BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c122285_g1_i1 len=144 path=[122:0-143]

Length=144
                                                                      Score     E

gb|AGR66195.1|  methionine adenosyltransferase                        87.0    2e-19   
gb|AFK33626.1|  unknown                                               74.3    1e-14   
emb|CDX91837.1|  BnaC03g31390D                                        75.1    1e-14   
ref|XP_008917255.1|  S-adenosylmethionine synthase 2                  74.3    2e-14   
emb|CDY72092.1|  BnaCnng75920D                                        74.7    2e-14   
emb|CDX74394.1|  BnaA03g26530D                                        74.7    2e-14   
dbj|BAH20274.1|  AT4G01850                                            73.9    2e-14   Arabidopsis thaliana [mouse-ear cress]
gb|AAP87282.1|  putative S-adenosylmethionine synthetase              74.7    2e-14   Brassica oleracea var. capitata
ref|XP_002679392.1|  predicted protein                                74.7    2e-14   Naegleria gruberi strain NEG-M
sp|P49611.1|METK1_BRAJU  RecName: Full=S-adenosylmethionine synth...  74.3    3e-14   Brassica juncea [brown mustard]
ref|XP_002896578.1|  S-adenosylmethionine synthetase 2                74.3    3e-14   
sp|Q5DNB1.1|METK_BRARP  RecName: Full=S-adenosylmethionine syntha...  74.3    3e-14   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_010230849.1|  PREDICTED: S-adenosylmethionine synthase 1       74.3    3e-14   
ref|XP_008902357.1|  S-adenosylmethionine synthase 2                  74.3    3e-14   
gb|ABJ15732.1|  S-adenosylmethionine synthetase 2                     72.8    4e-14   Triticum monococcum [einkorn wheat]
ref|XP_009111338.1|  PREDICTED: S-adenosylmethionine synthase-like    74.3    4e-14   
ref|XP_009134472.1|  PREDICTED: S-adenosylmethionine synthase         74.3    4e-14   
sp|Q94FA6.1|METK3_BRAJU  RecName: Full=S-adenosylmethionine synth...  74.3    4e-14   Brassica juncea [brown mustard]
emb|CDM83018.1|  unnamed protein product                              73.9    4e-14   
ref|XP_009526921.1|  hypothetical protein PHYSODRAFT_285996           73.9    4e-14   
sp|A6XMY9.1|METK1_TRIMO  RecName: Full=S-adenosylmethionine synth...  73.9    4e-14   Triticum monococcum [einkorn wheat]
gb|EMS55466.1|  S-adenosylmethionine synthase 1                       73.9    5e-14   
gb|ACH61251.1|  S-adenosyl methionine synthetase                      72.4    5e-14   Pseudotsuga menziesii
gb|ACH61229.1|  S-adenosyl methionine synthetase                      72.4    6e-14   Pseudotsuga menziesii
gb|EYU36152.1|  hypothetical protein MIMGU_mgv1a021639mg              73.6    6e-14   
emb|CDX75914.1|  BnaC03g39970D                                        73.9    6e-14   
gb|AFW97626.1|  putative S-adenosylmethionine synthetase              73.6    6e-14   
ref|XP_010456120.1|  PREDICTED: S-adenosylmethionine synthase-like    73.6    7e-14   
ref|XP_010422683.1|  PREDICTED: S-adenosylmethionine synthase         73.6    7e-14   
ref|NP_192094.1|  S-adenosylmethionine synthase 2                     73.6    7e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396376.1|  hypothetical protein EUTSA_v10028715mg           73.6    7e-14   
ref|XP_006287904.1|  hypothetical protein CARUB_v10001138mg           73.6    7e-14   
ref|XP_010428836.1|  PREDICTED: S-adenosylmethionine synthase-like    73.6    7e-14   
emb|CDX82370.1|  BnaA03g34510D                                        73.6    7e-14   
ref|XP_009135526.1|  PREDICTED: S-adenosylmethionine synthase 2-like  73.6    7e-14   
ref|XP_002872873.1|  S-adenosylmethionine synthetase                  73.6    8e-14   
ref|XP_009838370.1|  S-adenosylmethionine synthase 2                  73.2    8e-14   
sp|Q56TU3.1|METK2_DAUCA  RecName: Full=S-adenosylmethionine synth...  73.2    1e-13   Daucus carota [carrots]
gb|KDO32031.1|  S-adenosylmethionine synthase                         72.8    1e-13   
gb|EMT05685.1|  S-adenosylmethionine synthetase 3                     71.6    1e-13   
gb|ADC80657.1|  S-adenosylmethionine synthase-like protein            70.5    1e-13   Tachigali melinonii
dbj|BAC81654.1|  S-adenosylmethionine synthetase-1                    70.1    1e-13   Pisum sativum [garden pea]
gb|ADM18304.1|  SAM synthetase 1                                      72.8    1e-13   
sp|Q56TU4.1|METK1_DAUCA  RecName: Full=S-adenosylmethionine synth...  72.8    1e-13   Daucus carota [carrots]
gb|ADC80656.1|  S-adenosylmethionine synthase-like protein            70.5    1e-13   Tachigali melinonii
sp|Q4LB22.1|METK3_HORVU  RecName: Full=S-adenosylmethionine synth...  72.4    2e-13   Hordeum vulgare [barley]
sp|Q9FPL6.1|METK2_SUASA  RecName: Full=S-adenosylmethionine synth...  72.4    2e-13   Suaeda salsa
ref|XP_008606768.1|  S-adenosylmethionine synthase                    72.4    2e-13   
gb|EFA84075.1|  S-adenosylmethionine synthetase                       72.4    2e-13   Heterostelium album PN500
dbj|BAF46020.1|  putative Adomet decarboxylase                        71.2    2e-13   Cryptomeria japonica
ref|XP_004515907.1|  PREDICTED: S-adenosylmethionine synthase 2-like  72.4    2e-13   
dbj|BAF46024.1|  putative Adomet decarboxylase                        71.2    2e-13   Cryptomeria japonica
dbj|BAF46019.1|  putative Adomet decarboxylase                        71.2    2e-13   Cryptomeria japonica
gb|AIT39705.1|  S-adenosylmethionine synthetase                       72.0    2e-13   
ref|XP_006305011.1|  hypothetical protein CARUB_v10009376mg           72.0    2e-13   
sp|P49612.2|METK1_PEA  RecName: Full=S-adenosylmethionine synthas...  72.0    2e-13   Pisum sativum [garden pea]
gb|ADM64331.1|  S-adenosyl-L-methionine synthase                      72.0    2e-13   
ref|XP_006418333.1|  hypothetical protein EUTSA_v10007845mg           72.0    2e-13   
ref|XP_009389524.1|  PREDICTED: S-adenosylmethionine synthase 5       72.0    2e-13   
sp|P24260.1|METK2_DIACA  RecName: Full=S-adenosylmethionine synth...  72.0    2e-13   Dianthus caryophyllus [carnation]
gb|ACV87970.1|  methionine adenosyltransferase                        70.9    2e-13   Acanthascus dawsoni [sharp-lipped boot sponge]
ref|WP_033227267.1|  S-adenosylmethionine synthetase                  70.1    2e-13   
ref|XP_011089950.1|  PREDICTED: S-adenosylmethionine synthase 3-like  72.0    2e-13   
gb|ADC80644.1|  S-adenosylmethionine synthase-like protein            69.7    3e-13   Phanera guianensis
gb|EMT05684.1|  S-adenosylmethionine synthetase 2                     72.0    3e-13   
gb|EMS47328.1|  S-adenosylmethionine synthase 1                       72.0    3e-13   
gb|ADC80655.1|  S-adenosylmethionine synthase-like protein            69.7    3e-13   Eperua falcata
gb|ACD92982.1|  S-adenosylmethionine synthetase                       70.9    3e-13   Panax ginseng [Asiatic ginseng]
ref|XP_006406736.1|  hypothetical protein EUTSA_v10020887mg           71.6    3e-13   
emb|CDY48693.1|  BnaCnng16700D                                        71.6    3e-13   
sp|Q84MM2.1|METK_LITCN  RecName: Full=S-adenosylmethionine syntha...  71.6    3e-13   Litchi chinensis [litchi]
gb|KDO36066.1|  hypothetical protein CISIN_1g044843mg                 69.7    3e-13   
sp|Q9FUZ1.1|METK2_BRAJU  RecName: Full=S-adenosylmethionine synth...  71.6    3e-13   Brassica juncea [brown mustard]
gb|KDO72159.1|  hypothetical protein CISIN_1g045358mg                 69.7    3e-13   
sp|P50299.1|METK1_HORVU  RecName: Full=S-adenosylmethionine synth...  71.6    3e-13   Hordeum vulgare [barley]
gb|EYU29879.1|  hypothetical protein MIMGU_mgv1a006187mg              72.0    3e-13   
dbj|BAF46026.1|  putative Adomet decarboxylase                        70.9    3e-13   Chamaecyparis obtusa
dbj|BAF46025.1|  putative Adomet decarboxylase                        70.9    3e-13   Chamaecyparis obtusa
gb|ADC80653.1|  S-adenosylmethionine synthase-like protein            69.3    4e-13   Eperua falcata
emb|CAJ01702.1|  putative AdoMet synthase 1                           71.6    4e-13   Hordeum vulgare [barley]
ref|XP_009114068.1|  PREDICTED: S-adenosylmethionine synthase 2       71.6    4e-13   
sp|Q4LB23.1|METK2_HORVU  RecName: Full=S-adenosylmethionine synth...  71.6    4e-13   Hordeum vulgare [barley]
gb|AAA58772.1|  S-adenosylmethionine synthase                         71.2    4e-13   Pisum sativum [garden pea]
emb|CCC55422.1|  S-adenosylmethionine synthase 1                      71.2    4e-13   
gb|EPS69795.1|  s-adenosylmethionine synthase                         71.2    4e-13   
ref|XP_006419259.1|  hypothetical protein CICLE_v10005146mg           71.2    4e-13   
ref|XP_006855322.1|  hypothetical protein AMTR_s00057p00083760        71.2    4e-13   
ref|XP_009793311.1|  PREDICTED: S-adenosylmethionine synthase 1-like  71.2    4e-13   
gb|ABO27088.1|  S-adenosylmethionine synthetase                       69.3    4e-13   
ref|XP_010524596.1|  PREDICTED: S-adenosylmethionine synthase         71.2    4e-13   
ref|XP_009617578.1|  PREDICTED: S-adenosylmethionine synthase 2-like  71.2    4e-13   
ref|XP_003881929.1|  S-adenosylmethionine synthetase,related          71.2    4e-13   
ref|XP_008223483.1|  PREDICTED: S-adenosylmethionine synthase 5       71.2    4e-13   
gb|ADC80654.1|  S-adenosylmethionine synthase-like protein            68.9    4e-13   Eperua falcata
ref|XP_004967602.1|  PREDICTED: S-adenosylmethionine synthase 3-l...  71.2    4e-13   
ref|XP_004967601.1|  PREDICTED: S-adenosylmethionine synthase 3-l...  71.2    4e-13   
ref|XP_006488750.1|  PREDICTED: LOW QUALITY PROTEIN: S-adenosylme...  71.2    4e-13   
ref|XP_008390498.1|  PREDICTED: S-adenosylmethionine synthase 2       71.2    5e-13   
gb|ABY25855.1|  S-adenosylmethionine synthetase                       71.2    5e-13   Glycine soja [wild soybean]
ref|XP_002273336.1|  PREDICTED: S-adenosylmethionine synthase 1 i...  71.2    5e-13   Vitis vinifera
ref|XP_003550837.1|  PREDICTED: S-adenosylmethionine synthase-lik...  71.2    5e-13   
ref|XP_003550804.1|  PREDICTED: S-adenosylmethionine synthase-lik...  71.2    5e-13   
gb|ACU24485.1|  unknown                                               71.2    5e-13   Glycine max [soybeans]
ref|XP_002439235.1|  hypothetical protein SORBIDRAFT_09g002840        71.2    5e-13   Sorghum bicolor [broomcorn]
gb|AGJ50598.1|  SAMS                                                  70.1    5e-13   
ref|XP_008227796.1|  PREDICTED: S-adenosylmethionine synthase 1       71.2    5e-13   
emb|CAN72082.1|  hypothetical protein VITISV_033661                   71.2    5e-13   Vitis vinifera
ref|XP_004288343.1|  PREDICTED: S-adenosylmethionine synthase 2-l...  70.9    5e-13   
ref|XP_010651779.1|  PREDICTED: S-adenosylmethionine synthase 1 i...  71.2    5e-13   
ref|XP_010457229.1|  PREDICTED: S-adenosylmethionine synthase 1-like  71.2    5e-13   
ref|XP_003546550.1|  PREDICTED: S-adenosylmethionine synthase-lik...  71.2    5e-13   
gb|AGF69113.1|  S-adenosylmethionine synthetase                       71.2    5e-13   
ref|XP_010267208.1|  PREDICTED: S-adenosylmethionine synthase 1       70.9    5e-13   
gb|ACK37352.1|  S-adenosyl-L-methionine synthetase                    70.9    6e-13   Glebionis coronaria [crown daisy]
gb|EYU38563.1|  hypothetical protein MIMGU_mgv1a007936mg              70.9    6e-13   
ref|XP_007221573.1|  hypothetical protein PRUPE_ppa025497mg           70.9    6e-13   
ref|XP_006354373.1|  PREDICTED: S-adenosylmethionine synthase 2-l...  70.9    6e-13   
gb|AFI38954.1|  S-adenosyl-L-methionine synthetase                    70.9    6e-13   
dbj|BAC81655.1|  S-adenosylmethionine synthetase-2                    70.5    6e-13   Pisum sativum [garden pea]
gb|EYU19403.1|  hypothetical protein MIMGU_mgv1a007849mg              70.9    6e-13   
ref|XP_010509423.1|  PREDICTED: S-adenosylmethionine synthase 3-like  70.9    6e-13   
dbj|BAP47512.1|  S-adenosylmethionine synthetase                      70.9    6e-13   
gb|ABC24692.1|  S-adenosyl-L-methionine synthetase                    68.9    6e-13   Annona cherimola [cherimoya]
ref|XP_004288342.1|  PREDICTED: S-adenosylmethionine synthase 2-l...  70.9    6e-13   
gb|KCW46782.1|  hypothetical protein EUGRSUZ_K00588                   70.9    6e-13   
gb|AGF95110.1|  S-adenosylmethionine synthetase                       68.9    7e-13   
ref|XP_002881476.1|  hypothetical protein ARALYDRAFT_902809           70.9    7e-13   
gb|ABB29941.1|  S-adenosyl methionine synthase-like                   70.1    7e-13   Solanum tuberosum [potatoes]
gb|KHG08721.1|  S-adenosylmethionine synthase 1                       70.9    7e-13   
sp|Q94FA5.1|METK4_BRAJU  RecName: Full=S-adenosylmethionine synth...  70.9    7e-13   Brassica juncea [brown mustard]
ref|XP_006410860.1|  hypothetical protein EUTSA_v10016774mg           70.9    7e-13   
ref|XP_009141614.1|  PREDICTED: S-adenosylmethionine synthase 3-like  70.9    7e-13   
ref|XP_009133101.1|  PREDICTED: S-adenosylmethionine synthase 3       70.9    7e-13   
ref|NP_181225.1|  S-adenosylmethionine synthase 3                     70.9    7e-13   Arabidopsis thaliana [mouse-ear cress]
dbj|BAI66450.1|  S-adenosylmethionine synthase                        68.9    7e-13   Malus domestica [apple tree]
sp|A9PHE9.1|METK5_POPTR  RecName: Full=S-adenosylmethionine synth...  70.9    7e-13   Populus trichocarpa [western balsam poplar]
ref|XP_008447451.1|  PREDICTED: S-adenosylmethionine synthase 2       70.9    7e-13   
gb|AFK36950.1|  unknown                                               70.9    7e-13   
ref|XP_011019063.1|  PREDICTED: S-adenosylmethionine synthase 3       70.9    7e-13   
sp|P47916.1|METK_POPDE  RecName: Full=S-adenosylmethionine syntha...  70.9    7e-13   Populus deltoides
ref|XP_006379697.1|  S-adenosylmethionine synthase family protein     70.9    7e-13   
ref|NP_188365.1|  S-adenosylmethionine synthase 4                     70.9    7e-13   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01944.1|  s-adenosylmethionine synthetase like protein         70.9    7e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011071333.1|  PREDICTED: S-adenosylmethionine synthase 2       70.9    7e-13   
ref|WP_030634096.1|  S-adenosylmethionine synthetase                  68.9    7e-13   
ref|XP_010312254.1|  PREDICTED: S-adenosylmethionine synthase 3-like  70.5    8e-13   
gb|KCW88660.1|  hypothetical protein EUGRSUZ_A01021                   70.1    8e-13   
ref|XP_006645787.1|  PREDICTED: S-adenosylmethionine synthase 3-like  70.5    8e-13   
gb|AFW82691.1|  methionine adenosyltransferase                        70.9    8e-13   
ref|XP_006297742.1|  hypothetical protein CARUB_v10013777mg           70.9    8e-13   
emb|CAJ45523.1|  S-adenosylmethionine synthetase                      70.5    8e-13   Oryza rufipogon [common wild rice]
ref|XP_003609861.1|  S-adenosylmethionine synthetase                  70.9    8e-13   
emb|CAJ45548.1|  S-adenosylmethionine synthetase                      70.5    8e-13   Oryza rufipogon [common wild rice]
emb|CAJ45536.1|  S-adenosylmethionine synthetase                      70.5    8e-13   Oryza rufipogon [common wild rice]
emb|CAJ45492.1|  S-adenosylmethionine synthetas                       70.5    8e-13   Oryza sativa [red rice]
emb|CBI39656.3|  unnamed protein product                              69.3    8e-13   
sp|Q4H1G4.1|METK1_BETVU  RecName: Full=S-adenosylmethionine synth...  70.5    8e-13   Beta vulgaris [beet]
ref|WP_018850095.1|  S-adenosylmethionine synthase                    70.5    8e-13   
ref|XP_010505371.1|  PREDICTED: S-adenosylmethionine synthase 4-like  70.5    8e-13   
gb|AAT40304.1|  S-adenosylmethionine synthase                         70.5    8e-13   Medicago sativa [alfalfa]
ref|XP_004968660.1|  PREDICTED: S-adenosylmethionine synthase 1-like  70.9    9e-13   
ref|XP_010465788.1|  PREDICTED: S-adenosylmethionine synthase 4       70.5    9e-13   
emb|CAJ45530.1|  S-adenosylmethionine synthetase                      70.5    9e-13   Oryza rufipogon [common wild rice]
emb|CAJ45565.1|  S-adenosylmethionine synthetase                      70.5    9e-13   Oryza rufipogon [common wild rice]
gb|KDP27996.1|  hypothetical protein JCGZ_19076                       70.5    9e-13   
emb|CAJ45487.1|  S-adenosylmethionine synthetase                      70.5    9e-13   Oryza sativa [red rice]
emb|CAJ45501.1|  S-adenosylmethionine synthetas                       70.5    9e-13   Oryza sativa [red rice]
emb|CAJ45528.1|  S-adenosylmethionine synthetase                      70.5    9e-13   Oryza rufipogon [common wild rice]
emb|CAJ45486.1|  S-adenosylmethionine synthetase                      70.5    9e-13   Oryza sativa [red rice]
emb|CAJ45488.1|  S-adenosylmethionine synthetase                      70.5    9e-13   Oryza sativa [red rice]
ref|XP_008461384.1|  PREDICTED: S-adenosylmethionine synthase 2-like  70.5    9e-13   
sp|P93438.1|METK2_ORYSJ  RecName: Full=S-adenosylmethionine synth...  70.5    9e-13   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001132867.2|  uncharacterized protein LOC100194360             70.5    9e-13   Zea mays [maize]
gb|ADC80652.1|  S-adenosylmethionine synthase-like protein            68.2    9e-13   Eperua falcata
sp|Q944U4.1|METK_DENCR  RecName: Full=S-adenosylmethionine syntha...  70.5    9e-13   Dendrobium crumenatum
ref|XP_005743843.1|  PREDICTED: S-adenosylmethionine synthase iso...  69.7    9e-13   
ref|XP_004551780.1|  PREDICTED: S-adenosylmethionine synthase iso...  69.7    9e-13   
ref|XP_010674512.1|  PREDICTED: S-adenosylmethionine synthase 1       70.5    9e-13   
ref|XP_010270953.1|  PREDICTED: S-adenosylmethionine synthase 5       70.5    9e-13   
ref|XP_006840308.1|  hypothetical protein AMTR_s00045p00073480        70.5    9e-13   
emb|CAJ45556.1|  S-adenosylmethionine synthetase                      70.5    9e-13   Oryza rufipogon [common wild rice]
emb|CAJ45561.1|  S-adenosylmethionine synthetase                      70.5    9e-13   Oryza officinalis
emb|CAJ45535.1|  S-adenosylmethionine synthetase                      70.5    9e-13   Oryza rufipogon [common wild rice]
ref|XP_008785826.1|  PREDICTED: S-adenosylmethionine synthase 3       70.5    9e-13   
ref|XP_007223013.1|  hypothetical protein PRUPE_ppa006841mg           70.5    9e-13   
ref|XP_011011515.1|  PREDICTED: S-adenosylmethionine synthase 3       70.5    9e-13   
ref|XP_009401660.1|  PREDICTED: S-adenosylmethionine synthase 1-like  70.5    9e-13   
ref|XP_006654018.1|  PREDICTED: S-adenosylmethionine synthase 1-like  70.5    9e-13   
ref|NP_001054575.1|  Os05g0135700                                     70.5    9e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010241791.1|  PREDICTED: S-adenosylmethionine synthase 1-like  70.5    9e-13   
ref|WP_031507770.1|  S-adenosylmethionine synthetase                  70.5    9e-13   
ref|WP_005319909.1|  S-adenosylmethionine synthase                    70.5    9e-13   
gb|AGE09560.1|  SAM2-like protein                                     70.5    9e-13   
ref|WP_030611133.1|  S-adenosylmethionine synthetase                  70.5    9e-13   
emb|CAJ45555.1|  S-adenosylmethionine synthetase                      70.5    9e-13   Oryza rufipogon [common wild rice]
emb|CAJ45511.1|  S-adenosylmethionine synthetase                      70.5    9e-13   Oryza rufipogon [common wild rice]
emb|CAJ45532.1|  S-adenosylmethionine synthetase                      70.5    9e-13   Oryza rufipogon [common wild rice]
emb|CAJ45544.1|  S-adenosylmethionine synthetase                      70.5    9e-13   Oryza rufipogon [common wild rice]
ref|WP_006350360.1|  S-adenosylmethionine synthase                    70.5    9e-13   
ref|XP_010035406.1|  PREDICTED: S-adenosylmethionine synthase 1       70.5    9e-13   
ref|XP_008390375.1|  PREDICTED: S-adenosylmethionine synthase 2-like  70.5    9e-13   
ref|XP_007051250.1|  S-adenosylmethionine synthetase 2 isoform 1      70.5    9e-13   
ref|XP_004153699.1|  PREDICTED: S-adenosylmethionine synthase 1-l...  70.5    9e-13   
gb|AFC88125.1|  S-adenosylmethionine synthetase                       70.5    9e-13   
emb|CDY37784.1|  BnaC04g00410D                                        70.5    1e-12   
ref|XP_006644126.1|  PREDICTED: S-adenosylmethionine synthase 2-like  70.5    1e-12   
ref|XP_010045729.1|  PREDICTED: S-adenosylmethionine synthase 5       70.5    1e-12   
ref|XP_010099707.1|  S-adenosylmethionine synthase 2                  70.5    1e-12   
ref|NP_001234425.1|  S-adenosylmethionine synthase 1                  70.5    1e-12   
ref|XP_004135945.1|  PREDICTED: S-adenosylmethionine synthase 1-like  70.5    1e-12   
gb|ABU94067.1|  S-adenosylmethionine synthetase                       68.2    1e-12   Pinus sylvestris [Scotch pine]
gb|AHA84275.1|  S-adenosylmethionine synthase                         70.5    1e-12   
sp|P93254.1|METK_MESCR  RecName: Full=S-adenosylmethionine syntha...  70.5    1e-12   Mesembryanthemum crystallinum
ref|XP_010024863.1|  PREDICTED: S-adenosylmethionine synthase 2       70.5    1e-12   
gb|AGF95108.1|  S-adenosylmethionine synthetase                       70.5    1e-12   
ref|XP_009408430.1|  PREDICTED: S-adenosylmethionine synthase 5-like  70.5    1e-12   
ref|XP_008793316.1|  PREDICTED: S-adenosylmethionine synthase 4       70.5    1e-12   
ref|XP_003567567.1|  PREDICTED: S-adenosylmethionine synthase 4       70.5    1e-12   
gb|KIF73518.1|  S-adenosylmethionine synthetase                       70.5    1e-12   
ref|XP_004168041.1|  PREDICTED: S-adenosylmethionine synthase 1-l...  70.5    1e-12   
ref|NP_001130734.1|  uncharacterized protein LOC100191838             70.5    1e-12   Zea mays [maize]
gb|ACF79074.1|  unknown                                               70.5    1e-12   Zea mays [maize]
gb|AHX42567.1|  S-adenosylmethionine synthetase                       70.5    1e-12   
ref|XP_002312296.2|  hypothetical protein POPTR_0008s09870g           70.5    1e-12   Populus trichocarpa [western balsam poplar]
ref|WP_003956418.1|  S-adenosylmethionine synthase                    70.5    1e-12   
ref|XP_010911974.1|  PREDICTED: S-adenosylmethionine synthase 3       70.5    1e-12   
ref|XP_009124482.1|  PREDICTED: S-adenosylmethionine synthase 2       70.1    1e-12   
ref|XP_006397900.1|  hypothetical protein EUTSA_v10001487mg           70.1    1e-12   
ref|WP_028814062.1|  S-adenosylmethionine synthetase                  70.5    1e-12   
ref|WP_023542991.1|  S-adenosylmethionine synthase                    70.5    1e-12   
gb|ABP35525.1|  S-adenosyl-L-methionine synthetase                    70.5    1e-12   Ipomoea batatas [batate]
gb|KHN28175.1|  S-adenosylmethionine synthase                         70.1    1e-12   
gb|AGV22114.1|  S-adenosylmethionine synthetase 1                     70.1    1e-12   
ref|XP_009353412.1|  PREDICTED: S-adenosylmethionine synthase 2-like  70.5    1e-12   
sp|A4ULF8.1|METK_MEDSF  RecName: Full=S-adenosylmethionine syntha...  70.5    1e-12   Medicago falcata [sickle alfalfa]
gb|KCW46783.1|  hypothetical protein EUGRSUZ_K00588                   70.1    1e-12   
ref|WP_008406419.1|  MULTISPECIES: S-adenosylmethionine synthase      70.5    1e-12   
ref|XP_010679475.1|  PREDICTED: S-adenosylmethionine synthase 2       70.1    1e-12   
ref|XP_006349861.1|  PREDICTED: S-adenosylmethionine synthase 2-like  70.1    1e-12   
ref|XP_004168042.1|  PREDICTED: S-adenosylmethionine synthase 1-l...  70.1    1e-12   
ref|XP_004153700.1|  PREDICTED: S-adenosylmethionine synthase 1-l...  70.1    1e-12   
gb|KFG59787.1|  S-adenosyl methionine synthetase                      68.2    1e-12   
dbj|BAP19030.1|  S-adenosyl-L-methionine synthase like protein        70.1    1e-12   
sp|Q8W3Y4.1|METK_PHALU  RecName: Full=S-adenosylmethionine syntha...  70.1    1e-12   Phaseolus lunatus
gb|ACU21288.1|  unknown                                               70.1    1e-12   Glycine max [soybeans]
ref|XP_002519309.1|  s-adenosylmethionine synthetase, putative        70.1    1e-12   Ricinus communis
ref|XP_009772911.1|  PREDICTED: S-adenosylmethionine synthase 2       70.1    1e-12   
ref|XP_002266358.1|  PREDICTED: S-adenosylmethionine synthase 2       70.1    1e-12   Vitis vinifera
ref|XP_007154451.1|  hypothetical protein PHAVU_003G120300g           70.5    1e-12   
ref|WP_030721075.1|  S-adenosylmethionine synthetase                  70.1    1e-12   
ref|XP_008781205.1|  PREDICTED: S-adenosylmethionine synthase         70.1    1e-12   
gb|ACG42196.1|  S-adenosylmethionine synthetase 1                     70.1    1e-12   Zea mays [maize]
ref|WP_030663210.1|  S-adenosylmethionine synthetase                  70.1    1e-12   
ref|XP_009609235.1|  PREDICTED: S-adenosylmethionine synthase 2       70.1    1e-12   
sp|Q96552.1|METK2_CATRO  RecName: Full=S-adenosylmethionine synth...  70.1    1e-12   Catharanthus roseus [chatas]
ref|XP_004252944.1|  PREDICTED: S-adenosylmethionine synthase 2       70.1    1e-12   
sp|Q4H1G3.1|METK2_BETVU  RecName: Full=S-adenosylmethionine synth...  70.1    1e-12   Beta vulgaris [beet]
ref|WP_018534830.1|  S-adenosylmethionine synthase                    70.1    1e-12   
gb|ADC45377.1|  S-adenosylmethionine synthetase                       70.1    1e-12   
ref|NP_001042794.1|  Os01g0293000                                     70.1    1e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009359772.1|  PREDICTED: S-adenosylmethionine synthase 2-like  70.1    1e-12   
gb|KEH42171.1|  S-adenosylmethionine synthase-like protein            70.1    1e-12   
gb|KEH42170.1|  S-adenosylmethionine synthase-like protein            70.1    1e-12   
ref|XP_010507932.1|  PREDICTED: S-adenosylmethionine synthase 2       70.1    1e-12   
ref|XP_007154447.1|  hypothetical protein PHAVU_003G120000g           70.1    1e-12   
ref|WP_030787274.1|  S-adenosylmethionine synthetase                  70.1    1e-12   
ref|WP_030560496.1|  S-adenosylmethionine synthetase                  70.1    1e-12   
ref|WP_030355516.1|  S-adenosylmethionine synthetase                  70.1    1e-12   
emb|CAN75334.1|  hypothetical protein VITISV_002362                   70.1    1e-12   Vitis vinifera
gb|AEY85025.1|  S-adenosylmethionine synthetase                       70.1    1e-12   
ref|WP_031084757.1|  S-adenosylmethionine synthetase                  70.1    1e-12   
gb|ACN40813.1|  unknown                                               68.9    1e-12   Picea sitchensis
ref|XP_004960412.1|  PREDICTED: S-adenosylmethionine synthase 1-like  70.5    1e-12   
gb|KEH37748.1|  S-adenosylmethionine synthase-like protein            70.1    1e-12   
ref|XP_010506734.1|  PREDICTED: S-adenosylmethionine synthase 2-like  70.1    1e-12   
ref|XP_009365469.1|  PREDICTED: S-adenosylmethionine synthase 2-like  70.1    1e-12   
gb|ACF57862.1|  S-adenosyl-L-methionine synthetase                    70.1    1e-12   
gb|KCW61378.1|  hypothetical protein EUGRSUZ_H04112                   70.5    1e-12   
ref|XP_009589856.1|  PREDICTED: S-adenosylmethionine synthase 1       70.1    1e-12   
ref|XP_002319463.1|  S-adenosylmethionine synthetase-2 family pro...  70.1    1e-12   
emb|CAN75687.1|  hypothetical protein VITISV_034977                   70.1    1e-12   
gb|AFV79415.1|  s-adenosyl methionine synthetase                      67.8    1e-12   
gb|AFV79319.1|  s-adenosyl methionine synthetase                      67.8    1e-12   
gb|EMT15540.1|  S-adenosylmethionine synthetase 1                     69.7    1e-12   
gb|ABR18346.1|  unknown                                               70.1    1e-12   
ref|XP_010518399.1|  PREDICTED: S-adenosylmethionine synthase 2-like  70.1    1e-12   
ref|XP_006294369.1|  hypothetical protein CARUB_v10023387mg           70.1    1e-12   
ref|XP_002280106.1|  PREDICTED: S-adenosylmethionine synthase 5       70.1    1e-12   
ref|XP_011023857.1|  PREDICTED: S-adenosylmethionine synthase 2       70.1    1e-12   
dbj|BAL41450.1|  methionine adenosyltransferase 1                     69.3    1e-12   
ref|XP_007031241.1|  S-adenosylmethionine synthetase 1                70.1    1e-12   
gb|ABK94600.1|  unknown                                               70.1    1e-12   
sp|Q6GV10.1|METK_SOLPL  RecName: Full=S-adenosylmethionine syntha...  70.1    1e-12   
ref|NP_001146249.1|  uncharacterized protein LOC100279822             70.1    1e-12   
ref|XP_010921340.1|  PREDICTED: S-adenosylmethionine synthase         70.1    1e-12   
ref|XP_008388436.1|  PREDICTED: S-adenosylmethionine synthase 2-like  70.1    1e-12   
ref|XP_007163296.1|  hypothetical protein PHAVU_001G222800g           70.1    1e-12   
ref|XP_009335533.1|  PREDICTED: S-adenosylmethionine synthase 2-like  70.1    1e-12   
ref|WP_021683473.1|  methionine adenosyltransferase                   70.1    1e-12   
sp|P49613.1|METK2_PEA  RecName: Full=S-adenosylmethionine synthas...  69.7    1e-12   
ref|WP_018836703.1|  MULTISPECIES: S-adenosylmethionine synthase      70.1    1e-12   
ref|XP_002889403.1|  S-adenosylmethionine synthetase                  69.7    1e-12   
ref|XP_010276540.1|  PREDICTED: S-adenosylmethionine synthase 2       70.1    1e-12   
ref|XP_009412154.1|  PREDICTED: S-adenosylmethionine synthase         70.1    1e-12   
ref|XP_007027434.1|  Methionine adenosyltransferase 3                 70.1    1e-12   
ref|WP_030360464.1|  MULTISPECIES: S-adenosylmethionine synthetase    70.1    1e-12   
ref|WP_030674843.1|  S-adenosylmethionine synthetase                  70.1    1e-12   
gb|AAA32868.1|  S-adenosylmethionine synthetase                       70.1    1e-12   
ref|XP_010659744.1|  PREDICTED: S-adenosylmethionine synthase 4       70.1    1e-12   
ref|WP_030590698.1|  S-adenosylmethionine synthetase                  70.1    1e-12   
ref|NP_001269246.1|  S-adenosylmethionine synthase-like               70.1    1e-12   
ref|WP_003982713.1|  MULTISPECIES: S-adenosylmethionine synthetase    70.1    1e-12   
sp|Q9FVG7.1|METK2_PINCO  RecName: Full=S-adenosylmethionine synth...  69.7    1e-12   
sp|Q9X4Q2.1|METK_STRST  RecName: Full=S-adenosylmethionine syntha...  70.1    1e-12   
gb|ADC80649.1|  S-adenosylmethionine synthase-like protein            67.8    1e-12   
ref|NP_001275609.1|  S-adenosylmethionine synthase 1                  69.7    1e-12   
ref|WP_030769198.1|  MULTISPECIES: S-adenosylmethionine synthetase    69.7    1e-12   
ref|WP_028444188.1|  MULTISPECIES: S-adenosylmethionine synthetase    69.7    1e-12   
dbj|BAC81656.1|  S-adenosylmethionine synthetase-3                    67.4    2e-12   
ref|WP_033304307.1|  S-adenosylmethionine synthetase                  69.7    2e-12   
ref|WP_030375169.1|  MULTISPECIES: S-adenosylmethionine synthetase    69.7    2e-12   
ref|WP_024490960.1|  S-adenosylmethionine synthetase                  69.7    2e-12   
ref|WP_014044800.1|  MULTISPECIES: S-adenosylmethionine synthase      69.7    2e-12   
sp|A9NYY0.1|METK2_PICSI  RecName: Full=S-adenosylmethionine synth...  69.7    2e-12   
ref|XP_002314993.1|  S-adenosylmethionine synthase family protein     69.7    2e-12   
ref|WP_023420373.1|  MULTISPECIES: S-adenosylmethionine synthetase    69.7    2e-12   
ref|XP_008887837.1|  S-adenosyl methionine synthetase                 69.7    2e-12   
ref|XP_002366688.1|  S-adenosylmethionine synthetase, putative        69.7    2e-12   
sp|O22338.1|METK_MUSAC  RecName: Full=S-adenosylmethionine syntha...  69.7    2e-12   
ref|WP_016638834.1|  putative S-adenosylmethionine synthase           69.7    2e-12   
gb|KCW46784.1|  hypothetical protein EUGRSUZ_K00588                   68.9    2e-12   
ref|WP_030642869.1|  S-adenosylmethionine synthetase                  69.7    2e-12   
ref|XP_004551779.1|  PREDICTED: S-adenosylmethionine synthase iso...  69.3    2e-12   
ref|WP_020275649.1|  putative S-adenosylmethionine synthase           69.7    2e-12   
gb|ADC80651.1|  S-adenosylmethionine synthase-like protein            67.4    2e-12   
gb|ADC80647.1|  S-adenosylmethionine synthase-like protein            67.4    2e-12   
ref|XP_010914756.1|  PREDICTED: S-adenosylmethionine synthase-like    69.7    2e-12   
ref|XP_005825468.1|  hypothetical protein GUITHDRAFT_77190            69.7    2e-12   
ref|WP_030695426.1|  S-adenosylmethionine synthetase                  69.7    2e-12   
gb|AAK96504.1|  At1g02500/T14P4_22                                    69.3    2e-12   
sp|Q6F3F1.1|METK4_ATRNU  RecName: Full=S-adenosylmethionine synth...  69.7    2e-12   
gb|ABU94038.1|  S-adenosylmethionine synthetase                       67.4    2e-12   
ref|XP_003626035.1|  S-adenosylmethionine synthetase                  69.7    2e-12   
sp|Q7XZR1.2|METK1_ATRNU  RecName: Full=S-adenosylmethionine synth...  69.7    2e-12   
ref|XP_003452035.1|  PREDICTED: S-adenosylmethionine synthase iso...  69.3    2e-12   
ref|WP_018895757.1|  S-adenosylmethionine synthase                    69.7    2e-12   
ref|WP_010636544.1|  MULTISPECIES: S-adenosylmethionine synthase      69.7    2e-12   
emb|CBI30144.3|  unnamed protein product                              69.7    2e-12   
ref|XP_005743842.1|  PREDICTED: S-adenosylmethionine synthase iso...  69.3    2e-12   
ref|XP_004551778.1|  PREDICTED: S-adenosylmethionine synthase iso...  69.3    2e-12   
sp|Q8GTL5.1|METK_CARPA  RecName: Full=S-adenosylmethionine syntha...  69.7    2e-12   
sp|Q6F3F3.1|METK2_ATRNU  RecName: Full=S-adenosylmethionine synth...  69.3    2e-12   
sp|Q6F3F0.1|METK3_ATRNU  RecName: Full=S-adenosylmethionine synth...  69.3    2e-12   
ref|XP_003625682.1|  S-adenosylmethionine synthetase                  70.1    2e-12   
gb|AFK42420.1|  unknown                                               69.3    2e-12   
gb|AGF95107.1|  S-adenosylmethionine synthetase                       67.4    2e-12   
ref|XP_009385101.1|  PREDICTED: S-adenosylmethionine synthase 3-like  69.7    2e-12   
ref|XP_009363082.1|  PREDICTED: S-adenosylmethionine synthase 1       69.3    2e-12   
gb|EFE80138.1|  S-adenosylmethionine synthetase                       69.3    2e-12   
sp|Q96551.1|METK1_CATRO  RecName: Full=S-adenosylmethionine synth...  69.3    2e-12   
ref|WP_030294604.1|  S-adenosylmethionine synthetase                  69.3    2e-12   
ref|WP_030026172.1|  S-adenosylmethionine synthetase                  69.3    2e-12   
ref|WP_030633238.1|  S-adenosylmethionine synthetase                  67.8    2e-12   
ref|WP_030706350.1|  S-adenosylmethionine synthetase                  69.3    2e-12   
ref|XP_001442617.1|  hypothetical protein                             69.3    2e-12   
ref|XP_009367157.1|  PREDICTED: S-adenosylmethionine synthase 1-like  69.3    2e-12   
ref|XP_008343205.1|  PREDICTED: S-adenosylmethionine synthase 1       69.3    2e-12   
ref|XP_003541415.1|  PREDICTED: S-adenosylmethionine synthase 3-like  69.3    2e-12   
ref|WP_030157476.1|  S-adenosylmethionine synthetase                  69.3    2e-12   
ref|WP_015607346.1|  MULTISPECIES: S-adenosylmethionine synthase      69.3    2e-12   
ref|XP_007202118.1|  hypothetical protein PRUPE_ppa006915mg           69.3    2e-12   
ref|XP_008372935.1|  PREDICTED: S-adenosylmethionine synthase 4-like  67.4    2e-12   
ref|WP_030573012.1|  S-adenosylmethionine synthetase                  69.3    2e-12   
gb|AIU34471.1|  putative S-adenosyl-L-methionine synthetase           69.3    2e-12   
ref|WP_030873691.1|  S-adenosylmethionine synthetase                  69.3    2e-12   
ref|WP_030800121.1|  S-adenosylmethionine synthetase                  69.3    2e-12   
ref|WP_008740396.1|  S-adenosylmethionine synthase                    69.3    2e-12   
ref|WP_018512469.1|  S-adenosylmethionine synthase                    69.3    2e-12   
ref|WP_018490200.1|  MULTISPECIES: S-adenosylmethionine synthase      69.3    2e-12   
ref|WP_006123164.1|  MULTISPECIES: S-adenosylmethionine synthase      69.3    2e-12   
ref|XP_003536989.1|  PREDICTED: S-adenosylmethionine synthase 1-like  69.3    2e-12   
ref|WP_010057353.1|  S-adenosylmethionine synthetase                  69.3    3e-12   
ref|WP_032760493.1|  S-adenosylmethionine synthetase                  68.9    3e-12   
ref|NP_001234004.1|  S-adenosylmethionine synthase 3                  69.3    3e-12   
ref|XP_002457705.1|  hypothetical protein SORBIDRAFT_03g011930        69.3    3e-12   
ref|WP_030965755.1|  MULTISPECIES: S-adenosylmethionine synthetase    69.3    3e-12   
ref|WP_030841517.1|  S-adenosylmethionine synthetase                  69.3    3e-12   
ref|WP_030656249.1|  MULTISPECIES: S-adenosylmethionine synthetase    69.3    3e-12   
dbj|BAH30214.1|  methionine S-adenosyl transferase                    68.9    3e-12   
ref|XP_009760627.1|  PREDICTED: S-adenosylmethionine synthase 1       68.9    3e-12   
sp|Q9SBQ5.1|METK2_PETHY  RecName: Full=S-adenosylmethionine synth...  68.9    3e-12   
ref|WP_030584143.1|  S-adenosylmethionine synthetase                  69.3    3e-12   
gb|ACF17673.1|  putative S-adenosylmethionine synthetase              68.9    3e-12   
ref|XP_009609870.1|  PREDICTED: S-adenosylmethionine synthase 3       68.9    3e-12   
ref|XP_008462483.1|  PREDICTED: S-adenosylmethionine synthase 4       68.9    3e-12   
gb|AES81900.2|  S-adenosylmethionine synthase-like protein            68.9    3e-12   
gb|AGW99248.1|  S-adenosylmethionine synthetase                       68.9    3e-12   
ref|XP_004494065.1|  PREDICTED: S-adenosylmethionine synthase 3-like  68.9    3e-12   
sp|P50301.1|METK1_ACTCH  RecName: Full=S-adenosylmethionine synth...  68.9    3e-12   
gb|AEN14510.1|  S-adenosylmethionine synthetase                       68.9    3e-12   
emb|CDJ56394.1|  S-adenosylmethionine synthetase, putative            68.9    3e-12   
gb|KDP28322.1|  hypothetical protein JCGZ_14093                       68.9    3e-12   
ref|XP_009391529.1|  PREDICTED: S-adenosylmethionine synthase-like    68.9    3e-12   
ref|XP_008241399.1|  PREDICTED: S-adenosylmethionine synthase 3       68.9    3e-12   
gb|AFK48536.1|  unknown                                               67.4    3e-12   
ref|XP_004143274.1|  PREDICTED: S-adenosylmethionine synthase 2-like  68.9    3e-12   
ref|WP_018960542.1|  S-adenosylmethionine synthase                    68.9    3e-12   
ref|XP_011077317.1|  PREDICTED: S-adenosylmethionine synthase 3       68.9    3e-12   
sp|Q38JH8.1|METK2_SOLTU  RecName: Full=S-adenosylmethionine synth...  68.9    3e-12   
ref|XP_006339084.1|  PREDICTED: S-adenosylmethionine synthase 3-like  68.9    3e-12   
gb|AAL33587.1|  methionine adenosyltransferase                        67.4    3e-12   
ref|XP_003557087.1|  PREDICTED: S-adenosylmethionine synthase-like    68.9    3e-12   
ref|XP_006583980.1|  PREDICTED: S-adenosylmethionine synthase-like    68.9    3e-12   
ref|XP_010941482.1|  PREDICTED: S-adenosylmethionine synthase-like    68.9    3e-12   
gb|AGK91208.1|  S-adenosylmethionine synthetase                       65.9    3e-12   
ref|WP_037926156.1|  S-adenosylmethionine synthetase                  68.9    3e-12   
gb|AHH25131.1|  S-adenosylmethionine synthetase-1                     68.6    3e-12   
gb|AGV22115.1|  S-adenosylmethionine synthetase 2                     68.9    3e-12   
ref|WP_037795609.1|  S-adenosylmethionine synthetase                  68.9    3e-12   
ref|XP_009403767.1|  PREDICTED: S-adenosylmethionine synthase 1       68.9    3e-12   
ref|XP_009795613.1|  PREDICTED: S-adenosylmethionine synthase 3-like  68.9    3e-12   
ref|XP_002512570.1|  s-adenosylmethionine synthetase, putative        68.9    3e-12   
gb|AER27715.1|  S-adenosyl-L-methionine synthase                      68.2    3e-12   
ref|WP_022403138.1|  s-adenosylmethionine synthase                    68.9    3e-12   
ref|XP_010091412.1|  S-adenosylmethionine synthase 2                  68.9    3e-12   
gb|KHG10268.1|  S-adenosylmethionine synthase 4                       68.9    3e-12   
ref|XP_010031402.1|  PREDICTED: S-adenosylmethionine synthase 1       68.9    3e-12   
ref|WP_003970371.1|  S-adenosylmethionine synthase                    68.9    3e-12   
sp|P50303.1|METK3_ACTCH  RecName: Full=S-adenosylmethionine synth...  68.6    3e-12   
ref|WP_017950787.1|  hypothetical protein                             68.9    3e-12   
gb|EDX27120.1|  S-adenosylmethionine synthetase                       68.9    3e-12   
ref|XP_002519480.1|  s-adenosylmethionine synthetase, putative        68.9    3e-12   
ref|XP_006381397.1|  S-adenosylmethionine synthetase family protein   68.9    3e-12   
gb|ACJ83268.1|  unknown                                               67.0    3e-12   
ref|WP_007453217.1|  S-adenosylmethionine synthase                    68.9    3e-12   
gb|KDS84288.1|  S-adenosylmethionine synthetase                       67.0    3e-12   
ref|XP_011087536.1|  PREDICTED: S-adenosylmethionine synthase 1       68.9    3e-12   
ref|XP_010093299.1|  S-adenosylmethionine synthase 1                  68.9    3e-12   
ref|XP_003567630.1|  PREDICTED: S-adenosylmethionine synthase 3-like  68.9    3e-12   
gb|ADC80645.1|  S-adenosylmethionine synthase-like protein            66.6    3e-12   
ref|XP_008369552.1|  PREDICTED: S-adenosylmethionine synthase 3       68.9    3e-12   
dbj|BAP47513.1|  S-adenosylmethionine synthetase                      68.9    3e-12   
emb|CDP06782.1|  unnamed protein product                              68.9    4e-12   
ref|WP_030234020.1|  S-adenosylmethionine synthetase                  68.6    4e-12   
ref|XP_010559172.1|  PREDICTED: S-adenosylmethionine synthase 1-like  68.9    4e-12   
ref|NP_001148708.1|  S-adenosylmethionine synthetase 1                68.9    4e-12   
ref|NP_001042349.1|  Os01g0207300                                     66.6    4e-12   
ref|XP_002515204.1|  s-adenosylmethionine synthetase, putative        68.9    4e-12   
ref|XP_011018770.1|  PREDICTED: S-adenosylmethionine synthase 4       68.6    4e-12   
ref|XP_010558180.1|  PREDICTED: S-adenosylmethionine synthase 4       68.6    4e-12   
sp|P50302.1|METK2_ACTCH  RecName: Full=S-adenosylmethionine synth...  68.6    4e-12   
ref|XP_007162776.1|  hypothetical protein PHAVU_001G179500g           68.6    4e-12   
sp|Q96553.1|METK3_CATRO  RecName: Full=S-adenosylmethionine synth...  68.6    4e-12   
gb|ADC80648.1|  S-adenosylmethionine synthase-like protein            66.6    4e-12   
ref|XP_003632745.1|  PREDICTED: S-adenosylmethionine synthase 3       68.6    4e-12   
gb|ADC80650.1|  S-adenosylmethionine synthase-like protein            66.6    4e-12   
ref|XP_003536032.1|  PREDICTED: S-adenosylmethionine synthase 1-l...  68.6    4e-12   
emb|CAC82203.1|  S-adenosylmethionine synthetase                      68.6    4e-12   
ref|WP_012081041.1|  S-adenosylmethionine synthetase                  68.6    4e-12   
ref|WP_011872320.1|  S-adenosylmethionine synthetase                  68.6    4e-12   
ref|XP_002961973.1|  hypothetical protein SELMODRAFT_164791           68.6    4e-12   
ref|XP_009391996.1|  PREDICTED: S-adenosylmethionine synthase         68.6    4e-12   
ref|XP_009400237.1|  PREDICTED: S-adenosylmethionine synthase 5-like  68.6    4e-12   
gb|KHG12690.1|  S-adenosylmethionine synthase                         68.9    4e-12   
ref|XP_008654959.1|  PREDICTED: S-adenosylmethionine synthetase 1...  68.6    4e-12   
ref|XP_009377021.1|  PREDICTED: S-adenosylmethionine synthase 4       68.6    4e-12   
sp|Q9AT55.1|METK2_ELAUM  RecName: Full=S-adenosylmethionine synth...  68.6    4e-12   
gb|ABI22144.1|  putative S-adenosylmethionine synthetase              68.6    4e-12   
gb|ABU94049.1|  S-adenosylmethionine synthetase                       66.2    4e-12   
ref|XP_010543435.1|  PREDICTED: S-adenosylmethionine synthase 3-like  68.6    4e-12   
ref|WP_023549839.1|  S-adenosylmethionine synthase                    68.6    4e-12   
ref|WP_027757257.1|  S-adenosylmethionine synthetase                  68.6    4e-12   
ref|WP_012087300.1|  S-adenosylmethionine synthase                    68.6    4e-12   
ref|WP_022128334.1|  s-adenosylmethionine synthase                    68.6    5e-12   
ref|XP_006428268.1|  hypothetical protein CICLE_v10011912mg           68.6    5e-12   
ref|XP_010556675.1|  PREDICTED: S-adenosylmethionine synthase         68.6    5e-12   
ref|XP_008387540.1|  PREDICTED: S-adenosylmethionine synthase 4       68.6    5e-12   
ref|WP_027769683.1|  S-adenosylmethionine synthetase                  68.6    5e-12   
ref|XP_002176347.1|  predicted protein                                68.2    5e-12   
ref|XP_006492396.1|  PREDICTED: S-adenosylmethionine synthase 1-like  68.6    5e-12   
gb|AHF52916.1|  methionine adenosyltransferase                        67.0    5e-12   
gb|AHB32111.1|  S-adenosylmethionine synthase                         68.2    5e-12   
sp|A7L2Z6.1|METK_GOSHI  RecName: Full=S-adenosylmethionine syntha...  68.2    5e-12   
ref|XP_001425954.1|  hypothetical protein                             68.6    5e-12   
ref|WP_009063389.1|  MULTISPECIES: S-adenosylmethionine synthase      68.6    5e-12   
emb|CDJ69773.1|  S-adenosylmethionine synthetase, putative            68.6    5e-12   
sp|Q9AT56.1|METK1_ELAUM  RecName: Full=S-adenosylmethionine synth...  68.2    5e-12   
ref|XP_002301543.1|  hypothetical protein POPTR_0002s19000g           68.2    5e-12   
ref|XP_006783917.1|  PREDICTED: S-adenosylmethionine synthase iso...  68.2    5e-12   
ref|XP_006388227.1|  hypothetical protein POPTR_0274s002001g          68.2    5e-12   
ref|WP_007829349.1|  S-adenosylmethionine synthase                    68.6    5e-12   
emb|CDJ38737.1|  S-adenosylmethionine synthetase, putative            68.2    5e-12   
ref|XP_009860450.1|  PREDICTED: S-adenosylmethionine synthase iso...  68.2    5e-12   
ref|WP_014157390.1|  MULTISPECIES: S-adenosylmethionine synthase      68.2    5e-12   
ref|XP_002982311.1|  hypothetical protein SELMODRAFT_155092           68.2    6e-12   
ref|XP_011003147.1|  PREDICTED: S-adenosylmethionine synthase 1       68.2    6e-12   
ref|WP_022263962.1|  s-adenosylmethionine synthase                    68.2    6e-12   
ref|XP_004297087.1|  PREDICTED: S-adenosylmethionine synthase 3-l...  68.2    6e-12   
gb|ADN96174.1|  S-adenosylmethionine synthetase                       68.2    6e-12   
ref|XP_001455683.1|  hypothetical protein                             68.2    6e-12   



>gb|AGR66195.1| methionine adenosyltransferase, partial [Monomorphina pyrum]
Length=258

 Score = 87.0 bits (214),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KKEEDFGAGDQGLM+GYA DET +LMPLSH LALKICEK+NELR NG
Sbjct  105  KKEEDFGAGDQGLMMGYASDETTDLMPLSHSLALKICEKINELRNNG  151



>gb|AFK33626.1| unknown [Lotus japonicus]
Length=249

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPLSH LA K+  KL E+RKNG
Sbjct  114  KRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKLGAKLTEVRKNG  160



>emb|CDX91837.1| BnaC03g31390D [Brassica napus]
Length=364

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPLSH LA KI  KL E+RKNG
Sbjct  113  KRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKIGAKLTEVRKNG  159



>ref|XP_008917255.1| S-adenosylmethionine synthase 2 [Phytophthora parasitica INRA-310]
 gb|ETM97448.1| S-adenosylmethionine synthase 2 [Phytophthora parasitica INRA-310]
Length=335

 Score = 74.3 bits (181),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -2

Query  137  EEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            +ED GAGDQG+M GYA DETPELMPLSH LA K+  KL E+RKNG
Sbjct  63   DEDVGAGDQGIMFGYASDETPELMPLSHVLATKLGSKLTEVRKNG  107



>emb|CDY72092.1| BnaCnng75920D [Brassica napus]
 emb|CDY22010.1| BnaA09g00390D [Brassica napus]
Length=365

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPLSH LA KI  KL E+RKNG
Sbjct  113  KRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKIGAKLTEVRKNG  159



>emb|CDX74394.1| BnaA03g26530D [Brassica napus]
Length=365

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPLSH LA KI  KL E+RKNG
Sbjct  113  KRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKIGAKLTEVRKNG  159



>dbj|BAH20274.1| AT4G01850 [Arabidopsis thaliana]
Length=306

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPLSH LA KI  +L E+RKNG
Sbjct  26   KRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKIGARLTEVRKNG  72



>gb|AAP87282.1| putative S-adenosylmethionine synthetase, partial [Brassica oleracea 
var. capitata]
Length=366

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPLSH LA KI  KL E+RKNG
Sbjct  86   KRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKIGAKLTEVRKNG  132



>ref|XP_002679392.1| predicted protein [Naegleria gruberi]
 gb|EFC46648.1| predicted protein [Naegleria gruberi]
Length=384

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            + EE+ GAGDQGLM GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  112  RTEEELGAGDQGLMFGYASDETPELMPLSHLLASKLAARLTEVRKNG  158



>sp|P49611.1|METK1_BRAJU RecName: Full=S-adenosylmethionine synthase 1; Short=AdoMet synthase 
1; AltName: Full=Methionine adenosyltransferase 1; Short=MAT 
1 [Brassica juncea]
 emb|CAA56590.1| S-adenosyl-L-methionine synthetase [Brassica juncea]
Length=393

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPLSH LA KI  KL E+RKNG
Sbjct  113  KRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKIGAKLTEVRKNG  159



>ref|XP_002896578.1| S-adenosylmethionine synthetase 2 [Phytophthora infestans T30-4]
 gb|AAN31489.1| S-adenosyl methionine synthetase [Phytophthora infestans]
 gb|EEY67024.1| S-adenosylmethionine synthetase 2 [Phytophthora infestans T30-4]
Length=391

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -2

Query  137  EEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            +ED GAGDQG+M GYA DETPELMPLSH LA K+  KL E+RKNG
Sbjct  119  DEDVGAGDQGIMFGYASDETPELMPLSHVLATKLGSKLTEVRKNG  163



>sp|Q5DNB1.1|METK_BRARP RecName: Full=S-adenosylmethionine synthase; Short=AdoMet synthase; 
AltName: Full=Methionine adenosyltransferase; Short=MAT 
[Brassica rapa subsp. pekinensis]
 sp|Q94FA4.1|METK5_BRAJU RecName: Full=S-adenosylmethionine synthase 5; Short=AdoMet synthase 
5; AltName: Full=Methionine adenosyltransferase 5; Short=MAT 
5 [Brassica juncea]
 gb|AAK71235.1| S-adenosylmethionine synthetase [Brassica juncea]
 gb|AAV80205.1| S-adenosyl-L-methionine synthetase [Brassica rapa subsp. pekinensis]
Length=393

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPLSH LA KI  KL E+RKNG
Sbjct  113  KRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKIGAKLTEVRKNG  159



>ref|XP_010230849.1| PREDICTED: S-adenosylmethionine synthase 1 [Brachypodium distachyon]
Length=394

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG+M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  115  KRPEDIGAGDQGIMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  161



>ref|XP_008902357.1| S-adenosylmethionine synthase 2 [Phytophthora parasitica INRA-310]
 gb|ETI51646.1| S-adenosylmethionine synthase 2 [Phytophthora parasitica P1569]
 gb|ETK91572.1| S-adenosylmethionine synthase 2 [Phytophthora parasitica]
 gb|ETL44978.1| S-adenosylmethionine synthase 2 [Phytophthora parasitica]
 gb|ETL98136.1| S-adenosylmethionine synthase 2 [Phytophthora parasitica]
 gb|ETM51278.1| S-adenosylmethionine synthase 2 [Phytophthora parasitica]
 gb|ETN12381.1| S-adenosylmethionine synthase 2 [Phytophthora parasitica INRA-310]
 gb|ETO80401.1| S-adenosylmethionine synthase 2 [Phytophthora parasitica P1976]
 gb|ETP21429.1| S-adenosylmethionine synthase 2 [Phytophthora parasitica CJ01A1]
 gb|ETP49382.1| S-adenosylmethionine synthase 2 [Phytophthora parasitica P10297]
Length=391

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -2

Query  137  EEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            +ED GAGDQG+M GYA DETPELMPLSH LA K+  KL E+RKNG
Sbjct  119  DEDVGAGDQGIMFGYASDETPELMPLSHVLATKLGSKLTEVRKNG  163



>gb|ABJ15732.1| S-adenosylmethionine synthetase 2 [Triticum monococcum]
Length=289

 Score = 72.8 bits (177),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG+M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  10   KRPEEVGAGDQGIMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  56



>ref|XP_009111338.1| PREDICTED: S-adenosylmethionine synthase-like [Brassica rapa]
Length=393

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPLSH LA KI  KL E+RKNG
Sbjct  113  KRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKIGAKLTEVRKNG  159



>ref|XP_009134472.1| PREDICTED: S-adenosylmethionine synthase [Brassica rapa]
Length=393

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPLSH LA KI  KL E+RKNG
Sbjct  113  KRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKIGAKLTEVRKNG  159



>sp|Q94FA6.1|METK3_BRAJU RecName: Full=S-adenosylmethionine synthase 3; Short=AdoMet synthase 
3; AltName: Full=Methionine adenosyltransferase 3; Short=MAT 
3 [Brassica juncea]
 gb|AAK71233.1| S-adenosylmethionine synthetase [Brassica juncea]
Length=393

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPLSH LA KI  KL E+RKNG
Sbjct  113  KRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKIGAKLTEVRKNG  159



>emb|CDM83018.1| unnamed protein product [Triticum aestivum]
Length=394

 Score = 73.9 bits (180),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG+M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  115  KRPEDIGAGDQGIMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  161



>ref|XP_009526921.1| hypothetical protein PHYSODRAFT_285996 [Phytophthora sojae]
 gb|EGZ17863.1| hypothetical protein PHYSODRAFT_285996 [Phytophthora sojae]
Length=392

 Score = 73.9 bits (180),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -2

Query  137  EEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            +ED GAGDQG+M GYA DETPELMPLSH LA K+  KL E+RKNG
Sbjct  120  DEDVGAGDQGIMFGYASDETPELMPLSHVLATKLGSKLTEVRKNG  164



>sp|A6XMY9.1|METK1_TRIMO RecName: Full=S-adenosylmethionine synthase 1; Short=AdoMet synthase 
1; AltName: Full=Methionine adenosyltransferase 1; Short=MAT 
1 [Triticum monococcum]
 gb|ABJ15731.1| S-adenosylmethionine synthetase 1 [Triticum monococcum]
 gb|EMT05283.1| S-adenosylmethionine synthetase 1 [Aegilops tauschii]
Length=394

 Score = 73.9 bits (180),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG+M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  115  KRPEDIGAGDQGIMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  161



>gb|EMS55466.1| S-adenosylmethionine synthase 1 [Triticum urartu]
Length=394

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG+M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  115  KRPEDIGAGDQGIMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  161



>gb|ACH61251.1| S-adenosyl methionine synthetase [Pseudotsuga menziesii]
Length=267

 Score = 72.4 bits (176),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKNG
Sbjct  52   KRPEDIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNG  98



>gb|ACH61229.1| S-adenosyl methionine synthetase [Pseudotsuga menziesii]
 gb|ACH61230.1| S-adenosyl methionine synthetase [Pseudotsuga menziesii]
 gb|ACH61231.1| S-adenosyl methionine synthetase [Pseudotsuga menziesii]
 gb|ACH61232.1| S-adenosyl methionine synthetase [Pseudotsuga menziesii]
 gb|ACH61233.1| S-adenosyl methionine synthetase [Pseudotsuga menziesii]
 gb|ACH61234.1| S-adenosyl methionine synthetase [Pseudotsuga menziesii]
 gb|ACH61235.1| S-adenosyl methionine synthetase [Pseudotsuga menziesii]
 gb|ACH61236.1| S-adenosyl methionine synthetase [Pseudotsuga menziesii]
 gb|ACH61237.1| S-adenosyl methionine synthetase [Pseudotsuga menziesii]
 gb|ACH61238.1| S-adenosyl methionine synthetase [Pseudotsuga menziesii]
 gb|ACH61239.1| S-adenosyl methionine synthetase [Pseudotsuga menziesii]
 gb|ACH61240.1| S-adenosyl methionine synthetase [Pseudotsuga menziesii]
 gb|ACH61241.1| S-adenosyl methionine synthetase [Pseudotsuga menziesii]
 gb|ACH61242.1| S-adenosyl methionine synthetase [Pseudotsuga menziesii]
 gb|ACH61243.1| S-adenosyl methionine synthetase [Pseudotsuga menziesii]
 gb|ACH61244.1| S-adenosyl methionine synthetase [Pseudotsuga menziesii]
 gb|ACH61245.1| S-adenosyl methionine synthetase [Pseudotsuga menziesii]
 gb|ACH61246.1| S-adenosyl methionine synthetase [Pseudotsuga menziesii]
 gb|ACH61247.1| S-adenosyl methionine synthetase [Pseudotsuga menziesii]
 gb|ACH61248.1| S-adenosyl methionine synthetase [Pseudotsuga menziesii]
 gb|ACH61249.1| S-adenosyl methionine synthetase [Pseudotsuga menziesii]
 gb|ACH61250.1| S-adenosyl methionine synthetase [Pseudotsuga menziesii]
 gb|ACH61252.1| S-adenosyl methionine synthetase [Pseudotsuga menziesii]
 gb|ACH61253.1| S-adenosyl methionine synthetase [Pseudotsuga macrocarpa]
Length=267

 Score = 72.4 bits (176),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKNG
Sbjct  52   KRPEDIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNG  98



>gb|EYU36152.1| hypothetical protein MIMGU_mgv1a021639mg [Erythranthe guttata]
Length=380

 Score = 73.6 bits (179),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPLSH LA K+  KL+E+RKNG
Sbjct  106  KKPEEIGAGDQGHMFGYATDETPELMPLSHLLATKLAAKLSEVRKNG  152



>emb|CDX75914.1| BnaC03g39970D [Brassica napus]
Length=468

 Score = 73.9 bits (180),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK ED GAGDQG M GYA DETPELMPLSH LA K+  KL E+RKNG
Sbjct  188  KKPEDIGAGDQGHMFGYATDETPELMPLSHVLATKLGAKLTEVRKNG  234



>gb|AFW97626.1| putative S-adenosylmethionine synthetase [Chorispora bungeana]
Length=393

 Score = 73.6 bits (179),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK ED GAGDQG M GYA DETPELMPLSH LA K+  KL E+RKNG
Sbjct  113  KKPEDIGAGDQGHMFGYATDETPELMPLSHVLATKLGAKLTEVRKNG  159



>ref|XP_010456120.1| PREDICTED: S-adenosylmethionine synthase-like [Camelina sativa]
Length=393

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPLSH LA KI  +L E+RKNG
Sbjct  113  KRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKIGARLTEVRKNG  159



>ref|XP_010422683.1| PREDICTED: S-adenosylmethionine synthase [Camelina sativa]
Length=393

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPLSH LA KI  +L E+RKNG
Sbjct  113  KRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKIGARLTEVRKNG  159



>ref|NP_192094.1| S-adenosylmethionine synthase 2 [Arabidopsis thaliana]
 ref|NP_001078345.1| S-adenosylmethionine synthase 2 [Arabidopsis thaliana]
 sp|P17562.1|METK2_ARATH RecName: Full=S-adenosylmethionine synthase 2; Short=AdoMet synthase 
2; AltName: Full=Methionine adenosyltransferase 2; Short=MAT 
2 [Arabidopsis thaliana]
 gb|AAD22647.1|AC007138_11 S-adenosylmethionine synthase 2 [Arabidopsis thaliana]
 gb|AAA32869.1| S-adenosylmethionine synthetase (sam-2) [Arabidopsis thaliana]
 emb|CAB80678.1| S-adenosylmethionine synthase 2 [Arabidopsis thaliana]
 gb|AAL61934.1| S-adenosylmethionine synthase 2 [Arabidopsis thaliana]
 gb|AAM19825.1| AT4g01850/T7B11_11 [Arabidopsis thaliana]
 gb|AAN18144.1| At4g01850/T7B11_11 [Arabidopsis thaliana]
 gb|AEE82084.1| S-adenosylmethionine synthase 2 [Arabidopsis thaliana]
 gb|AEE82085.1| S-adenosylmethionine synthase 2 [Arabidopsis thaliana]
Length=393

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPLSH LA KI  +L E+RKNG
Sbjct  113  KRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKIGARLTEVRKNG  159



>ref|XP_006396376.1| hypothetical protein EUTSA_v10028715mg [Eutrema salsugineum]
 gb|ESQ37829.1| hypothetical protein EUTSA_v10028715mg [Eutrema salsugineum]
Length=393

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPLSH LA KI  +L E+RKNG
Sbjct  113  KRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKIGARLTEVRKNG  159



>ref|XP_006287904.1| hypothetical protein CARUB_v10001138mg [Capsella rubella]
 gb|EOA20802.1| hypothetical protein CARUB_v10001138mg [Capsella rubella]
Length=393

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPLSH LA KI  +L E+RKNG
Sbjct  113  KRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKIGARLTEVRKNG  159



>ref|XP_010428836.1| PREDICTED: S-adenosylmethionine synthase-like [Camelina sativa]
Length=393

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPLSH LA KI  +L E+RKNG
Sbjct  113  KRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKIGARLTEVRKNG  159



>emb|CDX82370.1| BnaA03g34510D [Brassica napus]
Length=393

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK ED GAGDQG M GYA DETPELMPLSH LA K+  KL E+RKNG
Sbjct  113  KKPEDIGAGDQGHMFGYATDETPELMPLSHVLATKLGAKLTEVRKNG  159



>ref|XP_009135526.1| PREDICTED: S-adenosylmethionine synthase 2-like [Brassica rapa]
Length=393

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK ED GAGDQG M GYA DETPELMPLSH LA K+  KL E+RKNG
Sbjct  113  KKPEDIGAGDQGHMFGYATDETPELMPLSHVLATKLGAKLTEVRKNG  159



>ref|XP_002872873.1| S-adenosylmethionine synthetase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49132.1| S-adenosylmethionine synthetase [Arabidopsis lyrata subsp. lyrata]
Length=394

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPLSH LA KI  +L E+RKNG
Sbjct  113  KRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKIGARLTEVRKNG  159



>ref|XP_009838370.1| S-adenosylmethionine synthase 2 [Aphanomyces astaci]
 gb|ETV71927.1| S-adenosylmethionine synthase 2 [Aphanomyces astaci]
Length=387

 Score = 73.2 bits (178),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -2

Query  140  KEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ED GAGDQG+M GYA DETPELMPL+H LA ++  KL E+RKNG
Sbjct  114  KDEDIGAGDQGIMFGYATDETPELMPLTHVLATQLGAKLTEVRKNG  159



>sp|Q56TU3.1|METK2_DAUCA RecName: Full=S-adenosylmethionine synthase 2; Short=AdoMet synthase 
2; AltName: Full=Methionine adenosyltransferase 2; Short=MAT 
2 [Daucus carota]
 gb|AAT85666.1| S-adenosyl-L-methionine synthetase 2 [Daucus carota]
Length=393

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPLSH LA K+  KL E+RKNG
Sbjct  113  KRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKLGAKLTEVRKNG  159



>gb|KDO32031.1| S-adenosylmethionine synthase [Saprolegnia parasitica CBS 223.65]
Length=375

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -2

Query  140  KEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ED GAGDQG+M GYA DETPELMPL+H LA ++  +L E+RKNG
Sbjct  102  KDEDIGAGDQGIMFGYATDETPELMPLTHVLATQLGARLTEVRKNG  147



>gb|EMT05685.1| S-adenosylmethionine synthetase 3 [Aegilops tauschii]
Length=306

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG+M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  115  KRPEEVGAGDQGIMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  161



>gb|ADC80657.1| S-adenosylmethionine synthase-like protein [Tachigali melinonii]
Length=167

 Score = 70.5 bits (171),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L ELRKNG
Sbjct  82   KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTELRKNG  128



>dbj|BAC81654.1| S-adenosylmethionine synthetase-1 [Pisum sativum]
Length=141

 Score = 70.1 bits (170),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  26   KKPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  72



>gb|ADM18304.1| SAM synthetase 1 [Gladiolus grandiflorus]
Length=397

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPLSH LA K+  KL E+RKNG
Sbjct  116  KKPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGAKLTEVRKNG  162



>sp|Q56TU4.1|METK1_DAUCA RecName: Full=S-adenosylmethionine synthase 1; Short=AdoMet synthase 
1; AltName: Full=Methionine adenosyltransferase 1; Short=MAT 
1 [Daucus carota]
 gb|AAT85665.1| S-adenosyl-L-methionine synthetase 1 [Daucus carota]
Length=441

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPLSH LA K+  KL E+RKNG
Sbjct  113  KRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKLGAKLTEVRKNG  159



>gb|ADC80656.1| S-adenosylmethionine synthase-like protein [Tachigali melinonii]
Length=167

 Score = 70.5 bits (171),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L ELRKNG
Sbjct  82   KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTELRKNG  128



>sp|Q4LB22.1|METK3_HORVU RecName: Full=S-adenosylmethionine synthase 3; Short=AdoMet synthase 
3; AltName: Full=Methionine adenosyltransferase 3; Short=MAT 
3 [Hordeum vulgare]
 emb|CAJ01704.1| putative AdoMet synthase 3 [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85492.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS47587.1| S-adenosylmethionine synthase 3 [Triticum urartu]
Length=394

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG+M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  115  KRPEEVGAGDQGIMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  161



>sp|Q9FPL6.1|METK2_SUASA RecName: Full=S-adenosylmethionine synthase 2; Short=AdoMet synthase 
2; AltName: Full=Methionine adenosyltransferase 2; Short=MAT 
2 [Suaeda salsa]
 gb|AAG42490.1| S-adenosylmethionine synthetase 2 [Suaeda salsa]
Length=395

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEDVGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>ref|XP_008606768.1| S-adenosylmethionine synthase [Saprolegnia diclina VS20]
 gb|EQC39496.1| S-adenosylmethionine synthase [Saprolegnia diclina VS20]
Length=387

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -2

Query  140  KEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ED GAGDQG+M GYA DETPELMPL+H LA ++  +L E+RKNG
Sbjct  114  KDEDIGAGDQGIMFGYATDETPELMPLTHVLATQLGARLTEVRKNG  159



>gb|EFA84075.1| S-adenosylmethionine synthetase [Polysphondylium pallidum PN500]
Length=385

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K  ED GAGDQG M GYA +ETPELMPL+H+LA ++  KL ELRKNG
Sbjct  113  KNPEDIGAGDQGHMFGYATNETPELMPLTHYLASELVTKLTELRKNG  159



>dbj|BAF46020.1| putative Adomet decarboxylase [Cryptomeria japonica]
Length=316

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPL+H LA K+  KL ++RKNG
Sbjct  45   KRPEDIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTDVRKNG  91



>ref|XP_004515907.1| PREDICTED: S-adenosylmethionine synthase 2-like [Cicer arietinum]
Length=390

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKN  6
            KK ED GAGDQG M GYA DETPELMPL+H LA KI  KL E+RKN
Sbjct  113  KKPEDIGAGDQGHMFGYATDETPELMPLTHVLATKIGAKLTEVRKN  158



>dbj|BAF46024.1| putative Adomet decarboxylase [Cryptomeria japonica]
Length=316

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPL+H LA K+  KL ++RKNG
Sbjct  45   KRPEDIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTDVRKNG  91



>dbj|BAF46019.1| putative Adomet decarboxylase [Cryptomeria japonica]
 dbj|BAF46021.1| putative Adomet decarboxylase [Cryptomeria japonica]
 dbj|BAF46022.1| putative Adomet decarboxylase [Cryptomeria japonica]
 dbj|BAF46023.1| putative Adomet decarboxylase [Cryptomeria japonica]
Length=316

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPL+H LA K+  KL ++RKNG
Sbjct  45   KRPEDIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTDVRKNG  91



>gb|AIT39705.1| S-adenosylmethionine synthetase [Robinia pseudoacacia]
Length=392

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  114  KRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  160



>ref|XP_006305011.1| hypothetical protein CARUB_v10009376mg [Capsella rubella]
 gb|EOA37909.1| hypothetical protein CARUB_v10009376mg [Capsella rubella]
Length=393

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>sp|P49612.2|METK1_PEA RecName: Full=S-adenosylmethionine synthase 1; Short=AdoMet synthase 
1; AltName: Full=Methionine adenosyltransferase 1; Short=MAT 
1, partial [Pisum sativum]
 emb|CAA57580.1| methionine adenosyltransferase [Pisum sativum]
Length=366

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  88   KKPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  134



>gb|ADM64331.1| S-adenosyl-L-methionine synthase [Musa acuminata AAA Group]
Length=396

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  116  KRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  162



>ref|XP_006418333.1| hypothetical protein EUTSA_v10007845mg [Eutrema salsugineum]
 gb|ESQ36686.1| hypothetical protein EUTSA_v10007845mg [Eutrema salsugineum]
Length=393

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>ref|XP_009389524.1| PREDICTED: S-adenosylmethionine synthase 5 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389525.1| PREDICTED: S-adenosylmethionine synthase 5 [Musa acuminata subsp. 
malaccensis]
Length=396

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  116  KRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  162



>sp|P24260.1|METK2_DIACA RecName: Full=S-adenosylmethionine synthase 2; Short=AdoMet synthase 
2; AltName: Full=Methionine adenosyltransferase 2; Short=MAT 
2 [Dianthus caryophyllus]
 gb|AAA33274.1| S-adenosylmethionine synthetase [Dianthus caryophyllus]
 prf||1802406A Met(S-adenosyl) synthetase
Length=396

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  117  KRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  163



>gb|ACV87970.1| methionine adenosyltransferase [Acanthascus dawsoni]
Length=301

 Score = 70.9 bits (172),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  137  EEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKN  6
            +++ GAGDQGLM GYA DET E+MPLSH LA+K+CE+L++LR+N
Sbjct  95   DDEVGAGDQGLMFGYATDETSEMMPLSHVLAMKLCEQLSKLRRN  138



>ref|WP_033227267.1| S-adenosylmethionine synthetase, partial [Streptomyces virginiae]
Length=187

 Score = 70.1 bits (170),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  125  GAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            GAGDQGLM GYACDETPELMPL  H+A ++  +L+E+RKNG
Sbjct  5    GAGDQGLMFGYACDETPELMPLPIHIAHRLSRRLSEVRKNG  45



>ref|XP_011089950.1| PREDICTED: S-adenosylmethionine synthase 3-like [Sesamum indicum]
Length=384

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPLSH LA K+  KL E+RKNG
Sbjct  113  KKPEEIGAGDQGHMFGYATDETPELMPLSHLLANKLAAKLTEVRKNG  159



>gb|ADC80644.1| S-adenosylmethionine synthase-like protein [Bauhinia guianensis]
 gb|ADC80646.1| S-adenosylmethionine synthase-like protein [Bauhinia guianensis]
Length=167

 Score = 69.7 bits (169),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  KL E+RKNG
Sbjct  82   KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGAKLTEVRKNG  128



>gb|EMT05684.1| S-adenosylmethionine synthetase 2 [Aegilops tauschii]
Length=394

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG+M GYA DETPELMPL+H LA K+  +L E+RKNG
Sbjct  115  KRPEEIGAGDQGIMFGYATDETPELMPLTHMLATKLGARLTEVRKNG  161



>gb|EMS47328.1| S-adenosylmethionine synthase 1 [Triticum urartu]
Length=394

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG+M GYA DETPELMPL+H LA K+  +L E+RKNG
Sbjct  115  KRPEEIGAGDQGIMFGYATDETPELMPLTHMLATKLGARLTEVRKNG  161



>gb|ADC80655.1| S-adenosylmethionine synthase-like protein [Eperua falcata]
Length=166

 Score = 69.7 bits (169),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  81   KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  127



>gb|ACD92982.1| S-adenosylmethionine synthetase [Panax ginseng]
Length=307

 Score = 70.9 bits (172),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KKPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>ref|XP_006406736.1| hypothetical protein EUTSA_v10020887mg [Eutrema salsugineum]
 gb|ESQ48189.1| hypothetical protein EUTSA_v10020887mg [Eutrema salsugineum]
Length=393

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPLSH LA K+  KL E+RKNG
Sbjct  113  KKPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGAKLTEVRKNG  159



>emb|CDY48693.1| BnaCnng16700D [Brassica napus]
Length=393

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPLSH LA K+  KL E+RKNG
Sbjct  113  KKPEEVGAGDQGHMFGYATDETPELMPLSHVLATKLGAKLTEVRKNG  159



>sp|Q84MM2.1|METK_LITCN RecName: Full=S-adenosylmethionine synthase; Short=AdoMet synthase; 
AltName: Full=Methionine adenosyltransferase; Short=MAT 
[Litchi chinensis]
 gb|AAP13994.1| S-adenosylmethionine synthetase [Litchi chinensis]
Length=393

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KKPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>gb|KDO36066.1| hypothetical protein CISIN_1g044843mg, partial [Citrus sinensis]
Length=200

 Score = 69.7 bits (169),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  KL E+RKNG
Sbjct  113  KRAEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGAKLTEVRKNG  159



>sp|Q9FUZ1.1|METK2_BRAJU RecName: Full=S-adenosylmethionine synthase 2; Short=AdoMet synthase 
2; AltName: Full=Methionine adenosyltransferase 2; Short=MAT 
2 [Brassica juncea]
 gb|AAG17666.1| S-adenosylmethionine synthetase [Brassica juncea]
Length=393

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPLSH LA K+  KL E+RKNG
Sbjct  113  KKPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGAKLTEVRKNG  159



>gb|KDO72159.1| hypothetical protein CISIN_1g045358mg, partial [Citrus sinensis]
Length=200

 Score = 69.7 bits (169),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  KL E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGAKLTEVRKNG  159



>sp|P50299.1|METK1_HORVU RecName: Full=S-adenosylmethionine synthase 1; Short=AdoMet synthase 
1; AltName: Full=Methionine adenosyltransferase 1; Short=MAT 
1 [Hordeum vulgare]
 dbj|BAA09895.1| S-adenosylmethionine synthetase [Hordeum vulgare]
Length=394

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG+M GYA DETPELMPL+H LA K+  +L E+RKNG
Sbjct  115  KRPEEVGAGDQGIMFGYATDETPELMPLTHMLATKLGARLTEVRKNG  161



>gb|EYU29879.1| hypothetical protein MIMGU_mgv1a006187mg [Erythranthe guttata]
Length=454

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKN  6
            KK ED GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKN
Sbjct  177  KKPEDIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKN  222



>dbj|BAF46026.1| putative Adomet decarboxylase [Chamaecyparis obtusa]
Length=316

 Score = 70.9 bits (172),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKNG
Sbjct  45   KRPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNG  91



>dbj|BAF46025.1| putative Adomet decarboxylase [Chamaecyparis obtusa]
 dbj|BAF46027.1| putative Adomet decarboxylase [Chamaecyparis obtusa]
 dbj|BAF46028.1| putative Adomet decarboxylase [Chamaecyparis obtusa]
Length=316

 Score = 70.9 bits (172),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKNG
Sbjct  45   KRPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNG  91



>gb|ADC80653.1| S-adenosylmethionine synthase-like protein [Eperua falcata]
Length=167

 Score = 69.3 bits (168),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  82   KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  128



>emb|CAJ01702.1| putative AdoMet synthase 1 [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92001.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=394

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG+M GYA DETPELMPL+H LA K+  +L E+RKNG
Sbjct  115  KRPEEVGAGDQGIMFGYATDETPELMPLTHMLATKLGARLTEVRKNG  161



>ref|XP_009114068.1| PREDICTED: S-adenosylmethionine synthase 2 [Brassica rapa]
 emb|CDY63017.1| BnaA01g36920D [Brassica napus]
Length=393

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPLSH LA K+  KL E+RKNG
Sbjct  113  KKPEEVGAGDQGHMFGYATDETPELMPLSHVLATKLGAKLTEVRKNG  159



>sp|Q4LB23.1|METK2_HORVU RecName: Full=S-adenosylmethionine synthase 2; Short=AdoMet synthase 
2; AltName: Full=Methionine adenosyltransferase 2; Short=MAT 
2 [Hordeum vulgare]
 emb|CAJ01703.1| putative AdoMet synthase 2 [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85976.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=394

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG+M GYA DETPELMPL+H LA K+  +L E+RKNG
Sbjct  115  KRPEEVGAGDQGIMFGYATDETPELMPLTHMLATKLGARLTEVRKNG  161



>gb|AAA58772.1| S-adenosylmethionine synthase, partial [Pisum sativum]
Length=360

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  88   KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  134



>emb|CCC55422.1| S-adenosylmethionine synthase 1 [Pinus pinaster]
Length=391

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPL+H LA KI  +L E+RKNG
Sbjct  113  KKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKIGSRLTEVRKNG  159



>gb|EPS69795.1| s-adenosylmethionine synthase, partial [Genlisea aurea]
Length=390

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KKPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>ref|XP_006419259.1| hypothetical protein CICLE_v10005146mg [Citrus clementina]
 gb|ESR32499.1| hypothetical protein CICLE_v10005146mg [Citrus clementina]
Length=387

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  KL E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGAKLTEVRKNG  159



>ref|XP_006855322.1| hypothetical protein AMTR_s00057p00083760 [Amborella trichopoda]
 gb|ERN16789.1| hypothetical protein AMTR_s00057p00083760 [Amborella trichopoda]
Length=392

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKNG
Sbjct  113  KKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNG  159



>ref|XP_009793311.1| PREDICTED: S-adenosylmethionine synthase 1-like [Nicotiana sylvestris]
 ref|XP_009793312.1| PREDICTED: S-adenosylmethionine synthase 1-like [Nicotiana sylvestris]
Length=393

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KKPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>gb|ABO27088.1| S-adenosylmethionine synthetase [Dendrobium hybrid cultivar]
Length=207

 Score = 69.3 bits (168),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  116  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  162



>ref|XP_010524596.1| PREDICTED: S-adenosylmethionine synthase [Tarenaya hassleriana]
 ref|XP_010524597.1| PREDICTED: S-adenosylmethionine synthase [Tarenaya hassleriana]
Length=390

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KKPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>ref|XP_009617578.1| PREDICTED: S-adenosylmethionine synthase 2-like [Nicotiana tomentosiformis]
 ref|XP_009617579.1| PREDICTED: S-adenosylmethionine synthase 2-like [Nicotiana tomentosiformis]
 ref|XP_009617581.1| PREDICTED: S-adenosylmethionine synthase 2-like [Nicotiana tomentosiformis]
Length=393

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KKPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>ref|XP_003881929.1| S-adenosylmethionine synthetase,related [Neospora caninum Liverpool]
 emb|CBZ51896.1| S-adenosylmethionine synthetase,related [Neospora caninum Liverpool]
Length=401

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KKEED GAGDQG M GYACDET E MPLSH LA ++ ++L E+RK G
Sbjct  119  KKEEDVGAGDQGHMFGYACDETEEFMPLSHSLATRLGKRLTEVRKQG  165



>ref|XP_008223483.1| PREDICTED: S-adenosylmethionine synthase 5 [Prunus mume]
Length=393

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  KL E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGAKLTEVRKNG  159



>gb|ADC80654.1| S-adenosylmethionine synthase-like protein [Eperua falcata]
Length=167

 Score = 68.9 bits (167),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  82   KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  128



>ref|XP_004967602.1| PREDICTED: S-adenosylmethionine synthase 3-like isoform X2 [Setaria 
italica]
Length=396

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPE+MPLSH LA K+  +L E+RKNG
Sbjct  116  KRPEDIGAGDQGHMFGYATDETPEMMPLSHVLATKLGARLTEVRKNG  162



>ref|XP_004967601.1| PREDICTED: S-adenosylmethionine synthase 3-like isoform X1 [Setaria 
italica]
Length=409

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPE+MPLSH LA K+  +L E+RKNG
Sbjct  129  KRPEDIGAGDQGHMFGYATDETPEMMPLSHVLATKLGARLTEVRKNG  175



>ref|XP_006488750.1| PREDICTED: LOW QUALITY PROTEIN: S-adenosylmethionine synthase-like 
[Citrus sinensis]
Length=393

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  KL E+RKNG
Sbjct  113  KRAEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGAKLTEVRKNG  159



>ref|XP_008390498.1| PREDICTED: S-adenosylmethionine synthase 2 [Malus domestica]
 ref|XP_008351153.1| PREDICTED: S-adenosylmethionine synthase 2 [Malus domestica]
Length=393

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKNG
Sbjct  113  KKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNG  159



>gb|ABY25855.1| S-adenosylmethionine synthetase [Glycine soja]
Length=392

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  114  KKPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  160



>ref|XP_002273336.1| PREDICTED: S-adenosylmethionine synthase 1 isoform X1 [Vitis 
vinifera]
Length=394

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKNG
Sbjct  116  KKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNG  162



>ref|XP_003550837.1| PREDICTED: S-adenosylmethionine synthase-like isoform 1 [Glycine 
max]
Length=392

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  114  KKPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  160



>ref|XP_003550804.1| PREDICTED: S-adenosylmethionine synthase-like isoform 1 [Glycine 
max]
Length=392

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  114  KKPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  160



>gb|ACU24485.1| unknown [Glycine max]
Length=392

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  114  KKPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  160



>ref|XP_002439235.1| hypothetical protein SORBIDRAFT_09g002840 [Sorghum bicolor]
 gb|EES17665.1| hypothetical protein SORBIDRAFT_09g002840 [Sorghum bicolor]
Length=396

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  KL E+RKNG
Sbjct  116  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGAKLTEVRKNG  162



>gb|AGJ50598.1| SAMS, partial [Pericallis cruenta]
Length=300

 Score = 70.1 bits (170),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKN  6
            KK E+ GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKN
Sbjct  23   KKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKN  68



>ref|XP_008227796.1| PREDICTED: S-adenosylmethionine synthase 1 [Prunus mume]
Length=393

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KKPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>emb|CAN72082.1| hypothetical protein VITISV_033661 [Vitis vinifera]
Length=391

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKNG
Sbjct  113  KKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNG  159



>ref|XP_004288343.1| PREDICTED: S-adenosylmethionine synthase 2-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=358

 Score = 70.9 bits (172),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  KL E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGAKLTEVRKNG  159



>ref|XP_010651779.1| PREDICTED: S-adenosylmethionine synthase 1 isoform X2 [Vitis 
vinifera]
 ref|XP_010651780.1| PREDICTED: S-adenosylmethionine synthase 1 isoform X2 [Vitis 
vinifera]
 sp|A7PQS0.1|METK1_VITVI RecName: Full=S-adenosylmethionine synthase 1; Short=AdoMet synthase 
1; AltName: Full=Methionine adenosyltransferase 1; Short=MAT 
1 [Vitis vinifera]
Length=391

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKNG
Sbjct  113  KKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNG  159



>ref|XP_010457229.1| PREDICTED: S-adenosylmethionine synthase 1-like [Camelina sativa]
Length=393

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPL+H LA K+  +L E+RKNG
Sbjct  113  KRPEDIGAGDQGHMFGYATDETPELMPLTHVLATKLGARLTEVRKNG  159



>ref|XP_003546550.1| PREDICTED: S-adenosylmethionine synthase-like isoform 1 [Glycine 
max]
 ref|XP_003546552.1| PREDICTED: S-adenosylmethionine synthase-like isoform 3 [Glycine 
max]
 gb|KHN09889.1| S-adenosylmethionine synthase [Glycine soja]
Length=395

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  KL E+RKNG
Sbjct  115  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGAKLTEVRKNG  161



>gb|AGF69113.1| S-adenosylmethionine synthetase [Saccharum hybrid cultivar ROC22]
Length=396

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  KL E+RKNG
Sbjct  116  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGAKLTEVRKNG  162



>ref|XP_010267208.1| PREDICTED: S-adenosylmethionine synthase 1 [Nelumbo nucifera]
Length=391

 Score = 70.9 bits (172),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKNG
Sbjct  113  KKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNG  159



>gb|ACK37352.1| S-adenosyl-L-methionine synthetase [Glebionis coronaria]
Length=390

 Score = 70.9 bits (172),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKN  6
            KK ED GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKN
Sbjct  113  KKPEDIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKN  158



>gb|EYU38563.1| hypothetical protein MIMGU_mgv1a007936mg [Erythranthe guttata]
Length=390

 Score = 70.9 bits (172),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKN  6
            KK ED GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKN
Sbjct  113  KKPEDIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKN  158



>ref|XP_007221573.1| hypothetical protein PRUPE_ppa025497mg [Prunus persica]
 gb|EMJ22772.1| hypothetical protein PRUPE_ppa025497mg [Prunus persica]
Length=373

 Score = 70.9 bits (172),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>ref|XP_006354373.1| PREDICTED: S-adenosylmethionine synthase 2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006354374.1| PREDICTED: S-adenosylmethionine synthase 2-like isoform X2 [Solanum 
tuberosum]
Length=390

 Score = 70.9 bits (172),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKN  6
            KK ED GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKN
Sbjct  113  KKPEDIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKN  158



>gb|AFI38954.1| S-adenosyl-L-methionine synthetase [Fragaria x ananassa]
Length=393

 Score = 70.9 bits (172),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  KL E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGAKLTEVRKNG  159



>dbj|BAC81655.1| S-adenosylmethionine synthetase-2 [Pisum sativum]
Length=346

 Score = 70.5 bits (171),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPE MPLSH LA K+  KL E+RKNG
Sbjct  64   KRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATKLGAKLTEVRKNG  110



>gb|EYU19403.1| hypothetical protein MIMGU_mgv1a007849mg [Erythranthe guttata]
 gb|EYU19404.1| hypothetical protein MIMGU_mgv1a007849mg [Erythranthe guttata]
Length=393

 Score = 70.9 bits (172),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPLSH LA K+  KL E+RK+G
Sbjct  113  KRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKLGAKLTEVRKDG  159



>ref|XP_010509423.1| PREDICTED: S-adenosylmethionine synthase 3-like [Camelina sativa]
Length=390

 Score = 70.9 bits (172),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKN  6
            KK ED GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKN
Sbjct  113  KKPEDIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKN  158



>dbj|BAP47512.1| S-adenosylmethionine synthetase [Gentiana triflora]
Length=390

 Score = 70.9 bits (172),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKN  6
            KK ED GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKN
Sbjct  113  KKPEDIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKN  158



>gb|ABC24692.1| S-adenosyl-L-methionine synthetase [Annona cherimola]
Length=238

 Score = 68.9 bits (167),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  107  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  153



>ref|XP_004288342.1| PREDICTED: S-adenosylmethionine synthase 2-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=393

 Score = 70.9 bits (172),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  KL E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGAKLTEVRKNG  159



>gb|KCW46782.1| hypothetical protein EUGRSUZ_K00588 [Eucalyptus grandis]
Length=384

 Score = 70.9 bits (172),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  104  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  150



>gb|AGF95110.1| S-adenosylmethionine synthetase, partial [Prunus persica]
Length=232

 Score = 68.9 bits (167),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  KL E RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGAKLTEARKNG  159



>ref|XP_002881476.1| hypothetical protein ARALYDRAFT_902809 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006294371.1| hypothetical protein CARUB_v10023389mg [Capsella rubella]
 ref|XP_006294372.1| hypothetical protein CARUB_v10023389mg [Capsella rubella]
 ref|XP_010505234.1| PREDICTED: S-adenosylmethionine synthase 3 [Camelina sativa]
 ref|XP_010516917.1| PREDICTED: S-adenosylmethionine synthase 3 [Camelina sativa]
 gb|EFH57735.1| hypothetical protein ARALYDRAFT_902809 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EOA27269.1| hypothetical protein CARUB_v10023389mg [Capsella rubella]
 gb|EOA27270.1| hypothetical protein CARUB_v10023389mg [Capsella rubella]
Length=390

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKN  6
            KK ED GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKN
Sbjct  113  KKPEDIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKN  158



>gb|ABB29941.1| S-adenosyl methionine synthase-like [Solanum tuberosum]
Length=337

 Score = 70.1 bits (170),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>gb|KHG08721.1| S-adenosylmethionine synthase 1 [Gossypium arboreum]
Length=393

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPE MPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEDIGAGDQGHMFGYATDETPEFMPLSHVLATKLGARLTEVRKNG  159



>sp|Q94FA5.1|METK4_BRAJU RecName: Full=S-adenosylmethionine synthase 4; Short=AdoMet synthase 
4; AltName: Full=Methionine adenosyltransferase 4; Short=MAT 
4 [Brassica juncea]
 gb|AAK71234.1| S-adenosylmethionine synthetase [Brassica juncea]
Length=390

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKN  6
            KK ED GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKN
Sbjct  113  KKPEDIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKN  158



>ref|XP_006410860.1| hypothetical protein EUTSA_v10016774mg [Eutrema salsugineum]
 gb|ESQ52313.1| hypothetical protein EUTSA_v10016774mg [Eutrema salsugineum]
Length=390

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKN  6
            KK ED GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKN
Sbjct  113  KKPEDIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKN  158



>ref|XP_009141614.1| PREDICTED: S-adenosylmethionine synthase 3-like [Brassica rapa]
Length=390

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKN  6
            KK ED GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKN
Sbjct  113  KKPEDIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKN  158



>ref|XP_009133101.1| PREDICTED: S-adenosylmethionine synthase 3 [Brassica rapa]
Length=390

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKN  6
            KK ED GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKN
Sbjct  113  KKPEDIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKN  158



>ref|NP_181225.1| S-adenosylmethionine synthase 3 [Arabidopsis thaliana]
 ref|NP_001118458.1| S-adenosylmethionine synthase 3 [Arabidopsis thaliana]
 sp|Q9SJL8.1|METK3_ARATH RecName: Full=S-adenosylmethionine synthase 3; Short=AdoMet synthase 
3; AltName: Full=Methionine adenosyltransferase 3; Short=MAT 
3 [Arabidopsis thaliana]
 gb|AAK32897.1|AF367310_1 At2g36880/T1J8.6 [Arabidopsis thaliana]
 gb|AAD31573.1| putative s-adenosylmethionine synthetase [Arabidopsis thaliana]
 gb|AAM91431.1| At2g36880/T1J8.6 [Arabidopsis thaliana]
 gb|AEC09310.1| S-adenosylmethionine synthase 3 [Arabidopsis thaliana]
 gb|AEC09311.1| S-adenosylmethionine synthase 3 [Arabidopsis thaliana]
Length=390

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKN  6
            KK ED GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKN
Sbjct  113  KKPEDIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKN  158



>dbj|BAI66450.1| S-adenosylmethionine synthase [Malus domestica]
Length=222

 Score = 68.9 bits (167),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNG  159



>sp|A9PHE9.1|METK5_POPTR RecName: Full=S-adenosylmethionine synthase 5; Short=AdoMet synthase 
5; AltName: Full=Methionine adenosyltransferase 5; Short=MAT 
5 [Populus trichocarpa]
 gb|ABK95802.1| unknown [Populus trichocarpa]
Length=395

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  114  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  160



>ref|XP_008447451.1| PREDICTED: S-adenosylmethionine synthase 2 [Cucumis melo]
Length=393

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>gb|AFK36950.1| unknown [Medicago truncatula]
 gb|AES92058.2| S-adenosylmethionine synthase-like protein [Medicago truncatula]
Length=393

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  115  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  161



>ref|XP_011019063.1| PREDICTED: S-adenosylmethionine synthase 3 [Populus euphratica]
Length=395

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  114  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  160



>sp|P47916.1|METK_POPDE RecName: Full=S-adenosylmethionine synthase; Short=AdoMet synthase; 
AltName: Full=Methionine adenosyltransferase; Short=MAT 
[Populus deltoides]
 gb|AAA20112.1| S-adenosyl methionine synthetase [Populus trichocarpa x Populus 
deltoides]
Length=395

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  114  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  160



>ref|XP_006379697.1| S-adenosylmethionine synthase family protein [Populus trichocarpa]
 sp|A9PEK8.1|METK3_POPTR RecName: Full=S-adenosylmethionine synthase 3; Short=AdoMet synthase 
3; AltName: Full=Methionine adenosyltransferase 3; Short=MAT 
3 [Populus trichocarpa]
 gb|ABK94811.1| unknown [Populus trichocarpa]
 gb|ERP57494.1| S-adenosylmethionine synthase family protein [Populus trichocarpa]
Length=395

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  114  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  160



>ref|NP_188365.1| S-adenosylmethionine synthase 4 [Arabidopsis thaliana]
 ref|XP_002885209.1| S-adenosylmethionine synthase 3 [Arabidopsis lyrata subsp. lyrata]
 sp|Q9LUT2.1|METK4_ARATH RecName: Full=S-adenosylmethionine synthase 4; Short=AdoMet synthase 
4; AltName: Full=Methionine adenosyltransferase 4; Short=MAT 
4 [Arabidopsis thaliana]
 dbj|BAB02743.1| S-adenosylmethionine synthase [Arabidopsis thaliana]
 gb|AAK59799.1| AT3g17390/MGD8_20 [Arabidopsis thaliana]
 gb|AAM53266.1| putative S-adenosylmethionine synthetase [Arabidopsis thaliana]
 gb|AAM64740.1| putative s-adenosylmethionine synthetase [Arabidopsis thaliana]
 gb|AAN31855.1| putative s-adenosylmethionine synthetase [Arabidopsis thaliana]
 gb|AAO11581.1| At3g17390/MGD8_20 [Arabidopsis thaliana]
 gb|EFH61468.1| S-adenosylmethionine synthase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|AEE75948.1| S-adenosylmethionine synthase 4 [Arabidopsis thaliana]
Length=393

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKNG
Sbjct  113  KKPEEVGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNG  159



>dbj|BAF01944.1| s-adenosylmethionine synthetase like protein [Arabidopsis thaliana]
Length=393

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKNG
Sbjct  113  KKPEEVGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNG  159



>ref|XP_011071333.1| PREDICTED: S-adenosylmethionine synthase 2 [Sesamum indicum]
 ref|XP_011071334.1| PREDICTED: S-adenosylmethionine synthase 2 [Sesamum indicum]
 ref|XP_011071335.1| PREDICTED: S-adenosylmethionine synthase 2 [Sesamum indicum]
Length=393

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGSRLTEVRKNG  159



>ref|WP_030634096.1| S-adenosylmethionine synthetase, partial [Streptomyces albus]
Length=260

 Score = 68.9 bits (167),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  125  GAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            GAGDQGLM GYACDETPELMPL  HLA ++  +L+E+RKNG
Sbjct  131  GAGDQGLMFGYACDETPELMPLPIHLAHRLSRRLSEVRKNG  171



>ref|XP_010312254.1| PREDICTED: S-adenosylmethionine synthase 3-like [Solanum lycopersicum]
Length=390

 Score = 70.5 bits (171),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKN  6
            KK ED GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKN
Sbjct  113  KKPEDIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKN  158



>gb|KCW88660.1| hypothetical protein EUGRSUZ_A01021 [Eucalyptus grandis]
Length=352

 Score = 70.1 bits (170),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  72   KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  118



>ref|XP_006645787.1| PREDICTED: S-adenosylmethionine synthase 3-like [Oryza brachyantha]
Length=393

 Score = 70.5 bits (171),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  116  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  162



>gb|AFW82691.1| methionine adenosyltransferase [Zea mays]
Length=421

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  141  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  187



>ref|XP_006297742.1| hypothetical protein CARUB_v10013777mg, partial [Capsella rubella]
 gb|EOA30640.1| hypothetical protein CARUB_v10013777mg, partial [Capsella rubella]
Length=424

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKNG
Sbjct  144  KKPEEVGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNG  190



>emb|CAJ45523.1| S-adenosylmethionine synthetase [Oryza rufipogon]
Length=389

 Score = 70.5 bits (171),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  111  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  157



>ref|XP_003609861.1| S-adenosylmethionine synthetase [Medicago truncatula]
Length=422

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  144  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  190



>emb|CAJ45548.1| S-adenosylmethionine synthetase [Oryza rufipogon]
Length=389

 Score = 70.5 bits (171),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  111  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  157



>emb|CAJ45536.1| S-adenosylmethionine synthetase [Oryza rufipogon]
Length=389

 Score = 70.5 bits (171),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  111  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  157



>emb|CAJ45492.1| S-adenosylmethionine synthetas [Oryza sativa]
Length=389

 Score = 70.5 bits (171),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  111  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  157



>emb|CBI39656.3| unnamed protein product [Vitis vinifera]
Length=299

 Score = 69.3 bits (168),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  99   KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  145



>sp|Q4H1G4.1|METK1_BETVU RecName: Full=S-adenosylmethionine synthase 1; Short=AdoMet synthase 
1; AltName: Full=Methionine adenosyltransferase 1; Short=MAT 
1 [Beta vulgaris]
 dbj|BAE07179.1| S-adenosyl-L-methionine synthetase [Beta vulgaris]
Length=396

 Score = 70.5 bits (171),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  117  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  163



>ref|WP_018850095.1| S-adenosylmethionine synthase [Streptomyces sp. CNT372]
Length=402

 Score = 70.5 bits (171),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  125  GAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            GAGDQGLM GYACDETPELMPL  HLA ++  +L+E+RKNG
Sbjct  126  GAGDQGLMFGYACDETPELMPLPIHLAHRLSRRLSEVRKNG  166



>ref|XP_010505371.1| PREDICTED: S-adenosylmethionine synthase 4-like [Camelina sativa]
Length=393

 Score = 70.5 bits (171),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKNG
Sbjct  113  KKPEEVGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNG  159



>gb|AAT40304.1| S-adenosylmethionine synthase [Medicago sativa]
Length=391

 Score = 70.5 bits (171),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>ref|XP_004968660.1| PREDICTED: S-adenosylmethionine synthase 1-like [Setaria italica]
Length=442

 Score = 70.9 bits (172),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  163  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  209



>ref|XP_010465788.1| PREDICTED: S-adenosylmethionine synthase 4 [Camelina sativa]
 ref|XP_010487618.1| PREDICTED: S-adenosylmethionine synthase 4 [Camelina sativa]
Length=393

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKNG
Sbjct  113  KKPEEVGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNG  159



>emb|CAJ45530.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45531.1| S-adenosylmethionine synthetase [Oryza rufipogon]
Length=389

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  111  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  157



>emb|CAJ45565.1| S-adenosylmethionine synthetase [Oryza rufipogon]
Length=389

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  111  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  157



>gb|KDP27996.1| hypothetical protein JCGZ_19076 [Jatropha curcas]
Length=413

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>emb|CAJ45487.1| S-adenosylmethionine synthetase [Oryza sativa]
 emb|CAJ45494.1| S-adenosylmethionine synthetas [Oryza sativa]
 emb|CAJ45495.1| S-adenosylmethionine synthetas [Oryza sativa]
 emb|CAJ45509.1| S-adenosylmethionine synthetase [Oryza rufipogon]
Length=389

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  111  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  157



>emb|CAJ45501.1| S-adenosylmethionine synthetas [Oryza sativa]
Length=389

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  111  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  157



>emb|CAJ45528.1| S-adenosylmethionine synthetase [Oryza rufipogon]
Length=389

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  111  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  157



>emb|CAJ45486.1| S-adenosylmethionine synthetase [Oryza sativa]
 emb|CAJ45498.1| S-adenosylmethionine synthetas [Oryza sativa]
 emb|CAJ45500.1| S-adenosylmethionine synthetas [Oryza sativa]
 emb|CAJ45506.1| S-adenosylmethionine synthetas [Oryza sativa]
 emb|CAJ45510.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45513.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45514.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45515.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45517.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45520.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45522.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45541.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45553.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45554.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45557.1| S-adenosylmethionine synthetase [Oryza rufipogon]
Length=389

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  111  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  157



>emb|CAJ45488.1| S-adenosylmethionine synthetase [Oryza sativa]
 emb|CAJ45489.1| S-adenosylmethionine synthetase [Oryza sativa]
 emb|CAJ45490.1| S-adenosylmethionine synthetase [Oryza sativa]
 emb|CAJ45491.1| S-adenosylmethionine synthetase [Oryza sativa]
 emb|CAJ45493.1| S-adenosylmethionine synthetas [Oryza sativa]
 emb|CAJ45496.1| S-adenosylmethionine synthetas [Oryza sativa]
 emb|CAJ45499.1| S-adenosylmethionine synthetas [Oryza sativa]
 emb|CAJ45502.1| S-adenosylmethionine synthetas [Oryza sativa]
 emb|CAJ45503.1| S-adenosylmethionine synthetas [Oryza sativa]
 emb|CAJ45504.1| S-adenosylmethionine synthetas [Oryza sativa]
 emb|CAJ45505.1| S-adenosylmethionine synthetas [Oryza sativa]
 emb|CAJ45507.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45508.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45516.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45518.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45519.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45524.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45525.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45526.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45527.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45529.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45534.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45537.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45538.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45539.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45540.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45542.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45543.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45545.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45546.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45547.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45549.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45550.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45551.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45552.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45558.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45559.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45560.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45562.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45563.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45564.1| S-adenosylmethionine synthetase [Oryza rufipogon]
Length=389

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  111  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  157



>ref|XP_008461384.1| PREDICTED: S-adenosylmethionine synthase 2-like [Cucumis melo]
Length=393

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>sp|P93438.1|METK2_ORYSJ RecName: Full=S-adenosylmethionine synthase 2; Short=AdoMet synthase 
2; AltName: Full=Methionine adenosyltransferase 2; Short=MAT 
2 [Oryza sativa Japonica Group]
 gb|AAC05590.1| S-adenosyl-L-methionine synthetase [Oryza sativa]
 dbj|BAC65881.1| putative methionine adenosyltransferase [Oryza sativa Japonica 
Group]
Length=394

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  115  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  161



>ref|NP_001132867.2| uncharacterized protein LOC100194360 [Zea mays]
 gb|ACF81892.2| unknown [Zea mays]
 tpg|DAA54442.1| TPA: hypothetical protein ZEAMMB73_685440 [Zea mays]
Length=394

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  115  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  161



>gb|ADC80652.1| S-adenosylmethionine synthase-like protein [Eperua falcata]
Length=167

 Score = 68.2 bits (165),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L ++RKNG
Sbjct  82   KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTQVRKNG  128



>sp|Q944U4.1|METK_DENCR RecName: Full=S-adenosylmethionine synthase; Short=AdoMet synthase; 
AltName: Full=Methionine adenosyltransferase; Short=MAT 
[Dendrobium crumenatum]
 gb|AAL16064.1|AF420238_1 S-adenosyl-L-methionine synthetase [Dendrobium crumenatum]
Length=395

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  116  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  162



>ref|XP_005743843.1| PREDICTED: S-adenosylmethionine synthase isoform type-1-like 
isoform X2 [Pundamilia nyererei]
 ref|XP_005743844.1| PREDICTED: S-adenosylmethionine synthase isoform type-1-like 
isoform X3 [Pundamilia nyererei]
Length=332

 Score = 69.7 bits (169),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            +KEED GAGDQGLM GYA DET E MPL+  LA K+ EK++ELR+NG
Sbjct  62   RKEEDIGAGDQGLMFGYATDETEECMPLTIVLAHKLNEKMSELRRNG  108



>ref|XP_004551780.1| PREDICTED: S-adenosylmethionine synthase isoform type-1-like 
isoform X3 [Maylandia zebra]
Length=332

 Score = 69.7 bits (169),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            +KEED GAGDQGLM GYA DET E MPL+  LA K+ EK++ELR+NG
Sbjct  62   RKEEDIGAGDQGLMFGYATDETEECMPLTIVLAHKLNEKMSELRRNG  108



>ref|XP_010674512.1| PREDICTED: S-adenosylmethionine synthase 1 [Beta vulgaris subsp. 
vulgaris]
Length=396

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  117  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  163



>ref|XP_010270953.1| PREDICTED: S-adenosylmethionine synthase 5 [Nelumbo nucifera]
 ref|XP_010270954.1| PREDICTED: S-adenosylmethionine synthase 5 [Nelumbo nucifera]
Length=393

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>ref|XP_006840308.1| hypothetical protein AMTR_s00045p00073480 [Amborella trichopoda]
 gb|ERN01983.1| hypothetical protein AMTR_s00045p00073480 [Amborella trichopoda]
Length=397

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>emb|CAJ45556.1| S-adenosylmethionine synthetase [Oryza rufipogon]
Length=389

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  111  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  157



>emb|CAJ45561.1| S-adenosylmethionine synthetase [Oryza officinalis]
Length=389

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  111  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  157



>emb|CAJ45535.1| S-adenosylmethionine synthetase [Oryza rufipogon]
Length=389

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  111  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  157



>ref|XP_008785826.1| PREDICTED: S-adenosylmethionine synthase 3 [Phoenix dactylifera]
Length=391

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPL+H LA K+  +L E+RKNG
Sbjct  113  KKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGARLTEVRKNG  159



>ref|XP_007223013.1| hypothetical protein PRUPE_ppa006841mg [Prunus persica]
 ref|XP_007223014.1| hypothetical protein PRUPE_ppa006841mg [Prunus persica]
 ref|XP_007223015.1| hypothetical protein PRUPE_ppa006841mg [Prunus persica]
 gb|AGF95109.1| S-adenosylmethionine synthetase [Prunus persica]
 gb|EMJ24212.1| hypothetical protein PRUPE_ppa006841mg [Prunus persica]
 gb|EMJ24213.1| hypothetical protein PRUPE_ppa006841mg [Prunus persica]
 gb|EMJ24214.1| hypothetical protein PRUPE_ppa006841mg [Prunus persica]
Length=393

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  KL E RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGAKLTEARKNG  159



>ref|XP_011011515.1| PREDICTED: S-adenosylmethionine synthase 3 [Populus euphratica]
Length=395

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  114  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  160



>ref|XP_009401660.1| PREDICTED: S-adenosylmethionine synthase 1-like [Musa acuminata 
subsp. malaccensis]
Length=396

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  116  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  162



>ref|XP_006654018.1| PREDICTED: S-adenosylmethionine synthase 1-like [Oryza brachyantha]
Length=396

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  116  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  162



>ref|NP_001054575.1| Os05g0135700 [Oryza sativa Japonica Group]
 sp|Q0DKY4.1|METK1_ORYSJ RecName: Full=S-adenosylmethionine synthase 1; Short=AdoMet synthase 
1; AltName: Full=Methionine adenosyltransferase 1; Short=MAT 
1 [Oryza sativa Japonica Group]
 sp|A2Y053.2|METK1_ORYSI RecName: Full=S-adenosylmethionine synthase 1; Short=AdoMet synthase 
1; AltName: Full=Methionine adenosyltransferase 1; Short=MAT 
1 [Oryza sativa Indica Group]
 emb|CAA81481.1| S-adenosyl methionine synthetase [Oryza sativa]
 gb|AAT94053.1| S-adenosylmethionine synthetase [Oryza sativa Japonica Group]
 dbj|BAF16489.1| Os05g0135700 [Oryza sativa Japonica Group]
 dbj|BAG92801.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95925.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97007.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62242.1| hypothetical protein OsJ_17029 [Oryza sativa Japonica Group]
 gb|AIR95988.1| S-adenosylmethionine synthase I [Oryza sativa Japonica Group]
 gb|AIR95994.1| S-adenosylmethionine synthase I [Oryza sativa Japonica Group]
Length=396

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  116  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  162



>ref|XP_010241791.1| PREDICTED: S-adenosylmethionine synthase 1-like [Nelumbo nucifera]
Length=391

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPL+H LA K+  +L E+RKNG
Sbjct  113  KKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGARLTEVRKNG  159



>ref|WP_031507770.1| S-adenosylmethionine synthetase [Streptomyces megasporus]
Length=402

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  125  GAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            GAGDQGLM GYACDETPELMPL  HLA ++  +L+E+RKNG
Sbjct  126  GAGDQGLMFGYACDETPELMPLPIHLAHRLSRRLSEVRKNG  166



>ref|WP_005319909.1| S-adenosylmethionine synthase [Streptomyces pristinaespiralis]
 gb|EDY65272.1| SAM synthetase [Streptomyces pristinaespiralis ATCC 25486]
Length=402

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  125  GAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            GAGDQGLM GYACDETPELMPL  HLA ++  +L+E+RKNG
Sbjct  126  GAGDQGLMFGYACDETPELMPLPIHLAHRLSRRLSEVRKNG  166



>gb|AGE09560.1| SAM2-like protein, partial [Eucalyptus cladocalyx]
Length=392

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>ref|WP_030611133.1| S-adenosylmethionine synthetase [Streptomyces achromogenes]
Length=403

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  125  GAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            GAGDQGLM GYACDETPELMPL  HLA ++  +L+E+RKNG
Sbjct  126  GAGDQGLMFGYACDETPELMPLPIHLAHRLSRRLSEVRKNG  166



>emb|CAJ45555.1| S-adenosylmethionine synthetase [Oryza rufipogon]
Length=389

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  111  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  157



>emb|CAJ45511.1| S-adenosylmethionine synthetase [Oryza rufipogon]
 emb|CAJ45512.1| S-adenosylmethionine synthetase [Oryza rufipogon]
Length=389

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  111  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  157



>emb|CAJ45532.1| S-adenosylmethionine synthetase [Oryza rufipogon]
Length=389

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  111  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  157



>emb|CAJ45544.1| S-adenosylmethionine synthetase [Oryza rufipogon]
Length=389

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  111  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  157



>ref|WP_006350360.1| S-adenosylmethionine synthase [Streptomyces tsukubaensis]
 gb|EIF88683.1| S-adenosylmethionine synthetase [Streptomyces tsukubaensis NRRL18488]
Length=404

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  125  GAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            GAGDQGLM GYACDETPELMPL  HLA ++  +L+E+RKNG
Sbjct  128  GAGDQGLMFGYACDETPELMPLPIHLAHRLSRRLSEVRKNG  168



>ref|XP_010035406.1| PREDICTED: S-adenosylmethionine synthase 1 [Eucalyptus grandis]
Length=393

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>ref|XP_008390375.1| PREDICTED: S-adenosylmethionine synthase 2-like [Malus domestica]
Length=393

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNG  159



>ref|XP_007051250.1| S-adenosylmethionine synthetase 2 isoform 1 [Theobroma cacao]
 ref|XP_007051251.1| S-adenosylmethionine synthetase 2 isoform 1 [Theobroma cacao]
 gb|EOX95407.1| S-adenosylmethionine synthetase 2 isoform 1 [Theobroma cacao]
 gb|EOX95408.1| S-adenosylmethionine synthetase 2 isoform 1 [Theobroma cacao]
Length=393

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>ref|XP_004153699.1| PREDICTED: S-adenosylmethionine synthase 1-like isoform 1 [Cucumis 
sativus]
 ref|XP_004168951.1| PREDICTED: S-adenosylmethionine synthase 1-like isoform 1 [Cucumis 
sativus]
 ref|XP_004168952.1| PREDICTED: S-adenosylmethionine synthase 1-like isoform 2 [Cucumis 
sativus]
 ref|XP_004168953.1| PREDICTED: S-adenosylmethionine synthase 1-like isoform 3 [Cucumis 
sativus]
Length=401

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  121  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  167



>gb|AFC88125.1| S-adenosylmethionine synthetase [Lycoris radiata]
Length=401

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  121  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  167



>emb|CDY37784.1| BnaC04g00410D [Brassica napus]
Length=391

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>ref|XP_006644126.1| PREDICTED: S-adenosylmethionine synthase 2-like [Oryza brachyantha]
Length=402

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  115  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  161



>ref|XP_010045729.1| PREDICTED: S-adenosylmethionine synthase 5 [Eucalyptus grandis]
 ref|XP_010045734.1| PREDICTED: S-adenosylmethionine synthase 5 [Eucalyptus grandis]
 gb|KCW88662.1| hypothetical protein EUGRSUZ_A01021 [Eucalyptus grandis]
 gb|KCW88663.1| hypothetical protein EUGRSUZ_A01021 [Eucalyptus grandis]
 gb|KCW88664.1| hypothetical protein EUGRSUZ_A01021 [Eucalyptus grandis]
 gb|KCW88665.1| hypothetical protein EUGRSUZ_A01021 [Eucalyptus grandis]
Length=393

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>ref|XP_010099707.1| S-adenosylmethionine synthase 2 [Morus notabilis]
 gb|EXB80284.1| S-adenosylmethionine synthase 2 [Morus notabilis]
Length=393

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>ref|NP_001234425.1| S-adenosylmethionine synthase 1 [Solanum lycopersicum]
 sp|P43280.1|METK1_SOLLC RecName: Full=S-adenosylmethionine synthase 1; Short=AdoMet synthase 
1; AltName: Full=Methionine adenosyltransferase 1; Short=MAT 
1 [Solanum lycopersicum]
 emb|CAA80865.1| S-adenosyl-L-methionine synthetase [Solanum lycopersicum]
Length=393

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>ref|XP_004135945.1| PREDICTED: S-adenosylmethionine synthase 1-like [Cucumis sativus]
 ref|XP_004135964.1| PREDICTED: S-adenosylmethionine synthase 1-like [Cucumis sativus]
Length=393

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>gb|ABU94067.1| S-adenosylmethionine synthetase [Pinus sylvestris]
Length=159

 Score = 68.2 bits (165),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNG  159



>gb|AHA84275.1| S-adenosylmethionine synthase [Phaseolus vulgaris]
Length=392

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  114  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  160



>sp|P93254.1|METK_MESCR RecName: Full=S-adenosylmethionine synthase; Short=AdoMet synthase; 
AltName: Full=Methionine adenosyltransferase; Short=MAT 
[Mesembryanthemum crystallinum]
 gb|AAB38500.1| methionine adenosyltransferase [Mesembryanthemum crystallinum]
Length=392

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>ref|XP_010024863.1| PREDICTED: S-adenosylmethionine synthase 2 [Eucalyptus grandis]
Length=393

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>gb|AGF95108.1| S-adenosylmethionine synthetase [Prunus persica]
Length=393

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>ref|XP_009408430.1| PREDICTED: S-adenosylmethionine synthase 5-like [Musa acuminata 
subsp. malaccensis]
Length=396

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  116  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  162



>ref|XP_008793316.1| PREDICTED: S-adenosylmethionine synthase 4 [Phoenix dactylifera]
Length=396

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  116  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  162



>ref|XP_003567567.1| PREDICTED: S-adenosylmethionine synthase 4 [Brachypodium distachyon]
Length=396

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  116  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  162



>gb|KIF73518.1| S-adenosylmethionine synthetase [Streptomyces sp. 150FB]
Length=406

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  125  GAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            GAGDQGLM GYACDETPELMPL  HLA ++  +L+E+RKNG
Sbjct  130  GAGDQGLMFGYACDETPELMPLPIHLAHRLARRLSEVRKNG  170



>ref|XP_004168041.1| PREDICTED: S-adenosylmethionine synthase 1-like isoform 1 [Cucumis 
sativus]
Length=401

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  121  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  167



>ref|NP_001130734.1| uncharacterized protein LOC100191838 [Zea mays]
 gb|ACG46613.1| S-adenosylmethionine synthetase 1 [Zea mays]
Length=396

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  116  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  162



>gb|ACF79074.1| unknown [Zea mays]
 gb|ACR38469.1| unknown [Zea mays]
 gb|AFW82692.1| methionine adenosyltransferase [Zea mays]
Length=396

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  116  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  162



>gb|AHX42567.1| S-adenosylmethionine synthetase [Saccharum hybrid cultivar ROC22]
Length=396

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  116  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  162



>ref|XP_002312296.2| hypothetical protein POPTR_0008s09870g [Populus trichocarpa]
 gb|EEE89663.2| hypothetical protein POPTR_0008s09870g [Populus trichocarpa]
Length=408

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  127  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  173



>ref|WP_003956418.1| S-adenosylmethionine synthase [Streptomyces clavuligerus]
 gb|EDY50856.1| SAM synthetase [Streptomyces clavuligerus ATCC 27064]
 gb|EFG05781.1| S-adenosylmethionine synthetase [Streptomyces clavuligerus ATCC 
27064]
Length=405

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  125  GAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            GAGDQGLM GYACDETPELMPL  HLA ++  +L E+RKNG
Sbjct  129  GAGDQGLMFGYACDETPELMPLPIHLAHRLSRRLTEVRKNG  169



>ref|XP_010911974.1| PREDICTED: S-adenosylmethionine synthase 3 [Elaeis guineensis]
 ref|XP_010911975.1| PREDICTED: S-adenosylmethionine synthase 3 [Elaeis guineensis]
Length=391

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KK E+ GAGDQG M GYA DETPELMPL+H LA K+  +L E+RKNG
Sbjct  113  KKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGARLTEVRKNG  159



>ref|XP_009124482.1| PREDICTED: S-adenosylmethionine synthase 2 [Brassica rapa]
 ref|XP_009124483.1| PREDICTED: S-adenosylmethionine synthase 2 [Brassica rapa]
 emb|CDX80079.1| BnaA05g00770D [Brassica napus]
Length=391

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>ref|XP_006397900.1| hypothetical protein EUTSA_v10001487mg [Eutrema salsugineum]
 gb|ESQ39353.1| hypothetical protein EUTSA_v10001487mg [Eutrema salsugineum]
Length=391

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>ref|WP_028814062.1| S-adenosylmethionine synthetase [Streptomyces flavidovirens]
Length=402

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  125  GAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            GAGDQGLM GYACDETPELMPL  HLA ++  +L+E+RKNG
Sbjct  126  GAGDQGLMFGYACDETPELMPLPIHLAHRLSRRLSEVRKNG  166



>ref|WP_023542991.1| S-adenosylmethionine synthase [Streptomyces niveus]
 gb|EST20200.1| S-adenosylmethionine synthase [Streptomyces niveus NCIMB 11891]
Length=402

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  125  GAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            GAGDQGLM GYACDETPELMPL  HLA ++  +L+E+RKNG
Sbjct  126  GAGDQGLMFGYACDETPELMPLPIHLAHRLSRRLSEVRKNG  166



>gb|ABP35525.1| S-adenosyl-L-methionine synthetase [Ipomoea batatas]
Length=393

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ ED GAGDQG M GYA DETPELMPLSH LA K+  +L E+RK+G
Sbjct  113  KRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKDG  159



>gb|KHN28175.1| S-adenosylmethionine synthase [Glycine soja]
Length=392

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  114  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  160



>gb|AGV22114.1| S-adenosylmethionine synthetase 1 [Betula luminifera]
Length=392

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>ref|XP_009353412.1| PREDICTED: S-adenosylmethionine synthase 2-like [Pyrus x bretschneideri]
Length=395

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNG  159



>sp|A4ULF8.1|METK_MEDSF RecName: Full=S-adenosylmethionine synthase; Short=AdoMet synthase; 
AltName: Full=Methionine adenosyltransferase; Short=MAT 
[Medicago falcata]
 gb|ABO77438.1| S-adenosyl-L-methionine synthetase [Medicago falcata]
Length=396

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPL+H LA K+  KL E+RKNG
Sbjct  115  KRPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNG  161



>gb|KCW46783.1| hypothetical protein EUGRSUZ_K00588 [Eucalyptus grandis]
Length=383

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>ref|WP_008406419.1| MULTISPECIES: S-adenosylmethionine synthase [Streptomyces]
 gb|EKC95824.1| methionine adenosyltransferase [Streptomyces sp. SM8]
Length=407

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  125  GAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            GAGDQGLM GYACDETPELMPL  HLA ++  +L+E+RKNG
Sbjct  131  GAGDQGLMFGYACDETPELMPLPIHLAHRLSRRLSEVRKNG  171



>ref|XP_010679475.1| PREDICTED: S-adenosylmethionine synthase 2 [Beta vulgaris subsp. 
vulgaris]
Length=393

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>ref|XP_006349861.1| PREDICTED: S-adenosylmethionine synthase 2-like [Solanum tuberosum]
Length=393

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>ref|XP_004168042.1| PREDICTED: S-adenosylmethionine synthase 1-like isoform 2 [Cucumis 
sativus]
 ref|XP_004168043.1| PREDICTED: S-adenosylmethionine synthase 1-like isoform 3 [Cucumis 
sativus]
 ref|XP_004168044.1| PREDICTED: S-adenosylmethionine synthase 1-like isoform 4 [Cucumis 
sativus]
Length=393

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>ref|XP_004153700.1| PREDICTED: S-adenosylmethionine synthase 1-like isoform 2 [Cucumis 
sativus]
 ref|XP_004153701.1| PREDICTED: S-adenosylmethionine synthase 1-like isoform 3 [Cucumis 
sativus]
 ref|XP_004168954.1| PREDICTED: S-adenosylmethionine synthase 1-like isoform 4 [Cucumis 
sativus]
 ref|XP_004168955.1| PREDICTED: S-adenosylmethionine synthase 1-like isoform 5 [Cucumis 
sativus]
 gb|KGN45065.1| hypothetical protein Csa_7G419610 [Cucumis sativus]
 gb|KGN45069.1| hypothetical protein Csa_7G419650 [Cucumis sativus]
Length=393

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>gb|KFG59787.1| S-adenosyl methionine synthetase, partial [Toxoplasma gondii 
RUB]
 gb|KFH14859.1| S-adenosyl methionine synthetase, partial [Toxoplasma gondii 
MAS]
Length=191

 Score = 68.2 bits (165),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            KKEE+ GAGDQG M GYACDET E MPLSH LA ++ ++L E+RK G
Sbjct  133  KKEEEVGAGDQGHMFGYACDETEEFMPLSHSLATRLGKRLTEVRKQG  179



>dbj|BAP19030.1| S-adenosyl-L-methionine synthase like protein [Andropogon virginicus]
Length=396

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  116  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  162



>sp|Q8W3Y4.1|METK_PHALU RecName: Full=S-adenosylmethionine synthase; Short=AdoMet synthase; 
AltName: Full=Methionine adenosyltransferase; Short=MAT 
[Phaseolus lunatus]
 dbj|BAB83761.1| S-adenosylmethionine synthetase [Phaseolus lunatus]
Length=392

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  114  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  160



>gb|ACU21288.1| unknown [Glycine max]
Length=392

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  114  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  160



>ref|XP_002519309.1| s-adenosylmethionine synthetase, putative [Ricinus communis]
 gb|EEF43173.1| s-adenosylmethionine synthetase, putative [Ricinus communis]
Length=393

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>ref|XP_009772911.1| PREDICTED: S-adenosylmethionine synthase 2 [Nicotiana sylvestris]
 gb|AGT40328.1| SAMS synthase [Nicotiana attenuata]
Length=393

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>ref|XP_002266358.1| PREDICTED: S-adenosylmethionine synthase 2 [Vitis vinifera]
 sp|A7NVX9.1|METK2_VITVI RecName: Full=S-adenosylmethionine synthase 2; Short=AdoMet synthase 
2; AltName: Full=Methionine adenosyltransferase 2; Short=MAT 
2 [Vitis vinifera]
Length=393

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  113  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  159



>ref|XP_007154451.1| hypothetical protein PHAVU_003G120300g [Phaseolus vulgaris]
 gb|ESW26445.1| hypothetical protein PHAVU_003G120300g [Phaseolus vulgaris]
Length=438

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  143  KKEEDFGAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            K+ E+ GAGDQG M GYA DETPELMPLSH LA K+  +L E+RKNG
Sbjct  160  KRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNG  206



>ref|WP_030721075.1| S-adenosylmethionine synthetase [Streptomyces sp. NRRL F-2580]
Length=401

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  125  GAGDQGLMIGYACDETPELMPLSHHLALKICEKLNELRKNG  3
            GAGDQGLM GYACDETPELMPL  HLA ++  +L+E+RKNG
Sbjct  126  GAGDQGLMFGYACDETPELMPLPIHLAHRLSRRLSEVRKNG  166



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506149393984