BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c122507_g1_i1 len=124 path=[102:0-123]

Length=124
                                                                      Score     E

ref|XP_008676218.1|  PREDICTED: zinc finger protein 862-like          45.8    5e-04   
tpg|DAA56791.1|  TPA: hypothetical protein ZEAMMB73_441202            45.4    7e-04   



>ref|XP_008676218.1| PREDICTED: zinc finger protein 862-like [Zea mays]
Length=745

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 1/40 (3%)
 Frame = +2

Query  5    DLKSCCICLEAALKRDEQCGDIDGNELYIELKLLREILSK  124
            DLKS C  LE ALK+D +  D+D NELY+ELK L+E + K
Sbjct  609  DLKSSCDNLETALKKDGK-SDVDANELYMELKFLQEFMPK  647



>tpg|DAA56791.1| TPA: hypothetical protein ZEAMMB73_441202 [Zea mays]
Length=842

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 1/40 (3%)
 Frame = +2

Query  5    DLKSCCICLEAALKRDEQCGDIDGNELYIELKLLREILSK  124
            DLKS C  LE ALK+D +  D+D NELY+ELK L+E + K
Sbjct  706  DLKSSCDNLETALKKDGK-SDVDANELYMELKFLQEFMPK  744



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 529750811642