISPECIES: glutathione S-transferase [Pseudomonas]
Length=209

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG H QP+F  +NPF +VPVIDDNG ++ +
Sbjct  35   VDLAKGAHKQPDFLALNPFGQVPVIDDNGTVIAD  68



>ref|WP_016712045.1| glutathione S-transferase [Pseudomonas monteilii]
Length=209

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG H QP+F  +NPF +VPVIDDNG ++ +
Sbjct  35   VDLAKGAHKQPDFLALNPFGQVPVIDDNGTVIAD  68



>ref|WP_016498284.1| glutathione S-transferase family protein [Pseudomonas putida]
 ref|YP_008112144.1| glutathione S-transferase family protein [Pseudomonas putida 
NBRC 14164]
 dbj|BAN52960.1| glutathione S-transferase family protein [Pseudomonas putida 
NBRC 14164]
Length=209

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG H QP+F  +NPF +VPVIDDNG ++ +
Sbjct  35   VDLAKGAHKQPDFLALNPFGQVPVIDDNGTVIAD  68



>ref|XP_003487027.1| PREDICTED: glutathione S-transferase D5-like [Bombus impatiens]
Length=221

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/31 (55%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  13   VKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + G+H++P+F K+NP   +P IDDNGFIL E
Sbjct  36   MNGEHMKPDFLKLNPQHVIPTIDDNGFILCE  66



>ref|WP_027594713.1| glutathione S-transferase [Pseudomonas sp. LAIL14HWK12:I7]
Length=209

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG+H QP F  +NPF +VPVIDDNG ++ +
Sbjct  35   VDLAKGEHKQPAFLALNPFGQVPVIDDNGTVIAD  68



>gb|AFB83399.1| theta class glutathione S-transferase [Ruditapes philippinarum]
Length=231

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I +  G+HLQ EF KI+P ++VPVI+DNGF+L E
Sbjct  34   IDLGSGEHLQEEFTKISPIQRVPVIEDNGFVLGE  67



>ref|WP_023536266.1| hypothetical protein [Pseudomonas putida]
 gb|EST13768.1| hypothetical protein EDP1_2960 [Pseudomonas putida S610]
Length=209

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + +  G H QPEF  INPF +VPVIDDNG ++ +
Sbjct  35   VDLAAGAHKQPEFLAINPFGQVPVIDDNGTVIAD  68



>ref|WP_016488698.1| MULTISPECIES: glutathione S-transferase [Pseudomonas]
 ref|YP_008096869.1| glutathione S-transferase [Pseudomonas putida H8234]
 gb|AGN80211.1| glutathione S-transferase [Pseudomonas putida H8234]
 gb|ERT18402.1| glutathione S-transferase [Pseudomonas putida SJ3]
Length=209

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG H QP+F  +NPF +VPVIDDNG ++ +
Sbjct  35   VDLAKGAHKQPDFLALNPFGQVPVIDDNGTVIAD  68



>ref|XP_006463830.1| hypothetical protein AGABI2DRAFT_194526 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV44508.1| hypothetical protein AGABI2DRAFT_194526 [Agaricus bisporus var. 
bisporus H97]
Length=214

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  4   IRVVKGQHLQPEFRKINPFRKVPVIDDNGFIL  99
           + +VKG+H  PEF+  NPF ++P IDD GFIL
Sbjct  33  VDLVKGEHKMPEFKAKNPFEQIPYIDDGGFIL  64



>gb|AEE62835.1| unknown [Dendroctonus ponderosae]
Length=67

 Score = 43.9 bits (102),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            ++    G+H+  EF KINP +++PVIDDNGF L E
Sbjct  32   DLLYTSGRHMSEEFAKINPQKELPVIDDNGFQLSE  66



>ref|WP_039613945.1| glutathione S-transferase [Pseudomonas sp. C5pp]
 gb|KIC81624.1| glutathione S-transferase [Pseudomonas sp. C5pp]
Length=209

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG H QP+F  +NPF +VPVIDDNG ++ +
Sbjct  35   VDLAKGAHKQPDFLALNPFGQVPVIDDNGTVIAD  68



>gb|AIR95622.1| GST D4 [Tetranychus cinnabarinus]
Length=215

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/30 (60%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +1

Query  16   KGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            KG+HL+PEF KINPF  +P + D+GF L E
Sbjct  37   KGEHLKPEFLKINPFHCIPTMVDDGFALWE  66



>gb|AGE34482.1| glutathione S-transferase [Tetranychus urticae]
Length=215

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/30 (60%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +1

Query  16   KGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            KG+HL+PEF KINPF  +P + D+GF L E
Sbjct  37   KGEHLKPEFLKINPFHCIPTMVDDGFALWE  66



>gb|ABQ82132.1| glutathione S-transferase theta [Alitta succinea]
Length=226

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +1

Query  16   KGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            KG+H   EF KINPF+ VPVIDD GF+L E
Sbjct  38   KGEHQTEEFAKINPFQLVPVIDDGGFVLYE  67



>ref|WP_011532620.1| glutathione S-transferase [Pseudomonas entomophila]
 ref|YP_607014.1| glutathione S-transferase [Pseudomonas entomophila L48]
 emb|CAK14204.1| putative glutathione S-transferase [Pseudomonas entomophila L48]
Length=209

 Score = 45.1 bits (105),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG H QP+F  +NPF +VPVIDDNG ++ +
Sbjct  35   VDLAKGAHKQPDFLALNPFGQVPVIDDNGIVIAD  68



>ref|WP_029885569.1| glutathione S-transferase [Pseudomonas putida]
Length=209

 Score = 45.1 bits (105),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG H QP+F  +NPF +VPVIDDNG ++ +
Sbjct  35   VDLAKGAHKQPDFLALNPFGQVPVIDDNGTVIAD  68



>gb|KGU82257.1| glutathione S-transferase [Pseudomonas mediterranea CFBP 5447]
Length=208

 Score = 45.1 bits (105),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG H Q +F  INPF +VPVIDDNG IL +
Sbjct  34   VDLAKGAHKQADFLAINPFGQVPVIDDNGVILAD  67



>ref|WP_012273814.1| glutathione S-transferase [Pseudomonas putida]
 ref|YP_001670474.1| glutathione S-transferase domain-containing protein [Pseudomonas 
putida GB-1]
 gb|ABZ00139.1| Glutathione S-transferase domain [Pseudomonas putida GB-1]
Length=209

 Score = 45.1 bits (105),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG H QP+F  +NPF +VPVIDDNG ++ +
Sbjct  35   VDLAKGAHKQPDFLALNPFGQVPVIDDNGTVIAD  68



>ref|XP_313665.4| AGAP004378-PA [Anopheles gambiae str. PEST]
 gb|EAA09273.5| AGAP004378-PA [Anopheles gambiae str. PEST]
Length=214

 Score = 45.1 bits (105),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+ ++KG+HL+PEF KINP   VP + DN F+L E
Sbjct  30   EVDLLKGEHLKPEFLKINPQHTVPTLVDNDFVLWE  64



>ref|XP_004466465.1| PREDICTED: glutathione S-transferase theta-1-like isoform 4 [Dasypus 
novemcinctus]
Length=269

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + +G+HLQPEFRK+NP  KVP + D  F+L E
Sbjct  33   VVLARGEHLQPEFRKVNPLGKVPALRDGDFLLAE  66



>gb|AAM53609.1|AF513637_1 glutathione S-transferase D11 [Anopheles gambiae]
Length=214

 Score = 45.1 bits (105),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+ ++KG+HL+PEF KINP   VP + DN F+L E
Sbjct  30   EVDLLKGEHLKPEFLKINPQHTVPTLVDNDFVLWE  64



>ref|WP_008528814.1| glutathione S-transferase [Rhizobium sp. Pop5]
 gb|EJZ20718.1| glutathione S-transferase [Rhizobium sp. Pop5]
Length=203

 Score = 45.1 bits (105),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/35 (49%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+ +  G H  PEF K+NPF +VPV+DDNG ++ +
Sbjct  30   EVDMAAGAHKTPEFLKLNPFGQVPVLDDNGTVVAD  64



>ref|WP_015271508.1| MULTISPECIES: glutathione S-transferase domain-containing protein 
[Pseudomonas]
 ref|YP_007230940.1| glutathione S-transferase domain-containing protein [Pseudomonas 
putida HB3267]
 ref|YP_008956297.1| glutathione S-transferase [Pseudomonas monteilii SB3078]
 ref|YP_008961660.1| glutathione S-transferase [Pseudomonas monteilii SB3101]
 gb|AGA74997.1| glutathione S-transferase domain-containing protein [Pseudomonas 
putida HB3267]
 gb|ESW37219.1| glutathione S-transferase [Pseudomonas taiwanensis SJ9]
 gb|AHC84146.1| glutathione S-transferase [Pseudomonas monteilii SB3078]
 gb|AHC89517.1| glutathione S-transferase [Pseudomonas monteilii SB3101]
 gb|AHZ78988.1| glutathione S-transferase domain-containing protein [Pseudomonas 
putida]
 gb|KGK27101.1| glutathione S-transferase [Pseudomonas plecoglossicida]
Length=209

 Score = 45.1 bits (105),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG H QP+F  +NPF +VPVIDDNG ++ +
Sbjct  35   VDLAKGAHKQPDFLALNPFGQVPVIDDNGTVIAD  68



>ref|XP_002034438.1| GM21876 [Drosophila sechellia]
 gb|EDW48451.1| GM21876 [Drosophila sechellia]
Length=220

 Score = 45.1 bits (105),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + +++ +HL+PEF KINP   VP +DDNGF L +
Sbjct  34   VNLMEKEHLKPEFLKINPLHTVPALDDNGFYLSD  67



>ref|XP_003692160.1| PREDICTED: uncharacterized protein LOC100872123 [Apis florea]
Length=457

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/33 (52%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFIL  99
            ++ ++ G+HL+PEF K+NP   +P IDDNGF L
Sbjct  274  KVDLLNGEHLKPEFLKMNPQHTIPTIDDNGFYL  306


 Score = 45.1 bits (105),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I  +KG+H++ EF K+NP   +P IDDNGF+L E
Sbjct  33   ISPLKGEHMKSEFVKLNPQHVIPTIDDNGFVLCE  66



>ref|WP_013973895.1| glutathione S-transferase [Pseudomonas putida]
 ref|YP_004703516.1| glutathione S-transferase family protein [Pseudomonas putida 
S16]
 gb|AEJ14636.1| glutathione S-transferase family protein [Pseudomonas putida 
S16]
Length=209

 Score = 45.1 bits (105),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG H QP+F  +NPF +VPVIDDNG ++ +
Sbjct  35   VDLAKGAHKQPDFLALNPFGQVPVIDDNGTVIAD  68



>gb|AHD16018.1| glutathione S-transferase [Pseudomonas sp. FGI182]
Length=209

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG H QP+F  +NPF +VPVIDDNG ++ +
Sbjct  35   VDLAKGAHKQPDFLALNPFGQVPVIDDNGTVVAD  68



>ref|WP_023443797.1| hypothetical protein [Pseudomonas chloritidismutans]
 gb|ESR01271.1| hypothetical protein F753_01015 [Pseudomonas chloritidismutans 
AW-1]
Length=209

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG H QPEF  +NPF +VPVID NG +L +
Sbjct  35   VDLAKGAHKQPEFLAMNPFGQVPVIDHNGTVLSD  68



>ref|WP_003254843.1| glutathione S-transferase [Pseudomonas putida]
 gb|EMR45367.1| glutathione S-transferase domain-containing protein [Pseudomonas 
putida LS46]
 gb|ENY75637.1| glutathione S-transferase domain-containing protein [Pseudomonas 
putida TRO1]
Length=209

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG H QP+F  +NPF +VPVIDDNG ++ +
Sbjct  35   VDLAKGAHKQPDFLALNPFGQVPVIDDNGTVIAD  68



>ref|WP_030139060.1| glutathione S-transferase [Pseudomonas fluorescens]
Length=208

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG H QPEF  IN F +VPV+DDNG +L +
Sbjct  34   VDLAKGAHKQPEFLAINSFGQVPVLDDNGVVLAD  67



>ref|WP_021784471.1| MULTISPECIES: glutathione S-transferase [Pseudomonas putida group]
 gb|ERK99755.1| glutathione S-transferase [Pseudomonas putida LF54]
Length=209

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG H QP+F  +NPF +VPVIDDNG ++ +
Sbjct  35   VDLAKGAHKQPDFLALNPFGQVPVIDDNGTVIAD  68



>gb|AFD36890.1| glutathione S-transferase delta2 [Panonychus citri]
Length=217

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  10   VVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            +++G+HL+PEF KINPF  +P + D+GF L E
Sbjct  35   LMQGEHLKPEFLKINPFHCIPTLVDDGFTLWE  66



>ref|WP_010952317.1| glutathione S-transferase [Pseudomonas putida]
 ref|NP_743322.1| glutathione S-transferase [Pseudomonas putida KT2440]
 gb|AAN66786.1|AE016307_5 glutathione S-transferase family protein [Pseudomonas putida 
KT2440]
Length=209

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG H QP+F  +NPF +VPVIDDNG ++ +
Sbjct  35   VDLAKGAHKQPDFLALNPFGQVPVIDDNGTVIAD  68



>ref|WP_012051444.1| glutathione S-transferase [Pseudomonas putida]
 ref|YP_001266541.1| glutathione S-transferase domain-containing protein [Pseudomonas 
putida F1]
 ref|YP_006387881.1| glutathione S-transferase domain-containing protein [Pseudomonas 
putida ND6]
 ref|YP_006533625.1| glutathione S-transferase domain-containing protein [Pseudomonas 
putida DOT-T1E]
 gb|ABQ77357.1| Glutathione S-transferase, N-terminal domain protein [Pseudomonas 
putida F1]
 gb|AFK70766.1| glutathione S-transferase domain-containing protein [Pseudomonas 
putida ND6]
 gb|AFO48831.1| glutathione S-transferase domain-containing protein [Pseudomonas 
putida DOT-T1E]
Length=209

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG H QP+F  +NPF +VPVIDDNG ++ +
Sbjct  35   VDLAKGAHKQPDFLALNPFGQVPVIDDNGTVIAD  68



>ref|WP_014589965.1| glutathione S-transferase [Pseudomonas putida]
 ref|YP_005929094.1| glutathione S-transferase [Pseudomonas putida BIRD-1]
 gb|ADR58889.1| Glutathione S-transferase domain-containing protein [Pseudomonas 
putida BIRD-1]
 gb|AJA12405.1| glutathione S-transferase [Pseudomonas putida S12]
Length=209

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG H QP+F  +NPF +VPVIDDNG ++ +
Sbjct  35   VDLAKGAHKQPDFLALNPFGQVPVIDDNGTVIAD  68



>ref|NP_611325.2| glutathione S transferase E3 [Drosophila melanogaster]
 gb|AAF57699.1| glutathione S transferase E3 [Drosophila melanogaster]
 gb|ABV82154.1| FI01423p [Drosophila melanogaster]
Length=220

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + +++ +HL+PEF KINP   VP +DDNGF L +
Sbjct  34   VNLMEKEHLKPEFLKINPLHTVPALDDNGFYLAD  67



>ref|XP_002425266.1| GSTD1-5 protein, putative [Pediculus humanus corporis]
 gb|EEB12528.1| GSTD1-5 protein, putative [Pediculus humanus corporis]
Length=216

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + ++KG+HL+PEF KINP   +P I DNGF + E
Sbjct  33   LELMKGEHLKPEFLKINPQHTIPTIIDNGFCMWE  66



>gb|KFB39335.1| glutathione s-transferase E6 [Anopheles sinensis]
Length=223

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+ V KG H   EF+++NP + +P +DDNGF+L +
Sbjct  35   EMNVYKGHHRNEEFKRLNPVQTIPTLDDNGFLLMD  69



>gb|AEJ87232.1| glutathione s-transferase E4 [Anopheles stephensi]
Length=224

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+ EFRK+NP   +PVIDD+G I+ E
Sbjct  35   INLIAGDHLKEEFRKLNPQHTIPVIDDDGTIVTE  68



>ref|XP_003705339.1| PREDICTED: glutathione S-transferase 1, isoform D-like [Megachile 
rotundata]
Length=390

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            ++ ++ G HL+PE+ KINP   +P IDDNGF L E
Sbjct  206  DVDLMNGAHLKPEYLKINPQHTIPTIDDNGFCLWE  240



>gb|AGE34481.1| glutathione S-transferase [Tetranychus urticae]
Length=215

 Score = 44.7 bits (104),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  10   VVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            +++G+HL+PEF KINPF  +P + D+GF L E
Sbjct  35   LMQGEHLKPEFLKINPFHCIPTLVDDGFALWE  66



>gb|ELT90456.1| hypothetical protein CAPTEDRAFT_173236 [Capitella teleta]
Length=229

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +1

Query  16   KGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            KG+H   E+RKI+PF  VPVIDDNGF L E
Sbjct  38   KGEHHTDEYRKISPFGLVPVIDDNGFTLTE  67



>gb|AIR95619.1| GST D1 [Tetranychus cinnabarinus]
Length=216

 Score = 44.7 bits (104),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  10   VVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            +++G+HL+PEF KINPF  +P + D+GF L E
Sbjct  35   LMQGEHLKPEFLKINPFHCIPTLVDDGFALWE  66



>gb|AAB26517.1| glutathione S-transferase D23, DmGST23 {EC 2.5.1.18} [Drosophila 
melanogaster, Peptide, 214 aa]
Length=214

 Score = 44.7 bits (104),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            ++R+ +G+HL+PEF K+NP   +P + DNGF + E
Sbjct  29   QLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWE  63



>emb|CAH58743.1| putative glutahione S-transferase, delta class [Episyrphus balteatus]
Length=211

 Score = 44.7 bits (104),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+ ++ G+HL+PEF KINP   +P + DNGF L E
Sbjct  30   ELNLMAGEHLKPEFVKINPQHTIPTLVDNGFALWE  64



>ref|NP_524913.1| glutathione S transferase D4 [Drosophila melanogaster]
 sp|Q9VG96.1|GSTT4_DROME RecName: Full=Glutathione S-transferase D4; Short=DmGST23 [Drosophila 
melanogaster]
 gb|AAF54789.1| glutathione S transferase D4 [Drosophila melanogaster]
 gb|AAL49270.1| RE70889p [Drosophila melanogaster]
 gb|ACL86959.1| GstD4-PA, partial [synthetic construct]
 gb|ACL91670.1| GstD4-PA [synthetic construct]
Length=215

 Score = 44.7 bits (104),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            ++R+ +G+HL+PEF K+NP   +P + DNGF + E
Sbjct  30   QLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWE  64



>ref|XP_002031488.1| GM24018 [Drosophila sechellia]
 gb|EDW42474.1| GM24018 [Drosophila sechellia]
Length=215

 Score = 44.7 bits (104),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            ++R+ +G+HL+PEF K+NP   +P + DNGF + E
Sbjct  30   QLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWE  64



>ref|WP_039593216.1| glutathione S-transferase [Pseudomonas frederiksbergensis]
 gb|KHK62813.1| glutathione S-transferase [Pseudomonas frederiksbergensis]
Length=208

 Score = 44.7 bits (104),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG H Q +F  INPF +VPVIDDNG +L +
Sbjct  34   VDLAKGAHKQADFLAINPFGQVPVIDDNGVVLAD  67



>gb|AFX97454.1| glutathione-S-transferase e2, partial [Anopheles arabiensis]
Length=206

 Score = 44.7 bits (104),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  28   INLLTGDHLKPEFLKLNPQHTIPVLDDNGTIITE  61



>gb|AFX97452.1| glutathione-S-transferase e2, partial [Anopheles arabiensis]
 gb|AFX97453.1| glutathione-S-transferase e2, partial [Anopheles arabiensis]
 gb|AFX97455.1| glutathione-S-transferase e2, partial [Anopheles arabiensis]
Length=206

 Score = 44.7 bits (104),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  28   INLLTGDHLKPEFLKLNPQHTIPVLDDNGTIITE  61



>gb|AEJ87231.1| glutathione s-transferase E2 [Anopheles stephensi]
Length=221

 Score = 44.7 bits (104),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HLQPEF K+NP   +PV+DD+G I+ E
Sbjct  34   INLLAGDHLQPEFLKLNPQHTIPVLDDDGTIITE  67



>ref|XP_002103730.1| GD18817 [Drosophila simulans]
 gb|EDX13233.1| GD18817 [Drosophila simulans]
Length=215

 Score = 44.7 bits (104),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            ++R+ +G+HL+PEF K+NP   +P + DNGF + E
Sbjct  30   QLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWE  64



>ref|WP_027914188.1| MULTISPECIES: glutathione S-transferase [Pseudomonas]
Length=209

 Score = 44.7 bits (104),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + +  G H QPEF  +NPF +VPVIDDNG ++ +
Sbjct  35   VDLAAGAHKQPEFLALNPFGQVPVIDDNGTVIAD  68



>ref|WP_023379104.1| glutathione S-transferase domain-containing protein [Pseudomonas 
sp. VLB120]
 ref|YP_008762090.1| glutathione S-transferase domain-containing protein [Pseudomonas 
sp. VLB120]
 gb|AGZ33963.1| glutathione S-transferase domain-containing protein [Pseudomonas 
sp. VLB120]
Length=209

 Score = 44.7 bits (104),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG H QP+F  +NPF +VPVIDDNG ++ +
Sbjct  35   VDLAKGAHKQPDFLALNPFGQVPVIDDNGTVIAD  68



>gb|AFX97445.1| glutathione-S-transferase e2, partial [Anopheles arabiensis]
Length=206

 Score = 44.3 bits (103),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  28   INLLTGDHLKPEFLKLNPQHTIPVLDDNGTIITE  61



>ref|WP_028733894.1| glutathione S-transferase [Rhizobium leguminosarum]
Length=203

 Score = 44.3 bits (103),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+ +  G H  P+F K+NPF +VPV+DDNG ++ +
Sbjct  30   EVDLAAGAHKAPDFLKLNPFGQVPVLDDNGVVIAD  64



>ref|WP_027685378.1| glutathione S-transferase [Rhizobium leguminosarum]
Length=203

 Score = 44.3 bits (103),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+ +  G H  P+F K+NPF +VPV+DDNG ++ +
Sbjct  30   EVDLAAGAHKAPDFLKLNPFGQVPVLDDNGVVIAD  64



>ref|WP_018446211.1| glutathione S-transferase [Rhizobium gallicum]
Length=203

 Score = 44.3 bits (103),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+ +  G H  P+F K+NPF +VPV+DDNG ++ +
Sbjct  30   EVDLAAGAHKAPDFLKLNPFGQVPVLDDNGVVIAD  64



>gb|AFW99927.1| glutathione-S-transferase e2 [Anopheles gambiae]
Length=221

 Score = 44.7 bits (104),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  34   INLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITE  67



>gb|AFX97458.1| glutathione-S-transferase e2, partial [Anopheles arabiensis]
Length=206

 Score = 44.3 bits (103),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  28   INLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITE  61



>gb|AFQ61039.1| glutathione S-transferase delta/epsilon [Tetranychus urticae]
Length=218

 Score = 44.7 bits (104),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 17/35 (49%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+ ++ G+H++PEF  INPF  VP + D+GF L E
Sbjct  32   EVSLLTGEHMKPEFLSINPFHCVPTLVDDGFALWE  66



>gb|AFX97461.1| glutathione-S-transferase e2, partial [Anopheles arabiensis]
Length=206

 Score = 44.3 bits (103),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  28   INLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITE  61



>ref|WP_039011738.1| glutathione S-transferase [Pseudomonas brassicacearum]
Length=209

 Score = 44.3 bits (103),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + ++KG+H  PEF  IN F +VPVIDDNG +L +
Sbjct  36   VDLMKGEHKTPEFLAINSFGQVPVIDDNGTVLAD  69



>ref|WP_027912298.1| glutathione S-transferase [Pseudomonas sp. URIL14HWK12:I7]
Length=209

 Score = 44.3 bits (103),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + ++KG+H  PEF  IN F +VPVIDDNG +L +
Sbjct  36   VDLMKGEHKTPEFLAINSFGQVPVIDDNGTVLAD  69



>ref|WP_014338513.1| glutathione S-transferase [Pseudomonas fluorescens]
 ref|YP_005208468.1| glutathione s-transferase [Pseudomonas fluorescens F113]
 gb|AEV63073.1| glutathione s-transferase [Pseudomonas fluorescens F113]
Length=209

 Score = 44.3 bits (103),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + ++KG+H  PEF  IN F +VPVIDDNG +L +
Sbjct  36   VDLMKGEHKTPEFLAINSFGQVPVIDDNGTVLAD  69



>ref|WP_003201089.1| MULTISPECIES: glutathione S-transferase [Pseudomonas]
 ref|YP_004353774.1| glutathione S-transferase [Pseudomonas brassicacearum subsp. 
brassicacearum NFM421]
 gb|AEA68770.1| putative glutathione S-transferase [Pseudomonas brassicacearum 
subsp. brassicacearum NFM421]
 gb|EIK65106.1| glutathione S-transferase [Pseudomonas fluorescens Q8r1-96]
Length=209

 Score = 44.3 bits (103),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + ++KG+H  PEF  IN F +VPVIDDNG +L +
Sbjct  36   VDLMKGEHKTPEFLAINSFGQVPVIDDNGTVLAD  69



>gb|AGK30036.1| glutathione S transferase class epsilon, partial [Anopheles gambiae]
Length=221

 Score = 44.7 bits (104),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  34   INLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITE  67



>gb|AFX97442.1| glutathione-S-transferase e2, partial [Anopheles arabiensis]
Length=206

 Score = 44.3 bits (103),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  28   INLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITE  61



>gb|KFB52547.1| glutathione s-transferase E2 [Anopheles sinensis]
Length=206

 Score = 44.3 bits (103),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+ ++ G HL+P+F K+NP   +PV+DD+G I+ E
Sbjct  33   EVNLLAGDHLKPDFLKLNPQHTIPVLDDDGTIVSE  67



>ref|XP_002074757.1| GK22981 [Drosophila willistoni]
 gb|EDW85743.1| GK22981 [Drosophila willistoni]
Length=223

 Score = 44.7 bits (104),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 17/35 (49%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            ++ +  G+HL+ +F K+NP   VPV+DDNGFI+ E
Sbjct  34   QVNLSAGEHLKEDFLKMNPQHTVPVLDDNGFIIWE  68



>gb|AFW99926.1| glutathione-S-transferase e2 [Anopheles gambiae]
Length=221

 Score = 44.7 bits (104),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  34   INLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITE  67



>gb|AGK30026.1| glutathione S transferase class epsilon, partial [Anopheles gambiae]
 gb|AGK30031.1| glutathione S transferase class epsilon, partial [Anopheles gambiae]
Length=220

 Score = 44.7 bits (104),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  33   INLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITE  66



>ref|WP_027840732.1| glutathione S-transferase [Mastigocoleus testarum]
Length=204

 Score = 44.3 bits (103),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 17/35 (49%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            ++ +V G+H Q  FR +NPF +VPVIDD+G I+ +
Sbjct  31   DVDLVNGEHKQEAFRALNPFGQVPVIDDDGTIVSD  65



>gb|AFX97460.1| glutathione-S-transferase e2, partial [Anopheles arabiensis]
Length=206

 Score = 44.3 bits (103),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  28   INLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITE  61



>gb|AFX97449.1| glutathione-S-transferase e2, partial [Anopheles arabiensis]
Length=206

 Score = 44.3 bits (103),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  28   INLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITE  61



>gb|AFX97451.1| glutathione-S-transferase e2, partial [Anopheles arabiensis]
Length=206

 Score = 44.3 bits (103),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  28   INLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITE  61



>gb|AFX97450.1| glutathione-S-transferase e2, partial [Anopheles arabiensis]
Length=206

 Score = 44.3 bits (103),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  28   INLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITE  61



>gb|AFX97448.1| glutathione-S-transferase e2, partial [Anopheles arabiensis]
Length=206

 Score = 44.3 bits (103),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  28   INLLTGDHLKPEFLKLNPQHTIPVLDDNGTIITE  61



>gb|AFX97447.1| glutathione-S-transferase e2, partial [Anopheles arabiensis]
 gb|AFX97457.1| glutathione-S-transferase e2, partial [Anopheles arabiensis]
 gb|AFX97459.1| glutathione-S-transferase e2, partial [Anopheles arabiensis]
Length=206

 Score = 44.3 bits (103),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  28   INLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITE  61



>gb|AFX97446.1| glutathione-S-transferase e2, partial [Anopheles arabiensis]
Length=206

 Score = 44.3 bits (103),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  28   INLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITE  61



>gb|AFX97443.1| glutathione-S-transferase e2, partial [Anopheles arabiensis]
Length=206

 Score = 44.3 bits (103),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  28   INLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITE  61



>ref|WP_039603785.1| glutathione S-transferase [Pseudomonas putida]
 gb|KHL73236.1| glutathione S-transferase [Pseudomonas putida]
Length=207

 Score = 44.3 bits (103),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG H QPEF  +NP  +VPVIDDNG ++ +
Sbjct  32   VDLAKGAHKQPEFLALNPLGQVPVIDDNGTVIAD  65



>ref|XP_002097368.1| GE26177 [Drosophila yakuba]
 gb|EDW97080.1| GE26177 [Drosophila yakuba]
Length=215

 Score = 44.3 bits (103),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            ++R+ +G+HL+PEF K+NP   +P + DNGF + E
Sbjct  30   QLRLTEGEHLKPEFVKLNPQHTIPTLVDNGFTIWE  64



>gb|AHC08049.1| epsilon glutathione S-transferase [Locusta migratoria]
Length=221

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  19  GQHLQPEFRKINPFRKVPVIDDNGFIL  99
           G+HL+ EF KINP   VP IDDNGFIL
Sbjct  38  GEHLKEEFVKINPQHTVPTIDDNGFIL  64



>gb|AAG45164.1|AF316636_1 glutathione S-transferase E2 [Anopheles gambiae]
Length=221

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  34   INLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITE  67



>gb|AFW99928.1| glutathione-S-transferase e2 [Anopheles gambiae]
Length=221

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  34   INLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITE  67



>ref|XP_319968.3| AGAP009194-PA [Anopheles gambiae str. PEST]
 pdb|2IL3|A Chain A, Structures Of An Insect Epsilon-Class Glutathione S- 
Transferase From The Malaria Vector Anopheles Gambiae: Evidence 
For High Ddt-Detoxifying Activity
 pdb|2IL3|B Chain B, Structures Of An Insect Epsilon-Class Glutathione S- 
Transferase From The Malaria Vector Anopheles Gambiae: Evidence 
For High Ddt-Detoxifying Activity
 pdb|2IMI|A Chain A, Structures Of An Insect Epsilon-Class Glutathione S- 
Transferase From The Malaria Vector Anopheles Gambiae: Evidence 
For High Ddt-Detoxifying Activity
 pdb|2IMI|B Chain B, Structures Of An Insect Epsilon-Class Glutathione S- 
Transferase From The Malaria Vector Anopheles Gambiae: Evidence 
For High Ddt-Detoxifying Activity
 pdb|2IMK|A Chain A, Structures Of An Insect Epsilon-Class Glutathione S- 
Transferase From The Malaria Vector Anopheles Gambiae: Evidence 
For High Ddt-Detoxifying Activity
 pdb|2IMK|B Chain B, Structures Of An Insect Epsilon-Class Glutathione S- 
Transferase From The Malaria Vector Anopheles Gambiae: Evidence 
For High Ddt-Detoxifying Activity
 gb|EAA43411.3| AGAP009194-PA [Anopheles gambiae str. PEST]
Length=221

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  34   INLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITE  67



>gb|AGK30032.1| glutathione S transferase class epsilon, partial [Anopheles gambiae]
Length=219

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  33   INLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITE  66



>ref|NP_001279515.1| glutathione S-transferase theta-1-like [Callorhinchus milii]
 ref|XP_007900009.1| PREDICTED: glutathione S-transferase theta-1-like [Callorhinchus 
milii]
 gb|AFK11343.1| glutathione S-transferase theta-like protein [Callorhinchus milii]
Length=239

 Score = 44.7 bits (104),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +1

Query  16   KGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            KG+   PEF ++NP RKVPVI DNGF+L E
Sbjct  54   KGEQNSPEFGRLNPMRKVPVIVDNGFVLTE  83



>gb|AGK30029.1| glutathione S transferase class epsilon, partial [Anopheles gambiae]
 gb|AGK30040.1| glutathione S transferase class epsilon, partial [Anopheles gambiae]
Length=218

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  33   INLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITE  66



>ref|XP_001868773.1| glutathione S-transferase 1-1 [Culex quinquefasciatus]
 gb|EDS27665.1| glutathione S-transferase 1-1 [Culex quinquefasciatus]
Length=227

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + ++ G+HL+PEF K+NP   VPV+DDNG I+ +
Sbjct  34   VDLLAGEHLKPEFVKLNPQHAVPVLDDNGTIITD  67



>gb|AFX97444.1| glutathione-S-transferase e2, partial [Anopheles arabiensis]
Length=206

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  28   INLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITE  61



>pdb|4GSN|A Chain A, Crystal Structure Of Gste2 Zan/u Variant From Anopheles 
Gambiae
 pdb|4GSN|B Chain B, Crystal Structure Of Gste2 Zan/u Variant From Anopheles 
Gambiae
 pdb|4GSN|C Chain C, Crystal Structure Of Gste2 Zan/u Variant From Anopheles 
Gambiae
 pdb|4GSN|D Chain D, Crystal Structure Of Gste2 Zan/u Variant From Anopheles 
Gambiae
Length=220

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  33   INLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITE  66



>gb|AGK30035.1| glutathione S transferase class epsilon, partial [Anopheles gambiae]
Length=219

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  33   INLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITE  66



>gb|AGK30033.1| glutathione S transferase class epsilon, partial [Anopheles gambiae]
 gb|AGK30037.1| glutathione S transferase class epsilon, partial [Anopheles gambiae]
Length=219

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  33   INLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITE  66



>gb|AGK30038.1| glutathione S transferase class epsilon, partial [Anopheles gambiae]
Length=217

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  32   INLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITE  65



>gb|AGK30034.1| glutathione S transferase class epsilon, partial [Anopheles gambiae]
Length=194

 Score = 43.9 bits (102),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  21   INLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITE  54



>ref|WP_012313095.1| glutathione S-transferase [Pseudomonas putida]
 ref|YP_001748054.1| glutathione S-transferase domain-containing protein [Pseudomonas 
putida W619]
 gb|ACA71685.1| Glutathione S-transferase domain [Pseudomonas putida W619]
Length=207

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG H QPEF  +NP  +VPVIDDNG ++ +
Sbjct  32   VDLAKGAHKQPEFLALNPLGQVPVIDDNGTVIAD  65



>gb|AGK30030.1| glutathione S transferase class epsilon, partial [Anopheles gambiae]
Length=207

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  21   INLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITE  54



>ref|XP_007304092.1| glutathione S-transferase-like protein [Stereum hirsutum FP-91666 
SS1]
 gb|EIM86362.1| glutathione S-transferase-like protein [Stereum hirsutum FP-91666 
SS1]
Length=214

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG H  P F +I PF +VP IDD+GFIL E
Sbjct  33   VDLTKGAHKAPSFTEIQPFGQVPYIDDDGFILYE  66



>gb|AAV36537.1| glutathione S-transferase [Paxillus involutus]
 gb|AAV36538.1| glutathione S-transferase [Paxillus involutus]
Length=169

 Score = 43.5 bits (101),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + + KG+H +P++++  PF ++P IDDNGFIL E
Sbjct  9    VDLTKGEHKKPDYKEKQPFGQIPYIDDNGFILYE  42



>gb|EKC37978.1| Glutathione S-transferase theta-1 [Crassostrea gigas]
Length=138

 Score = 43.1 bits (100),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/29 (62%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  19   GQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            G+H Q  F KINP + VPVIDD GF+L E
Sbjct  39   GEHKQEAFTKINPVQLVPVIDDGGFVLTE  67



>gb|AGK30028.1| glutathione S transferase class epsilon, partial [Anopheles gambiae]
Length=218

 Score = 44.3 bits (103),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  32   INLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITE  65



>ref|XP_010752736.1| PREDICTED: glutathione S-transferase theta-1-like [Larimichthys 
crocea]
Length=228

 Score = 44.3 bits (103),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 17/30 (57%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  16   KGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            +G++  PEF K+NP +KVPV++DNGF+L E
Sbjct  41   RGENRTPEFTKLNPMQKVPVLEDNGFVLTE  70



>gb|AGK30025.1| glutathione S transferase class epsilon, partial [Anopheles gambiae]
Length=196

 Score = 43.9 bits (102),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  21   INLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITE  54



>gb|AIH07595.1| glutathione S-transferase delta 2, partial [Spodoptera litura]
Length=163

 Score = 43.1 bits (100),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 15/32 (47%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  10   VVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            +++G H+ PE+ K+NP   +P +DD+GFIL E
Sbjct  17   IMEGHHMTPEYLKMNPQHTIPTMDDSGFILWE  48



>gb|AGK30024.1| glutathione S transferase class epsilon, partial [Anopheles gambiae]
 gb|AGK30039.1| glutathione S transferase class epsilon, partial [Anopheles gambiae]
Length=206

 Score = 43.9 bits (102),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  21   INLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITE  54



>ref|NP_001037183.1| glutathione S-transferase delta 1 [Bombyx mori]
 emb|CAA07071.1| glutathione S-transferase [Bombyx mori]
Length=218

 Score = 44.3 bits (103),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 16/32 (50%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  10   VVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            ++ G+H+ PE+ K+NP   +P +DDNGFIL E
Sbjct  38   IMNGEHMTPEYLKMNPQHTIPTMDDNGFILWE  69



>pdb|4E8E|A Chain A, Structural Characterization Of Bombyx Mori Glutathione 
Transferase Bmgstd1
 pdb|4E8E|B Chain B, Structural Characterization Of Bombyx Mori Glutathione 
Transferase Bmgstd1
 pdb|4E8E|C Chain C, Structural Characterization Of Bombyx Mori Glutathione 
Transferase Bmgstd1
 pdb|4E8E|D Chain D, Structural Characterization Of Bombyx Mori Glutathione 
Transferase Bmgstd1
 pdb|4E8H|A Chain A, Structural Of Bombyx Mori Glutathione Transferase Bmgstd1 
Complex With Gtt
 pdb|4E8H|B Chain B, Structural Of Bombyx Mori Glutathione Transferase Bmgstd1 
Complex With Gtt
 pdb|4E8H|C Chain C, Structural Of Bombyx Mori Glutathione Transferase Bmgstd1 
Complex With Gtt
 pdb|4E8H|D Chain D, Structural Of Bombyx Mori Glutathione Transferase Bmgstd1 
Complex With Gtt
Length=219

 Score = 44.3 bits (103),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 16/32 (50%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  10   VVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            ++ G+H+ PE+ K+NP   +P +DDNGFIL E
Sbjct  39   IMNGEHMTPEYLKMNPQHTIPTMDDNGFILWE  70



>ref|NP_001165927.1| glutathione S-transferase T3 [Nasonia vitripennis]
Length=221

 Score = 44.3 bits (103),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I + K +HLQP + KINP RK+P ++ NGF L E
Sbjct  33   INLAKREHLQPGYEKINPLRKIPALEHNGFKLTE  66



>ref|WP_029875264.1| glutathione S-transferase [Rhizobium leguminosarum]
Length=203

 Score = 43.9 bits (102),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+ +  G H  P+F K+NPF +VPV+DDNG ++ +
Sbjct  30   EVDLAAGAHKAPDFLKLNPFGQVPVLDDNGTVIAD  64



>ref|WP_028741515.1| glutathione S-transferase [Rhizobium leguminosarum]
Length=203

 Score = 43.9 bits (102),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+ +  G H  P+F K+NPF +VPV+DDNG ++ +
Sbjct  30   EVDLAAGAHKAPDFLKLNPFGQVPVLDDNGTVIAD  64



>ref|WP_027665146.1| glutathione S-transferase [Rhizobium leguminosarum]
Length=203

 Score = 43.9 bits (102),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+ +  G H  P+F K+NPF +VPV+DDNG ++ +
Sbjct  30   EVDLAAGAHKAPDFLKLNPFGQVPVLDDNGTVIAD  64



>ref|WP_026238929.1| glutathione S-transferase [Rhizobium leguminosarum]
Length=203

 Score = 43.9 bits (102),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+ +  G H  P+F K+NPF +VPV+DDNG ++ +
Sbjct  30   EVDMAAGAHKAPDFLKLNPFGQVPVLDDNGTVITD  64



>ref|WP_026236812.1| glutathione S-transferase [Rhizobium leguminosarum]
Length=203

 Score = 43.9 bits (102),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+ +  G H  P+F K+NPF +VPV+DDNG ++ +
Sbjct  30   EVDLAAGAHKAPDFLKLNPFGQVPVLDDNGTVIAD  64



>gb|AHF83169.1| glutathione S-transferase [Rhizobium leguminosarum bv. trifolii 
WSM1689]
Length=203

 Score = 43.9 bits (102),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+ +  G H  P+F K+NPF +VPV+DDNG ++ +
Sbjct  30   EVDLAAGAHKAPDFLKLNPFGQVPVLDDNGTVIAD  64



>ref|WP_020049227.1| glutathione S-transferase [Rhizobium leguminosarum]
Length=203

 Score = 43.9 bits (102),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+ +  G H  P+F K+NPF +VPV+DDNG ++ +
Sbjct  30   EVDLAAGAHKAPDFLKLNPFGQVPVLDDNGTVIAD  64



>ref|WP_017990845.1| glutathione S-transferase [Rhizobium leguminosarum]
Length=203

 Score = 43.9 bits (102),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+ +  G H  P+F K+NPF +VPV+DDNG ++ +
Sbjct  30   EVDLAAGAHKAPDFLKLNPFGQVPVLDDNGTVIAD  64



>ref|WP_017959678.1| glutathione S-transferase [Rhizobium leguminosarum]
Length=203

 Score = 43.9 bits (102),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+ +  G H  P+F K+NPF +VPV+DDNG ++ +
Sbjct  30   EVDLAAGAHKAPDFLKLNPFGQVPVLDDNGTVIAD  64



>ref|WP_018241299.1| glutathione S-transferase [Rhizobium leguminosarum]
 sp|Q52828.1|GSTA_RHILE RecName: Full=Protein GstA [Rhizobium leguminosarum]
 emb|CAA61942.1| GSTA protein [Rhizobium leguminosarum]
Length=203

 Score = 43.9 bits (102),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+ +  G H  P+F K+NPF +VPV+DDNG ++ +
Sbjct  30   EVDLAAGAHKAPDFLKLNPFGQVPVLDDNGTVIAD  64



>ref|WP_003557912.1| glutathione S-transferase [Rhizobium leguminosarum]
Length=203

 Score = 43.9 bits (102),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+ +  G H  P+F K+NPF +VPV+DDNG ++ +
Sbjct  30   EVDLAAGAHKAPDFLKLNPFGQVPVLDDNGTVIAD  64



>ref|WP_003546723.1| glutathione S-transferase [Rhizobium leguminosarum]
 gb|EJC70224.1| glutathione S-transferase [Rhizobium leguminosarum bv. viciae 
WSM1455]
Length=203

 Score = 43.9 bits (102),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+ +  G H  P+F K+NPF +VPV+DDNG ++ +
Sbjct  30   EVDLAAGAHKAPDFLKLNPFGQVPVLDDNGTVIAD  64



>ref|WP_012756702.1| glutathione S-transferase [Rhizobium leguminosarum]
 ref|YP_002974891.1| glutathione S-transferase domain protein [Rhizobium leguminosarum 
bv. trifolii WSM1325]
 gb|ACS55352.1| Glutathione S-transferase domain protein [Rhizobium leguminosarum 
bv. trifolii WSM1325]
Length=203

 Score = 43.9 bits (102),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+ +  G H  P+F K+NPF +VPV+DDNG ++ +
Sbjct  30   EVDLAAGAHKAPDFLKLNPFGQVPVLDDNGTVIAD  64



>ref|WP_011651126.1| glutathione S-transferase [Rhizobium leguminosarum]
 ref|YP_767029.1| glutathione S-transferase [Rhizobium leguminosarum bv. viciae 
3841]
 emb|CAK06920.1| putative glutathione S-transferase [Rhizobium leguminosarum bv. 
viciae 3841]
Length=203

 Score = 43.9 bits (102),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+ +  G H  P+F K+NPF +VPV+DDNG ++ +
Sbjct  30   EVDLAAGAHKAPDFLKLNPFGQVPVLDDNGTVIAD  64



>gb|EHJ70012.1| glutathione S-transferase theta 1 [Danaus plexippus]
Length=228

 Score = 44.3 bits (103),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I + KG+H   E+ KIN F+KVPVID NGF+L E
Sbjct  33   IDLRKGEHYSNEYAKINRFQKVPVIDHNGFVLSE  66



>gb|ACE81253.1| glutathione S-transferase theta 1 [Tigriopus japonicus]
Length=229

 Score = 44.3 bits (103),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 16/34 (47%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            IRV K +H  PEF+ +NP + VP+I+D+GF++++
Sbjct  33   IRVAKMEHHGPEFQALNPLKTVPIINDDGFVVKD  66



>ref|WP_024322853.1| glutathione S-transferase [Rhizobium leguminosarum]
Length=203

 Score = 43.9 bits (102),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+ +  G H  P+F K+NPF +VPV+DDNG ++ +
Sbjct  30   EVDMAAGAHKAPDFLKLNPFGQVPVLDDNGTVIAD  64



>ref|WP_018070961.1| glutathione S-transferase [Rhizobium leguminosarum]
Length=203

 Score = 43.9 bits (102),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+ +  G H  P+F K+NPF +VPV+DDNG ++ +
Sbjct  30   EVDMAAGAHKAPDFLKLNPFGQVPVLDDNGTVIAD  64



>ref|XP_003487026.1| PREDICTED: glutathione S-transferase 1-like [Bombus impatiens]
Length=216

 Score = 43.9 bits (102),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 17/35 (49%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+ ++ G +L+PE+ K+NP   +P IDDNGF L E
Sbjct  32   EVALMNGDNLKPEYLKMNPQHTIPTIDDNGFYLWE  66



>gb|EYF01001.1| Glutathione S-transferase, phi [Chondromyces apiculatus DSM 436]
Length=205

 Score = 43.9 bits (102),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + ++KG+  +PEF K+ PF  +PV+DD+GFIL E
Sbjct  31   VDLMKGEQKKPEFLKLQPFGVIPVLDDDGFILYE  64



>ref|XP_007769415.1| glutathione S-transferase [Coniophora puteana RWD-64-598 SS2]
 gb|EIW80468.1| glutathione S-transferase [Coniophora puteana RWD-64-598 SS2]
Length=214

 Score = 43.9 bits (102),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I + KG+H QP + K +PF +VP IDD+GFIL E
Sbjct  33   IDLFKGEHKQPAYTKFHPFGQVPYIDDDGFILFE  66



>ref|NP_001156289.1| glutathione S-transferase, theta class-like [Acyrthosiphon pisum]
 dbj|BAH70833.1| ACYPI009122 [Acyrthosiphon pisum]
Length=232

 Score = 43.9 bits (102),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + ++KG+    EF  INPF+KVPV++ NGF+L E
Sbjct  34   VDLLKGEQFTAEFEAINPFKKVPVVNANGFVLIE  67



>gb|AGK30023.1| glutathione S transferase class epsilon, partial [Anopheles gambiae]
Length=209

 Score = 43.9 bits (102),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  22   INLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITE  55



>ref|NP_001165915.1| glutathione S-transferase D5 [Nasonia vitripennis]
Length=219

 Score = 43.9 bits (102),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +1

Query  13   VKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            +KG+ ++  FRKINP   +P IDDNGFIL E
Sbjct  36   LKGETMKASFRKINPQHTIPTIDDNGFILWE  66



>gb|AGK30027.1| glutathione S transferase class epsilon, partial [Anopheles gambiae]
Length=208

 Score = 43.9 bits (102),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+PEF K+NP   +PV+DDNG I+ E
Sbjct  22   INLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITE  55



>gb|AEJ87244.1| glutathione s-transferase E4 [Anopheles plumbeus]
Length=223

 Score = 43.9 bits (102),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I ++ G HL+ EFRK+NP   +P+IDDNG I+ +
Sbjct  34   INLIAGDHLKDEFRKLNPQHTIPLIDDNGAIVYD  67



>gb|KHQ54600.1| putative glutathione S-transferase [Ponticoccus sp. UMTAT08]
Length=222

 Score = 43.9 bits (102),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  22   QHLQPEFRKINPFRKVPVIDDNGFILQE  105
            QH  P+FR+INP  ++PVIDDNG +L++
Sbjct  39   QHKSPDFRQINPLGQLPVIDDNGLVLRD  66



>ref|XP_004466462.1| PREDICTED: glutathione S-transferase theta-1-like isoform 1 [Dasypus 
novemcinctus]
Length=272

 Score = 44.3 bits (103),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 18/29 (62%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  19   GQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            G+HLQPEFRK+NP  KVP + D  F+L E
Sbjct  68   GEHLQPEFRKVNPLGKVPALRDGDFLLAE  96



>ref|XP_008301352.1| PREDICTED: glutathione S-transferase theta-1-like [Stegastes 
partitus]
Length=209

 Score = 43.5 bits (101),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            +RV   +H  PEF K+NP +KVPV+ DNGF+L E
Sbjct  18   VRVQWREHRTPEFTKLNPMQKVPVLVDNGFVLTE  51



>ref|XP_004466464.1| PREDICTED: glutathione S-transferase theta-1-like isoform 3 [Dasypus 
novemcinctus]
Length=299

 Score = 44.3 bits (103),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 18/29 (62%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  19   GQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            G+HLQPEFRK+NP  KVP + D  F+L E
Sbjct  68   GEHLQPEFRKVNPLGKVPALRDGDFLLAE  96



>gb|ABC46449.1| GST [Lygus lineolaris]
 gb|ABC46450.1| GST [Lygus lineolaris]
Length=216

 Score = 43.9 bits (102),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  10   VVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            ++KG+HL P+F KINP   VP + DNGF+L E
Sbjct  35   LMKGEHLAPDFVKINPQHCVPTLVDNGFVLLE  66



>gb|AHC08059.1| delta glutathione S-transferase [Locusta migratoria]
Length=233

 Score = 43.9 bits (102),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 17/35 (49%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+    G+HL  +F K NP R++P +DDNGF L E
Sbjct  33   EVDFAAGEHLSDDFSKKNPQREIPCLDDNGFFLSE  67



>gb|AEE63346.1| unknown [Dendroctonus ponderosae]
Length=231

 Score = 43.9 bits (102),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 18/29 (62%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +1

Query  19   GQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            G+H+  EF KINP +++PVIDDNGF L E
Sbjct  38   GRHMSEEFAKINPQKELPVIDDNGFQLSE  66



>ref|XP_003630525.1| Glutathione transferase [Medicago truncatula]
 gb|AET05001.1| glutathione S-transferase theta [Medicago truncatula]
Length=188

 Score = 43.1 bits (100),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            I + K QHL PEF+ INPF+KVP I D  F L E
Sbjct  33   IELSKRQHLSPEFQAINPFKKVPAIVDGRFKLFE  66



>ref|XP_001868772.1| glutathione-s-transferase theta, gst [Culex quinquefasciatus]
 gb|EDS27664.1| glutathione-s-transferase theta, gst [Culex quinquefasciatus]
Length=219

 Score = 43.5 bits (101),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    IRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            + ++ G HL+PE+ K+NP   VPV+DDNG I+ E
Sbjct  34   VNLMAGDHLKPEYLKMNPRHTVPVLDDNGTIVYE  67



>gb|AHG44619.1| glutathione S-transferase [Rhizobium leguminosarum bv. trifolii 
CB782]
Length=203

 Score = 43.5 bits (101),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+ +  G H  PEF K+NPF +VPV+DD+G ++ +
Sbjct  30   EVDLAAGAHKAPEFLKLNPFGQVPVLDDDGTVIAD  64



>ref|XP_008695826.1| PREDICTED: glutathione S-transferase theta-1-like [Ursus maritimus]
Length=237

 Score = 43.9 bits (102),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 3/38 (8%)
 Frame = +1

Query  1    EIRVV---KGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+R V   +G+HL+PEF K+NP  KVP + D  F+L E
Sbjct  29   ELRSVELGRGEHLKPEFLKVNPLGKVPALKDGDFLLAE  66



>ref|WP_015158039.1| glutathione S-transferase [Chamaesiphon minutus]
 ref|YP_007095372.1| glutathione S-transferase [Chamaesiphon minutus PCC 6605]
 gb|AFY91845.1| glutathione S-transferase [Chamaesiphon minutus PCC 6605]
Length=182

 Score = 43.1 bits (100),  Expect = 0.001, Method: Composition-based stats.
 Identities = 19/29 (66%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  19   GQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            G+HLQP+F KINPF KVP I D  F L E
Sbjct  36   GEHLQPDFLKINPFGKVPAIVDGDFALFE  64



>ref|WP_026154078.1| glutathione S-transferase [Rhizobium leguminosarum]
Length=203

 Score = 43.5 bits (101),  Expect = 0.001, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+ +  G H  P+F K+NPF +VPV+DDNG ++ +
Sbjct  30   EVDMAAGAHKGPDFLKLNPFGQVPVLDDNGTVIAD  64



>gb|AAG38507.1|AF273041_1 glutathione transferase GST1-1 [Anopheles dirus]
 gb|AAG17625.1| glutathione transferase [Anopheles cracens]
Length=209

 Score = 43.5 bits (101),  Expect = 0.001, Method: Composition-based stats.
 Identities = 16/32 (50%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  10   VVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            ++ G+H++PEF K+NP   +P +DDNGF L E
Sbjct  33   LMAGEHMKPEFLKLNPQHCIPTLDDNGFSLWE  64



>ref|WP_037168816.1| glutathione S-transferase [Rhizobium sp. CF258]
Length=205

 Score = 43.5 bits (101),  Expect = 0.001, Method: Composition-based stats.
 Identities = 17/35 (49%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EIRVVKGQHLQPEFRKINPFRKVPVIDDNGFILQE  105
            E+ +  G H  PEF K+NPF +VPV+DD G I+ +
Sbjct  30   EVDLAAGAHKSPEFLKLNPFGQVPVLDDGGTIVAD  64



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 525703048884