BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c12187_g1_i2 len=445 path=[530:0-51 581:52-444]

Length=445
                                                                      Score     E

ref|XP_006356750.1|  PREDICTED: uncharacterized protein LOC102604101  57.0    5e-09   
ref|XP_010264784.1|  PREDICTED: uncharacterized protein LOC104602705  54.7    6e-09   
ref|XP_006357929.1|  PREDICTED: E3 ubiquitin protein ligase RIN2-...  53.5    2e-08   
ref|XP_010272908.1|  PREDICTED: uncharacterized protein LOC104608573  50.4    4e-08   
ref|XP_007015042.1|  Transferases,tRNA-methyltransferases             57.4    4e-08   
ref|XP_009762955.1|  PREDICTED: uncharacterized protein LOC104214925  59.7    1e-07   
gb|EEE55062.1|  hypothetical protein OsJ_02776                        48.9    6e-07   Oryza sativa Japonica Group [Japonica rice]
gb|EEC80893.1|  hypothetical protein OsI_23536                        47.0    2e-05   Oryza sativa Indica Group [Indian rice]
gb|EEC80895.1|  hypothetical protein OsI_23541                        47.0    2e-05   Oryza sativa Indica Group [Indian rice]
gb|EEE65953.1|  hypothetical protein OsJ_21835                        46.6    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002521057.1|  conserved hypothetical protein                   43.9    4e-05   Ricinus communis
gb|EAZ12025.1|  hypothetical protein OsJ_01904                        43.5    4e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009629904.1|  PREDICTED: uncharacterized protein LOC104119971  52.4    4e-05   
ref|XP_008663160.1|  PREDICTED: uncharacterized protein LOC103641598  50.4    7e-05   
gb|ABG89853.1|  unknown                                               49.7    8e-05   Phyllostachys edulis [kikko-chiku]
ref|XP_008680913.1|  PREDICTED: uncharacterized protein LOC103656043  49.7    1e-04   
ref|XP_002437546.1|  hypothetical protein SORBIDRAFT_10g029135        49.3    1e-04   Sorghum bicolor [broomcorn]
emb|CAN76938.1|  hypothetical protein VITISV_025425                   49.3    1e-04   Vitis vinifera
ref|XP_002450635.1|  hypothetical protein SORBIDRAFT_05g008466        47.0    2e-04   Sorghum bicolor [broomcorn]
ref|XP_008653835.1|  PREDICTED: uncharacterized protein LOC103633962  48.9    2e-04   
ref|XP_004980562.1|  PREDICTED: uncharacterized protein LOC101785349  47.0    3e-04   
ref|XP_008660861.1|  PREDICTED: uncharacterized protein LOC103639970  48.1    3e-04   
ref|XP_010087209.1|  hypothetical protein L484_006138                 48.9    4e-04   
ref|XP_008650637.1|  PREDICTED: uncharacterized protein LOC103631523  42.0    6e-04   
ref|XP_008650682.1|  PREDICTED: uncharacterized protein LOC103631581  48.1    7e-04   
ref|XP_009760314.1|  PREDICTED: uncharacterized protein LOC104212668  48.1    8e-04   
ref|XP_002509827.1|  conserved hypothetical protein                   47.0    0.001   Ricinus communis



>ref|XP_006356750.1| PREDICTED: uncharacterized protein LOC102604101 [Solanum tuberosum]
Length=1051

 Score = 57.0 bits (136),  Expect(3) = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = +3

Query  177  DPMVWLLRCESSFHHADTPDHERVPLAAHHMIGKAQLWYHSETAVSPFASWASFK  341
            DP+ WL RC+  F H  TPD E+V LA+ H+ G AQLW+       P  SW  FK
Sbjct  96   DPLGWLNRCDHFFRHQQTPDEEKVGLASFHLEGNAQLWFLQLETDLPEPSWDEFK  150


 Score = 24.6 bits (52),  Expect(3) = 5e-09, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 17/35 (49%), Gaps = 1/35 (3%)
 Frame = +1

Query  334  RLRKSVVLSFGPPRSINPLGELKLLFQTGRHVDDY  438
              ++   L FGPP     LGEL  L Q G  V DY
Sbjct  148  EFKRYCNLRFGPPIRSQKLGELAKLRQIGS-VADY  181


 Score = 24.3 bits (51),  Expect(3) = 5e-09, Method: Compositional matrix adjust.
 Identities = 8/15 (53%), Positives = 12/15 (80%), Gaps = 0/15 (0%)
 Frame = +1

Query  127  RYPKVEFPLFSGEED  171
            RY K++FP F+G+ D
Sbjct  82   RYTKLDFPWFTGQGD  96



>ref|XP_010264784.1| PREDICTED: uncharacterized protein LOC104602705 [Nelumbo nucifera]
Length=271

 Score = 54.7 bits (130),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 41/81 (51%), Gaps = 2/81 (2%)
 Frame = +3

Query  99   T*GITPTFFPVSQSRIPFVFRRGRPQDPMVWLLRCESSFHHADTPDHERVPLAAHHMIGK  278
            T G   T  P   SR+ F    G   DP+ WL RCE  F +  T D ++V LAA H+  +
Sbjct  72   TTGQGATIIP-KYSRLEFPSYNGN-GDPLGWLHRCEQFFRNQRTDDRDKVSLAAFHLTEE  129

Query  279  AQLWYHSETAVSPFASWASFK  341
            AQLW++      P   WA FK
Sbjct  130  AQLWFYRLEQEEPGLGWAQFK  150


 Score = 32.0 bits (71),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = +1

Query  334  RLRKSVVLSFGPPRSINPLGELKLLFQTG  420
            + +   +L FGPP + NPLGEL  L QTG
Sbjct  148  QFKSYCLLRFGPPLTSNPLGELINLKQTG  176



>ref|XP_006357929.1| PREDICTED: E3 ubiquitin protein ligase RIN2-like [Solanum tuberosum]
Length=838

 Score = 53.5 bits (127),  Expect(3) = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 34/68 (50%), Gaps = 0/68 (0%)
 Frame = +3

Query  159  RRGRPQDPMVWLLRCESSFHHADTPDHERVPLAAHHMIGKAQLWYHSETAVSPFASWASF  338
            R    +DP+ WL RCE  F H  T + E+V LA+ H+ G AQLW+       P  SW  F
Sbjct  90   RFNGQEDPLGWLNRCEHFFRHQQTLEEEKVGLASFHLEGNAQLWFLQLETDLPQLSWDDF  149

Query  339  KEERCFEF  362
            K      F
Sbjct  150  KRHCNLRF  157


 Score = 25.4 bits (54),  Expect(3) = 2e-08, Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 1/34 (3%)
 Frame = +1

Query  337  LRKSVVLSFGPPRSINPLGELKLLFQTGRHVDDY  438
             ++   L FGPP     LGEL  L Q G  V DY
Sbjct  149  FKRHCNLRFGPPIRSQKLGELAKLRQIGS-VADY  181


 Score = 24.6 bits (52),  Expect(3) = 2e-08, Method: Composition-based stats.
 Identities = 8/15 (53%), Positives = 13/15 (87%), Gaps = 0/15 (0%)
 Frame = +1

Query  127  RYPKVEFPLFSGEED  171
            R+ K++FP F+G+ED
Sbjct  82   RHTKLDFPRFNGQED  96



>ref|XP_010272908.1| PREDICTED: uncharacterized protein LOC104608573 [Nelumbo nucifera]
Length=185

 Score = 50.4 bits (119),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 0/55 (0%)
 Frame = +3

Query  177  DPMVWLLRCESSFHHADTPDHERVPLAAHHMIGKAQLWYHSETAVSPFASWASFK  341
            DP+ WL  CE  F +  T + ++V LAA H+  +AQLW++      P  SW  FK
Sbjct  96   DPLGWLYHCEQFFRNQRTEEKDKVSLAAFHLTDEAQLWFYRVEQEEPDLSWDQFK  150


 Score = 33.1 bits (74),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 22/37 (59%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  LPGHRLRKSVVLSFGPPRSINPLGELKLLFQTGRHVD  432
            L   + +   +L FGPP + NPLGEL  L QTG  V+
Sbjct  144  LSWDQFKSYCLLWFGPPLTSNPLGELINLKQTGTVVE  180



>ref|XP_007015042.1| Transferases,tRNA-methyltransferases [Theobroma cacao]
 gb|EOY32661.1| Transferases,tRNA-methyltransferases [Theobroma cacao]
Length=1075

 Score = 57.4 bits (137),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  QDPMVWLLRCESSFHHADTPDHERVPLAAHHMIGKAQLWYHSETAVSPFASWASFKEE  347
            +DP+ WL RCE  F H  TP+ E+V L + H+ G AQLW+      +P  SW  FK +
Sbjct  506  EDPLRWLSRCEHFFRHQQTPEEEKVSLTSFHLEGNAQLWFLQMEVDTPQPSWNEFKRQ  563


 Score = 25.8 bits (55),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 18/34 (53%), Gaps = 0/34 (0%)
 Frame = +1

Query  331  HRLRKSVVLSFGPPRSINPLGELKLLFQTGRHVD  432
            +  ++   L FGPP   + LGEL  L Q+G   D
Sbjct  558  NEFKRQCHLRFGPPLRSHKLGELVKLRQSGSMAD  591



>ref|XP_009762955.1| PREDICTED: uncharacterized protein LOC104214925 [Nicotiana sylvestris]
Length=849

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +3

Query  174  QDPMVWLLRCESSFHHADTPDHERVPLAAHHMIGKAQLWYHSETAVSPFASWASFKEERC  353
            +DP++W+ RCE  F +  T + ++V LAA H++G+AQLWYH      P   W+ FKE   
Sbjct  70   EDPLIWVHRCEKFFSNQRTNEVDKVGLAAFHLLGEAQLWYHQVEQEYPSVDWSEFKEYCA  129

Query  354  FEF  362
              F
Sbjct  130  LRF  132



>gb|EEE55062.1| hypothetical protein OsJ_02776 [Oryza sativa Japonica Group]
Length=692

 Score = 48.9 bits (115),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 40/78 (51%), Gaps = 4/78 (5%)
 Frame = +3

Query  105  GITPTFFPVSQSRIPFVFRRGRPQDPMVWLLRCESSFHHADTPDHERVPLAAHHMIGKAQ  284
             I  +F P ++   P    +G   DP+ WL RCE+ F    TP+  +V  A+ H+IG AQ
Sbjct  216  AIDNSFLPRAKLEFPTYDGKG---DPLPWLNRCET-FRGQKTPETRKVWYASLHLIGDAQ  271

Query  285  LWYHSETAVSPFASWASF  338
            LWY+     S   SW  F
Sbjct  272  LWYYRIELNSGEPSWRRF  289


 Score = 30.8 bits (68),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 17/36 (47%), Positives = 23/36 (64%), Gaps = 1/36 (3%)
 Frame = +1

Query  334  RLRKSVVLSFGPPRSINPLGELKLLFQTGRHVDDYV  441
            R  + V   FGPP + +PLGEL  L +TG  V++YV
Sbjct  288  RFVQLVHTRFGPPMTDSPLGELTALRRTGT-VENYV  322



>gb|EEC80893.1| hypothetical protein OsI_23536 [Oryza sativa Indica Group]
Length=288

 Score = 47.0 bits (110),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 32/57 (56%), Gaps = 2/57 (4%)
 Frame = +3

Query  177  DPMVWLLRCESSFHHADTPDHERVPLAAHHMIGKAQLWY-HSETAVSPFASWASFKE  344
            DP+ WL  CE  F    +PD +RV LA +H+ G AQ WY H E    P   W +FKE
Sbjct  105  DPLNWLNHCEQFFRAQRSPDGDRVWLATYHLTGAAQEWYFHYEQHKGP-PDWDTFKE  160


 Score = 27.7 bits (60),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = +1

Query  361  FGPPRSINPLGELKLLFQT  417
            +GPP   NPLGELK L Q+
Sbjct  166  YGPPIRNNPLGELKRLSQS  184



>gb|EEC80895.1| hypothetical protein OsI_23541 [Oryza sativa Indica Group]
Length=351

 Score = 47.0 bits (110),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 32/57 (56%), Gaps = 2/57 (4%)
 Frame = +3

Query  177  DPMVWLLRCESSFHHADTPDHERVPLAAHHMIGKAQLWY-HSETAVSPFASWASFKE  344
            DP+ WL  CE  F    +PD +RV LA +H+ G AQ WY H E    P   W +FKE
Sbjct  157  DPLNWLNHCEQFFRAQRSPDGDRVWLATYHLTGAAQEWYFHYEQHKGP-PDWDTFKE  212


 Score = 27.7 bits (60),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = +1

Query  361  FGPPRSINPLGELKLLFQT  417
            +GPP   NPLGELK L Q+
Sbjct  218  YGPPIRNNPLGELKRLSQS  236



>gb|EEE65953.1| hypothetical protein OsJ_21835 [Oryza sativa Japonica Group]
Length=347

 Score = 46.6 bits (109),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 32/57 (56%), Gaps = 2/57 (4%)
 Frame = +3

Query  177  DPMVWLLRCESSFHHADTPDHERVPLAAHHMIGKAQLWY-HSETAVSPFASWASFKE  344
            DP+ WL  CE  F    +PD +RV LA +H+ G AQ WY H E    P   W +FKE
Sbjct  164  DPLNWLNHCEQFFRAQRSPDGDRVWLATYHLTGAAQEWYFHYEQHKGP-PDWDTFKE  219


 Score = 27.7 bits (60),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = +1

Query  361  FGPPRSINPLGELKLLFQT  417
            +GPP   NPLGELK L Q+
Sbjct  225  YGPPIRNNPLGELKRLSQS  243



>ref|XP_002521057.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41341.1| conserved hypothetical protein [Ricinus communis]
Length=211

 Score = 43.9 bits (102),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 26/43 (60%), Gaps = 0/43 (0%)
 Frame = +3

Query  213  FHHADTPDHERVPLAAHHMIGKAQLWYHSETAVSPFASWASFK  341
            FHH  TP+ ERV LA+ H+   AQ+WY       P  +WA+FK
Sbjct  49   FHHQRTPEEERVSLASLHLEEDAQVWYLKLARDKPQLTWANFK  91


 Score = 29.6 bits (65),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 14/22 (64%), Gaps = 0/22 (0%)
 Frame = +1

Query  355  LSFGPPRSINPLGELKLLFQTG  420
            L FGPP   N LGEL  L QTG
Sbjct  96   LRFGPPTGSNKLGELSKLKQTG  117



>gb|EAZ12025.1| hypothetical protein OsJ_01904 [Oryza sativa Japonica Group]
Length=272

 Score = 43.5 bits (101),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 32/58 (55%), Gaps = 2/58 (3%)
 Frame = +3

Query  174  QDPMVWLLRCESSFHHADTPDHERVPLAAHHMIGKAQLWY-HSETAVSPFASWASFKE  344
            +DP+ WL  CE  FH   T   +RV LA +H+ G AQ WY H E    P   W +FK+
Sbjct  100  EDPLNWLNHCEQFFHGQRTDAGDRVWLATYHLTGNAQEWYFHHEQHKGP-PDWDTFKD  156


 Score = 29.6 bits (65),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = +1

Query  361  FGPPRSINPLGELKLLFQT  417
            FGPP   NPLGELK L QT
Sbjct  162  FGPPIRHNPLGELKRLTQT  180



>ref|XP_009629904.1| PREDICTED: uncharacterized protein LOC104119971 [Nicotiana tomentosiformis]
Length=1066

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 34/62 (55%), Gaps = 0/62 (0%)
 Frame = +3

Query  177  DPMVWLLRCESSFHHADTPDHERVPLAAHHMIGKAQLWYHSETAVSPFASWASFKEERCF  356
            +P VW+ +CE  F+   TPD+++V   A ++ G A+ WY+S         W  FKEE C 
Sbjct  254  EPKVWIRKCERYFNLYRTPDNQKVEADALYLNGLAEKWYNSLVLSRGIIGWVEFKEELCS  313

Query  357  EF  362
             F
Sbjct  314  RF  315



>ref|XP_008663160.1| PREDICTED: uncharacterized protein LOC103641598 [Zea mays]
Length=269

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = +3

Query  174  QDPMVWLLRCESSFHHADTPDHERVPLAAHHMIGKAQLWYHSETAVSPFASWASFKE  344
            +DP+ WL RCE  F    T + ++V LA++H+ G AQ WYH      PF   A+F+E
Sbjct  155  EDPLGWLNRCEQYFRGQRTVEEDKVWLASYHLTGAAQQWYHLLEREEPFPVLATFQE  211



>gb|ABG89853.1| unknown [Phyllostachys edulis]
Length=203

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = +3

Query  174  QDPMVWLLRCESSFHHADTPDHERVPLAAHHMIGKAQLWYHSETAVSPFASWASFKE  344
            +DP+ WL RCE  F    TP+ ++V LA++H++G AQ WY+          W  FK+
Sbjct  80   EDPLGWLNRCEQFFRCQQTPESDKVWLASYHLVGSAQQWYYQLERDDGEPPWQLFKD  136



>ref|XP_008680913.1| PREDICTED: uncharacterized protein LOC103656043 [Zea mays]
Length=221

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +3

Query  177  DPMVWLLRCESSFHHADTPDHERVPLAAHHMIGKAQLWYHSETAVSPFASWASFKE  344
            DPM+++ +CES F H  T   ERV +A++H+   AQLWY+         SW  FK+
Sbjct  72   DPMLFINKCESYFRHHRTLGEERVRMASYHLDDVAQLWYNQLEEDDGAPSWGRFKD  127



>ref|XP_002437546.1| hypothetical protein SORBIDRAFT_10g029135 [Sorghum bicolor]
 gb|EER88913.1| hypothetical protein SORBIDRAFT_10g029135 [Sorghum bicolor]
Length=207

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 0/56 (0%)
 Frame = +3

Query  177  DPMVWLLRCESSFHHADTPDHERVPLAAHHMIGKAQLWYHSETAVSPFASWASFKE  344
            DP +WL RCE  F    T + ++V LAA HM G AQ+WY+     +   +W  F E
Sbjct  84   DPDIWLHRCELFFRLQRTEEGDKVCLAAFHMTGAAQIWYYGHERNNGVPTWPQFAE  139



>emb|CAN76938.1| hypothetical protein VITISV_025425 [Vitis vinifera]
Length=446

 Score = 49.3 bits (116),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 22/57 (39%), Positives = 30/57 (53%), Gaps = 1/57 (2%)
 Frame = +3

Query  174  QDPMVWLLRCESSFHHADTPDHERVPLAAHHMIGKAQLWYHSETAVSPFASWASFKE  344
            +DP  W+ R E  F      + E+VPLA +H+ G+AQLWY         A W + KE
Sbjct  166  EDPTSWICRVEQFFEFQKIAEEEKVPLATYHLEGEAQLWYQILKEEGEVA-WLTLKE  221


 Score = 22.3 bits (46),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 10/20 (50%), Positives = 13/20 (65%), Gaps = 1/20 (5%)
 Frame = +1

Query  127  RYPKVEFPLFSGEEDLKTLW  186
            R  K++FP F+G ED  T W
Sbjct  153  RVTKLDFPRFNGSED-PTSW  171



>ref|XP_002450635.1| hypothetical protein SORBIDRAFT_05g008466 [Sorghum bicolor]
 gb|EES09623.1| hypothetical protein SORBIDRAFT_05g008466 [Sorghum bicolor]
Length=1507

 Score = 47.0 bits (110),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +3

Query  177  DPMVWLLRCESSFHHADTPDHERVPLAAHHMIGKAQLWYHSETAVSPFASWASFKE  344
            DPM++L +CE+ F    T   ERV  A++++ G AQLWY+     S   +WA FKE
Sbjct  149  DPMLFLNKCEAYFRQHRTMAEERVWQASYNLEGVAQLWYNQLEEDSGTPTWARFKE  204


 Score = 23.9 bits (50),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (3%)
 Frame = +1

Query  334  RLRKSVVLSFGPPRSINPLGELKLLFQTGRHVDDY  438
            R ++ + L FGPP    PL EL    +TG  V++Y
Sbjct  201  RFKEYLHLRFGPPLRSAPLFELAECRRTGT-VEEY  234



>ref|XP_008653835.1| PREDICTED: uncharacterized protein LOC103633962 [Zea mays]
Length=220

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 0/56 (0%)
 Frame = +3

Query  177  DPMVWLLRCESSFHHADTPDHERVPLAAHHMIGKAQLWYHSETAVSPFASWASFKE  344
            DPM+++ +CES F H  T   ERV +A++H+   AQLWY          SW  FK+
Sbjct  72   DPMLFINKCESYFRHHRTLGEERVRMASYHLDDVAQLWYSQLEEDDGAPSWGRFKD  127



>ref|XP_004980562.1| PREDICTED: uncharacterized protein LOC101785349 [Setaria italica]
Length=375

 Score = 47.0 bits (110),  Expect(3) = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 36/64 (56%), Gaps = 2/64 (3%)
 Frame = +3

Query  174  QDPMVWLLRCESSFHHADTPDHERVPLAAHHMIGKAQLWYHSETAVSPFASWASFKE--E  347
            +DP  WL  CE  FH   T + ++V LA++HM+G AQ WY      S    W+ FKE   
Sbjct  89   EDPFDWLNCCEQFFHGQRTLEEDKVWLASYHMMGTAQTWYFMLERDSRPPLWSDFKELCN  148

Query  348  RCFE  359
            +CF+
Sbjct  149  QCFD  152


 Score = 21.9 bits (45),  Expect(3) = 3e-04, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 3/25 (12%)
 Frame = +1

Query  106  GSLLRFSRYP---KVEFPLFSGEED  171
            GSL+     P   K+EFP F G+ED
Sbjct  66   GSLVARPAVPHFHKLEFPTFDGKED  90


 Score = 20.4 bits (41),  Expect(3) = 3e-04, Method: Compositional matrix adjust.
 Identities = 8/13 (62%), Positives = 9/13 (69%), Gaps = 0/13 (0%)
 Frame = +1

Query  361  FGPPRSINPLGEL  399
            F PP   NP+GEL
Sbjct  151  FDPPLRSNPVGEL  163



>ref|XP_008660861.1| PREDICTED: uncharacterized protein LOC103639970 [Zea mays]
Length=219

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 36/57 (63%), Gaps = 3/57 (5%)
 Frame = +3

Query  177  DPMVWLLRCESSFHHADTPDHERVPLAAHHMIGKAQLWYHS-ETAVSPFASWASFKE  344
            DPM+++ +CES F H  T   ERV +A++H+   AQLWY+  E   +P  SW  FK+
Sbjct  72   DPMLFINKCESYFRHHRTLGEERVRMASYHLDDVAQLWYNQLEDDGAP--SWGRFKD  126



>ref|XP_010087209.1| hypothetical protein L484_006138 [Morus notabilis]
 gb|EXB28516.1| hypothetical protein L484_006138 [Morus notabilis]
Length=545

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 40/84 (48%), Gaps = 1/84 (1%)
 Frame = +3

Query  111  TPTFFPVSQSRIPFVFRRGRPQDPMVWLLRCESSFHHADTPDHERVPLAAHHMIGKAQLW  290
            T   FP    R+ F    G  +DP +W+   E  F   +  + E+V LA++++ G AQ+W
Sbjct  59   TGGVFPPRYLRLDFPVYNG-AEDPTIWICGAEQFFDFQNVAEAEKVRLASYYLEGDAQIW  117

Query  291  YHSETAVSPFASWASFKEERCFEF  362
               +  ++    WA FK E    F
Sbjct  118  IQRKNTLNEHIDWARFKRELMLRF  141



>ref|XP_008650637.1| PREDICTED: uncharacterized protein LOC103631523 [Zea mays]
Length=350

 Score = 42.0 bits (97),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 30/56 (54%), Gaps = 0/56 (0%)
 Frame = +3

Query  177  DPMVWLLRCESSFHHADTPDHERVPLAAHHMIGKAQLWYHSETAVSPFASWASFKE  344
            DPM+++ +CES F    T   ERV +A++++   AQLWY           W  FKE
Sbjct  71   DPMLFINKCESYFRQQRTLAEERVWMASYNLEDVAQLWYIQLQEDEGTPPWGRFKE  126


 Score = 27.3 bits (59),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 1/38 (3%)
 Frame = +1

Query  325  PGHRLRKSVVLSFGPPRSINPLGELKLLFQTGRHVDDY  438
            P  R ++ + L FGPP    PL EL    +TG  V+DY
Sbjct  120  PWGRFKELLNLRFGPPLRAAPLFELAECRRTG-TVEDY  156



>ref|XP_008650682.1| PREDICTED: uncharacterized protein LOC103631581 [Zea mays]
Length=331

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 0/56 (0%)
 Frame = +3

Query  177  DPMVWLLRCESSFHHADTPDHERVPLAAHHMIGKAQLWYHSETAVSPFASWASFKE  344
            DPM+++ +C+S F H  T   ERV +A++H+   AQLWY          SW  FK+
Sbjct  72   DPMLFINKCDSYFRHHRTLGEERVRMASYHLDDVAQLWYSQLEEDDGAPSWGRFKD  127



>ref|XP_009760314.1| PREDICTED: uncharacterized protein LOC104212668 [Nicotiana sylvestris]
Length=684

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 22/63 (35%), Positives = 32/63 (51%), Gaps = 0/63 (0%)
 Frame = +3

Query  174  QDPMVWLLRCESSFHHADTPDHERVPLAAHHMIGKAQLWYHSETAVSPFASWASFKEERC  353
             +P  W+ +CE  F+   TPD+ +V + A ++ G A +WY S        SW  FKEE  
Sbjct  91   HEPKGWIRKCERYFNLYRTPDNLKVEVTALYLNGLADIWYDSLVLSKGEVSWTEFKEELL  150

Query  354  FEF  362
              F
Sbjct  151  IRF  153



>ref|XP_002509827.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51214.1| conserved hypothetical protein [Ricinus communis]
Length=208

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/63 (27%), Positives = 33/63 (52%), Gaps = 0/63 (0%)
 Frame = +3

Query  174  QDPMVWLLRCESSFHHADTPDHERVPLAAHHMIGKAQLWYHSETAVSPFASWASFKEERC  353
             +P +W+ +CE  F     P+ +++ +A+ ++  +A +WY    A +  + W  F EE C
Sbjct  119  NNPRLWIKKCEKYFQLYSIPNEQKIDIASLYLGDRADIWYQGWQAQTRSSDWGKFSEELC  178

Query  354  FEF  362
              F
Sbjct  179  RRF  181



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 513384835824