BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c12165_g1_i1 len=1581 path=[1602:0-686 22:687-1580]

Length=1581
                                                                      Score     E

dbj|BAG55007.1|  adenylate isopentenyltransferase                       653   0.0      Ipomoea nil [qian niu]
emb|CDO98989.1|  unnamed protein product                                410   2e-136   
ref|XP_009804222.1|  PREDICTED: adenylate isopentenyltransferase ...    390   1e-128   
ref|XP_009618569.1|  PREDICTED: adenylate isopentenyltransferase ...    378   8e-124   
ref|XP_011091051.1|  PREDICTED: LOW QUALITY PROTEIN: adenylate is...    371   2e-121   
gb|KDO74822.1|  hypothetical protein CISIN_1g020362mg                   366   2e-119   
ref|NP_001266270.1|  adenylate isopentenyltransferase 5, chloropl...    366   3e-119   
ref|XP_007034593.1|  Isopentenyltransferase 5, putative                 366   3e-119   
ref|XP_010278446.1|  PREDICTED: adenylate isopentenyltransferase ...    365   1e-118   
ref|XP_002314413.1|  hypothetical protein POPTR_0010s03150g             363   3e-118   Populus trichocarpa [western balsam poplar]
ref|XP_002312745.1|  hypothetical protein POPTR_0008s20650g             362   1e-117   Populus trichocarpa [western balsam poplar]
ref|XP_011009688.1|  PREDICTED: adenylate isopentenyltransferase ...    361   3e-117   
ref|XP_006419806.1|  hypothetical protein CICLE_v10005414mg             361   3e-117   
emb|CAN64738.1|  hypothetical protein VITISV_007444                     362   5e-117   Vitis vinifera
ref|XP_010693920.1|  PREDICTED: adenylate isopentenyltransferase ...    360   8e-117   
emb|CBI26180.3|  unnamed protein product                                360   1e-116   
ref|XP_011012333.1|  PREDICTED: adenylate isopentenyltransferase ...    360   1e-116   
ref|XP_002277591.1|  PREDICTED: adenylate isopentenyltransferase ...    360   1e-116   Vitis vinifera
ref|XP_011071664.1|  PREDICTED: adenylate isopentenyltransferase ...    357   2e-115   
ref|XP_002517150.1|  ATP binding protein, putative                      355   3e-115   Ricinus communis
ref|XP_006339408.1|  PREDICTED: adenylate isopentenyltransferase ...    355   7e-115   
ref|XP_010551776.1|  PREDICTED: adenylate isopentenyltransferase ...    352   7e-114   
ref|XP_009356755.1|  PREDICTED: adenylate isopentenyltransferase ...    351   2e-113   
ref|XP_009365803.1|  PREDICTED: adenylate isopentenyltransferase ...    351   3e-113   
ref|XP_008223011.1|  PREDICTED: LOW QUALITY PROTEIN: adenylate is...    351   4e-113   
ref|XP_002271962.1|  PREDICTED: adenylate isopentenyltransferase ...    350   4e-113   Vitis vinifera
ref|XP_009342172.1|  PREDICTED: adenylate isopentenyltransferase ...    350   6e-113   
ref|NP_001281297.1|  adenylate isopentenyltransferase 5, chloropl...    350   7e-113   
ref|XP_010548779.1|  PREDICTED: adenylate isopentenyltransferase ...    348   5e-112   
gb|KDP40100.1|  hypothetical protein JCGZ_02098                         347   9e-112   
ref|XP_008340912.1|  PREDICTED: LOW QUALITY PROTEIN: adenylate is...    347   1e-111   
ref|NP_001288042.1|  uncharacterized protein LOC103449027               345   2e-111   
ref|XP_010103429.1|  Adenylate isopentenyltransferase 5                 347   2e-111   
gb|AIN44214.1|  IPT3                                                    345   3e-111   
ref|XP_007200740.1|  hypothetical protein PRUPE_ppa023171mg             345   5e-111   
ref|XP_011102016.1|  PREDICTED: adenylate isopentenyltransferase ...    344   5e-111   
ref|XP_008235248.1|  PREDICTED: adenylate isopentenyltransferase ...    345   7e-111   
gb|ADY80560.1|  adenylate isopentenyltransferase                        344   1e-110   
gb|ADT82707.1|  adenylate isopentenyltransferase                        343   1e-110   
gb|ADY80558.1|  adenylate isopentenyltransferase                        343   2e-110   
ref|XP_007226947.1|  hypothetical protein PRUPE_ppa025177mg             343   2e-110   
ref|XP_011102015.1|  PREDICTED: adenylate isopentenyltransferase ...    342   3e-110   
ref|XP_011079824.1|  PREDICTED: adenylate isopentenyltransferase ...    343   3e-110   
ref|XP_010035694.1|  PREDICTED: adenylate isopentenyltransferase ...    343   3e-110   
ref|XP_007147775.1|  hypothetical protein PHAVU_006G154200g             343   3e-110   
ref|XP_010035684.1|  PREDICTED: adenylate isopentenyltransferase ...    343   5e-110   
ref|XP_008451382.1|  PREDICTED: adenylate isopentenyltransferase ...    342   5e-110   
gb|ABG82043.1|  isopentenyltransferase                                  342   7e-110   Malus hupehensis
ref|XP_008368862.1|  PREDICTED: adenylate isopentenyltransferase ...    342   8e-110   
gb|AFI49626.1|  isopentenyl transferases protein                        341   1e-109   
ref|XP_011102039.1|  PREDICTED: adenylate isopentenyltransferase ...    340   4e-109   
ref|XP_008458554.1|  PREDICTED: adenylate isopentenyltransferase ...    340   7e-109   
ref|XP_004290672.1|  PREDICTED: adenylate isopentenyltransferase ...    339   1e-108   
ref|XP_002533064.1|  ATP binding protein, putative                      339   1e-108   Ricinus communis
ref|XP_011033688.1|  PREDICTED: adenylate isopentenyltransferase ...    338   2e-108   
ref|XP_010090377.1|  Adenylate isopentenyltransferase 3                 337   3e-108   
ref|XP_007050663.1|  Isopentenyltransferase 3, putative                 337   6e-108   
ref|XP_010024423.1|  PREDICTED: adenylate isopentenyltransferase ...    337   8e-108   
ref|XP_004136062.1|  PREDICTED: adenylate isopentenyltransferase ...    337   9e-108   
ref|XP_010938767.1|  PREDICTED: adenylate isopentenyltransferase ...    335   2e-107   
ref|XP_002321061.2|  hypothetical protein POPTR_0014s13540g             333   2e-106   Populus trichocarpa [western balsam poplar]
ref|XP_011092012.1|  PREDICTED: adenylate isopentenyltransferase ...    331   5e-106   
ref|XP_011078654.1|  PREDICTED: adenylate isopentenyltransferase ...    330   8e-106   
dbj|BAG55006.1|  adenylate isopentenyltransferase                       330   3e-105   Ipomoea nil [qian niu]
ref|XP_008438727.1|  PREDICTED: adenylate isopentenyltransferase ...    330   5e-105   
ref|XP_010551669.1|  PREDICTED: adenylate isopentenyltransferase ...    330   5e-105   
emb|CAN64248.1|  hypothetical protein VITISV_032976                     328   6e-105   Vitis vinifera
ref|XP_004150320.1|  PREDICTED: adenylate isopentenyltransferase ...    329   9e-105   
gb|ABD93935.1|  adenylate isopentenyltransferase                        329   1e-104   Lotus japonicus
gb|KHN37566.1|  Adenylate isopentenyltransferase 5, chloroplastic       327   4e-104   
ref|XP_004486153.1|  PREDICTED: adenylate isopentenyltransferase ...    326   2e-103   
ref|XP_004134460.1|  PREDICTED: adenylate isopentenyltransferase ...    325   3e-103   
ref|XP_008804944.1|  PREDICTED: adenylate isopentenyltransferase ...    327   3e-103   
ref|XP_010420690.1|  PREDICTED: adenylate isopentenyltransferase ...    325   4e-103   
ref|XP_009385519.1|  PREDICTED: adenylate isopentenyltransferase ...    324   7e-103   
ref|XP_002268848.3|  PREDICTED: adenylate isopentenyltransferase ...    323   8e-103   Vitis vinifera
ref|XP_006288171.1|  hypothetical protein CARUB_v10001408mg             323   1e-102   
ref|XP_008780079.1|  PREDICTED: adenylate isopentenyltransferase ...    323   2e-102   
ref|XP_010454167.1|  PREDICTED: adenylate isopentenyltransferase ...    323   2e-102   
dbj|BAB59032.1|  cytokinin synthase                                     323   2e-102   Arabidopsis thaliana [mouse-ear cress]
gb|KCW49921.1|  hypothetical protein EUGRSUZ_K03385                     323   3e-102   
ref|XP_006400459.1|  hypothetical protein EUTSA_v10015859mg             323   3e-102   
ref|XP_010492943.1|  PREDICTED: adenylate isopentenyltransferase ...    322   4e-102   
ref|XP_010255880.1|  PREDICTED: adenylate isopentenyltransferase ...    322   4e-102   
ref|XP_010942491.1|  PREDICTED: adenylate isopentenyltransferase ...    321   6e-102   
ref|NP_197405.1|  isopentenyltransferase 5                              322   7e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011102233.1|  PREDICTED: adenylate isopentenyltransferase ...    320   8e-102   
gb|EYU43837.1|  hypothetical protein MIMGU_mgv1a020459mg                321   9e-102   
ref|XP_008786948.1|  PREDICTED: adenylate isopentenyltransferase ...    322   9e-102   
ref|XP_004296948.1|  PREDICTED: adenylate isopentenyltransferase ...    322   1e-101   
ref|XP_004172767.1|  PREDICTED: LOW QUALITY PROTEIN: adenylate is...    320   2e-101   
gb|EYU46608.1|  hypothetical protein MIMGU_mgv1a026307mg                320   2e-101   
gb|ABD93934.1|  adenylate isopentenyltransferase                        320   2e-101   Lotus japonicus
ref|XP_002873926.1|  cytokinin synthase                                 320   4e-101   
ref|XP_004296947.1|  PREDICTED: adenylate isopentenyltransferase ...    321   5e-101   
ref|XP_006444118.1|  hypothetical protein CICLE_v10021361mg             318   7e-101   
ref|XP_006479751.1|  PREDICTED: adenylate isopentenyltransferase ...    318   8e-101   
dbj|BAK64271.1|  isopentenyltransferase                                 315   1e-100   
ref|XP_010039257.1|  PREDICTED: adenylate isopentenyltransferase ...    322   2e-100   
ref|XP_009392057.1|  PREDICTED: adenylate isopentenyltransferase ...    320   2e-100   
ref|XP_009120925.1|  PREDICTED: adenylate isopentenyltransferase ...    318   3e-100   
gb|KEH36761.1|  adenylate isopentenyltransferase                        318   3e-100   
ref|XP_009126292.1|  PREDICTED: adenylate isopentenyltransferase ...    317   5e-100   
emb|CDY47191.1|  BnaAnng08610D                                          317   6e-100   
emb|CDX92563.1|  BnaA10g16020D                                          316   1e-99    
ref|XP_011082638.1|  PREDICTED: adenylate isopentenyltransferase ...    315   1e-99    
emb|CDY13945.1|  BnaC09g38810D                                          313   1e-98    
ref|XP_003518930.1|  PREDICTED: adenylate isopentenyltransferase ...    313   1e-98    
gb|KCW84294.1|  hypothetical protein EUGRSUZ_B01146                     311   1e-98    
emb|CDY02590.1|  BnaC02g08450D                                          313   2e-98    
gb|ACX55059.1|  isopentenyltransferase                                  309   2e-98    Vitis vinifera
ref|XP_010684312.1|  PREDICTED: adenylate isopentenyltransferase ...    312   2e-98    
ref|XP_011102013.1|  PREDICTED: adenylate isopentenyltransferase ...    311   2e-98    
gb|KHN18893.1|  Adenylate isopentenyltransferase 3, chloroplastic       311   3e-98    
ref|XP_009387145.1|  PREDICTED: adenylate isopentenyltransferase ...    315   4e-98    
ref|XP_010524014.1|  PREDICTED: adenylate isopentenyltransferase ...    310   1e-97    
dbj|BAE75937.1|  adenylate isopentenyltransferase                       311   2e-97    Pisum sativum [garden pea]
ref|XP_010532708.1|  PREDICTED: LOW QUALITY PROTEIN: adenylate is...    309   3e-97    
ref|XP_004508369.1|  PREDICTED: adenylate isopentenyltransferase ...    306   2e-96    
ref|XP_008791009.1|  PREDICTED: adenylate isopentenyltransferase ...    306   3e-96    
ref|NP_001237359.1|  isopentenyl transferase                            307   4e-96    
gb|EYU45613.1|  hypothetical protein MIMGU_mgv1a022025mg                305   5e-96    
dbj|BAE75936.1|  adenylate isopentenyltransferase                       306   8e-96    Pisum sativum [garden pea]
ref|XP_011101071.1|  PREDICTED: adenylate isopentenyltransferase ...    305   8e-96    
ref|XP_004495223.1|  PREDICTED: adenylate isopentenyltransferase ...    306   9e-96    
ref|XP_011102014.1|  PREDICTED: adenylate isopentenyltransferase ...    302   9e-96    
ref|XP_010545085.1|  PREDICTED: adenylate isopentenyltransferase ...    305   2e-95    
gb|KHN33068.1|  Adenylate isopentenyltransferase 5, chloroplastic       305   3e-95    
ref|XP_007144614.1|  hypothetical protein PHAVU_007G170100g             303   5e-95    
ref|XP_007162406.1|  hypothetical protein PHAVU_001G149400g             303   5e-95    
ref|NP_567138.1|  adenylate isopentenyltransferase 3                    304   7e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002878496.1|  ATIPT3                                             303   8e-95    
ref|XP_009782718.1|  PREDICTED: adenylate isopentenyltransferase ...    303   8e-95    
ref|XP_003520560.2|  PREDICTED: adenylate isopentenyltransferase ...    301   3e-94    
ref|XP_003553453.2|  PREDICTED: adenylate isopentenyltransferase ...    301   4e-94    
emb|CAB87756.1|  tRNA isopentenyl transferase-like protein              301   4e-94    Arabidopsis thaliana [mouse-ear cress]
gb|KHN45368.1|  Adenylate isopentenyltransferase 3, chloroplastic       300   7e-94    
gb|AEQ30076.1|  adenylate isopentenyltransferase                        300   7e-94    
ref|XP_009627634.1|  PREDICTED: adenylate isopentenyltransferase ...    300   1e-93    
emb|CDX85119.1|  BnaC07g07870D                                          300   1e-93    
ref|XP_006850780.1|  hypothetical protein AMTR_s00025p00094380          300   2e-93    
gb|ABD93933.1|  adenylate isopentenyltransferase                        299   6e-93    Lotus japonicus
ref|XP_006406003.1|  hypothetical protein EUTSA_v10022241mg             298   6e-93    
ref|XP_006298111.1|  hypothetical protein CARUB_v10014152mg             298   8e-93    
ref|XP_007045420.1|  TRNA delta(2)-isopentenylpyrophosphate trans...    298   1e-92    
dbj|BAE43829.1|  isopentenyltransferase                                 298   1e-92    Brassica rapa subsp. pekinensis [bai cai]
dbj|BAB59033.1|  cytokinin synthase                                     298   1e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006423200.1|  hypothetical protein CICLE_v10029953mg             297   1e-92    
ref|XP_003536902.1|  PREDICTED: adenylate isopentenyltransferase ...    298   2e-92    
ref|NP_566735.1|  adenylate isopentenyltransferase 7                    297   2e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003528670.1|  PREDICTED: adenylate isopentenyltransferase ...    296   4e-92    
ref|XP_006487203.1|  PREDICTED: adenylate isopentenyltransferase ...    296   4e-92    
ref|XP_002883441.1|  cytokinin synthase                                 296   4e-92    
ref|XP_009102596.1|  PREDICTED: adenylate isopentenyltransferase ...    296   5e-92    
ref|XP_007045376.1|  TRNA delta(2)-isopentenylpyrophosphate trans...    296   5e-92    
ref|XP_009116977.1|  PREDICTED: adenylate isopentenyltransferase ...    296   6e-92    
emb|CDX93935.1|  BnaC04g20940D                                          296   6e-92    
emb|CDY67797.1|  BnaCnng56440D                                          295   1e-91    
ref|XP_010512718.1|  PREDICTED: adenylate isopentenyltransferase ...    294   3e-91    
gb|KFK35473.1|  hypothetical protein AALP_AA5G288800                    294   5e-91    
ref|XP_010512717.1|  PREDICTED: adenylate isopentenyltransferase ...    293   7e-91    
ref|XP_010468886.1|  PREDICTED: adenylate isopentenyltransferase ...    293   7e-91    
ref|XP_006293019.1|  hypothetical protein CARUB_v10019297mg             293   8e-91    
gb|KEH32204.1|  adenylate isopentenyltransferase                        294   9e-91    
ref|XP_003550509.1|  PREDICTED: adenylate isopentenyltransferase ...    293   1e-90    
ref|XP_010413197.1|  PREDICTED: adenylate isopentenyltransferase ...    293   1e-90    
ref|XP_009778781.1|  PREDICTED: adenylate isopentenyltransferase ...    292   3e-90    
gb|AAM65536.1|  cytokinin synthase                                      291   4e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004987245.1|  PREDICTED: adenylate isopentenyltransferase ...    291   6e-90    
gb|EPS74194.1|  hypothetical protein M569_00558                         289   6e-90    
ref|XP_010488441.1|  PREDICTED: adenylate isopentenyltransferase ...    290   1e-89    
ref|XP_009603455.1|  PREDICTED: adenylate isopentenyltransferase ...    290   1e-89    
ref|XP_010068121.1|  PREDICTED: adenylate isopentenyltransferase ...    288   2e-89    
ref|XP_009138635.1|  PREDICTED: adenylate isopentenyltransferase ...    290   2e-89    
ref|XP_003590677.1|  Adenylate isopentenyltransferase                   287   1e-88    
ref|XP_006653174.1|  PREDICTED: adenylate isopentenyltransferase ...    288   1e-88    
ref|XP_010512656.1|  PREDICTED: adenylate isopentenyltransferase ...    287   2e-88    
ref|XP_006402308.1|  hypothetical protein EUTSA_v10006499mg             286   4e-88    
gb|AEA03283.1|  isopentenyltransferase                                  286   5e-88    
ref|XP_007210848.1|  hypothetical protein PRUPE_ppa015780mg             284   6e-88    
ref|XP_009400154.1|  PREDICTED: adenylate isopentenyltransferase ...    286   7e-88    
ref|XP_004148309.1|  PREDICTED: adenylate isopentenyltransferase ...    285   1e-87    
ref|XP_010932022.1|  PREDICTED: uncharacterized protein LOC105052792    293   1e-87    
gb|KDO51454.1|  hypothetical protein CISIN_1g044048mg                   282   1e-87    
ref|XP_002457830.1|  hypothetical protein SORBIDRAFT_03g014490          285   3e-87    Sorghum bicolor [broomcorn]
ref|XP_007045377.1|  TRNA delta(2)-isopentenylpyrophosphate trans...    283   3e-87    
ref|XP_010466712.1|  PREDICTED: adenylate isopentenyltransferase ...    283   4e-87    
gb|KHN03782.1|  Adenylate isopentenyltransferase 3, chloroplastic       282   6e-87    
ref|XP_008447303.1|  PREDICTED: adenylate isopentenyltransferase ...    283   6e-87    
ref|XP_008675872.1|  PREDICTED: adenylate isopentenyltransferase ...    283   8e-87    
ref|XP_007154132.1|  hypothetical protein PHAVU_003G093100g             282   1e-86    
ref|XP_008229695.1|  PREDICTED: adenylate isopentenyltransferase ...    280   2e-86    
ref|XP_006355868.1|  PREDICTED: adenylate isopentenyltransferase ...    281   3e-86    
ref|XP_002519092.1|  tRNA delta(2)-isopentenylpyrophosphate trans...    281   4e-86    Ricinus communis
ref|XP_011101075.1|  PREDICTED: adenylate isopentenyltransferase ...    278   5e-86    
gb|KHN17317.1|  Adenylate isopentenyltransferase 5, chloroplastic       280   6e-86    
ref|XP_010653719.1|  PREDICTED: adenylate isopentenyltransferase ...    278   6e-86    
ref|XP_002519099.1|  ATP binding protein, putative                      278   1e-85    Ricinus communis
gb|KDP46221.1|  hypothetical protein JCGZ_10061                         277   5e-85    
ref|NP_001244915.1|  adenylate isopentenyltransferase                   277   7e-85    
ref|XP_003551849.2|  PREDICTED: adenylate isopentenyltransferase ...    277   9e-85    
gb|KEH21991.1|  adenylate isopentenyltransferase                        275   5e-84    
ref|XP_010096214.1|  Adenylate isopentenyltransferase 3                 274   1e-83    
gb|KHN17318.1|  Adenylate isopentenyltransferase 5, chloroplastic       273   3e-83    
ref|XP_003596250.1|  Adenylate isopentenyltransferase                   271   7e-83    
emb|CDM82045.1|  unnamed protein product                                273   1e-82    
emb|CBI32356.3|  unnamed protein product                                270   1e-82    
gb|KCW62877.1|  hypothetical protein EUGRSUZ_G00473                     269   1e-82    
ref|XP_009371878.1|  PREDICTED: adenylate isopentenyltransferase ...    268   7e-82    
gb|KEH32922.1|  adenylate isopentenyltransferase                        269   7e-82    
ref|XP_008373615.1|  PREDICTED: adenylate isopentenyltransferase ...    268   7e-82    
gb|ADY80563.1|  adenylate isopentenyltransferase                        268   9e-82    
ref|XP_003598773.1|  Isopentenyltransferase                             266   1e-80    
gb|EPS59563.1|  hypothetical protein M569_15242                         264   2e-80    
gb|AEV76968.1|  isopentenyltransferase 7                                262   2e-80    
ref|XP_003598728.1|  Adenylate isopentenyltransferase                   265   2e-80    
ref|XP_008671619.1|  PREDICTED: adenylate isopentenyltransferase ...    266   3e-80    
gb|AAY29690.1|  putative cytokinin synthase 1                           263   4e-80    Populus tremula x Populus alba [gray poplar]
ref|XP_003621856.1|  Adenylate isopentenyltransferase                   264   4e-80    
ref|XP_003565777.1|  PREDICTED: adenylate isopentenyltransferase ...    265   5e-80    
ref|XP_008373754.1|  PREDICTED: adenylate isopentenyltransferase ...    263   8e-80    
gb|KEH21511.1|  adenylate isopentenyltransferase                        263   2e-79    
gb|ADG96011.1|  isopentenyltransferase                                  264   2e-79    
ref|XP_002459547.1|  hypothetical protein SORBIDRAFT_02g006400          263   2e-79    Sorghum bicolor [broomcorn]
ref|XP_011031808.1|  PREDICTED: adenylate isopentenyltransferase ...    263   3e-79    
gb|KHN03044.1|  Adenylate isopentenyltransferase 5, chloroplastic       262   4e-79    
ref|XP_004981325.1|  PREDICTED: adenylate isopentenyltransferase ...    261   2e-78    
gb|KEH26138.1|  adenylate isopentenyltransferase                        260   2e-78    
gb|ABY78885.1|  isopentenyl transferase IPT6                            261   3e-78    Zea mays [maize]
gb|EAY92293.1|  hypothetical protein OsI_14013                          261   3e-78    Oryza sativa Indica Group [Indian rice]
gb|ABR67048.1|  isopentenyltransferase                                  257   3e-78    Gossypium hirsutum [American cotton]
ref|XP_008665655.1|  PREDICTED: adenylate isopentenyltransferase ...    260   3e-78    
ref|XP_004251342.1|  PREDICTED: adenylate isopentenyltransferase ...    257   1e-77    
ref|XP_004955804.1|  PREDICTED: adenylate isopentenyltransferase ...    259   1e-77    
ref|XP_003598733.1|  Isopentenyltransferase                             257   3e-77    
ref|XP_010313571.1|  PREDICTED: adenylate isopentenyltransferase ...    256   3e-77    
ref|XP_007139147.1|  hypothetical protein PHAVU_008G005300g             256   3e-77    
ref|XP_002466230.1|  hypothetical protein SORBIDRAFT_01g003950          258   4e-77    Sorghum bicolor [broomcorn]
ref|XP_003559269.1|  PREDICTED: adenylate isopentenyltransferase ...    258   6e-77    
ref|XP_010313572.1|  PREDICTED: adenylate isopentenyltransferase ...    256   6e-77    
ref|NP_001051662.1|  Os03g0810100                                       258   8e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010512976.1|  PREDICTED: adenylate isopentenyltransferase ...    254   9e-77    
ref|XP_011037608.1|  PREDICTED: adenylate isopentenyltransferase ...    256   2e-76    
ref|XP_010313569.1|  PREDICTED: LOW QUALITY PROTEIN: adenylate is...    254   2e-76    
gb|KDP21488.1|  hypothetical protein JCGZ_21959                         253   3e-76    
ref|XP_003598771.1|  tRNA dimethylallyltransferase                      253   5e-76    
ref|XP_011007543.1|  PREDICTED: LOW QUALITY PROTEIN: adenylate is...    250   1e-75    
ref|XP_003598726.1|  Isopentenyltransferase                             252   2e-75    
ref|XP_004250601.1|  PREDICTED: adenylate isopentenyltransferase ...    251   2e-75    
ref|XP_002306084.1|  hypothetical protein POPTR_0004s15810g             253   2e-75    Populus trichocarpa [western balsam poplar]
ref|XP_010507619.1|  PREDICTED: adenylate isopentenyltransferase ...    251   2e-75    
ref|NP_001121194.1|  isopentenyl transferase IPT5                       253   3e-75    Zea mays [maize]
gb|KHN24939.1|  Adenylate isopentenyltransferase 5, chloroplastic       251   3e-75    
gb|AES68975.2|  adenylate isopentenyltransferase                        251   7e-75    
ref|NP_001121195.1|  isopentenyl transferase IPT4                       253   8e-75    Zea mays [maize]
ref|XP_003598724.1|  Isopentenyltransferase                             250   4e-74    
dbj|BAC84458.1|  putative cytokinin synthase                            249   2e-73    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010313570.1|  PREDICTED: adenylate isopentenyltransferase ...    246   2e-73    
ref|XP_007142919.1|  hypothetical protein PHAVU_007G028100g             248   3e-73    
ref|XP_010265118.1|  PREDICTED: adenylate isopentenyltransferase-...    248   3e-73    
ref|XP_010517205.1|  PREDICTED: adenylate isopentenyltransferase ...    245   4e-73    
ref|XP_003561295.1|  PREDICTED: adenylate isopentenyltransferase ...    246   2e-72    
ref|XP_010313578.1|  PREDICTED: uncharacterized protein LOC101253660    248   6e-71    
dbj|BAE47446.1|  adenylate isopentenyltransferase                       241   7e-71    Oryza sativa Japonica Group [Japonica rice]
gb|AIU94759.1|  isopentenyl transferase                                 236   1e-70    
ref|XP_004251331.1|  PREDICTED: adenylate isopentenyltransferase ...    237   1e-70    
emb|CBI27009.3|  unnamed protein product                                239   2e-70    
ref|XP_002311062.2|  hypothetical protein POPTR_0008s033302g            238   2e-70    Populus trichocarpa [western balsam poplar]
dbj|BAK06572.1|  predicted protein                                      241   6e-70    
gb|ABD93932.1|  adenylate isopentenyltransferase                        238   6e-70    Lotus japonicus
ref|XP_009608927.1|  PREDICTED: adenylate isopentenyltransferase ...    239   8e-70    
ref|XP_002279371.2|  PREDICTED: adenylate isopentenyltransferase        240   9e-70    Vitis vinifera
emb|CAN73470.1|  hypothetical protein VITISV_000274                     239   1e-69    Vitis vinifera
ref|XP_003536680.2|  PREDICTED: adenylate isopentenyltransferase-...    238   1e-69    
ref|XP_004245336.1|  PREDICTED: adenylate isopentenyltransferase ...    234   3e-69    
sp|Q5GHF7.1|IPT_HUMLU  RecName: Full=Adenylate isopentenyltransfe...    237   3e-69    Humulus lupulus [common hop]
pdb|3A8T|A  Chain A, Plant Adenylate Isopentenyltransferase In Co...    237   3e-69    
gb|AEV76966.1|  isopentenyltransferase 2                                235   3e-69    
ref|XP_010264047.1|  PREDICTED: adenylate isopentenyltransferase-...    237   3e-69    
gb|AAX12424.1|  adenylate isopentenyltransferase                        234   1e-68    
ref|XP_003598720.1|  tRNA dimethylallyltransferase                      233   3e-68    
ref|XP_004497083.1|  PREDICTED: LOW QUALITY PROTEIN: adenylate is...    235   3e-68    
ref|XP_004245335.2|  PREDICTED: adenylate isopentenyltransferase ...    233   4e-68    
ref|XP_010099238.1|  Adenylate isopentenyltransferase                   238   5e-68    
ref|XP_006467172.1|  PREDICTED: adenylate isopentenyltransferase ...    233   5e-68    
ref|XP_006425405.1|  hypothetical protein CICLE_v10025914mg             234   5e-68    
dbj|BAB59029.1|  cytokinin synthase                                     234   7e-68    
ref|NP_177013.1|  adenylate isopentenyltransferase 1                    234   9e-68    
gb|AES62904.2|  adenylate isopentenyltransferase                        233   1e-67    
gb|AES68971.2|  cytokinin biosynthetic isopentenyltransferase           231   1e-67    
ref|XP_003592653.1|  Adenylate isopentenyltransferase                   233   2e-67    
ref|XP_006842304.1|  hypothetical protein AMTR_s00079p00118940          233   2e-67    
ref|XP_010468282.1|  PREDICTED: adenylate isopentenyltransferase ...    231   3e-67    
gb|EPS70125.1|  hypothetical protein M569_04646                         229   7e-67    
gb|EAY90057.1|  hypothetical protein OsI_11629                          229   2e-66    
ref|XP_008669486.1|  PREDICTED: adenylate isopentenyltransferase ...    229   2e-66    
ref|NP_001050141.1|  Os03g0356900                                       229   3e-66    
emb|CDX95461.1|  BnaC01g33530D                                          228   5e-66    
emb|CDO97083.1|  unnamed protein product                                227   8e-66    
gb|KFK41258.1|  hypothetical protein AALP_AA2G106200                    226   9e-66    
ref|XP_006301434.1|  hypothetical protein CARUB_v10021852mg             228   2e-65    
ref|NP_001288044.1|  adenylate isopentenyltransferase-like              226   7e-65    
ref|XP_010419888.1|  PREDICTED: adenylate isopentenyltransferase ...    224   2e-64    
ref|XP_002888665.1|  cytokinin synthase                                 225   2e-64    
ref|XP_009356257.1|  PREDICTED: adenylate isopentenyltransferase-...    225   3e-64    
ref|XP_009112114.1|  PREDICTED: adenylate isopentenyltransferase ...    223   3e-64    
ref|XP_010312939.1|  PREDICTED: adenylate isopentenyltransferase ...    224   4e-64    
ref|XP_010470796.1|  PREDICTED: adenylate isopentenyltransferase ...    224   4e-64    
ref|XP_009356860.1|  PREDICTED: adenylate isopentenyltransferase-...    226   4e-64    
ref|XP_006406531.1|  hypothetical protein EUTSA_v10022249mg             223   4e-64    
gb|ADY80561.1|  adenylate isopentenyltransferase                        224   5e-64    
gb|EAZ29011.1|  hypothetical protein OsJ_13058                          221   7e-64    
ref|XP_002885297.1|  ATIPT8                                             222   1e-63    
ref|XP_004245333.1|  PREDICTED: adenylate isopentenyltransferase ...    219   2e-63    
emb|CDP00631.1|  unnamed protein product                                220   2e-63    
ref|XP_002526982.1|  adenylate dimethylallyltransferase, putative       221   2e-63    
gb|KDP29418.1|  hypothetical protein JCGZ_18339                         222   3e-63    
ref|XP_010415465.1|  PREDICTED: adenylate isopentenyltransferase ...    222   4e-63    
ref|XP_010489934.1|  PREDICTED: adenylate isopentenyltransferase ...    221   5e-63    
ref|XP_010511839.1|  PREDICTED: adenylate isopentenyltransferase ...    219   9e-63    
ref|XP_004977963.1|  PREDICTED: adenylate isopentenyltransferase ...    219   9e-63    
ref|XP_002447735.1|  hypothetical protein SORBIDRAFT_06g014810          220   1e-62    
gb|KHN03441.1|  Adenylate isopentenyltransferase 5, chloroplastic       218   1e-62    
ref|XP_004164161.1|  PREDICTED: LOW QUALITY PROTEIN: adenylate is...    218   1e-62    
ref|XP_006448462.1|  hypothetical protein CICLE_v10015747mg             220   2e-62    
ref|XP_006469085.1|  PREDICTED: adenylate isopentenyltransferase-...    218   2e-62    
ref|XP_010511841.1|  PREDICTED: adenylate isopentenyltransferase ...    219   3e-62    
ref|XP_004300976.1|  PREDICTED: adenylate isopentenyltransferase-...    218   4e-62    
ref|XP_010511840.1|  PREDICTED: adenylate isopentenyltransferase ...    219   6e-62    
ref|XP_010313579.1|  PREDICTED: adenylate isopentenyltransferase ...    218   7e-62    
ref|NP_188547.1|  adenylate isopentenyltransferase 8                    217   9e-62    
ref|XP_003561619.1|  PREDICTED: adenylate isopentenyltransferase ...    219   9e-62    
ref|XP_008389284.1|  PREDICTED: adenylate isopentenyltransferase-...    218   9e-62    
dbj|BAE43826.1|  isopentenyltransferase                                 217   2e-61    
gb|EYU29989.1|  hypothetical protein MIMGU_mgv1a010491mg                216   2e-61    
ref|XP_011022236.1|  PREDICTED: adenylate isopentenyltransferase        217   2e-61    
ref|XP_004135400.1|  PREDICTED: adenylate isopentenyltransferase-...    215   2e-61    
ref|XP_006391138.1|  hypothetical protein EUTSA_v10019632mg             217   2e-61    
ref|XP_011078661.1|  PREDICTED: adenylate isopentenyltransferase ...    213   2e-61    
ref|XP_002311463.1|  hypothetical protein POPTR_0008s12060g             217   2e-61    
ref|XP_008243241.1|  PREDICTED: adenylate isopentenyltransferase-...    217   3e-61    
emb|CDY44896.1|  BnaA02g13860D                                          216   4e-61    
gb|KGN52088.1|  hypothetical protein Csa_5G609740                       216   4e-61    
ref|XP_009127634.1|  PREDICTED: adenylate isopentenyltransferase ...    216   4e-61    
emb|CDX81518.1|  BnaC02g18220D                                          216   5e-61    
dbj|BAE47444.1|  adenylate isopentenyltransferase                       215   5e-61    
gb|EAY90075.1|  hypothetical protein OsI_11645                          215   5e-61    
gb|ABF96060.1|  cytokinin synthase, putative                            215   5e-61    
gb|AAT77806.1|  putative cytokinin synthase 3                           210   6e-61    
gb|EMT23388.1|  tRNA Delta(2)-isopentenylpyrophosphate transferase      214   1e-60    
gb|KFK39236.1|  hypothetical protein AALP_AA3G218100                    213   1e-60    
gb|EAZ26974.1|  hypothetical protein OsJ_10901                          214   1e-60    
emb|CDY04228.1|  BnaC06g25870D                                          211   1e-59    
ref|XP_007227090.1|  hypothetical protein PRUPE_ppa025556mg             211   1e-59    
ref|XP_011078656.1|  PREDICTED: adenylate isopentenyltransferase ...    206   1e-59    
gb|AAL83819.1|  unknown                                                 211   3e-59    
ref|XP_010681483.1|  PREDICTED: adenylate isopentenyltransferase-...    212   3e-59    
ref|XP_010554960.1|  PREDICTED: adenylate isopentenyltransferase ...    211   1e-58    
ref|XP_011007793.1|  PREDICTED: adenylate isopentenyltransferase        210   1e-58    
ref|XP_010667107.1|  PREDICTED: adenylate isopentenyltransferase ...    207   2e-58    
gb|ABR24101.1|  isopentenyl transferase                                 205   2e-58    
ref|XP_010927008.1|  PREDICTED: adenylate isopentenyltransferase-...    209   2e-58    
ref|XP_004295673.1|  PREDICTED: adenylate isopentenyltransferase-...    206   5e-58    
gb|AIN44215.1|  IPT5                                                    204   9e-58    
ref|XP_010260619.1|  PREDICTED: tRNA dimethylallyltransferase 2 i...    208   1e-57    
ref|XP_011102043.1|  PREDICTED: adenylate isopentenyltransferase ...    202   1e-57    
ref|XP_009394636.1|  PREDICTED: adenylate isopentenyltransferase        206   2e-57    
ref|NP_001244913.1|  adenylate isopentenyltransferase                   205   2e-57    
ref|XP_011070792.1|  PREDICTED: adenylate isopentenyltransferase-...    205   2e-57    
emb|CDY22984.1|  BnaC03g40850D                                          204   2e-57    
ref|XP_007044313.1|  Cytokinin biosynthetic isopentenyltransferas...    207   2e-57    
ref|XP_006413406.1|  hypothetical protein EUTSA_v10026816mg             205   2e-57    
gb|KCW64725.1|  hypothetical protein EUGRSUZ_G02313                     204   2e-57    
ref|XP_009782638.1|  PREDICTED: adenylate isopentenyltransferase ...    199   3e-57    
emb|CDY07385.1|  BnaA07g24640D                                          204   4e-57    
ref|XP_006300023.1|  hypothetical protein CARUB_v10016248mg             206   4e-57    
ref|NP_173912.1|  adenylate isopentenyltransferase 6                    204   6e-57    
ref|XP_010325227.1|  PREDICTED: adenylate isopentenyltransferase ...    198   8e-57    
gb|KDO76979.1|  hypothetical protein CISIN_1g019312mg                   204   8e-57    
ref|XP_009105044.1|  PREDICTED: adenylate isopentenyltransferase ...    204   1e-56    
ref|XP_011076680.1|  PREDICTED: adenylate isopentenyltransferase        204   1e-56    
ref|XP_006344131.1|  PREDICTED: adenylate isopentenyltransferase-...    204   1e-56    
ref|XP_010051132.1|  PREDICTED: adenylate isopentenyltransferase-...    201   6e-56    
ref|XP_006285561.1|  hypothetical protein CARUB_v10007003mg             201   7e-56    
ref|XP_008797668.1|  PREDICTED: adenylate isopentenyltransferase-...    202   7e-56    
gb|KCW81312.1|  hypothetical protein EUGRSUZ_C02687                     201   8e-56    
ref|XP_010066714.1|  PREDICTED: adenylate isopentenyltransferase        202   8e-56    
ref|NP_194196.1|  adenylate isopentenyltransferase 4                    199   3e-55    
ref|XP_009603978.1|  PREDICTED: adenylate isopentenyltransferase-...    201   4e-55    
ref|XP_006305994.1|  hypothetical protein CARUB_v10011273mg             200   4e-55    
ref|XP_006415869.1|  hypothetical protein EUTSA_v10009876mg             199   4e-55    
ref|XP_009762170.1|  PREDICTED: adenylate isopentenyltransferase ...    199   5e-55    
ref|XP_009762171.1|  PREDICTED: adenylate isopentenyltransferase ...    199   6e-55    
ref|XP_009135619.1|  PREDICTED: adenylate isopentenyltransferase ...    198   8e-55    
emb|CDX82308.1|  BnaA03g35130D                                          197   2e-54    
ref|XP_010051129.1|  PREDICTED: adenylate isopentenyltransferase-...    196   6e-54    
gb|EYU40761.1|  hypothetical protein MIMGU_mgv1a017953mg                195   6e-54    
ref|XP_008803560.1|  PREDICTED: adenylate isopentenyltransferase-...    196   1e-53    
ref|XP_008445640.1|  PREDICTED: adenylate isopentenyltransferase-...    195   2e-53    
emb|CDY18104.1|  BnaA01g23650D                                          194   2e-53    
gb|AFV15392.1|  isopentenyl transferase 1 protein                       195   2e-53    
ref|NP_001244914.1|  adenylate isopentenyltransferase                   194   3e-53    
ref|XP_004174133.1|  PREDICTED: adenylate isopentenyltransferase-...    193   7e-53    
ref|XP_010051139.1|  PREDICTED: uncharacterized protein LOC104439822    200   8e-53    
ref|XP_004150914.1|  PREDICTED: adenylate isopentenyltransferase-...    192   1e-52    
gb|KCW81314.1|  hypothetical protein EUGRSUZ_C02690                     191   2e-52    
gb|KCW81303.1|  hypothetical protein EUGRSUZ_C02671                     191   2e-52    
ref|XP_006360459.1|  PREDICTED: adenylate isopentenyltransferase ...    192   3e-52    
ref|XP_002869707.1|  ATIPT4                                             191   3e-52    
ref|XP_008807489.1|  PREDICTED: tRNA dimethylallyltransferase 2 i...    192   9e-52    
ref|XP_010051135.1|  PREDICTED: adenylate isopentenyltransferase-...    189   2e-51    
ref|XP_009630791.1|  PREDICTED: adenylate isopentenyltransferase-...    189   3e-51    
ref|XP_009630789.1|  PREDICTED: adenylate isopentenyltransferase-...    189   3e-51    
ref|XP_010051134.1|  PREDICTED: adenylate isopentenyltransferase-...    187   1e-50    
ref|XP_010477931.1|  PREDICTED: adenylate isopentenyltransferase ...    189   1e-50    
ref|XP_009769551.1|  PREDICTED: adenylate isopentenyltransferase-...    187   3e-50    
ref|XP_009406689.1|  PREDICTED: adenylate isopentenyltransferase-...    188   3e-50    
gb|EPS71073.1|  hypothetical protein M569_03686                         186   4e-50    
gb|KCW81313.1|  hypothetical protein EUGRSUZ_C02688                     184   5e-50    
ref|XP_004972102.1|  PREDICTED: adenylate isopentenyltransferase-...    185   1e-49    
ref|XP_004961311.1|  PREDICTED: adenylate isopentenyltransferase ...    186   1e-49    
ref|XP_010551259.1|  PREDICTED: LOW QUALITY PROTEIN: adenylate is...    185   1e-49    
ref|NP_001056250.2|  Os05g0551700                                       185   2e-49    
gb|AAT85187.1|  unknown protein                                         185   2e-49    
ref|XP_011101069.1|  PREDICTED: adenylate isopentenyltransferase ...    179   3e-49    
gb|AEV76969.1|  isopentenyltransferase 8                                183   3e-49    
ref|XP_010051140.1|  PREDICTED: uncharacterized protein LOC104439824    189   5e-49    
ref|XP_009413572.1|  PREDICTED: adenylate isopentenyltransferase-...    184   6e-49    
ref|XP_009418842.1|  PREDICTED: adenylate isopentenyltransferase-...    181   1e-48    
ref|XP_002456169.1|  hypothetical protein SORBIDRAFT_03g031570          182   3e-48    
ref|XP_002440201.1|  hypothetical protein SORBIDRAFT_09g027683          180   5e-48    
gb|KCW81302.1|  hypothetical protein EUGRSUZ_C02668                     179   7e-48    
gb|EEE66793.1|  hypothetical protein OsJ_23538                          178   1e-47    
gb|EPS73689.1|  adenylate isopentenyltransferase                        177   4e-47    
gb|EAZ26988.1|  hypothetical protein OsJ_10914                          177   6e-47    
ref|XP_008675172.1|  PREDICTED: adenylate isopentenyltransferase-...    178   1e-46    
ref|XP_011102140.1|  PREDICTED: adenylate isopentenyltransferase ...    172   1e-46    
tpg|DAA58061.1|  TPA: hypothetical protein ZEAMMB73_324127              177   1e-46    
ref|XP_008649973.1|  PREDICTED: adenylate isopentenyltransferase-...    175   1e-45    
ref|XP_010907505.1|  PREDICTED: adenylate isopentenyltransferase ...    173   1e-45    
gb|EEC81655.1|  hypothetical protein OsI_25198                          172   2e-45    
ref|XP_003565950.1|  PREDICTED: adenylate isopentenyltransferase-...    173   2e-45    
ref|XP_010312950.1|  PREDICTED: adenylate isopentenyltransferase ...    166   8e-45    
gb|EEC81657.1|  hypothetical protein OsI_25201                          170   9e-45    
gb|EEE64610.1|  hypothetical protein OsJ_19462                          172   5e-44    
dbj|BAE47449.1|  adenylate isopentenyltransferase                       168   7e-44    
gb|AFW83607.1|  hypothetical protein ZEAMMB73_928267                    169   9e-44    
ref|XP_011078657.1|  PREDICTED: adenylate isopentenyltransferase ...    163   1e-43    
ref|XP_008656764.1|  PREDICTED: adenylate isopentenyltransferase-...    169   1e-43    
ref|XP_009396727.1|  PREDICTED: adenylate isopentenyltransferase-...    168   2e-43    
ref|XP_010313568.1|  PREDICTED: uncharacterized protein LOC101244836    175   2e-43    
ref|XP_009782639.1|  PREDICTED: adenylate isopentenyltransferase ...    167   2e-43    
gb|AAY29691.1|  putative cytokinin synthase 2                           162   4e-43    
ref|XP_009396609.1|  PREDICTED: adenylate isopentenyltransferase-...    167   7e-43    
ref|XP_011101725.1|  PREDICTED: adenylate isopentenyltransferase ...    162   3e-42    
ref|XP_002315938.1|  hypothetical protein POPTR_0010s13370g             162   3e-42    
ref|XP_011102018.1|  PREDICTED: adenylate isopentenyltransferase ...    156   1e-41    
ref|XP_006365909.1|  PREDICTED: adenylate isopentenyltransferase ...    156   2e-41    
ref|XP_011092009.1|  PREDICTED: adenylate isopentenyltransferase ...    160   9e-41    
ref|XP_011101776.1|  PREDICTED: adenylate isopentenyltransferase ...    153   2e-40    
ref|XP_011102054.1|  PREDICTED: adenylate isopentenyltransferase ...    152   2e-40    
ref|XP_010460385.1|  PREDICTED: adenylate isopentenyltransferase ...    158   7e-40    
ref|XP_004980438.1|  PREDICTED: adenylate isopentenyltransferase-...    156   8e-40    
gb|AEV76967.1|  isopentenyltransferase 3                                154   1e-39    
ref|XP_011102045.1|  PREDICTED: adenylate isopentenyltransferase ...    152   4e-39    
dbj|BAE47451.1|  adenylate isopentenyltransferase                       154   1e-38    
ref|XP_011101062.1|  PREDICTED: adenylate isopentenyltransferase ...    151   1e-38    
dbj|BAD82547.1|  cytokinin synthase-like                                154   2e-38    
dbj|BAN84023.1|  isopentenyltransferase 8                               154   2e-38    
ref|XP_004954904.1|  PREDICTED: adenylate isopentenyltransferase-...    155   3e-38    
gb|KDO71288.1|  hypothetical protein CISIN_1g045245mg                   151   3e-38    
gb|KEH26140.1|  IPP transferase                                         158   1e-37    
ref|XP_010232162.1|  PREDICTED: adenylate isopentenyltransferase-...    150   3e-37    
dbj|BAK64272.1|  isopentenyltransferase                                 144   4e-37    
gb|EMT17399.1|  tRNA Delta(2)-isopentenylpyrophosphate transferase      146   6e-36    
ref|XP_010260621.1|  PREDICTED: tRNA dimethylallyltransferase 2 i...    146   9e-36    
dbj|BAM93483.1|  isopentenyltransferase                                 140   1e-35    
gb|EAY75421.1|  hypothetical protein OsI_03324                          145   2e-35    
ref|XP_004169602.1|  PREDICTED: tRNA dimethylallyltransferase 2-like    140   3e-35    
ref|XP_010038904.1|  PREDICTED: adenylate isopentenyltransferase-...    139   3e-34    
ref|XP_011101775.1|  PREDICTED: adenylate isopentenyltransferase ...    136   3e-34    
ref|XP_010260622.1|  PREDICTED: tRNA dimethylallyltransferase 2 i...    138   6e-34    
ref|XP_008461837.1|  PREDICTED: tRNA dimethylallyltransferase 2 i...    138   6e-34    
ref|NP_001244916.1|  isopentenyltransferase                             137   1e-33    
ref|XP_011088852.1|  PREDICTED: tRNA dimethylallyltransferase 2 i...    142   1e-33    
ref|XP_011088853.1|  PREDICTED: tRNA dimethylallyltransferase 2 i...    142   1e-33    
ref|XP_007208508.1|  hypothetical protein PRUPE_ppa026650mg             137   1e-33    
gb|ADD60672.1|  putative adenylate isopentyneyl transferase protein     137   2e-33    
ref|XP_011101777.1|  PREDICTED: adenylate isopentenyltransferase ...    134   3e-33    
ref|XP_010031467.1|  PREDICTED: tRNA dimethylallyltransferase 2-l...    141   3e-33    
ref|XP_010260620.1|  PREDICTED: tRNA dimethylallyltransferase 2 i...    138   1e-32    
gb|EYU24467.1|  hypothetical protein MIMGU_mgv1a025771mg                139   1e-32    
ref|XP_004139473.1|  PREDICTED: tRNA dimethylallyltransferase 2-like    139   1e-32    
ref|XP_010260618.1|  PREDICTED: tRNA dimethylallyltransferase 2 i...    138   4e-32    
emb|CAN76279.1|  hypothetical protein VITISV_013227                     135   5e-32    
ref|XP_009793638.1|  PREDICTED: tRNA dimethylallyltransferase 2 i...    137   5e-32    
gb|KDO38188.1|  hypothetical protein CISIN_1g048453mg                   132   5e-32    
ref|XP_009793637.1|  PREDICTED: tRNA dimethylallyltransferase 2 i...    137   5e-32    
ref|XP_008461831.1|  PREDICTED: tRNA dimethylallyltransferase 2 i...    137   6e-32    
ref|XP_009598004.1|  PREDICTED: tRNA dimethylallyltransferase 2 i...    137   7e-32    



>dbj|BAG55007.1| adenylate isopentenyltransferase [Ipomoea nil]
Length=319

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/313 (99%), Positives = 312/313 (99%), Gaps = 0/313 (0%)
 Frame = +2

Query  131   MMSCCFCKQTQPMVSFPSGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNS  310
             MMSCCFCKQTQPMVSFPSGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNS
Sbjct  1     MMSCCFCKQTQPMVSFPSGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNS  60

Query  311   DKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRL  490
             DKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRL
Sbjct  61    DKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRL  120

Query  491   PIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAR  670
             PIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAR
Sbjct  121   PIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAR  180

Query  671   EFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQL  850
             EFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQ VLQTGIDNIKANTCKLASCQL
Sbjct  181   EFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQGVLQTGIDNIKANTCKLASCQL  240

Query  851   QNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGTT  1030
             QNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGTT
Sbjct  241   QNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGTT  300

Query  1031  TTFLAPPTSPNSV  1069
             TTFLAPPTSPNSV
Sbjct  301   TTFLAPPTSPNSV  313



>emb|CDO98989.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   410 bits (1055),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 207/313 (66%), Positives = 244/313 (78%), Gaps = 10/313 (3%)
 Frame = +2

Query  134   MSCCFCKQTQPMVSFPSGLNISS--RWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVV  304
             +S   CK+  P+VSFP GLN+     WR KDKVV VMGATGTGKSRL+IDLATRF AE+V
Sbjct  3     ISLSACKEVPPLVSFPGGLNMDPFIPWRRKDKVVIVMGATGTGKSRLSIDLATRFPAEIV  62

Query  305   NSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKD  484
             NSDKMQVYKGLDI TNKV EEEC G+PHHLLG VDPN DFTA DF   A  AV++I RK 
Sbjct  63    NSDKMQVYKGLDIATNKVTEEECLGIPHHLLGFVDPNEDFTAHDFQNHASLAVESIIRKG  122

Query  485   RLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEE  664
             RLPIIAGGSNSYIKALV D  EF+SKY+CCFLW+D  + +L+ FV+ RV+KMVE GL++E
Sbjct  123   RLPIIAGGSNSYIKALVNDDLEFQSKYDCCFLWVDASVSILHSFVTKRVDKMVEAGLVDE  182

Query  665   AREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASC  844
              REFF+P GDY+RGI+RAIGVPEMDQ+FR  +  DE   +++L+ GID IK+NTCKLA C
Sbjct  183   VREFFNPKGDYSRGIRRAIGVPEMDQFFRNEKQVDEETGRKLLEEGIDKIKSNTCKLACC  242

Query  845   QLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQG  1024
             QL+NILRLQ QL GWN+ H LDATEAF KR   GAE+ EAWERLVA P TMIV  F+ + 
Sbjct  243   QLRNILRLQEQL-GWNM-HHLDATEAFLKR---GAESDEAWERLVARPGTMIVGQFLEED  297

Query  1025  TTTTFLA--PPTS  1057
                + L+  PP+S
Sbjct  298   EFVSTLSTTPPSS  310



>ref|XP_009804222.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Nicotiana sylvestris]
Length=334

 Score =   390 bits (1002),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 198/295 (67%), Positives = 226/295 (77%), Gaps = 12/295 (4%)
 Frame = +2

Query  149   CKQT--QPMVSFPSGLNISS---RWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSD  313
             CKQ   QP+++F  GL I     R RKDKVV VMGATGTGKSRL+IDLA  F AEVVNSD
Sbjct  11    CKQVHHQPLINFREGLTIDPFMPRRRKDKVVIVMGATGTGKSRLSIDLANHFQAEVVNSD  70

Query  314   KMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLP  493
             KMQVYKGLDIVTNKV EEE  G+ HHLLG+ DPN +FT+ DF   A  AV +ITRK  LP
Sbjct  71    KMQVYKGLDIVTNKVTEEETCGIQHHLLGIADPNENFTSTDFVHHASMAVGSITRKGHLP  130

Query  494   IIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEARE  673
             IIAGGSNSYIKALV D  EF+S+YECCFLWIDV++ VL  FVS+RV+KMV EGL+EE RE
Sbjct  131   IIAGGSNSYIKALVNDDIEFKSRYECCFLWIDVDLAVLRRFVSERVDKMVNEGLVEEVRE  190

Query  674   FFDPAGDYTRGIKRAIGVPEMDQYFRILEAS--DERMRQEVLQTGIDNIKANTCKLASCQ  847
             FF+P GDYT GI+RAIGVPE+DQYFR       DE  R  +LQ  I+ IKANTCKLA+CQ
Sbjct  191   FFNPEGDYTNGIRRAIGVPELDQYFRNENNKLIDEDARNRILQVAIEKIKANTCKLATCQ  250

Query  848   LQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDF  1012
              QNILRL+SQL GWNI  RLDATEAF+K+GG G   ++AW RLV+ PST  V  F
Sbjct  251   RQNILRLESQL-GWNI-SRLDATEAFEKKGGEG---HQAWHRLVSVPSTRFVRHF  300



>ref|XP_009618569.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=328

 Score =   378 bits (970),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 195/302 (65%), Positives = 225/302 (75%), Gaps = 13/302 (4%)
 Frame = +2

Query  131   MMSCCFCKQT---QPMVSFPSGLNISS---RWRKDKVVFVMGATGTGKSRLAIDLATRFV  292
             + S   CKQ    +P+++F  GL I     R RKDKVV VMGATGTGKS+L+IDLA  F 
Sbjct  5     IASYVSCKQVIHHEPLINFREGLTIDPFMPRRRKDKVVIVMGATGTGKSKLSIDLANHFQ  64

Query  293   AEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAI  472
             AEVVNSDKMQVY GLDIVTNKV EEE  G+ HHLLG+ DPN +FTA DF   A  AV  I
Sbjct  65    AEVVNSDKMQVYNGLDIVTNKVTEEETCGIQHHLLGIADPNENFTATDFVHHASMAVGLI  124

Query  473   TRKDRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEG  652
             TRK  LPIIAGGSNSYIKALV D  EF+S+YECCFLWIDV++ VL  FVS+RV+KMV EG
Sbjct  125   TRKGHLPIIAGGSNSYIKALVNDDIEFKSRYECCFLWIDVDLAVLRRFVSERVDKMVNEG  184

Query  653   LIEEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEAS--DERMRQEVLQTGIDNIKANT  826
             L+EE REFF+P GDYT GI+RAIGVPE+DQYFR       +E  R  +LQ  I+ IKANT
Sbjct  185   LVEEVREFFNPEGDYTNGIRRAIGVPELDQYFRNENNKLINEDARNRILQVAIEKIKANT  244

Query  827   CKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVH  1006
             CKLA+ Q QNILRL+SQL GWNI  RLDATEAF+K+   G+EA +AW RLV+ PST  V 
Sbjct  245   CKLATSQRQNILRLESQL-GWNI-SRLDATEAFEKK---GSEARQAWHRLVSEPSTRFVR  299

Query  1007  DF  1012
              F
Sbjct  300   HF  301



>ref|XP_011091051.1| PREDICTED: LOW QUALITY PROTEIN: adenylate isopentenyltransferase 
5, chloroplastic [Sesamum indicum]
Length=311

 Score =   371 bits (952),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 193/302 (64%), Positives = 222/302 (74%), Gaps = 21/302 (7%)
 Frame = +2

Query  134   MSCCFCKQTQPMVSFPSGLN------ISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVA  295
             +S   CKQTQP+V+FP GL       +    RKDKVVFV+GATGTGKSRL+IDLATRF A
Sbjct  3     ISFSACKQTQPLVNFPGGLINMDQLILPRHRRKDKVVFVIGATGTGKSRLSIDLATRFDA  62

Query  296   EVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAIT  475
             EV+NSDKMQVYKGL+I T           PHHLLG++DP+ DF A DF   A  A DAIT
Sbjct  63    EVINSDKMQVYKGLNIAT----------XPHHLLGIIDPDADFWAHDFVYHASVAADAIT  112

Query  476   RKDRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGL  655
              + RLPIIAGGSNS IKALV D  EFRS+Y+CCFLW+DV MPVL+ FVS RV++MV  GL
Sbjct  113   NRGRLPIIAGGSNSCIKALVNDDIEFRSRYDCCFLWVDVSMPVLHSFVSKRVDQMVGAGL  172

Query  656   IEEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKL  835
             +EE+REFF P GDYTRGI+RAIGVPEMD++FR     DE  R  +LQ  ID IK+N CKL
Sbjct  173   VEESREFFKPDGDYTRGIRRAIGVPEMDEFFRHERLVDEATRTRLLQAAIDQIKSNNCKL  232

Query  836   ASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             A  QLQNILRL  QLE W + HRLDATEAF KR   G +A EAWERLVA PST IV  F+
Sbjct  233   ACRQLQNILRLVEQLE-WRM-HRLDATEAFLKR---GEDANEAWERLVAGPSTRIVGRFL  287

Query  1016  CQ  1021
             C+
Sbjct  288   CE  289



>gb|KDO74822.1| hypothetical protein CISIN_1g020362mg [Citrus sinensis]
Length=327

 Score =   366 bits (940),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 187/312 (60%), Positives = 231/312 (74%), Gaps = 9/312 (3%)
 Frame = +2

Query  134   MSCCFCKQ-TQPMVSFPSGLNISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVVN  307
             +S   CKQ  QP+V+F     +   +R KDKVVFVMGATGTGKSRLAIDLATRF AE++N
Sbjct  3     LSMTACKQAVQPLVTFQGVHKLEHFFRRKDKVVFVMGATGTGKSRLAIDLATRFPAEIIN  62

Query  308   SDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDR  487
             SDKMQVYKGLDIVTNKV EEEC GVPHHLLG+++PN +FTA DF   A  A+++I  +DR
Sbjct  63    SDKMQVYKGLDIVTNKVTEEECHGVPHHLLGIIEPNANFTATDFRNHASLAIESILSRDR  122

Query  488   LPIIAGGSNSYIKALVK-DHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEE  664
             LPIIAGGS+SYIKALV  D AEF+ +YEC FLW+DV +PVL+ FVS+RV++MVE GL+EE
Sbjct  123   LPIIAGGSSSYIKALVNGDAAEFQLRYECFFLWVDVSLPVLHSFVSERVDRMVELGLVEE  182

Query  665   AREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASC  844
              ++ FDP  DY+RGI+RAIGVPE+DQY R     D ++R ++L+  I+ IK NTC L+  
Sbjct  183   VKQMFDPQADYSRGIRRAIGVPELDQYIRAGSLLDHKIRAKLLEAAINKIKENTCNLSCR  242

Query  845   QLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQG  1024
             QLQ I RL + +  WNI HR+DATE F KR   G EA EAWE+LV  PSTM V  F+   
Sbjct  243   QLQKIHRL-NDVWNWNI-HRIDATEVFLKR---GEEADEAWEKLVMLPSTMTVRQFLYDE  297

Query  1025  TTTTFLAPPTSP  1060
                T + P T+P
Sbjct  298   DRVTTM-PETAP  308



>ref|NP_001266270.1| adenylate isopentenyltransferase 5, chloroplastic-like [Solanum 
lycopersicum]
 gb|ADZ28498.1| isopentenyltransferase 2 [Solanum lycopersicum]
Length=329

 Score =   366 bits (940),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 188/294 (64%), Positives = 229/294 (78%), Gaps = 13/294 (4%)
 Frame = +2

Query  149   CKQTQPMVSFPSGLNISSRW---RKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKM  319
             CK  Q +++F   L I       RKDKVV VMGATGTGKSRL+IDLA +F AEVVNSDKM
Sbjct  14    CKH-QLLINFRDSLTIDPFIPPRRKDKVVIVMGATGTGKSRLSIDLAKQFSAEVVNSDKM  72

Query  320   QVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPII  499
             Q+Y+GLDIVTNKV ++E  G+PHHLL ++DPN  FTA DFC++A +AVD+I  K +LPII
Sbjct  73    QIYEGLDIVTNKVTDKETCGIPHHLLSIIDPNEVFTATDFCQRASKAVDSIISKGQLPII  132

Query  500   AGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFF  679
             AGGSNSYIKALV D  EF+S+YECCFLWIDV + +L +FVS+RV+KMV+EGL++EAREFF
Sbjct  133   AGGSNSYIKALVNDDIEFKSRYECCFLWIDVNLKILQKFVSERVDKMVKEGLVDEAREFF  192

Query  680   DPAGDYTRGIKRAIGVPEMDQYFRILEAS---DERMRQEVLQTGIDNIKANTCKLASCQL  850
             +P GDYT GI+RAIGVPEM QYF I E +   +E  R ++LQ  I+NIK NTCKLA CQ 
Sbjct  193   NPDGDYTSGIRRAIGVPEMHQYF-INENNKMINENTRDKMLQIAIENIKVNTCKLACCQR  251

Query  851   QNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDF  1012
             QNILRL+SQLE W I +RLDATEAF+K+ G   EA++AW R+V   ST IV  F
Sbjct  252   QNILRLESQLE-WKI-NRLDATEAFEKKDG---EAHQAWNRIVYERSTQIVRHF  300



>ref|XP_007034593.1| Isopentenyltransferase 5, putative [Theobroma cacao]
 gb|EOY05519.1| Isopentenyltransferase 5, putative [Theobroma cacao]
Length=326

 Score =   366 bits (939),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 186/308 (60%), Positives = 227/308 (74%), Gaps = 7/308 (2%)
 Frame = +2

Query  131   MMSCCFCKQTQPMVSFPSGLNISSRW-RKDKVVFVMGATGTGKSRLAIDLATRF-VAEVV  304
             ++S   CKQ  P+ +F  GLN+ S + RKDKVVFVMGATGTGKSRLAIDLAT F  AE+V
Sbjct  3     VLSLPACKQVPPLGNFRGGLNVESFFSRKDKVVFVMGATGTGKSRLAIDLATCFDPAEIV  62

Query  305   NSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKD  484
             NSDKMQVYKGLDIVTNKV EEEC+GVPHHLLG+VDPN +FT+ DF   A  AV +I  K 
Sbjct  63    NSDKMQVYKGLDIVTNKVTEEECRGVPHHLLGIVDPNSNFTSMDFRHHASVAVKSIVSKG  122

Query  485   RLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEE  664
              LPIIAGGSNSYI+ALV    EF+ +YECCFLW+DV +PVL+ FV++RV++MV+ G+++E
Sbjct  123   SLPIIAGGSNSYIEALVNHDPEFQLRYECCFLWVDVSLPVLHSFVAERVDRMVQAGMVDE  182

Query  665   AREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASC  844
              ++ FDP  DY+RGI+RAIGVPEMDQYFR     D ++R  +L+T I  IK NTC LA  
Sbjct  183   VKQMFDPKADYSRGIRRAIGVPEMDQYFRAESILDAKIRARLLETAISKIKENTCMLACR  242

Query  845   QLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQG  1024
             QL+ I RL +Q + W + HR+DATE F KR   G EA EAW RLVA PSTMIV  F+   
Sbjct  243   QLEKIDRLYNQWK-WRM-HRIDATEVFLKR---GEEADEAWHRLVAGPSTMIVDQFLYDD  297

Query  1025  TTTTFLAP  1048
                  + P
Sbjct  298   NRVASIIP  305



>ref|XP_010278446.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic 
[Nelumbo nucifera]
Length=329

 Score =   365 bits (936),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 188/303 (62%), Positives = 223/303 (74%), Gaps = 14/303 (5%)
 Frame = +2

Query  125   RIMMSCCFCKQTQPMVSFPSG----LNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFV  292
             RI MS   CKQ  P ++FP G     + + R  KDKVVFVMGATGTGKS+L+IDLATRF 
Sbjct  2     RIFMSMA-CKQALPFLNFPGGGMGMESFTVRRPKDKVVFVMGATGTGKSKLSIDLATRFP  60

Query  293   AEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAI  472
             AE+VNSDKMQVY+GLDIVTNKV EEE +G+PHHLLGVVDP+ DFTA DFCR A  A+++I
Sbjct  61    AEIVNSDKMQVYEGLDIVTNKVTEEEQRGIPHHLLGVVDPDADFTALDFCRSASHAIESI  120

Query  473   TRKDRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEG  652
               +DRLPII GGSNSYI ALV D  EFRS+YECCFLW+DV +PVL+  VS RV++MVE G
Sbjct  121   VSRDRLPIIVGGSNSYIHALVNDDLEFRSRYECCFLWVDVCLPVLHSSVSKRVDRMVEAG  180

Query  653   LIEEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEAS---DERMRQEVLQTGIDNIKAN  823
             L++E R FF+P  DY+RGI+RAIGVPEMD++ R  EAS   DE +   +L+  I+ IK N
Sbjct  181   LVDEVRRFFEPEADYSRGIRRAIGVPEMDRFLR-XEASALKDEEILAILLEEAIEEIKVN  239

Query  824   TCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIV  1003
             TC LA CQLQ I RL+  L G   +H LDATE F K    G EA E WE+LVA P T IV
Sbjct  240   TCTLARCQLQKIYRLKELLRGK--MHCLDATEVFLKH---GKEAEETWEKLVAGPGTNIV  294

Query  1004  HDF  1012
               F
Sbjct  295   RHF  297



>ref|XP_002314413.1| hypothetical protein POPTR_0010s03150g [Populus trichocarpa]
 gb|EEF00584.1| hypothetical protein POPTR_0010s03150g [Populus trichocarpa]
Length=327

 Score =   363 bits (933),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 185/311 (59%), Positives = 223/311 (72%), Gaps = 8/311 (3%)
 Frame = +2

Query  134   MSCCFCKQTQPMVSFPSGLNISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNS  310
             +S    KQ QP  +F  GLN+   +R KDKVVFV+G TGTGKSRLAIDLATRF AEVVN 
Sbjct  5     LSLTAYKQVQPRGNFQGGLNMKPFFRRKDKVVFVVGPTGTGKSRLAIDLATRFPAEVVNC  64

Query  311   DKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRL  490
             DKMQVYKGLDIVTNKV EEEC+GVPHHLLG+ DPN +FT+ DF   A   V++I  +DRL
Sbjct  65    DKMQVYKGLDIVTNKVTEEECRGVPHHLLGIADPNANFTSDDFRHHASLVVESIVTRDRL  124

Query  491   PIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAR  670
             PIIAGGSNSYI+AL  D  EFR +YECCFLW+DV +P+LY FVS+RV++MVE GLI+E R
Sbjct  125   PIIAGGSNSYIEALANDDPEFRLRYECCFLWVDVSLPILYSFVSERVDRMVEAGLIDEVR  184

Query  671   EFFDPA--GDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASC  844
             + FDP    DY++GIKRAIGVPE+D + R     D + R+++L   ID IK NTC LAS 
Sbjct  185   DMFDPNKFDDYSQGIKRAIGVPELDHFLRNEAIVDAKTRRKLLDEAIDKIKENTCMLASR  244

Query  845   QLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQG  1024
             QLQ I RL S +  WN VHR+DAT  F     SG E    W++LVA PSTMIV+ F+C  
Sbjct  245   QLQKIHRLHS-IWNWN-VHRIDATPVFLT---SGKEVDNLWDKLVAGPSTMIVNQFLCDK  299

Query  1025  TTTTFLAPPTS  1057
                + + P  S
Sbjct  300   NYASPIIPSES  310



>ref|XP_002312745.1| hypothetical protein POPTR_0008s20650g [Populus trichocarpa]
 gb|EEE90112.1| hypothetical protein POPTR_0008s20650g [Populus trichocarpa]
Length=327

 Score =   362 bits (928),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 183/315 (58%), Positives = 225/315 (71%), Gaps = 8/315 (3%)
 Frame = +2

Query  134   MSCCFCKQTQPMVSFPSGLNISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNS  310
             +S    KQ QP V+F  GLN+   +R KDKVVFV+G TGTGKSRLAIDLAT F AEVVN 
Sbjct  5     LSLSAYKQVQPRVNFQGGLNMKPFFRRKDKVVFVLGPTGTGKSRLAIDLATHFPAEVVNC  64

Query  311   DKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRL  490
             DKMQVYKGLDIVTNKV EEEC+GVPHHLLG+ DPN DFT+ DF   A   V++I  +DRL
Sbjct  65    DKMQVYKGLDIVTNKVTEEECRGVPHHLLGIADPNADFTSDDFRHHASLVVESIVTRDRL  124

Query  491   PIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAR  670
             PIIAGGSNSY++AL  D  EFR +YECCFLW+DV +P+L+ FVSDRV++MV  GLI+E R
Sbjct  125   PIIAGGSNSYVEALANDDPEFRLRYECCFLWVDVSLPLLHSFVSDRVDRMVRAGLIDEVR  184

Query  671   EFFDPA--GDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASC  844
             + FDP    DY++GIKRAIGVPE+DQ+ R     D + R+++L   I+ IK NTC LA  
Sbjct  185   DVFDPTKFDDYSQGIKRAIGVPELDQFLRNETIVDAKTRRKLLDEAIEKIKENTCMLARR  244

Query  845   QLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQG  1024
             QLQ I RL S +  W + HR+DAT  F     SG EA   W+++VA PSTMIV+ F+C+ 
Sbjct  245   QLQKIRRLHS-IWNWKM-HRIDATPVFL---ASGKEADNLWDQIVAGPSTMIVNQFLCEE  299

Query  1025  TTTTFLAPPTSPNSV  1069
                + + P  S N V
Sbjct  300   NHVSPIVPSESINMV  314



>ref|XP_011009688.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Populus euphratica]
 ref|XP_011009689.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Populus euphratica]
Length=327

 Score =   361 bits (927),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 183/311 (59%), Positives = 223/311 (72%), Gaps = 8/311 (3%)
 Frame = +2

Query  134   MSCCFCKQTQPMVSFPSGLNISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNS  310
             +S    KQ QP V+F  GLN+   +R KDKVVFV+G TGTGKSRLAIDLATRF AEVVN 
Sbjct  5     LSLTAYKQVQPRVNFQGGLNMKPFFRRKDKVVFVVGPTGTGKSRLAIDLATRFPAEVVNC  64

Query  311   DKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRL  490
             DKMQVYKGLDIVTNKV E+EC+GVPHHLLG+ DP  +FT+ DF   A   V++I  +DRL
Sbjct  65    DKMQVYKGLDIVTNKVTEKECRGVPHHLLGIADPKANFTSDDFRHHASFVVESIVTRDRL  124

Query  491   PIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAR  670
             PIIAGGSNSYI+AL  D  EFR +YECCFLW+DV +P+LY FVS+RV++MVE GLI+E R
Sbjct  125   PIIAGGSNSYIEALANDDPEFRVRYECCFLWVDVSLPILYSFVSERVDRMVEAGLIDEVR  184

Query  671   EFFDPA--GDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASC  844
             + FDP    DY++GIKRAIGVPE+D + R     D + R+++L   ID IK NTC LAS 
Sbjct  185   DMFDPNKFDDYSQGIKRAIGVPELDHFLRNEAIVDAKTRRKLLDEAIDKIKENTCMLASR  244

Query  845   QLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQG  1024
             QLQ I RL S +  WN+ HR+DAT  F     SG E    W++LVA PSTMIV+ F+C  
Sbjct  245   QLQKIHRLHS-IWNWNM-HRIDATPVFLT---SGKEVDNLWDKLVAGPSTMIVNQFLCDK  299

Query  1025  TTTTFLAPPTS  1057
                + + P  S
Sbjct  300   NYVSPIIPSES  310



>ref|XP_006419806.1| hypothetical protein CICLE_v10005414mg [Citrus clementina]
 ref|XP_006489293.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Citrus sinensis]
 gb|ESR33046.1| hypothetical protein CICLE_v10005414mg [Citrus clementina]
Length=327

 Score =   361 bits (927),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 183/312 (59%), Positives = 229/312 (73%), Gaps = 9/312 (3%)
 Frame = +2

Query  134   MSCCFCKQ-TQPMVSFPSGLNISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVVN  307
             +S   CKQ  QP+V+F     +   +R KDKVVFVMGATGTGKSRLAIDLATRF AE++N
Sbjct  3     LSMTACKQAVQPLVTFQGVHKLEHFFRRKDKVVFVMGATGTGKSRLAIDLATRFPAEIIN  62

Query  308   SDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDR  487
             SDKMQVYKGLDIVTNKV EEEC GVPHHLLG+++PN +FTA DF   A  A+++I  +DR
Sbjct  63    SDKMQVYKGLDIVTNKVTEEECHGVPHHLLGIIEPNANFTATDFRNHASLAIESILSRDR  122

Query  488   LPIIAGGSNSYIKALVK-DHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEE  664
             LPIIAGGS+SYIKALV  D AEF+ +YEC FLW+DV +PVL+ FVS+RV++MVE GL+EE
Sbjct  123   LPIIAGGSSSYIKALVNGDAAEFQLRYECFFLWVDVSLPVLHSFVSERVDRMVELGLVEE  182

Query  665   AREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASC  844
              ++ FDP  DY+RG++RAIGVPE+DQY R     D ++  ++L+  I+ IK NTC L+  
Sbjct  183   VKQMFDPQADYSRGVRRAIGVPELDQYIRAGSLLDHKIHAKLLEAAINKIKENTCNLSCR  242

Query  845   QLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQG  1024
             QLQ I RL + +  WN+ HR+DATE F KR   G EA EAWE+LV  PSTM V  F+   
Sbjct  243   QLQKIHRL-NDIWNWNM-HRIDATEVFLKR---GEEADEAWEKLVMLPSTMTVRQFLYDE  297

Query  1025  TTTTFLAPPTSP  1060
                  + P T+P
Sbjct  298   DRVATM-PETAP  308



>emb|CAN64738.1| hypothetical protein VITISV_007444 [Vitis vinifera]
Length=382

 Score =   362 bits (930),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 181/302 (60%), Positives = 224/302 (74%), Gaps = 8/302 (3%)
 Frame = +2

Query  119   STRIMMSCCFCKQTQPMVSFPSGLNI---SSRWRKDKVVFVMGATGTGKSRLAIDLATRF  289
             S R+  S    KQ Q  +   SGLN+   + R RK+KVVFV+GATGTGKS+L+IDLATRF
Sbjct  51    SVRVAASSAIFKQAQTPLLDISGLNMELFNPRRRKEKVVFVIGATGTGKSKLSIDLATRF  110

Query  290   VAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDA  469
              +E++NSDKMQVYKGL IVTNKV EEEC+GVPHHLLG+ DPN +FTA DFC  A  A+ +
Sbjct  111   PSEIINSDKMQVYKGLHIVTNKVTEEECRGVPHHLLGIADPNTNFTAMDFCHHASLAIQS  170

Query  470   ITRKDRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEE  649
             IT ++R PIIAGGSNS+I+ALV D  EF+S+YECCFLW+DV +PVL+ FVS+RV++M+E 
Sbjct  171   ITARNRHPIIAGGSNSFIEALVTDVPEFKSRYECCFLWVDVSLPVLHRFVSERVDRMLEA  230

Query  650   GLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTC  829
             GL+EE R  FDP  DY+RGI+RAIGVPEMDQ+ R      +++  + L+  I  IK NTC
Sbjct  231   GLVEEVRRIFDPEADYSRGIRRAIGVPEMDQFLRGERIVGDKIAAQYLRKAIAKIKENTC  290

Query  830   KLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHD  1009
             KLA  QL  I RLQ+ + GW I HRLDATEAF KRG    +A EAWE+ VA PS  IV  
Sbjct  291   KLACSQLDKIHRLQN-IRGWKI-HRLDATEAFLKRGD---DAEEAWEKHVAGPSMDIVGC  345

Query  1010  FI  1015
             F+
Sbjct  346   FL  347



>ref|XP_010693920.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=328

 Score =   360 bits (924),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 175/310 (56%), Positives = 227/310 (73%), Gaps = 9/310 (3%)
 Frame = +2

Query  134   MSCCFCKQTQPMVSFPSGLNISS----RWRKDKVVFVMGATGTGKSRLAIDLATRFVAEV  301
             +S   CKQ QP++SFP GLN +S       KDKVV VMGATGTGKSRL+IDLAT F AE+
Sbjct  3     LSYPLCKQVQPLISFPGGLNTNSLNFHSSYKDKVVVVMGATGTGKSRLSIDLATHFPAEI  62

Query  302   VNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRK  481
             +NSDK+QVYKGLDIVTNKV EEEC+GV HHLLG++DP+VD+ AA F   AL A+++I  +
Sbjct  63    INSDKIQVYKGLDIVTNKVTEEECRGVTHHLLGIIDPDVDYNAAHFRHDALSAIESIIEQ  122

Query  482   DRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIE  661
             D+LPIIAGGSNS+I++LV D   F S+Y+CCFLW+DV + +L  FVS RV++MV+ GLI+
Sbjct  123   DKLPIIAGGSNSFIESLVNDDPYFASRYDCCFLWVDVNLHILRSFVSKRVDQMVKAGLID  182

Query  662   EAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLAS  841
             E R  FDP  +YT GI+RAIGVPE+D++ R     D+     +LQ  ID +K NTCKLAS
Sbjct  183   EVRGIFDPEANYTHGIRRAIGVPEIDRFLRAEGIVDKETLDTLLQIAIDEVKENTCKLAS  242

Query  842   CQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQ  1021
              QLQ I RL+    GWN+ H ++ATEAF K+   G +A+EAW+RLV  PS MIV  F+ +
Sbjct  243   RQLQKIHRLR-DFWGWNL-HHINATEAFLKQ---GEDAHEAWDRLVVGPSAMIVAQFLYR  297

Query  1022  GTTTTFLAPP  1051
              ++   ++ P
Sbjct  298   SSSVQSISQP  307



>emb|CBI26180.3| unnamed protein product [Vitis vinifera]
Length=329

 Score =   360 bits (923),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 179/292 (61%), Positives = 221/292 (76%), Gaps = 8/292 (3%)
 Frame = +2

Query  149   CKQTQPMVSFPSGLNI---SSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKM  319
             CKQ Q  +   SGLN+   + R RK+KVVFV+GATGTGKS+L+IDLATRF +E++NSDKM
Sbjct  8     CKQAQTPLLDISGLNMELFNPRRRKEKVVFVIGATGTGKSKLSIDLATRFPSEIINSDKM  67

Query  320   QVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPII  499
             QVYKGL IVTNKV EEEC+GVPHHLLG+ DPN +FTA DFC  A  A+ +IT ++R PII
Sbjct  68    QVYKGLHIVTNKVTEEECRGVPHHLLGIADPNTNFTAMDFCHHASLAIQSITARNRHPII  127

Query  500   AGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFF  679
             AGGSNS+I+ALV D  EF+S+YECCFLW+DV +PVL+ FVS+RV++M+E GL+EE R  F
Sbjct  128   AGGSNSFIEALVTDVPEFKSRYECCFLWVDVSLPVLHRFVSERVDRMLEAGLVEEVRRIF  187

Query  680   DPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNI  859
             DP  DY+RGI+RAIGVPEMDQ+ R      +++  + L+  I  IK NTCKLA  QL  I
Sbjct  188   DPEADYSRGIRRAIGVPEMDQFLRGERIVGDKIAAQYLRKAIAKIKENTCKLACSQLDKI  247

Query  860   LRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
              RLQ+ + GW I HRLDATEAF KRG    +A EAWE+ VA PS  IV  F+
Sbjct  248   HRLQN-IRGWKI-HRLDATEAFLKRGD---DAEEAWEKHVAGPSMDIVGCFL  294



>ref|XP_011012333.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Populus euphratica]
Length=327

 Score =   360 bits (923),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 183/315 (58%), Positives = 224/315 (71%), Gaps = 8/315 (3%)
 Frame = +2

Query  134   MSCCFCKQTQPMVSFPSGLNISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNS  310
             +S    KQ QP V+F  GLN+   +R KDKVVFV+G TGTGKSRLAIDLATRF AEVVN 
Sbjct  5     LSLSAYKQVQPRVNFQGGLNMKPFFRRKDKVVFVVGPTGTGKSRLAIDLATRFPAEVVNC  64

Query  311   DKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRL  490
             DKMQVYKGLDIVTNK  EEEC+GVPHHLLG+ DPN DFT+ DF   A   V++I  +DRL
Sbjct  65    DKMQVYKGLDIVTNKATEEECRGVPHHLLGIADPNADFTSDDFRHHASLVVESIVTRDRL  124

Query  491   PIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAR  670
             PIIAGGSNSY++AL  D  EFR +YECCFLW+DV +P+L+ FVSDRV++MV  GLI+E R
Sbjct  125   PIIAGGSNSYVEALANDDPEFRLRYECCFLWVDVSLPLLHSFVSDRVDRMVRAGLIDEVR  184

Query  671   EFFDPA--GDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASC  844
             + FDP    DY++GIKRAIGVPE+DQ+ R     D + R ++L   I+ IK NTC LA  
Sbjct  185   DVFDPTKFDDYSQGIKRAIGVPELDQFLRNETIMDAKTRGKLLDEAIEKIKENTCILACR  244

Query  845   QLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQG  1024
             QLQ I RL S +  W + HR+DAT  F     SG EA   W+++VA PSTMIV+ F+C+ 
Sbjct  245   QLQKIRRLHS-IWNWKM-HRIDATPVFL---ASGKEADNLWDQIVAGPSTMIVNQFLCEE  299

Query  1025  TTTTFLAPPTSPNSV  1069
                + + P  S N V
Sbjct  300   NRVSPIVPSESINMV  314



>ref|XP_002277591.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic 
[Vitis vinifera]
Length=330

 Score =   360 bits (923),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 179/292 (61%), Positives = 221/292 (76%), Gaps = 8/292 (3%)
 Frame = +2

Query  149   CKQTQPMVSFPSGLNI---SSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKM  319
             CKQ Q  +   SGLN+   + R RK+KVVFV+GATGTGKS+L+IDLATRF +E++NSDKM
Sbjct  9     CKQAQTPLLDISGLNMELFNPRRRKEKVVFVIGATGTGKSKLSIDLATRFPSEIINSDKM  68

Query  320   QVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPII  499
             QVYKGL IVTNKV EEEC+GVPHHLLG+ DPN +FTA DFC  A  A+ +IT ++R PII
Sbjct  69    QVYKGLHIVTNKVTEEECRGVPHHLLGIADPNTNFTAMDFCHHASLAIQSITARNRHPII  128

Query  500   AGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFF  679
             AGGSNS+I+ALV D  EF+S+YECCFLW+DV +PVL+ FVS+RV++M+E GL+EE R  F
Sbjct  129   AGGSNSFIEALVTDVPEFKSRYECCFLWVDVSLPVLHRFVSERVDRMLEAGLVEEVRRIF  188

Query  680   DPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNI  859
             DP  DY+RGI+RAIGVPEMDQ+ R      +++  + L+  I  IK NTCKLA  QL  I
Sbjct  189   DPEADYSRGIRRAIGVPEMDQFLRGERIVGDKIAAQYLRKAIAKIKENTCKLACSQLDKI  248

Query  860   LRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
              RLQ+ + GW I HRLDATEAF KRG    +A EAWE+ VA PS  IV  F+
Sbjct  249   HRLQN-IRGWKI-HRLDATEAFLKRGD---DAEEAWEKHVAGPSMDIVGCFL  295



>ref|XP_011071664.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Sesamum indicum]
Length=327

 Score =   357 bits (915),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 183/298 (61%), Positives = 222/298 (74%), Gaps = 7/298 (2%)
 Frame = +2

Query  134   MSCCFCKQTQPMVSFPSGLNISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNS  310
             MS    K  Q  ++  SG  + ++ + KDKVV V+GATGTGKSRLAIDLATRF AEV+NS
Sbjct  1     MSISAWKPAQSSMTNFSGRGMMNKHQGKDKVVVVLGATGTGKSRLAIDLATRFGAEVINS  60

Query  311   DKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRL  490
             DK+QVYKGLDIVTNKV  EEC+GVPHHLLG++DP VDFT  DF   AL A DAI +K+RL
Sbjct  61    DKIQVYKGLDIVTNKVSNEECRGVPHHLLGIIDPEVDFTVHDFVHHALLAADAIVQKNRL  120

Query  491   PIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAR  670
             PIIAGGSNS++ ALV D  EF SKYECCFLW+DV +PVL+  VS RV++MV+ GL+EE +
Sbjct  121   PIIAGGSNSFVLALVNDDTEFSSKYECCFLWMDVAIPVLHSHVSKRVDQMVDSGLVEEGK  180

Query  671   EFFDPA-GDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQ  847
              FFDP   DY  GI+RAIGVPEMD++FR     D   R ++L+  ID IK NTCKLA  Q
Sbjct  181   AFFDPKIRDYDYGIRRAIGVPEMDEFFRSEGLVDGETRAKLLKAAIDEIKMNTCKLACRQ  240

Query  848   LQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQ  1021
             ++ ILR++ +L GW I HRL+ATE F +RGG   +A EAWERLV  PST IV  FIC+
Sbjct  241   VEKILRMREEL-GWQI-HRLNATEVFLRRGG---DADEAWERLVLDPSTNIVARFICK  293



>ref|XP_002517150.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF45313.1| ATP binding protein, putative [Ricinus communis]
Length=314

 Score =   355 bits (912),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 180/289 (62%), Positives = 219/289 (76%), Gaps = 7/289 (2%)
 Frame = +2

Query  155   QTQPMVSFPSGLNISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYK  331
             Q QP+V+F   LN+   +R KDK+VFV+G TGTGKSRLAID+ATR  AEVVN DKMQVYK
Sbjct  2     QIQPLVNFQRALNMEPFFRRKDKLVFVVGPTGTGKSRLAIDIATRIPAEVVNCDKMQVYK  61

Query  332   GLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGS  511
             GLDIVTNKV EEEC+GVPHHLLGVV+P+ DFT+ DF   A  A+D I  +DRLPIIAGGS
Sbjct  62    GLDIVTNKVTEEECRGVPHHLLGVVEPDDDFTSDDFRLHASNALDLIRARDRLPIIAGGS  121

Query  512   NSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAG  691
             NS+I+AL  D  +FR +YECCFLW+DV +PVLY FVS+RV++MV+ GLI+E R  FDP  
Sbjct  122   NSFIEALANDDPQFRLRYECCFLWVDVSLPVLYSFVSERVDRMVKAGLIDEVRNIFDPIN  181

Query  692   -DYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRL  868
              +Y+RGIKRAIGVPE+DQ+FR  +  D + R ++L T I  IK NTC LA  QLQ I RL
Sbjct  182   TNYSRGIKRAIGVPELDQFFRYEDIVDAKTRGKLLDTSIAKIKENTCTLACRQLQKIHRL  241

Query  869   QSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
              ++   WN+ HR+DATE F +   +G EA EAWE+LVA PS MIV  FI
Sbjct  242   HNRW-SWNM-HRIDATEVFIR---NGEEAEEAWEKLVAGPSAMIVEQFI  285



>ref|XP_006339408.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Solanum tuberosum]
Length=330

 Score =   355 bits (911),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 181/291 (62%), Positives = 220/291 (76%), Gaps = 11/291 (4%)
 Frame = +2

Query  149   CKQTQPMVSFPSGLNISSRW---RKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKM  319
             CK  QP+ +F  GL I       RKDKVV VMGATGTGKSRL+IDLA  F AEVVNSDKM
Sbjct  15    CKH-QPLNNFRDGLTIDPFIPPRRKDKVVIVMGATGTGKSRLSIDLAKHFSAEVVNSDKM  73

Query  320   QVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPII  499
             Q+Y+GLDI+TNKV ++E  G+ HHLL ++DPN  FTA DFC++A +AVD+I  K +LPII
Sbjct  74    QIYEGLDIITNKVTDKETCGIQHHLLSIIDPNEVFTATDFCQRATKAVDSIISKGQLPII  133

Query  500   AGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFF  679
             AGGSNSYIKALV D  EF+S+YECCFLWIDV + +L  FVS RV+KMV+EGL+EEAREFF
Sbjct  134   AGGSNSYIKALVNDDIEFKSRYECCFLWIDVNLKILQRFVSKRVDKMVKEGLVEEAREFF  193

Query  680   DPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNI  859
             +P GDYT GI+RAIGVPEM QYF  +  +++  R ++LQ  I+NIK NT KLA CQ QNI
Sbjct  194   NPDGDYTSGIRRAIGVPEMHQYF--INENNKNTRDKMLQIAIENIKVNTYKLACCQRQNI  251

Query  860   LRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDF  1012
              RL+SQ E W I +RLDATEAF+K+   G E+ +AW  +V   ST IV  F
Sbjct  252   RRLESQFE-WKI-NRLDATEAFEKK---GIESNQAWHNIVYEQSTQIVRHF  297



>ref|XP_010551776.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Tarenaya hassleriana]
Length=330

 Score =   352 bits (904),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 179/295 (61%), Positives = 225/295 (76%), Gaps = 13/295 (4%)
 Frame = +2

Query  152   KQTQPMVSF--PSGL---NISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDK  316
             KQ QP++SF  P+G+   ++    RKD+VVFVMGATGTGKSRLAIDLATRF AE+VNSDK
Sbjct  9     KQIQPLLSFQGPAGITMVDVPFFRRKDRVVFVMGATGTGKSRLAIDLATRFPAEIVNSDK  68

Query  317   MQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPI  496
             +QVYKGLD+VTNKV  EE +GVPHHLLG VDP+ DFTAADF R+A +AV +I  +DR+PI
Sbjct  69    IQVYKGLDVVTNKVTPEESRGVPHHLLGTVDPDADFTAADFAREATRAVQSIVERDRVPI  128

Query  497   IAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREF  676
             IAGGSNSYI ALV D  +FR +Y+CCFLW+DV  PVL+ FVS+RV+KMVE GL++E R  
Sbjct  129   IAGGSNSYIDALVNDCVDFRLRYQCCFLWVDVSRPVLHSFVSERVDKMVEIGLVDEVRRI  188

Query  677   FDPAGDYTRGIKRAIGVPEMDQYF--RILEASDERMRQEVLQTGIDNIKANTCKLASCQL  850
             FDP+ DY+ GI+RAIGVPE+D++    + E++DE  R  +L+T I  IK NTC LA  Q+
Sbjct  189   FDPSADYSVGIRRAIGVPELDEFLLSELQESTDEN-RARLLETAIGKIKENTCSLACRQV  247

Query  851   QNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             Q I RL  Q + WN+ HR+DATE   +R   G EA EAWE +VA PS++IV  F+
Sbjct  248   QKIQRLYKQWK-WNM-HRIDATEVVLRR---GEEADEAWETIVARPSSLIVEQFL  297



>ref|XP_009356755.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic 
[Pyrus x bretschneideri]
Length=310

 Score =   351 bits (900),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 174/287 (61%), Positives = 218/287 (76%), Gaps = 9/287 (3%)
 Frame = +2

Query  194   ISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEEC  373
              + R +K+KVV VMGATGTGKSRL+IDLAT F AE++NSDKMQVY+GLDIVTNK+ +EE 
Sbjct  14    FNPRRQKEKVVIVMGATGTGKSRLSIDLATCFPAEIINSDKMQVYEGLDIVTNKITKEEQ  73

Query  374   QGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDH-AE  550
             +GVPHHLLG++DPN DFTA DFC     A++++  +DRLPII GGSNSYI+ALV DH  +
Sbjct  74    RGVPHHLLGILDPNEDFTARDFCDLTSLAIESVLGRDRLPIIVGGSNSYIEALVDDHDYK  133

Query  551   FRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVP  730
             FRSKYECCFLW+DV +PV++ FVS RV++MV+ G+++EAREFFDP  DY +GI+RAIGVP
Sbjct  134   FRSKYECCFLWVDVSVPVMHSFVSGRVDRMVQNGMVDEAREFFDPNADYMKGIRRAIGVP  193

Query  731   EMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLD  910
             E D+YFR     DE  R  +LQ  +D IK NTCKLA  QL+ I RL++ ++GWN+ H LD
Sbjct  194   EFDKYFRYGPLLDEETRARLLQQAVDEIKDNTCKLACRQLEKIHRLRN-IKGWNL-HPLD  251

Query  911   ATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGTTTTFLAPP  1051
             ATE F+KR   G EA EAWE+LV+ P  MIV  F+   T      PP
Sbjct  252   ATEVFRKR---GKEADEAWEKLVSGPGAMIVGQFLYNMTAEV---PP  292



>ref|XP_009365803.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic 
[Pyrus x bretschneideri]
Length=336

 Score =   351 bits (901),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 190/309 (61%), Positives = 229/309 (74%), Gaps = 20/309 (6%)
 Frame = +2

Query  125   RIMMSCCFCKQT-QPMVSF--PSGLNISSR---WRKDKVVFVMGATGTGKSRLAIDLATR  286
             RI+MS C  KQ  QPMVSF  P   NI+      RKDKVV VMGATGTGKSRLAIDLA  
Sbjct  2     RILMSAC--KQVVQPMVSFQGPGLTNINMDPFLRRKDKVVIVMGATGTGKSRLAIDLARH  59

Query  287   FV-AEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAV  463
                AE++NSDKMQVYKGLDIVTNKV E+EC+G+PHHL+G VDP+ DFTA DF   A  A+
Sbjct  60    NPPAEIINSDKMQVYKGLDIVTNKVTEDECKGIPHHLIGKVDPDSDFTANDFKHHASLAI  119

Query  464   DAITRKDRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMV  643
             ++I  +DRLPIIAGGSNSYI+ALV +H+EFR KYECCFLW+DV +PVL+ FVS+RV++MV
Sbjct  120   ESILERDRLPIIAGGSNSYIEALVDEHSEFRMKYECCFLWVDVAIPVLHSFVSERVDRMV  179

Query  644   EEGLIEEAREFFDPA--GDYTRGIKRAIGVPEMDQYFRILEAS---DERMRQEVLQTGID  808
             + GL+EE R  FD     +YTRGI+RAIGVPEMD+Y +  EAS   D+  ++ +LQ  I 
Sbjct  180   QMGLVEEVRRMFDSTTEKEYTRGIRRAIGVPEMDEYLQ-GEASGNNDDETQERLLQAAIS  238

Query  809   NIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAP  988
              IK NTC LA  QLQ I RLQ++  GWN+ HRLDATEAF K     AE  +AWE+LVA P
Sbjct  239   KIKENTCILAYRQLQKIRRLQAR-RGWNM-HRLDATEAFLKH---HAETNQAWEKLVARP  293

Query  989   STMIVHDFI  1015
             +T IV  F+
Sbjct  294   ATRIVRQFL  302



>ref|XP_008223011.1| PREDICTED: LOW QUALITY PROTEIN: adenylate isopentenyltransferase 
5, chloroplastic [Prunus mume]
Length=335

 Score =   351 bits (900),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 185/308 (60%), Positives = 225/308 (73%), Gaps = 17/308 (6%)
 Frame = +2

Query  149   CKQTQPMVSF--PSGL---NISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNS  310
             CKQ QPM+SF  P GL   N+   +R KDKVVFVMGATGTGKSRLAIDLAT + AE++NS
Sbjct  8     CKQVQPMLSFQGPPGLPSINMDPFFRRKDKVVFVMGATGTGKSRLAIDLATLYRAEIINS  67

Query  311   DKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRL  490
             DKMQVYKGLDIVTNKV EEEC+G+PHHLLG +DPN +FTA DF + A  A+++I  +DRL
Sbjct  68    DKMQVYKGLDIVTNKVTEEECRGIPHHLLGKIDPNFNFTANDFKQHASLAIESILERDRL  127

Query  491   PIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAR  670
             PIIAGGSNSYI+ALV DH EFR KYECCF+W+DV +PVL  FVS+RV++MV+ GL++E R
Sbjct  128   PIIAGGSNSYIEALVDDHPEFRMKYECCFIWVDVALPVLNSFVSERVDRMVKAGLVDEVR  187

Query  671   EFFDPA--GDYTRGIKRAIGVPEMDQYFRILEAS---DERMRQEVLQTGIDNIKANTCKL  835
               FD     +YT GI++AIG+PEMDQY R  EAS   DE  ++ +LQT I  IK NTC L
Sbjct  188   RMFDSTAEAEYTHGIRKAIGMPEMDQYLR-GEASGINDEETQERLLQTAISKIKENTCIL  246

Query  836   ASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             A  QLQ I RL S+   WN+ HRLDATE F K      EA +AWE+ VA P+  +V +F+
Sbjct  247   AHRQLQKIRRLCSR-RNWNM-HRLDATEVFLKH---RVEADQAWEKHVARPAKRMVGNFL  301

Query  1016  CQGTTTTF  1039
                  T  
Sbjct  302   VDPMPTIL  309



>ref|XP_002271962.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic 
[Vitis vinifera]
Length=327

 Score =   350 bits (899),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 183/309 (59%), Positives = 226/309 (73%), Gaps = 13/309 (4%)
 Frame = +2

Query  152   KQTQPMVSFPSG---LNISS-RWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKM  319
             KQTQP++S P G   +++S  RW K KVV VMGATGTGKSRL+IDLATRF AE+VNSDKM
Sbjct  9     KQTQPLLSIPPGDLTMDVSGHRWPKGKVVVVMGATGTGKSRLSIDLATRFPAEIVNSDKM  68

Query  320   QVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPII  499
             QVY+GLDIVTNK+ EEE +GVPHHLL +  PNVDFTA+DF   A  ++++I  + RLPI+
Sbjct  69    QVYEGLDIVTNKITEEEQRGVPHHLLRIAHPNVDFTASDFRDMASLSIESILGRGRLPIV  128

Query  500   AGGSNSYIKALVKD-HAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREF  676
              GGSNSYI+ALV D +++FRS+YECCFLW+DV   VL+ FVS RV+KMVE+G++EE ++ 
Sbjct  129   VGGSNSYIEALVGDEYSKFRSRYECCFLWVDVSRSVLHSFVSKRVDKMVEKGMVEEVQQL  188

Query  677   FDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQN  856
             F P  DYTRGI+RAIGVPE+D YFR     DE  R  VLQ  +  IKANTCKLA  QL+ 
Sbjct  189   FHPNADYTRGIRRAIGVPELDLYFRTEGFLDEEARARVLQEAVHEIKANTCKLACRQLEK  248

Query  857   ILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGTTTT  1036
             I RL++ +  W I HRL ATE  +K      EA EAWE+LVA PSTM+V  F+     T 
Sbjct  249   IHRLKN-VRKWKI-HRLGATEVLRK---CDREADEAWEKLVARPSTMMVAQFLYSVGATR  303

Query  1037  FLA---PPT  1054
              +A   PPT
Sbjct  304   SIATTSPPT  312



>ref|XP_009342172.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Pyrus x bretschneideri]
Length=336

 Score =   350 bits (899),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 189/309 (61%), Positives = 229/309 (74%), Gaps = 20/309 (6%)
 Frame = +2

Query  125   RIMMSCCFCKQT-QPMVSF--PSGLNISSR---WRKDKVVFVMGATGTGKSRLAIDLATR  286
             RI+MS C  KQ  QPMVSF  P   NI+      RKDKVV +MGATGTGKSRLAIDLA  
Sbjct  2     RILMSAC--KQVVQPMVSFQGPGLTNINMDPFLRRKDKVVIIMGATGTGKSRLAIDLARH  59

Query  287   FV-AEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAV  463
                AE++NSDKMQVYKGLDIVTNKV E+EC+G+PHHL+G VDP+ DFTA DF   A  A+
Sbjct  60    NPPAEIINSDKMQVYKGLDIVTNKVTEDECKGIPHHLIGKVDPDSDFTANDFKHHASLAI  119

Query  464   DAITRKDRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMV  643
             ++I  +DRLPIIAGGSNSYI+ALV +H+EFR KYECCFLW+DV +PVL+ FVS+RV++MV
Sbjct  120   ESILERDRLPIIAGGSNSYIEALVDEHSEFRMKYECCFLWVDVAIPVLHSFVSERVDRMV  179

Query  644   EEGLIEEAREFFDPA--GDYTRGIKRAIGVPEMDQYFRILEAS---DERMRQEVLQTGID  808
             + GL+EE R  FD     +YTRGI+RAIGVPEMD+Y +  EAS   D+  ++ +LQ  I 
Sbjct  180   KMGLVEEVRRMFDSTTEKEYTRGIRRAIGVPEMDEYLQ-GEASGNNDDETQERLLQAAIS  238

Query  809   NIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAP  988
              IK NTC LA  QLQ I RLQ++  GWN+ HRLDATEAF K     AE  +AWE+LVA P
Sbjct  239   KIKENTCILAYRQLQKIRRLQAR-RGWNM-HRLDATEAFLKH---HAETNQAWEKLVARP  293

Query  989   STMIVHDFI  1015
             +T IV  F+
Sbjct  294   ATRIVRQFL  302



>ref|NP_001281297.1| adenylate isopentenyltransferase 5, chloroplastic-like [Malus 
domestica]
 ref|XP_008390821.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Malus domestica]
 gb|ADN26573.1| isopentenyltransferase [Malus domestica]
 gb|ADY80559.1| adenylate isopentenyltransferase [Malus domestica]
Length=336

 Score =   350 bits (898),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 186/308 (60%), Positives = 228/308 (74%), Gaps = 18/308 (6%)
 Frame = +2

Query  125   RIMMSCCFCKQT-QPMVSF--PSGLNISSR---WRKDKVVFVMGATGTGKSRLAIDLATR  286
             RI+MS C  KQ  QPMVSF  P   NI+      RKDKVV VMGATGTGKSRLAIDLA  
Sbjct  2     RILMSAC--KQVVQPMVSFQGPGLTNINMDPFLRRKDKVVIVMGATGTGKSRLAIDLARH  59

Query  287   FV-AEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAV  463
                AE++NSDKMQVYKGLDIVTNKV E+EC+G+PHHL+G VDP+ DFTA DF   A  A+
Sbjct  60    NPPAEIINSDKMQVYKGLDIVTNKVTEDECKGIPHHLIGKVDPDSDFTANDFKHHASLAI  119

Query  464   DAITRKDRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMV  643
             ++I  +DRLPIIAGGSNSYI+ALV +H+EFR KYECCFLW+DV +PVL+ FVS+RV++MV
Sbjct  120   ESILERDRLPIIAGGSNSYIEALVDEHSEFRMKYECCFLWVDVAIPVLHSFVSERVDRMV  179

Query  644   EEGLIEEAREFFDPA--GDYTRGIKRAIGVPEMDQYFR--ILEASDERMRQEVLQTGIDN  811
             + GL+EE R  FD     +YTRG++RAIGVPEMD+Y +    + +D+  ++ +LQ  I  
Sbjct  180   KMGLVEEVRRMFDSTTEKEYTRGVRRAIGVPEMDEYLQGEASDNNDDETQERLLQAAISK  239

Query  812   IKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPS  991
             IK NTC LA  QLQ I RLQ++  GWN+ HRLDATEAF K     AE  +AWE+LVA P+
Sbjct  240   IKENTCILAYRQLQKIRRLQAR-RGWNM-HRLDATEAFLKH---HAETNQAWEKLVARPA  294

Query  992   TMIVHDFI  1015
             T IV  F+
Sbjct  295   TRIVRQFL  302



>ref|XP_010548779.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic 
[Tarenaya hassleriana]
Length=335

 Score =   348 bits (892),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 179/310 (58%), Positives = 228/310 (74%), Gaps = 15/310 (5%)
 Frame = +2

Query  128   IMMSCCFC--KQTQPMVSFP-----SGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATR  286
             +M+  C    K  QP++SF      + +++    RKDKVVF+MGATGTGKSRLA+DLA R
Sbjct  1     MMIKPCMSALKHIQPLLSFQGHTGITMIDVPFFRRKDKVVFIMGATGTGKSRLAVDLAAR  60

Query  287   FVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVD  466
             F AE+VNSDK+QVY+GL +VTNKV  EE +GVPHHLLG VDPN DFTAADF R+A +AV+
Sbjct  61    FPAEIVNSDKIQVYEGLGVVTNKVTPEESRGVPHHLLGTVDPNTDFTAADFAREATRAVE  120

Query  467   AITRKDRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVE  646
             +I  +DR+PIIAGGSNSYI+ALV   A+FR +Y+CCFLW+DV  PVL+ FVS+RV+KMVE
Sbjct  121   SIVERDRVPIIAGGSNSYIEALVNGCADFRLRYQCCFLWVDVSKPVLHSFVSERVDKMVE  180

Query  647   EGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYFR--ILEAS-DERMRQEVLQTGIDNIK  817
              GL++E    FDP+ DY+ GI+RAIGV E+D++ R    E+S DE  R  +LQT I+ IK
Sbjct  181   MGLVDEVHRIFDPSADYSVGIRRAIGVSELDEFLRSEFDESSGDEENRARLLQTAIETIK  240

Query  818   ANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTM  997
              NTC LA  QLQ I RL  Q + WN+ HR+DATE F +R   G +A EAWE +VA PS++
Sbjct  241   ENTCSLACRQLQKIQRLYKQWK-WNM-HRIDATEVFLRR---GEKADEAWETVVARPSSI  295

Query  998   IVHDFICQGT  1027
             IV  F+  GT
Sbjct  296   IVEQFLGYGT  305



>gb|KDP40100.1| hypothetical protein JCGZ_02098 [Jatropha curcas]
Length=334

 Score =   347 bits (891),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 174/301 (58%), Positives = 220/301 (73%), Gaps = 7/301 (2%)
 Frame = +2

Query  152   KQTQPMVSFPSGLNISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVY  328
             KQ QP+V+    +NI   +R KDKVVFV+G TGTGKSRLAIDLATR  AEV+N DKMQVY
Sbjct  11    KQIQPLVNLQRAINIEPFFRRKDKVVFVVGPTGTGKSRLAIDLATRIPAEVINCDKMQVY  70

Query  329   KGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGG  508
             KGLDIVTNKV EEEC+GVPHHL+G+VDPN +FT+ DF  QA  +V +I  +DRLPIIAGG
Sbjct  71    KGLDIVTNKVTEEECRGVPHHLIGIVDPNSNFTSDDFRHQASDSVKSIVARDRLPIIAGG  130

Query  509   SNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPA  688
             SNS+I+ALV D  EFR +YECCFLW+DV +PVL+ FVS+RV++MV+ GL+ E ++ FDP 
Sbjct  131   SNSFIEALVNDDHEFRLRYECCFLWVDVSLPVLHSFVSERVDRMVKAGLVNEVKKVFDPN  190

Query  689   G-DYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILR  865
               +Y++GI+RAIGVPE+DQYFR     D + R ++L   I+ IK N C L+  QLQ I R
Sbjct  191   NTNYSQGIRRAIGVPELDQYFRKEGIVDTKTRAKLLDLAIEKIKENNCILSCRQLQKIHR  250

Query  866   LQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGTTTTFLA  1045
             L ++   WN+ HR+DATE F K   +G EA E WE+ VA PSTMI+  F+        + 
Sbjct  251   LYNRW-SWNM-HRIDATEVFLK---NGKEAEEVWEKQVAGPSTMILEQFLYDEDHMATIV  305

Query  1046  P  1048
             P
Sbjct  306   P  306



>ref|XP_008340912.1| PREDICTED: LOW QUALITY PROTEIN: adenylate isopentenyltransferase 
5, chloroplastic [Malus domestica]
Length=332

 Score =   347 bits (890),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 188/331 (57%), Positives = 231/331 (70%), Gaps = 24/331 (7%)
 Frame = +2

Query  125   RIMMSCCFCKQT-QPMVSF--PSGLNISSR---WRKDKVVFVMGATGTGKSRLAIDLATR  286
             RI+MS C  KQ  QPMVSF  P+  NI+      RKDKVV VMGATGTGKSRLAIDLA  
Sbjct  2     RILMSAC--KQVVQPMVSFHGPALTNINMDPFFRRKDKVVIVMGATGTGKSRLAIDLAMH  59

Query  287   FVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVD  466
             + AE++NSDKMQVYKGLDIVTNKV EEEC+G+PHHL+G  DPN +FTA DF   A  A++
Sbjct  60    YPAEIINSDKMQVYKGLDIVTNKVTEEECKGIPHHLIGKFDPNSNFTANDFKNHASLAIE  119

Query  467   AITRKDRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVE  646
             +I  +DRLPIIAGGSNSYI+ALV  H+EFR KYECCFLW+DV +PVL+ FVS RV++MV+
Sbjct  120   SILERDRLPIIAGGSNSYIEALVDKHSEFRMKYECCFLWVDVAIPVLHSFVSKRVDRMVK  179

Query  647   EGLIEEAREFFDPA--GDYTRGIKRAIGVPEMDQYFRILEAS---DERMRQEVLQTGIDN  811
              GL++E R+ FD     +YT GI++AIGVPEM +Y    EAS   D+  ++ +LQ  I  
Sbjct  180   VGLVDEVRKMFDSTTEAEYTNGIRQAIGVPEMHEYLH-CEASGSNDDETQERLLQAAISK  238

Query  812   IKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPS  991
             IK NTC LA  QLQ I RLQ++  GWN+ HRLDATE F K  G   EA +AWE+ VA P+
Sbjct  239   IKENTCILAYRQLQKIRRLQAR-RGWNM-HRLDATEVFLKHQG---EADQAWEKFVATPA  293

Query  992   TMIVHDFICQGT-----TTTFLAPPTSPNSV  1069
             T +V  F+         T   + PP    S+
Sbjct  294   TRMVDKFLLBPIPSILPTEAIITPPILSTSM  324



>ref|NP_001288042.1| uncharacterized protein LOC103449027 [Malus domestica]
 gb|ADZ05814.1| adenylate isopentenyltransferase [Malus domestica]
Length=308

 Score =   345 bits (886),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 172/287 (60%), Positives = 215/287 (75%), Gaps = 9/287 (3%)
 Frame = +2

Query  194   ISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEEC  373
              + R +K+KVV VMGATGTGKSRL+IDLAT F AE++NSDKMQVY+GLDIVTNK+ +EE 
Sbjct  14    FNPRRQKEKVVIVMGATGTGKSRLSIDLATCFPAEIINSDKMQVYEGLDIVTNKITKEEQ  73

Query  374   QGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDH-AE  550
             +GVPHHLLG++DPN DFTA DFC     A++++  +DRLPII GGSNSYI+ALV DH  +
Sbjct  74    RGVPHHLLGILDPNEDFTARDFCDLTSLAIESVLGRDRLPIIVGGSNSYIEALVDDHDYK  133

Query  551   FRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVP  730
             FRSKYECCFLW+DV +PV++ FVS RV+ MV+ G+++EAREFFDP  DY +GI+RAIGVP
Sbjct  134   FRSKYECCFLWVDVSVPVMHSFVSGRVDHMVQNGMVDEAREFFDPNADYMKGIRRAIGVP  193

Query  731   EMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLD  910
             E D+YFR     DE  R  +LQ  +D IK NTCKLA  QL+ I  L++  +GWN+ H LD
Sbjct  194   EFDKYFRYGPLLDEETRARLLQQAVDKIKDNTCKLACRQLEKIHGLRNN-KGWNL-HPLD  251

Query  911   ATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGTTTTFLAPP  1051
             ATE F+KR   G +A EAWE+LV+ P  MIV  F+   T      PP
Sbjct  252   ATEVFRKR---GKDADEAWEKLVSGPGAMIVGQFLYNMTAEV---PP  292



>ref|XP_010103429.1| Adenylate isopentenyltransferase 5 [Morus notabilis]
 gb|EXB95832.1| Adenylate isopentenyltransferase 5 [Morus notabilis]
Length=348

 Score =   347 bits (890),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 183/327 (56%), Positives = 228/327 (70%), Gaps = 20/327 (6%)
 Frame = +2

Query  125   RIMMSCCFCKQTQPMVSFPSG-----LNISSRWR-KDKVVFVMGATGTGKSRLAIDLATR  286
             RI M    CKQ QP+VSF  G     LN+ + +R KDKVVFV+G TGTGKSRLAIDLATR
Sbjct  2     RIPMMSVACKQVQPLVSFQGGGFQAELNMEAFFRRKDKVVFVIGPTGTGKSRLAIDLATR  61

Query  287   FVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVD  466
             F +E++NSDKMQVYKGL+I TNKV +EEC+GVPHHLLG+ +P+ +F+AADFC  A  A+ 
Sbjct  62    FPSEIINSDKMQVYKGLEIATNKVTDEECRGVPHHLLGIAEPHSNFSAADFCLHASSAIK  121

Query  467   AITRKDRLPIIAGGSNSYIKALVK---------DHAEFRSKYECCFLWIDVEMPVLYEFV  619
             +I  + +LPIIAGGSNSYI AL+            ++FR +YECCFLW+DV +PVL  FV
Sbjct  122   SILDRGKLPIIAGGSNSYIDALLNDHDHDHDHDQRSQFRRQYECCFLWVDVSLPVLNAFV  181

Query  620   SDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYFRI-LEASDERMRQEVLQ  796
             S+RV++MV  GLI+E R  FDPA DY+RGI+RAIGVPE+D+ F      + ++ R  +LQ
Sbjct  182   SERVDRMVAAGLIDEVRRMFDPAADYSRGIRRAIGVPELDELFGAEARGASKKTRDRLLQ  241

Query  797   TGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERL  976
               I+ IK NTC LA  QLQ I RL  Q   WN VHRLDATEAF KR     +A EAWE+L
Sbjct  242   LAIEKIKVNTCLLARRQLQKIHRLHPQW-CWN-VHRLDATEAFLKR-HRHQDADEAWEKL  298

Query  977   VAAPSTMIVHDFICQGTTTTFLAPPTS  1057
             VA P+ MIV +F   G     + P T+
Sbjct  299   VAEPANMIVGEF-HYGEEIAAMVPSTT  324



>gb|AIN44214.1| IPT3 [Rosa hybrid cultivar]
Length=330

 Score =   345 bits (886),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 171/301 (57%), Positives = 222/301 (74%), Gaps = 17/301 (6%)
 Frame = +2

Query  146   FCKQTQPMVSFPSGLN----------ISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVA  295
              CKQTQ + + P  +           ++   +KDKVV VMGATGTGKS+L+IDLATRF A
Sbjct  6     MCKQTQTLPNVPLSIGGGHSHNLLDVLNVHRQKDKVVIVMGATGTGKSKLSIDLATRFPA  65

Query  296   EVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAIT  475
             E++NSDKMQ+Y+GLDI TNK+  +E +GVPHHLLGV+DPN DF+A DFC     AV++I 
Sbjct  66    EIINSDKMQLYEGLDIATNKISPQEQRGVPHHLLGVLDPNADFSADDFCGITCLAVESIL  125

Query  476   RKDRLPIIAGGSNSYIKALVKDHAE-FRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEG  652
              +DRLPII GGSNSYI+AL+  + + FRS+Y+CCFLW+DV +PVL  FVSDRV++MVE G
Sbjct  126   NRDRLPIIVGGSNSYIEALIDGYDKMFRSRYDCCFLWVDVSLPVLQSFVSDRVDQMVENG  185

Query  653   LIEEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCK  832
             ++EE REFFDP  DYT+GI+RAIGVPE D +FR   + DE  R  +L+  I+ +K NTCK
Sbjct  186   MVEEVREFFDPKADYTKGIRRAIGVPEFDDFFRYGPSLDEETRAWLLEQAINEVKDNTCK  245

Query  833   LASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDF  1012
             LA  QL+ I RL+++  GW++ H LDATE F+KR   G EA EAW+RLV+ PS +IV  F
Sbjct  246   LACRQLEKIRRLRNK--GWSL-HPLDATEVFRKR---GKEADEAWDRLVSGPSAVIVRQF  299

Query  1013  I  1015
             +
Sbjct  300   L  300



>ref|XP_007200740.1| hypothetical protein PRUPE_ppa023171mg [Prunus persica]
 gb|EMJ01939.1| hypothetical protein PRUPE_ppa023171mg [Prunus persica]
Length=322

 Score =   345 bits (885),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 171/302 (57%), Positives = 222/302 (74%), Gaps = 14/302 (5%)
 Frame = +2

Query  146   FCKQTQPMVSFPSG-----LNI-SSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVN  307
              CK+ Q ++  PSG     +++ + R +K+KVV VMGATGTGKSRL+IDLAT   AE++N
Sbjct  4     MCKEMQTLL--PSGGYNHKMDVFNPRRQKEKVVIVMGATGTGKSRLSIDLATHLAAEIIN  61

Query  308   SDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDR  487
             SDKMQVYKGLDI TNK+ EEE +GVPHHLLG++DPN DFTA DFC +    +++I  +DR
Sbjct  62    SDKMQVYKGLDIATNKITEEEQRGVPHHLLGILDPNEDFTATDFCDETSLTIESILGRDR  121

Query  488   LPIIAGGSNSYIKALVKDH-AEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEE  664
             LPII GGSNSYI+AL+ D+  +FRSKYECCFLW++V  PVL+ FVS RV+KMVE G+++E
Sbjct  122   LPIIVGGSNSYIEALIDDYDYKFRSKYECCFLWVNVSTPVLHSFVSKRVDKMVENGMVDE  181

Query  665   AREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASC  844
              REFF P  DY++GI+RAIGVPE D+YFR     DE  +  +L+  ++ IK N CKLAS 
Sbjct  182   VREFFHPNADYSKGIRRAIGVPEFDKYFRYGPFLDEETKARLLEQAVEEIKKNNCKLASR  241

Query  845   QLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQG  1024
             QL+ I RL++ ++GWN+ H LDATE F+KR   G E+ EAWE+ V  PS  IV  F+   
Sbjct  242   QLEKIQRLRN-VKGWNL-HPLDATEVFRKR---GKESDEAWEKFVYGPSAQIVRQFLYNY  296

Query  1025  TT  1030
              T
Sbjct  297   AT  298



>ref|XP_011102016.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Sesamum indicum]
Length=307

 Score =   344 bits (883),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 173/286 (60%), Positives = 214/286 (75%), Gaps = 6/286 (2%)
 Frame = +2

Query  167   MVSFPSGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIV  346
             M +F     ++    KDKVV V+GATGTGKSRLAIDLAT F AEV+NSDK+QVYKGLDIV
Sbjct  13    MTNFSVRGMMNKHQGKDKVVVVLGATGTGKSRLAIDLATCFGAEVINSDKIQVYKGLDIV  72

Query  347   TNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIK  526
             TNKV  EEC GVPHHLLG++DP VDFT  DF   AL A DAI +K+RLPIIAGGSNS+I+
Sbjct  73    TNKVSNEECHGVPHHLLGIIDPEVDFTVHDFVHHALLAADAIVQKNRLPIIAGGSNSFIQ  132

Query  527   ALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPA-GDYTR  703
             ALV D+ EF SKYECCFLW+DV +PVL+ +VS RV++MV+ GL+EE + FFDP   DY  
Sbjct  133   ALVTDNTEFSSKYECCFLWMDVAIPVLHSYVSKRVDQMVDSGLVEEGKAFFDPKIRDYDY  192

Query  704   GIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLE  883
             GI+RAIGVPEMD++FR     D   R ++L+  ID IK NTCKLA  Q++ ILR++ +  
Sbjct  193   GIRRAIGVPEMDEFFRSEGLVDGETRAKLLKAAIDEIKMNTCKLACRQVEKILRMREEF-  251

Query  884   GWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQ  1021
             GW I +RL+AT+ F + GG   EA +AWE+LV  PST +V  FIC+
Sbjct  252   GWEI-YRLNATQVFLRCGG---EANDAWEKLVLEPSTNMVARFICK  293



>ref|XP_008235248.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic 
[Prunus mume]
Length=322

 Score =   345 bits (884),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 170/297 (57%), Positives = 217/297 (73%), Gaps = 14/297 (5%)
 Frame = +2

Query  146   FCKQTQPMVSFPSGLN------ISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVN  307
              CK+ Q ++  PSG         + R +K+KVV VMGATGTGKSRL+IDLAT   AE++N
Sbjct  4     MCKEMQTLL--PSGAYSHKMDVFNPRRQKEKVVIVMGATGTGKSRLSIDLATHLAAEIIN  61

Query  308   SDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDR  487
             SDKMQVYKGLDI TNK+ EEE +GVPHHLLG+ DPN DFTA DFC +    +++I  +DR
Sbjct  62    SDKMQVYKGLDIATNKITEEEQRGVPHHLLGIHDPNADFTATDFCDETSLTIESILGRDR  121

Query  488   LPIIAGGSNSYIKALVKDH-AEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEE  664
             LPII GGSNSYI+AL+ D+  +FRSKYECCFLW++V  PVL+ FVS RV+KMVE G+++E
Sbjct  122   LPIIVGGSNSYIEALIDDYDYKFRSKYECCFLWVNVSTPVLHSFVSKRVDKMVENGMVDE  181

Query  665   AREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASC  844
              +EFF P  DY++GI+RAIGVPE D+YFR     DE  R  +L+  ++ IK N CKLAS 
Sbjct  182   VKEFFHPNADYSKGIRRAIGVPEFDKYFRYGPFLDEETRARLLEQAVEEIKKNNCKLASR  241

Query  845   QLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             QL+ I RL++ ++GWN+ H LDATE F+KR   G E+ EAWE+ V  PS  IV  F+
Sbjct  242   QLEKIQRLRN-VKGWNL-HPLDATEVFRKR---GKESDEAWEKFVYEPSAQIVRQFL  293



>gb|ADY80560.1| adenylate isopentenyltransferase [Malus domestica]
Length=334

 Score =   344 bits (883),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 187/325 (58%), Positives = 229/325 (70%), Gaps = 24/325 (7%)
 Frame = +2

Query  125   RIMMSCCFCKQT-QPMVSF--PSGLNISSR---WRKDKVVFVMGATGTGKSRLAIDLATR  286
             RI+MS C  KQ  QPMVSF  P+  NI+      RKDKVV VMGATGTGKSRLAIDLA  
Sbjct  2     RILMSAC--KQVVQPMVSFHGPALTNINMDPFFRRKDKVVIVMGATGTGKSRLAIDLAMH  59

Query  287   FVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVD  466
             + AE++NSDKMQVYKGLDIVTNKV EEEC+G+PHHL+G  DPN +FTA DF   A  A++
Sbjct  60    YPAEIINSDKMQVYKGLDIVTNKVTEEECKGIPHHLIGKFDPNSNFTANDFKNHASLAIE  119

Query  467   AITRKDRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVE  646
             +I  +DRLPIIAGGSNSYI+ALV  H+EFR KYECCFLW+DV +PVL+ FVS RV++MV+
Sbjct  120   SILERDRLPIIAGGSNSYIEALVDKHSEFRMKYECCFLWVDVAIPVLHSFVSKRVDRMVK  179

Query  647   EGLIEEAREFFDPA--GDYTRGIKRAIGVPEMDQYFRILEAS---DERMRQEVLQTGIDN  811
              GL++E R+ FD     +YT GI++AIGVPEM +Y    EAS   D+  ++ +LQ  I  
Sbjct  180   VGLVDEVRKMFDSTTEAEYTNGIRQAIGVPEMHEYLH-CEASGSNDDETQERLLQAAISK  238

Query  812   IKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPS  991
             IK NTC LA  QLQ I RLQ++  GWN+ HRLDATE F K  G   EA +AWE+ VA P+
Sbjct  239   IKENTCILAYRQLQKIRRLQAR-RGWNM-HRLDATEVFLKHQG---EADQAWEKFVATPA  293

Query  992   TMIVHDFICQGT-----TTTFLAPP  1051
             T +V  F+         T   + PP
Sbjct  294   TRMVDKFLLNPIPSILPTEAIITPP  318



>gb|ADT82707.1| adenylate isopentenyltransferase [Malus domestica]
Length=320

 Score =   343 bits (881),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 177/309 (57%), Positives = 224/309 (72%), Gaps = 15/309 (5%)
 Frame = +2

Query  146   FCKQTQPMVSFPS-GLN-----ISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVN  307
              CKQ Q +   PS G N      +   +K+KVV VMGATGTGKSRL+IDLAT F AE++N
Sbjct  4     MCKQIQTLQHVPSSGHNHKIDVFNPHRQKEKVVIVMGATGTGKSRLSIDLATCFPAEIIN  63

Query  308   SDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDR  487
             SDKMQVY+GLDIVTNK+ +EE +GVPHHLLG++DP+ DFTA DFC     A+++I  +DR
Sbjct  64    SDKMQVYEGLDIVTNKITKEEQRGVPHHLLGMLDPHEDFTARDFCDLTSIAIESILGRDR  123

Query  488   LPIIAGGSNSYIKALVKDH-AEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEE  664
             LPII GGSNSYI+AL+ D+  +FRSKY+CCFLW+DV  PVL+ FVS RV+ MV  G+++E
Sbjct  124   LPIIVGGSNSYIEALIDDYDYKFRSKYDCCFLWVDVSTPVLHSFVSKRVDHMVHNGMVDE  183

Query  665   AREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASC  844
             ARE+FDP  DYT+GI+RAIGVPE D+YFR     DE  R  +L+  +D IK NTCKLA  
Sbjct  184   AREYFDPNADYTKGIRRAIGVPEFDKYFRYGPFLDEETRTRLLRQAVDEIKDNTCKLACR  243

Query  845   QLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQG  1024
             QL+ I RL++ ++GWN+ H LDATE F+KR   G EA EAW++LV+  S MIV  F+   
Sbjct  244   QLEKIHRLRN-IKGWNL-HPLDATEVFRKR---GEEADEAWKKLVSGTSAMIVGQFLYNM  298

Query  1025  TTTTFLAPP  1051
             T      PP
Sbjct  299   TAE---VPP  304



>gb|ADY80558.1| adenylate isopentenyltransferase [Malus domestica]
Length=320

 Score =   343 bits (881),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 176/309 (57%), Positives = 226/309 (73%), Gaps = 15/309 (5%)
 Frame = +2

Query  146   FCKQTQPMVSFPS-GLN-----ISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVN  307
              CKQ Q ++  PS G N      +   +K+KVV VMGATGTGKSRL+IDLAT F AE++N
Sbjct  4     MCKQIQTLLHVPSSGHNHKMDVFNPHRQKEKVVIVMGATGTGKSRLSIDLATCFPAEIIN  63

Query  308   SDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDR  487
             SDKMQVY+GLDIVTNK+ +EE +GVPHHLLG++DP+ DFTA DFC     A+++I  +DR
Sbjct  64    SDKMQVYEGLDIVTNKITKEEQRGVPHHLLGMLDPHEDFTARDFCDLTSIAIESILGRDR  123

Query  488   LPIIAGGSNSYIKALVKDH-AEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEE  664
             LPII GGSNSYI+AL+ D+  +FRSKY+CCFLW+DV  PVL+ FVS RV+ MV+ G+++E
Sbjct  124   LPIIVGGSNSYIEALIDDYDYKFRSKYDCCFLWVDVSTPVLHSFVSKRVDHMVQNGMVDE  183

Query  665   AREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASC  844
             ARE+FDP  DYT+GI+RAIGVPE D+YFR     +E  R  +L+  +D IK NTCKLA  
Sbjct  184   AREYFDPNADYTKGIRRAIGVPEFDKYFRYGPFLEEETRARLLRQAVDEIKDNTCKLACR  243

Query  845   QLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQG  1024
             QL+ I RL++ ++GWN+ H LDATE F+KR   G EA EAW++LV+  S MIV  F+   
Sbjct  244   QLEKIHRLRN-IKGWNL-HPLDATEVFRKR---GEEADEAWKKLVSGTSAMIVGQFLYNM  298

Query  1025  TTTTFLAPP  1051
             T      PP
Sbjct  299   TAEV---PP  304



>ref|XP_007226947.1| hypothetical protein PRUPE_ppa025177mg [Prunus persica]
 gb|EMJ28146.1| hypothetical protein PRUPE_ppa025177mg [Prunus persica]
Length=338

 Score =   343 bits (881),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 183/315 (58%), Positives = 225/315 (71%), Gaps = 17/315 (5%)
 Frame = +2

Query  125   RIMMSCCFCKQTQPMVSF--PSGL---NISSRWR-KDKVVFVMGATGTGKSRLAIDLATR  286
             RI M  C  KQ QPMVSF  P GL   N+   +R KDKVVFVMGATGTGKSRLAIDLAT 
Sbjct  2     RIFMPAC--KQGQPMVSFQGPPGLPSINMDPFFRRKDKVVFVMGATGTGKSRLAIDLATF  59

Query  287   FVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVD  466
               AE++NSDKMQVYKGLDIVTNKV EEEC+G+PHHLLG +DPN +FTA DF + A  A++
Sbjct  60    HRAEIINSDKMQVYKGLDIVTNKVTEEECRGIPHHLLGQIDPNFNFTANDFKQHASLAIE  119

Query  467   AITRKDRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVE  646
             +I  +DRLPIIAGGSNSYI+ALV DH EFR KYECCF+W+DV +PVL  FVS+RV++MV+
Sbjct  120   SILERDRLPIIAGGSNSYIEALVDDHPEFRMKYECCFIWVDVALPVLNSFVSERVDRMVK  179

Query  647   EGLIEEAREFFDPA--GDYTRGIKRAIGVPEMDQYFR--ILEASDERMRQEVLQTGIDNI  814
              GL++E R  FD     +YT GI++AIG+PE+D+Y R      +DE  ++ +LQT I  I
Sbjct  180   AGLVDEVRRMFDSTAEAEYTHGIRKAIGMPELDEYLRSEACGINDEETQERLLQTAISKI  239

Query  815   KANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPST  994
             K NTC LA  QL+ I RL S+   WN+ HRLDATE F K      EA +AWE+ VA P+ 
Sbjct  240   KENTCILAHRQLKKIRRLCSR-RNWNM-HRLDATEVFLKH---RVEADQAWEKHVARPAK  294

Query  995   MIVHDFICQGTTTTF  1039
              +V +F+     T  
Sbjct  295   RMVGNFLVDPMPTIL  309



>ref|XP_011102015.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Sesamum indicum]
Length=286

 Score =   342 bits (876),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 171/271 (63%), Positives = 207/271 (76%), Gaps = 6/271 (2%)
 Frame = +2

Query  212   KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHH  391
             KDKVV V+GATGTGKSRLAIDLATRF AEV+NSDK+QVYKGLDIVTNKV  EEC GVPHH
Sbjct  7     KDKVVVVLGATGTGKSRLAIDLATRFGAEVINSDKIQVYKGLDIVTNKVSNEECHGVPHH  66

Query  392   LLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHAEFRSKYEC  571
             LLG++DP VDFT  DF   AL A DAI +K+RLPIIAGGSNS+I+ALV D+ EF SKYEC
Sbjct  67    LLGIIDPEVDFTVHDFGHHALLAADAIVQKNRLPIIAGGSNSFIQALVTDYTEFSSKYEC  126

Query  572   CFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPA-GDYTRGIKRAIGVPEMDQYF  748
             CFLW+DV +PVL+ +VS RV++MV+ GL+EE + FFDP   DY  GI+RAIGVPEMD++F
Sbjct  127   CFLWMDVAIPVLHSYVSKRVDQMVDSGLVEECKAFFDPKIRDYDYGIRRAIGVPEMDEFF  186

Query  749   RILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQ  928
             R     D   R ++L+  ID IK NTCKLA  Q++ ILR + +  GW I +RL+ TE F 
Sbjct  187   RSEGLVDGETRAKLLKAAIDEIKMNTCKLACRQVEKILRTREEF-GWQI-YRLNPTEVFV  244

Query  929   KRGGSGAEAYEAWERLVAAPSTMIVHDFICQ  1021
             + GG   +A +AWE LV  PST +V  FIC+
Sbjct  245   RCGG---DANDAWENLVLEPSTNMVARFICK  272



>ref|XP_011079824.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic 
[Sesamum indicum]
Length=317

 Score =   343 bits (879),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 168/299 (56%), Positives = 212/299 (71%), Gaps = 7/299 (2%)
 Frame = +2

Query  134   MSCCFCKQTQPMVSFPSGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSD  313
             MS    KQ +P++  PS   +     KDKVV VMGATGTGKSRL++DLATRF AE++NSD
Sbjct  3     MSLSISKQIRPLLHIPSTTTLRHGPLKDKVVVVMGATGTGKSRLSVDLATRFSAEIINSD  62

Query  314   KMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLP  493
             KMQVY GLDIVTNK+ +EE  GVPHHLLGVVDP  DF+AA+F   A   + +I  + +LP
Sbjct  63    KMQVYHGLDIVTNKITDEERSGVPHHLLGVVDPESDFSAANFRTMASITMKSILSRGQLP  122

Query  494   IIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEARE  673
             +I GGSNS+I+ALV     FRSKYECCFLW+DV MPVL  FVSDRV+KMVE G+++E RE
Sbjct  123   MIVGGSNSFIEALVD--MNFRSKYECCFLWVDVAMPVLDSFVSDRVDKMVERGMVDEVRE  180

Query  674   FFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQ  853
             F+ P  DY+RGI+RAIGVPE D +FR+    DE  R  +L   I+++K NT  LA  QL+
Sbjct  181   FYKPNADYSRGIRRAIGVPEFDNFFRVESFCDEETRARILTDAIESVKMNTSMLARIQLE  240

Query  854   NILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGTT  1030
              I RL+ +++GW  VHRLDAT+ F KRGG   +A  AWE+LV+ P   +V  F+    T
Sbjct  241   KIHRLR-KIKGWR-VHRLDATDVFMKRGG---KAEAAWEKLVSGPGAAVVSRFLYDSET  294



>ref|XP_010035694.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
isoform X2 [Eucalyptus grandis]
Length=329

 Score =   343 bits (880),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 174/311 (56%), Positives = 230/311 (74%), Gaps = 8/311 (3%)
 Frame = +2

Query  125   RIMMSCCFCKQTQPMVSFPSGLNISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEV  301
             ++ MS   CKQ QP+++FP  ++++  +R KDKVVFVMGATGTGKSRLAIDLAT F  EV
Sbjct  2     KVAMSAV-CKQVQPLLTFPGPIDMNPFYRRKDKVVFVMGATGTGKSRLAIDLATHFPGEV  60

Query  302   VNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRK  481
             +NSDKMQVYKGL+IVTNKV +EEC+ +PHHLLG VDP+ DFTA DF      A+ +I+R+
Sbjct  61    INSDKMQVYKGLNIVTNKVTKEECREIPHHLLGFVDPDSDFTATDFRDHTSLALPSISRQ  120

Query  482   DRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIE  661
             DR+PIIAGGSNS+I+ALV    EFRS+++CCFLW+DV +  L  FVS+RV++MVE GL++
Sbjct  121   DRVPIIAGGSNSFIEALVDGDPEFRSRHDCCFLWVDVSLSELCPFVSERVDRMVEAGLVD  180

Query  662   EAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEAS--DERMRQEVLQTGIDNIKANTCKL  835
             E R  ++P  D T+GI+RAIGV EMD YFR+ EA+  D++ +   L+  I  IK NT  L
Sbjct  181   EVRSMYNPKADNTKGIRRAIGVGEMDDYFRV-EATDADDKTKARFLEASITKIKDNTRSL  239

Query  836   ASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             A  Q + I RL + +  WN+ HR+DATE F++RG   A A EAWERLV  PS+MIV  F+
Sbjct  240   ARDQRKKICRLYN-MWSWNM-HRIDATEVFERRGSKEA-ADEAWERLVLRPSSMIVDRFL  296

Query  1016  CQGTTTTFLAP  1048
              +  +TT ++P
Sbjct  297   DEAPSTTIISP  307



>ref|XP_007147775.1| hypothetical protein PHAVU_006G154200g [Phaseolus vulgaris]
 gb|ESW19769.1| hypothetical protein PHAVU_006G154200g [Phaseolus vulgaris]
Length=328

 Score =   343 bits (879),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 174/323 (54%), Positives = 220/323 (68%), Gaps = 19/323 (6%)
 Frame = +2

Query  125   RIMMSCCFCKQTQPMVSFPSGLNISSRW---RKDKVVFVMGATGTGKSRLAIDLATRFV-  292
             +I +S C CKQ  P+VSF  GL + S +    KDKVV +MGATGTGK++LAIDLA  F+ 
Sbjct  2     KISISACACKQELPLVSFQKGLMMESLFPHRSKDKVVVIMGATGTGKTKLAIDLAKHFIP  61

Query  293   AEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAI  472
             AE+VNSDKMQVYKGLDI TNKV EEEC GVPHHLLG VDPN++F+A+DFCR A  A+D+I
Sbjct  62    AEIVNSDKMQVYKGLDITTNKVTEEECDGVPHHLLGTVDPNINFSASDFCRHATSAIDSI  121

Query  473   TRKDRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEG  652
               ++ LPIIAGGSNSY+ ALV  HAEFR +Y+CCFLW+DV +PVL+  +  RV++M++ G
Sbjct  122   VERNGLPIIAGGSNSYLDALVNHHAEFRLRYQCCFLWVDVSLPVLHSSLQARVDRMIDAG  181

Query  653   LIEEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEAS---DERMRQEVLQTGIDNIKAN  823
              + E R+FFDP  DYTRGI+RAIGVPE D + R  EAS   DE   + +L+  I  IK N
Sbjct  182   QVNEVRDFFDPRADYTRGIRRAIGVPEFDDFLRA-EASGTEDETTTKRLLEAAIARIKIN  240

Query  824   TCKLASCQLQNILRLQSQLEGWN-IVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMI  1000
              C LAS Q+Q I RL      W   +HRLDATE F +       +++ W   V A S +I
Sbjct  241   NCTLASRQIQKIHRLHGL---WKRSMHRLDATEVFLR-------SHDVWHDHVLAKSLLI  290

Query  1001  VHDFICQGTTTTFLAPPTSPNSV  1069
             +H+F+     T   A   SP  V
Sbjct  291   LHNFLYGEKKTHVPAGIVSPKDV  313



>ref|XP_010035684.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
isoform X1 [Eucalyptus grandis]
Length=337

 Score =   343 bits (879),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 174/311 (56%), Positives = 230/311 (74%), Gaps = 8/311 (3%)
 Frame = +2

Query  125   RIMMSCCFCKQTQPMVSFPSGLNISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEV  301
             ++ MS   CKQ QP+++FP  ++++  +R KDKVVFVMGATGTGKSRLAIDLAT F  EV
Sbjct  10    KVAMSAV-CKQVQPLLTFPGPIDMNPFYRRKDKVVFVMGATGTGKSRLAIDLATHFPGEV  68

Query  302   VNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRK  481
             +NSDKMQVYKGL+IVTNKV +EEC+ +PHHLLG VDP+ DFTA DF      A+ +I+R+
Sbjct  69    INSDKMQVYKGLNIVTNKVTKEECREIPHHLLGFVDPDSDFTATDFRDHTSLALPSISRQ  128

Query  482   DRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIE  661
             DR+PIIAGGSNS+I+ALV    EFRS+++CCFLW+DV +  L  FVS+RV++MVE GL++
Sbjct  129   DRVPIIAGGSNSFIEALVDGDPEFRSRHDCCFLWVDVSLSELCPFVSERVDRMVEAGLVD  188

Query  662   EAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEAS--DERMRQEVLQTGIDNIKANTCKL  835
             E R  ++P  D T+GI+RAIGV EMD YFR+ EA+  D++ +   L+  I  IK NT  L
Sbjct  189   EVRSMYNPKADNTKGIRRAIGVGEMDDYFRV-EATDADDKTKARFLEASITKIKDNTRSL  247

Query  836   ASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             A  Q + I RL + +  WN+ HR+DATE F++RG   A A EAWERLV  PS+MIV  F+
Sbjct  248   ARDQRKKICRLYN-MWSWNM-HRIDATEVFERRGSKEA-ADEAWERLVLRPSSMIVDRFL  304

Query  1016  CQGTTTTFLAP  1048
              +  +TT ++P
Sbjct  305   DEAPSTTIISP  315



>ref|XP_008451382.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic 
[Cucumis melo]
Length=330

 Score =   342 bits (878),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 170/298 (57%), Positives = 223/298 (75%), Gaps = 13/298 (4%)
 Frame = +2

Query  161   QPMVSFPSG-LNISS-----RWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQ  322
             QP+++ P G LN +      + +K+KVVFV+GATGTGKSRL+ID+AT+F +EV+NSDKMQ
Sbjct  15    QPLINLPPGRLNTNHFSNLRKLQKEKVVFVIGATGTGKSRLSIDIATQFPSEVINSDKMQ  74

Query  323   VYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIA  502
             VY GLDIVTNK+ ++E  GVPHHLLG+++P +DF+A++F   A+ ++DAI+  DRLPIIA
Sbjct  75    VYHGLDIVTNKITKQEQCGVPHHLLGIINPFLDFSASNFSDMAMLSLDAISSHDRLPIIA  134

Query  503   GGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFD  682
             GGSNSYI+AL+   + FR KYECCFLW+DV M VL  FVS+RV+KMV  G+++EA +FFD
Sbjct  135   GGSNSYIEALID--SNFRLKYECCFLWVDVSMQVLQSFVSERVDKMVANGMVDEAEKFFD  192

Query  683   PAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNIL  862
             PA DY+RGIKRAIGVPE D YFR     DE  ++++L+  I  +K +TCKLA  QL  I 
Sbjct  193   PARDYSRGIKRAIGVPEFDSYFRCRSLLDEEAQEKLLEESIAKVKEHTCKLALKQLGKIQ  252

Query  863   RLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGTTTT  1036
             RL++ ++GWNI HRLDATEAF K+   G EA EAW +LV  PST I+  F+      T
Sbjct  253   RLRN-IKGWNI-HRLDATEAFTKQ---GKEAEEAWNKLVTIPSTTIIDQFLHPNAVAT  305



>gb|ABG82043.1| isopentenyltransferase [Malus hupehensis]
Length=320

 Score =   342 bits (877),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 175/309 (57%), Positives = 225/309 (73%), Gaps = 15/309 (5%)
 Frame = +2

Query  146   FCKQTQPMVSFPS-GLN-----ISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVN  307
              CKQ Q ++  PS G N      +   +K+KVV VMGATGTGKSRL+IDLAT F AE++N
Sbjct  4     MCKQIQTLLHVPSSGHNHKMDVFNPHRQKEKVVIVMGATGTGKSRLSIDLATCFPAEIIN  63

Query  308   SDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDR  487
             SDKMQVY+GLDIVTNK+ +EE +GVPHHLLG++DP+ DFTA DFC     A+++I  +DR
Sbjct  64    SDKMQVYEGLDIVTNKITKEEQRGVPHHLLGMLDPHEDFTARDFCDLTSIAIESILGRDR  123

Query  488   LPIIAGGSNSYIKALVKDH-AEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEE  664
             LPII GGSNSYI+AL+ D+  +FRSKY+CCFLW+DV  P L+ FVS RV+ MV+ G+++E
Sbjct  124   LPIIVGGSNSYIEALIDDYDYKFRSKYDCCFLWVDVSTPALHSFVSKRVDHMVQNGMVDE  183

Query  665   AREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASC  844
             ARE+FDP  DYT+GI+RAIGVPE D+YFR     +E  R  +L+  +D IK NTCKLA  
Sbjct  184   AREYFDPNADYTKGIRRAIGVPEFDKYFRYGPFLEEETRARLLRQAVDEIKDNTCKLACR  243

Query  845   QLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQG  1024
             QL+ I RL++ ++GWN+ H LDATE F+KR   G EA EAW++LV+  S MIV  F+   
Sbjct  244   QLEKIHRLRN-IKGWNL-HPLDATEVFRKR---GEEADEAWKKLVSGTSAMIVGQFLYNM  298

Query  1025  TTTTFLAPP  1051
             T      PP
Sbjct  299   TAEV---PP  304



>ref|XP_008368862.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic 
[Malus domestica]
Length=320

 Score =   342 bits (876),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 176/309 (57%), Positives = 224/309 (72%), Gaps = 15/309 (5%)
 Frame = +2

Query  146   FCKQTQPMVSFPS-GLN-----ISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVN  307
              CKQ Q +   PS G N      +   +K+KVV VMGATGTGKSRL+IDLAT F AE++N
Sbjct  4     MCKQIQTLXHVPSSGHNHKXDVFNPHRQKEKVVIVMGATGTGKSRLSIDLATCFPAEIIN  63

Query  308   SDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDR  487
             SDKMQVY+GLDIVTNK+ +EE +GVPHHLLG++DP+ DFTA DFC     A+++I  +DR
Sbjct  64    SDKMQVYEGLDIVTNKITKEEQRGVPHHLLGMLDPHEDFTARDFCDLTSIAIESILGRDR  123

Query  488   LPIIAGGSNSYIKALVKDH-AEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEE  664
             LPII GGSNSYI+AL+ D+  +FRSKY+CCFLW+DV  PVL+ FVS RV+ MV+ G+++E
Sbjct  124   LPIIVGGSNSYIEALIDDYDYKFRSKYDCCFLWVDVSTPVLHSFVSKRVDHMVQNGMVDE  183

Query  665   AREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASC  844
             ARE+FDP  DYT+GI+RAIGVPE D+YFR      E  R  +L+  +D IK NTCKLA  
Sbjct  184   AREYFDPNADYTKGIRRAIGVPEFDKYFRYGPFLXEETRXRLLRQAVDEIKDNTCKLACR  243

Query  845   QLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQG  1024
             QL+ I RL++ ++GWN+ H LDATE F+KR   G EA EAW++LV+  S MIV  F+   
Sbjct  244   QLEKIHRLRN-IKGWNL-HPLDATEVFRKR---GEEADEAWKKLVSGTSAMIVGQFLYNM  298

Query  1025  TTTTFLAPP  1051
             T      PP
Sbjct  299   TAEV---PP  304



>gb|AFI49626.1| isopentenyl transferases protein [Chrysanthemum x morifolium]
Length=331

 Score =   341 bits (875),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 170/312 (54%), Positives = 232/312 (74%), Gaps = 13/312 (4%)
 Frame = +2

Query  134   MSCCFCKQTQP-MVSFPSG-LNIS---SRWRKDKVVFVMGATGTGKSRLAIDLATRFVAE  298
             M+   C+Q QP ++  P+G +++S    R +KDKVV VMGATGTGKSRL+IDLATR+ AE
Sbjct  3     MTMIGCQQAQPSLLQMPTGGMDLSVRRHRPQKDKVVVVMGATGTGKSRLSIDLATRYPAE  62

Query  299   VVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITR  478
             ++NSDKMQVY+GLDIVTNK+  EEC+GVPHHLLG+VDP  DFTA +F   A   + +I  
Sbjct  63    IINSDKMQVYEGLDIVTNKMTYEECEGVPHHLLGIVDPEADFTAQNFVSTASLTMKSIVG  122

Query  479   KDRLPIIAGGSNSYIKALVKD-HAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGL  655
             + +LPIIAGGSNS+I+AL+ D + EFRS+Y+ CFLW+DV MP+++ FVSDRV++MV  G+
Sbjct  123   RGKLPIIAGGSNSFIEALIDDQNYEFRSRYDVCFLWVDVAMPLIHRFVSDRVDRMVSAGI  182

Query  656   IEEAREFFDPAGDYTRGIKRAIGVPEMDQYFR--ILEASDERMRQEVLQTGIDNIKANTC  829
             +EE RE ++P  DY++GI+RAIGVPE D YFR     +SDE+ R+++L+  I+  K NTC
Sbjct  183   VEEVREMYNPNSDYSKGIRRAIGVPEFDAYFREEYSSSSDEKNRKKLLEEAINQTKINTC  242

Query  830   KLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHD  1009
             KLA  QL+ I RLQ+ ++GW I  RLDAT  FQK+   G EA E W + VA P ++IV+ 
Sbjct  243   KLACRQLEKIRRLQN-VKGWEI-RRLDATPVFQKQ---GQEADELWSKSVAGPGSLIVNQ  297

Query  1010  FICQGTTTTFLA  1045
             F+  G++ +F+ 
Sbjct  298   FLNFGSSRSFVG  309



>ref|XP_011102039.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Sesamum indicum]
Length=307

 Score =   340 bits (871),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 169/286 (59%), Positives = 214/286 (75%), Gaps = 6/286 (2%)
 Frame = +2

Query  167   MVSFPSGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIV  346
             M +F     ++    KDKVV V+GATGTGKSRLAIDLATRF AEV+NSDK+QVYKGLDIV
Sbjct  13    MTNFSVRGMMNKHQGKDKVVVVLGATGTGKSRLAIDLATRFGAEVINSDKIQVYKGLDIV  72

Query  347   TNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIK  526
             TNKV  EEC GVPHHLLG++DP VDFT  DF   AL A DAI +K+RLPIIAGGSNS+I+
Sbjct  73    TNKVSNEECHGVPHHLLGIIDPEVDFTVHDFVHHALLAADAIVQKNRLPIIAGGSNSFIQ  132

Query  527   ALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPA-GDYTR  703
             ALV ++ EF SKY CCFLW+DV + V++ +VS RV++M++ GL+EEA+ FFDP   DY  
Sbjct  133   ALVTNNTEFSSKYGCCFLWMDVAIQVVHSYVSKRVDQMLDSGLVEEAKAFFDPKIRDYDY  192

Query  704   GIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLE  883
             GI+RAIGVPEMD++FR     D   R ++L+  I+ IK NTCKLA  Q++ ILR++S+  
Sbjct  193   GIRRAIGVPEMDEFFRCEGLVDGETRAKLLKATINEIKMNTCKLACRQVEKILRMRSEF-  251

Query  884   GWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQ  1021
             GW I +RL+ATE + + GG   +A EAWE+LV  PST ++  FIC 
Sbjct  252   GWQI-YRLNATEVYLRYGG---DANEAWEKLVLEPSTNMLAHFICN  293



>ref|XP_008458554.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Cucumis melo]
Length=328

 Score =   340 bits (871),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 170/308 (55%), Positives = 222/308 (72%), Gaps = 15/308 (5%)
 Frame = +2

Query  149   CKQTQ---PMVSFP----SGLNISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVV  304
             CKQ     P+V+F     + LN+   +R KDKVVFVMGATGTGKSRLAIDLATRF AE++
Sbjct  9     CKQVAVEPPLVNFQGTNNNTLNLEPFFRRKDKVVFVMGATGTGKSRLAIDLATRFPAEII  68

Query  305   NSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDA-ITRK  481
             NSDK+QVYKGL ++TNKV E+EC+GVPHHLLG+ DPN +FT ADF R A  A+++ I  K
Sbjct  69    NSDKIQVYKGLKVLTNKVTEKECRGVPHHLLGIADPNSNFTVADFRRHASSAINSIIVGK  128

Query  482   DRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIE  661
              RLPI+AGGSNS+I++LV++  EFR +Y+CCFLW+DV +P+L  FVS+RV++M+E GL+ 
Sbjct  129   RRLPILAGGSNSFIESLVEEEPEFRYRYDCCFLWVDVSLPILNSFVSERVDRMLENGLVN  188

Query  662   EAREFFDPAG---DYTRGIKRAIGVPEMDQYFR--ILEASDERMRQEVLQTGIDNIKANT  826
             E R  FDP G   DY RGI+RAIGVPE+D + R  +   +D++ R  +L+  I  IK NT
Sbjct  189   EVRNLFDPNGLGNDYGRGIRRAIGVPELDAFLRAEMDSTTDDKARSRILKAAILKIKENT  248

Query  827   CKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRG-GSGAEAYEAWERLVAAPSTMIV  1003
              KLA  Q Q I RLQ++  GWN  HR+DATEAF + G G    +  AWE LV  PS+MI+
Sbjct  249   IKLACRQQQKIHRLQNKWRGWNNFHRIDATEAFLQLGNGENYSSDNAWETLVVEPSSMII  308

Query  1004  HDFICQGT  1027
               F+ + +
Sbjct  309   DQFLSKNS  316



>ref|XP_004290672.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=331

 Score =   339 bits (869),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 173/308 (56%), Positives = 220/308 (71%), Gaps = 16/308 (5%)
 Frame = +2

Query  122   TRIMMSCCFCKQTQPMVSFPS-----GLNI----SSRWRKDKVVFVMGATGTGKSRLAID  274
             T  MM  C   Q  P V   +       N+    + R +KDKVV VMGATGTGKS+L+ID
Sbjct  2     TMNMMPMCKQAQALPNVQLSNIGGGHSHNLLDVFNPRRQKDKVVIVMGATGTGKSKLSID  61

Query  275   LATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQAL  454
             LATRF AE++NSDKMQ Y+GLDI TNK+  +E + VPHHLLGV+DPNVDF+A DF     
Sbjct  62    LATRFPAEIINSDKMQFYEGLDIATNKITPQEQRDVPHHLLGVLDPNVDFSADDFSNVTC  121

Query  455   QAVDAITRKDRLPIIAGGSNSYIKALVKDHAE-FRSKYECCFLWIDVEMPVLYEFVSDRV  631
              AVD+I  ++RLPII GGSNSYI+ LV  +   FRS+Y+CCFLW+DV + VL+ FVSDRV
Sbjct  122   LAVDSILNRNRLPIIVGGSNSYIETLVDGYDNMFRSRYDCCFLWVDVSLSVLHSFVSDRV  181

Query  632   EKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDN  811
             ++MVE GL+EE REFFDP  DYT+GI+RAIGVPE D +FR     D+  R  +L+  I+ 
Sbjct  182   DQMVENGLVEEVREFFDPNADYTKGIRRAIGVPEFDDFFRYGPFLDDETRAGLLERAINE  241

Query  812   IKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPS  991
             +K NTCKLA  QL+ I RL+++  GW++ H+LDATE FQKR   G E++EAW+RLV+ PS
Sbjct  242   VKDNTCKLACRQLEKIRRLRNK--GWSL-HQLDATEVFQKR---GKESHEAWDRLVSGPS  295

Query  992   TMIVHDFI  1015
              MIV  F+
Sbjct  296   AMIVRQFL  303



>ref|XP_002533064.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF29303.1| ATP binding protein, putative [Ricinus communis]
Length=328

 Score =   339 bits (869),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 171/312 (55%), Positives = 223/312 (71%), Gaps = 13/312 (4%)
 Frame = +2

Query  119   STRIMMSCCFCKQT---QPMVSFPSGL----NISSRWRKDKVVFVMGATGTGKSRLAIDL  277
             ST + +S  FC+QT   Q  +  P+G      ++ RW+K KVV VMGATGTGKS+L++DL
Sbjct  1     STIMRLSMSFCQQTHHHQNTLDVPTGRLKMDIVTPRWQKPKVVIVMGATGTGKSKLSLDL  60

Query  278   ATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQ  457
             AT+  AE++NSDKMQ+YKGLDI TNK+ EEE  G+PHHLLGVV+PNVDFTA DFC  A Q
Sbjct  61    ATQCPAEIINSDKMQLYKGLDITTNKITEEEMSGIPHHLLGVVNPNVDFTAKDFCNMASQ  120

Query  458   AVDAITRKDRLPIIAGGSNSYIKALVKD-HAEFRSKYECCFLWIDVEMPVLYEFVSDRVE  634
             A+ +I+ +  LPI+ GGSNSYI+ALV D    FRSKY+CCFLW+DV M  L EF+  RV+
Sbjct  121   AIGSISTRGLLPIVVGGSNSYIEALVDDPDYRFRSKYDCCFLWVDVPMHALQEFLLKRVD  180

Query  635   KMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNI  814
             +MV++G+IEE R  FDP  DY++GI+++IGVPE D+Y +    SDER    +LQ  I  +
Sbjct  181   QMVKKGMIEEVRNIFDPRADYSKGIRKSIGVPEFDKYLKAEAFSDERNCARLLQQAISEV  240

Query  815   KANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPST  994
             K N CKLA  QL+ I RL+  ++GWNI HR+DATE F+KR   G +A +AW++LVA PS 
Sbjct  241   KHNNCKLARRQLEKIHRLK-YVKGWNI-HRIDATEVFRKR---GKKADDAWKKLVARPSI  295

Query  995   MIVHDFICQGTT  1030
              IV  F+    T
Sbjct  296   DIVRQFLYSANT  307



>ref|XP_011033688.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Populus euphratica]
Length=325

 Score =   338 bits (867),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 177/305 (58%), Positives = 218/305 (71%), Gaps = 15/305 (5%)
 Frame = +2

Query  131   MMSCC--FCKQTQPMVSFPSG------LNISSRWRKDKVVFVMGATGTGKSRLAIDLATR  286
             MM+ C   C QT  M+  P G      L+  SR +K+KVV VMG TGTGKSRL+I+LAT+
Sbjct  1     MMNLCKSLCPQTSRMLDIPPGRLKMDMLSPRSR-QKEKVVIVMGPTGTGKSRLSIELATQ  59

Query  287   FVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVD  466
             F AE++NSDKMQVYKGLDIVTNKV EEE  GVPHHLLG+ +PNVDFTA ++C  A  AV+
Sbjct  60    FPAEIINSDKMQVYKGLDIVTNKVAEEEKSGVPHHLLGIANPNVDFTATNYCHTASLAVE  119

Query  467   AITRKDRLPIIAGGSNSYIKALVKDHA-EFRSKYECCFLWIDVEMPVLYEFVSDRVEKMV  643
             +I+ +  LPII GGSNSYI+AL+ D     R  Y+CCFLW+DV MPVL++FVS RVE+MV
Sbjct  120   SISTRGLLPIIVGGSNSYIEALMDDEDFRLRLNYDCCFLWVDVSMPVLHKFVSRRVEQMV  179

Query  644   EEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKAN  823
               G+I+EAR  FDP  DY+ GI+R+IGVPE D+YFR     DE  R  +L   I ++K N
Sbjct  180   SMGMIDEARNIFDPYADYSTGIRRSIGVPEFDKYFRAEAFLDEENRARLLHEAICDVKKN  239

Query  824   TCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIV  1003
             TCKLA  Q + I RL+ +++GW+I HRLDATE FQK   SG EA  AWE LVA PST IV
Sbjct  240   TCKLACRQWEKINRLR-KIKGWDI-HRLDATEVFQK---SGKEAEHAWEMLVARPSTAIV  294

Query  1004  HDFIC  1018
                +C
Sbjct  295   GQLLC  299



>ref|XP_010090377.1| Adenylate isopentenyltransferase 3 [Morus notabilis]
 gb|EXB39347.1| Adenylate isopentenyltransferase 3 [Morus notabilis]
Length=317

 Score =   337 bits (865),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 177/302 (59%), Positives = 224/302 (74%), Gaps = 15/302 (5%)
 Frame = +2

Query  131   MMSCCFCKQTQPMVSFPS-GLNI---SSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAE  298
             MMS   CKQ QP V  P  GLN+   +SR + +KVV VMGATGTGKSRL++DLATRF AE
Sbjct  1     MMS--ICKQLQPTVHIPPCGLNLEAFNSRRQTNKVVIVMGATGTGKSRLSVDLATRFHAE  58

Query  299   VVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVV-DPNVDFTAADFCRQALQAVDAIT  475
             +VNSDKMQVY+GL+I TNK+ +EE  GVPHHLLG V +PN DF+A DF   A  A+++I 
Sbjct  59    IVNSDKMQVYEGLEITTNKITKEEQCGVPHHLLGAVQNPNADFSADDFSDAASIAIESIV  118

Query  476   RKDRLPIIAGGSNSYIKALVK--DHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEE  649
                RLPIIAGGSNSYI+ LV   D++ FR+KYECCFLW+DV MPVL+ +VS RV++MV  
Sbjct  119   DHGRLPIIAGGSNSYIEHLVDVLDYS-FRAKYECCFLWVDVSMPVLHPYVSKRVDEMVRN  177

Query  650   GLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTC  829
             G++EE R+ FDP   Y++GI+RAIGVPE D+YFR  +  DE+ R  VLQ  I+ IK NTC
Sbjct  178   GMVEEVRKMFDPNASYSKGIRRAIGVPEFDRYFRDEKLYDEKTRARVLQEAINEIKDNTC  237

Query  830   KLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHD  1009
             KLA  QL  I RL+++ +GW + HRLDATE +++RG    EA +AW+R VAAPS  IV +
Sbjct  238   KLACRQLGKIHRLRNR-DGWTL-HRLDATEVYRRRGN---EAEQAWKRHVAAPSAAIVDE  292

Query  1010  FI  1015
             F+
Sbjct  293   FL  294



>ref|XP_007050663.1| Isopentenyltransferase 3, putative [Theobroma cacao]
 gb|EOX94820.1| Isopentenyltransferase 3, putative [Theobroma cacao]
Length=322

 Score =   337 bits (864),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 172/300 (57%), Positives = 222/300 (74%), Gaps = 11/300 (4%)
 Frame = +2

Query  134   MSCCFCKQTQPMVSFPSG-LNI----SSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAE  298
             +S   CKQT  +    SG LN+    S R +K+KVV ++GATGTGKSRL+IDLATRF AE
Sbjct  4     ISLSMCKQTVVLPDRASGMLNLVDFFSPRRQKEKVVILLGATGTGKSRLSIDLATRFPAE  63

Query  299   VVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITR  478
             ++NSDK+Q ++GLDI TNK+ EEE  G+PHHLLGV++PN DFTA +F   A  A+D+I  
Sbjct  64    IINSDKIQAHEGLDIATNKITEEERCGIPHHLLGVINPNTDFTATNFVDMATHAMDSILF  123

Query  479   KDRLPIIAGGSNSYIKALVKDH-AEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGL  655
             + +LPIIAGGSNSYI+ALV D    FRSKYECCFLW+DV MPVL+ +VS+RV+KMVE G+
Sbjct  124   RSQLPIIAGGSNSYIEALVDDKDYRFRSKYECCFLWVDVAMPVLHHYVSERVDKMVENGM  183

Query  656   IEEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKL  835
             ++E R++FD   +YTRGI++AIGVPE D+YFR     D++ R ++LQ  I  IK NTCKL
Sbjct  184   VDEVRKYFDSNANYTRGIRKAIGVPEFDRYFRAEPFLDKQSRAKLLQEAIQEIKRNTCKL  243

Query  836   ASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             AS QL+ I RL+++ + W I HRLDAT  F +R   G EA EAWE  VA PST +V +F+
Sbjct  244   ASRQLEKIHRLRNK-KNWKI-HRLDATGVFLRR---GKEADEAWEEFVAGPSTEMVAEFL  298



>ref|XP_010024423.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW60866.1| hypothetical protein EUGRSUZ_H03602 [Eucalyptus grandis]
 gb|KCW60867.1| hypothetical protein EUGRSUZ_H03602 [Eucalyptus grandis]
Length=335

 Score =   337 bits (864),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 170/297 (57%), Positives = 217/297 (73%), Gaps = 8/297 (3%)
 Frame = +2

Query  134   MSCCFCKQ--TQPMVSFPSGLNISSRW-RKDKVVFVMGATGTGKSRLAIDLATRFVAEVV  304
             MS   CKQ   QP+++F  GLN  S + R+DK+VFV+GATGTGKSRLAIDLA RF  EVV
Sbjct  4     MSTVACKQAQVQPLMNFRGGLNAESFYHRRDKIVFVVGATGTGKSRLAIDLADRFRGEVV  63

Query  305   NSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKD  484
             NSDK+QVYKGLDIVTNKV EEEC+GVPHHLLG+ +P+ +FTA DF   AL A+D+I  + 
Sbjct  64    NSDKIQVYKGLDIVTNKVTEEECRGVPHHLLGIAEPDSEFTAIDFRCHALLAIDSILARG  123

Query  485   RLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEE  664
             RLPIIAGGSNS+I ALV    EFRS+Y+CCF W+DV MPVL+ F   RV++MVE GL++E
Sbjct  124   RLPIIAGGSNSFIDALVNGGPEFRSRYDCCFFWVDVLMPVLHSFAVRRVDRMVEAGLVDE  183

Query  665   AREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASC  844
              R  + P  D ++GI+RAIGV EM++Y      +D+R R ++L+  ++ IKANTC LA  
Sbjct  184   VRSVYRPGADNSKGIRRAIGVSEMEKYLSYENTADDRTRAKLLKEAVERIKANTCALACR  243

Query  845   QLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             QL+ I RL+S  +G   ++R+DATE FQK      EA EAW RLVA P T+I+  F+
Sbjct  244   QLEKIERLKSNWDGE--MNRIDATEVFQK---EDKEADEAWARLVAGPCTVILCKFL  295



>ref|XP_004136062.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004158934.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Cucumis sativus]
 gb|KGN44872.1| hypothetical protein Csa_7G392940 [Cucumis sativus]
Length=330

 Score =   337 bits (863),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 166/298 (56%), Positives = 219/298 (73%), Gaps = 13/298 (4%)
 Frame = +2

Query  161   QPMVSFPSG------LNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQ  322
             QP+++ P G       +   + +K+KVV V+G TGTGKSRL+ID+ATRF +EV+NSDKMQ
Sbjct  15    QPLINLPPGRLTTNPFSTLRKLQKEKVVIVIGPTGTGKSRLSIDIATRFPSEVINSDKMQ  74

Query  323   VYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIA  502
             VY GLDIVTNK+ ++E  GVPHHLLG+++P +DF+A++F   A+ ++DAI+  DRLPIIA
Sbjct  75    VYHGLDIVTNKITKQEQCGVPHHLLGIINPFLDFSASNFSDMAMLSLDAISSHDRLPIIA  134

Query  503   GGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFD  682
             GGSNSYI+AL+   + FR +YECCFLW+DV M VL  FVS+RV+KMV  G+++EA +FFD
Sbjct  135   GGSNSYIEALID--SNFRLRYECCFLWVDVSMQVLQSFVSERVDKMVANGMVDEAEKFFD  192

Query  683   PAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNIL  862
             PA DY+RGIKRAIGVPE D YFR     DE  ++++L+  I  +K +TCKLA  QL  I 
Sbjct  193   PARDYSRGIKRAIGVPEFDSYFRYRSLLDEEAQEKLLEESIAKVKEHTCKLALRQLGKIQ  252

Query  863   RLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGTTTT  1036
             RL++ ++GWNI HRLDATEAF K+   G EA EAW + V  PST I+  F+ Q    T
Sbjct  253   RLRN-VKGWNI-HRLDATEAFTKQ---GKEADEAWNKHVTIPSTTIIDQFLHQNVIAT  305



>ref|XP_010938767.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Elaeis guineensis]
Length=304

 Score =   335 bits (859),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 162/270 (60%), Positives = 209/270 (77%), Gaps = 5/270 (2%)
 Frame = +2

Query  209   RKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPH  388
              KDKVVFV+GATG+GKS+LAI LAT+F  EV+NSDKMQ+Y GLD++TNKV +EE  G+PH
Sbjct  37    HKDKVVFVLGATGSGKSKLAIALATQFDGEVINSDKMQLYFGLDVITNKVTKEETAGIPH  96

Query  389   HLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVK-DHAEFRSKY  565
             HLLGVV P+ DFTA+DF R+A+  + +I R+ RLPI+AGGSNSY++ALV  +  EFRS+Y
Sbjct  97    HLLGVVHPDADFTASDFAREAMHVIASILRRGRLPIVAGGSNSYVEALVDGEGGEFRSQY  156

Query  566   ECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQY  745
             ECCFLW+DVE+P+L+ FVS R++KMV +GL+EEAR  F    DY+RGI+RAIGVPEMD Y
Sbjct  157   ECCFLWLDVELPLLHSFVSARMDKMVAQGLVEEARSLFHADADYSRGIRRAIGVPEMDHY  216

Query  746   FRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAF  925
             FR+  ++DE  R  +L+  +D IKANTCKL   QLQ ILR  + L GW++ HR+DATE F
Sbjct  217   FRMEASADEETRARMLEGALDEIKANTCKLTCIQLQKILRFCT-LPGWDL-HRVDATEFF  274

Query  926   QKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
              +RG  G EA E WE++V +P   IV  F+
Sbjct  275   LRRGQDG-EA-EEWEKVVGSPCKEIVQKFL  302



>ref|XP_002321061.2| hypothetical protein POPTR_0014s13540g [Populus trichocarpa]
 gb|EEE99376.2| hypothetical protein POPTR_0014s13540g [Populus trichocarpa]
Length=324

 Score =   333 bits (854),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 174/303 (57%), Positives = 215/303 (71%), Gaps = 13/303 (4%)
 Frame = +2

Query  134   MSCC--FCKQTQPMVSFPSGL----NISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFV  292
             M+ C   C QT  M+  P G+     +S R R K+KVV VMG TGTGKSRL+I+LAT+F 
Sbjct  1     MNLCKSLCPQTSRMLDIPPGMLKMDMLSPRSRQKEKVVIVMGPTGTGKSRLSIELATQFP  60

Query  293   AEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAI  472
             AE++NSDKMQVYKGLDIVTNKV EEE  GVPHHLLG+ +P VDFTA ++C  A  AV++I
Sbjct  61    AEIINSDKMQVYKGLDIVTNKVAEEEKSGVPHHLLGIANPTVDFTATNYCHTASLAVESI  120

Query  473   TRKDRLPIIAGGSNSYIKALVKDHA-EFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEE  649
             + +  LPII GGSNSYI+AL+ D     R  Y+CCFLW+DV MPVL++FVS RVE+MV  
Sbjct  121   STRGLLPIIVGGSNSYIEALMDDEDFRLRLNYDCCFLWVDVSMPVLHKFVSRRVEQMVSV  180

Query  650   GLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTC  829
             G+I+E R  FDP  DY+ GI+R+IGVPE D+YFR     DE  R  +L   I ++K NTC
Sbjct  181   GMIDEVRNIFDPYADYSTGIRRSIGVPEFDKYFRAEAFLDEENRARLLHEAICDVKKNTC  240

Query  830   KLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHD  1009
             KLA  Q + I RL+ +++GW+I HRLDATE FQK   SG EA  AWE LVA PST IV  
Sbjct  241   KLACRQWEKINRLR-KIKGWDI-HRLDATEVFQK---SGKEAEHAWEMLVARPSTAIVGQ  295

Query  1010  FIC  1018
              +C
Sbjct  296   LLC  298



>ref|XP_011092012.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Sesamum indicum]
Length=292

 Score =   331 bits (848),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 170/296 (57%), Positives = 211/296 (71%), Gaps = 7/296 (2%)
 Frame = +2

Query  134   MSCCFCKQTQP-MVSFPSGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNS  310
             MS    K  Q  M++F     +     K+KVV V+GATGTGKSRLAIDLATRF AEV+NS
Sbjct  1     MSISAWKPAQSSMINFSVQGMMKKHQGKEKVVVVLGATGTGKSRLAIDLATRFGAEVINS  60

Query  311   DKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRL  490
             DK+QVYKGLDIVTNKVR EEC G  HHLLG++DP +DFT  DF   AL A DAI +K+RL
Sbjct  61    DKIQVYKGLDIVTNKVRNEECSGAQHHLLGIIDPEMDFTVHDFVHHALLAADAIIQKNRL  120

Query  491   PIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAR  670
             PIIAGGSNS+++AL  D  EF SKYECCFLW+DV +PVL+ ++S RV++MV+ GL+EE +
Sbjct  121   PIIAGGSNSFLQALASDDTEFPSKYECCFLWMDVAIPVLHSYMSKRVDQMVDSGLVEEGK  180

Query  671   EFFDP-AGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQ  847
              FFDP   DY  GI+RAIG+PEMD++FR     D   R ++L+  ID IK  TCKLA  Q
Sbjct  181   AFFDPKVRDYDYGIRRAIGIPEMDEFFRSEGLVDGETRAKLLKAAIDKIKRYTCKLACRQ  240

Query  848   LQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             ++   R++ +  GW I HRL+ATE F +R G   +A EAWE+LV  PST IV  FI
Sbjct  241   VEMNFRMREEF-GWRI-HRLNATEVFLQRSG---DANEAWEKLVLEPSTNIVAHFI  291



>ref|XP_011078654.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Sesamum indicum]
Length=286

 Score =   330 bits (846),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 168/284 (59%), Positives = 205/284 (72%), Gaps = 6/284 (2%)
 Frame = +2

Query  167   MVSFPSGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIV  346
             M +F  G  I+    KDKVV V+G TGTGKS LAIDLATRF  EV+NSDK+QVYK LDIV
Sbjct  1     MTNFTIGGVINKHRGKDKVVVVLGTTGTGKSLLAIDLATRFGTEVINSDKIQVYKCLDIV  60

Query  347   TNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIK  526
             TNKV  EEC GVPHHLLG++DP  DFT  DF   A  A DAI +K+RLPIIAGG+NS+I 
Sbjct  61    TNKVSNEECHGVPHHLLGIIDPEEDFTVHDFMHHAFLAADAIVQKNRLPIIAGGTNSFIH  120

Query  527   ALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPA-GDYTR  703
             ALV D  EF +KYECCFLW+D  +PVL+ +VS+RV++MV+ GL+EE + FFDP   DY  
Sbjct  121   ALVNDDTEFPTKYECCFLWMDEAIPVLHSYVSNRVDQMVDSGLLEEGKAFFDPKICDYDF  180

Query  704   GIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLE  883
             GI+RAIGVPEMD++FR     D   R ++L+  ID IK NTCKLA  Q++ ILR++ +  
Sbjct  181   GIRRAIGVPEMDEFFRSEGLVDGETRAKLLKAAIDEIKVNTCKLACRQVEKILRIREEFR  240

Query  884   GWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
              W I HRL+ATE F +R   GA+A EAWE+LV  P T IV  FI
Sbjct  241   -WKI-HRLNATEVFLRR---GADANEAWEKLVLEPCTNIVAHFI  279



>dbj|BAG55006.1| adenylate isopentenyltransferase [Ipomoea nil]
Length=332

 Score =   330 bits (847),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 170/316 (54%), Positives = 228/316 (72%), Gaps = 20/316 (6%)
 Frame = +2

Query  146   FCKQTQPMVSFPSG----LNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSD  313
              CKQ  P++  P+G    L I  R +K+KVV VMGATG GKSRL++DLATRF AE+VN+D
Sbjct  10    MCKQKLPLLHMPNGGGIDLKILHRPQKEKVVVVMGATGAGKSRLSVDLATRFSAEIVNAD  69

Query  314   KMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLP  493
             KMQVY+G D++TNKV +EE  GVPHHLLG++DP  DFTA +FC  A + + +I  + RLP
Sbjct  70    KMQVYQGFDVLTNKVTDEEAGGVPHHLLGIIDPEKDFTAKNFCNAASRCIKSIAGRGRLP  129

Query  494   IIAGGSNSYIKALVKDH-AEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAR  670
             +IAGGSNS+I+ALV+D  ++ +SKY+ CF+ +DV +PVL+ FVS+RV++MVE+G+IEEAR
Sbjct  130   MIAGGSNSFIEALVEDEDSKMKSKYDWCFICVDVALPVLHSFVSERVDRMVEKGMIEEAR  189

Query  671   EFFDPAG-DYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQ  847
               F+PA  DY++G++RAIG+ E+D+YFRI   SDE  R  +L+  I+++K NT  LA  Q
Sbjct  190   GMFNPASRDYSKGLRRAIGMQELDRYFRI--ESDEEHRARLLEDAINDVKKNTRTLACRQ  247

Query  848   LQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQG-  1024
             L+ I RL+  ++GW I HRLDATEAF KRGGS  EA +AWE LV AP T I++ F+    
Sbjct  248   LEKIKRLK-HVKGWKI-HRLDATEAFLKRGGS--EADQAWENLVVAPGTAILNRFLHSHA  303

Query  1025  -------TTTTFLAPP  1051
                    T    L PP
Sbjct  304   SSGSLFFTANNLLIPP  319



>ref|XP_008438727.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Cucumis melo]
Length=324

 Score =   330 bits (845),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 167/313 (53%), Positives = 225/313 (72%), Gaps = 10/313 (3%)
 Frame = +2

Query  128   IMMSCCFCKQTQPMV-SFPSGLNISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEV  301
             + ++    KQ QP+V +F    N+   +R KDKVV VMGATGTGKSRLAI+LATRF +E+
Sbjct  5     LSLTSAAGKQVQPLVGNFQGNFNMEQFFRRKDKVVVVMGATGTGKSRLAIELATRFPSEI  64

Query  302   VNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRK  481
             VNSDK+QVY+GLD+VTNKV EEE +G+PHHLL  +DP  +F++ DF   A  A+++I  +
Sbjct  65    VNSDKIQVYEGLDVVTNKVTEEERRGIPHHLLSSIDPKSNFSSRDFTHHASVAIESILAR  124

Query  482   DRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIE  661
             DRLPIIAGGSNSYI+ALV D+AE R +YE CFLW+DV +P+L +FVSDRV++MV+ G +E
Sbjct  125   DRLPIIAGGSNSYIEALVNDYAEARFRYEFCFLWVDVSLPILQKFVSDRVDRMVDGGFVE  184

Query  662   EAREFFDPAGDYTRGIKRAIGVPEMDQYFRI-LEASDERMRQEVLQTGIDNIKANTCKLA  838
             E R+ FDP GDY++GIKRAIGVPE+ +Y R   + +DER+ + +L+  I  IK NTC+LA
Sbjct  185   EVRQIFDPEGDYSQGIKRAIGVPELHEYLRAERDGADERVLKILLELAISRIKDNTCRLA  244

Query  839   SCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFIC  1018
               QL+ I  L ++   WN+  RLDAT AF      G  + + WE+LV  PS+ IV  F+C
Sbjct  245   FRQLEKIRLLHTKW-NWNL-RRLDATGAFLT---DGENSVDVWEKLVLEPSSRIVDQFLC  299

Query  1019  QGT--TTTFLAPP  1051
              G+   TT ++ P
Sbjct  300   DGSRRITTGISTP  312



>ref|XP_010551669.1| PREDICTED: adenylate isopentenyltransferase 7, mitochondrial-like 
[Tarenaya hassleriana]
Length=343

 Score =   330 bits (846),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 174/324 (54%), Positives = 224/324 (69%), Gaps = 27/324 (8%)
 Frame = +2

Query  152   KQTQPMVSFPSGLNISSRWR--KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQV  325
             KQ QP++SF   L +  ++   KDKVVFVMGATGTGKSRLAIDLATRF AE++NSDK+QV
Sbjct  9     KQVQPILSFKRKLGVDIQFLRPKDKVVFVMGATGTGKSRLAIDLATRFPAEIINSDKIQV  68

Query  326   YKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAG  505
             +KGLD+VTNKV  +EC+G+PHHLLG++DPN +FT+ DF   A Q + +IT KDRLPI+AG
Sbjct  69    HKGLDVVTNKVTPQECRGIPHHLLGIIDPNANFTSTDFSCLASQVIASITAKDRLPIVAG  128

Query  506   GSNSYIKALVKDHAEF--------------RS-----KYECCFLWIDVEMPVLYEFVSDR  628
             G+NSYI++LV   AEF              RS      Y+CCF+W+DV +PVL  FVS R
Sbjct  129   GANSYIESLVTRSAEFLLSGSNSYIESLVTRSAEFLLNYQCCFIWVDVSLPVLNSFVSKR  188

Query  629   VEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGID  808
             V+KMVE GL++E RE FDP  DY+ GI+RAIGVPE+ +YF      D   ++++L   ++
Sbjct  189   VDKMVETGLVDEVREMFDPKADYSVGIRRAIGVPELHEYFVSESLIDRGTQRKMLALAVN  248

Query  809   NIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAP  988
             NIK NT  LA  QLQ I RL ++   W  +HR+DATE F + G    EA EAWE LVA P
Sbjct  249   NIKQNTEILACRQLQKIHRLYNK-RNW-CMHRIDATEVFLRHGD---EAEEAWENLVARP  303

Query  989   STMIVHDF-ICQGTTTTFLAPPTS  1057
             ST IV++F + +  T T +A P S
Sbjct  304   STRIVNEFLLSEEDTLTSVAFPES  327



>emb|CAN64248.1| hypothetical protein VITISV_032976 [Vitis vinifera]
Length=305

 Score =   328 bits (842),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 173/289 (60%), Positives = 211/289 (73%), Gaps = 10/289 (3%)
 Frame = +2

Query  203   RWRKDKVVFVM-GATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQG  379
             RW K KVV VM  ATGTGKSRL+IDLATRF AE+VNSDKMQVY+GLDIVTNK+ EEE +G
Sbjct  7     RWPKGKVVVVMEWATGTGKSRLSIDLATRFPAEIVNSDKMQVYEGLDIVTNKITEEEQRG  66

Query  380   VPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKD-HAEFR  556
             VPHHLL +  PNVDFTA+DF   A  ++++I  + RLPI+ GGSNSYI+ALV D +++FR
Sbjct  67    VPHHLLRIAHPNVDFTASDFRDMASLSIESILGRGRLPIVVGGSNSYIEALVGDEYSKFR  126

Query  557   SKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEM  736
             S+YECCFLW+DV   VL+ FVS RV+KMVE+G++EE ++ F P  DYTRGI+RAIGVPE+
Sbjct  127   SRYECCFLWVDVSRSVLHSFVSKRVDKMVEKGMVEEVQQLFHPNADYTRGIRRAIGVPEL  186

Query  737   DQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDAT  916
             D YFR     DE  R  VLQ  +  IKANTCKLA  QL+ I RL++ +  W I HRL AT
Sbjct  187   DLYFRTEGFLDEEARARVLQEAVHEIKANTCKLACRQLEKIHRLKN-VRKWKI-HRLGAT  244

Query  917   EAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGTTTTFLA---PPT  1054
             E  +K      EA EAWE+LVA PSTM+V  F+     T  +A   PPT
Sbjct  245   EVLRK---CDREADEAWEKLVARPSTMMVAQFLYSVGATRSIATTSPPT  290



>ref|XP_004150320.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Cucumis sativus]
 gb|KGN47261.1| hypothetical protein Csa_6G237640 [Cucumis sativus]
Length=326

 Score =   329 bits (843),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 166/306 (54%), Positives = 215/306 (70%), Gaps = 13/306 (4%)
 Frame = +2

Query  149   CKQTQ---PMVSFP---SGLNISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVVN  307
             CKQ     P+V+F    + LN+   +R KDKVVFVMGATGTGKSRLAIDLATRF AE++N
Sbjct  9     CKQIAVEPPLVNFQGTNNTLNLEPFFRRKDKVVFVMGATGTGKSRLAIDLATRFPAEIIN  68

Query  308   SDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDR  487
             SDK+QVYKGL ++TNKV E+EC GVPHHLLG+ DPN +FT ADF R A   +++I    R
Sbjct  69    SDKIQVYKGLKVLTNKVTEKECCGVPHHLLGIADPNSNFTVADFRRHASSTINSIVVGKR  128

Query  488   -LPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEE  664
              LPI+AGGSNS+I++LV++  EFR +Y+CCFLW+DV +P+L  FVS+RV++M+E GL+ E
Sbjct  129   CLPILAGGSNSFIESLVEEEPEFRYRYDCCFLWVDVSLPILNSFVSERVDRMLENGLVNE  188

Query  665   AREFFDPAG---DYTRGIKRAIGVPEMDQYFR--ILEASDERMRQEVLQTGIDNIKANTC  829
              R  FDP G   DY  GI+RAIGVPE+D + R  +  A+D++ R  +L+  I  IK NT 
Sbjct  189   VRSLFDPNGLGNDYGHGIRRAIGVPELDAFLRAEMDSATDDKTRSRILKAAILKIKENTI  248

Query  830   KLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHD  1009
             KLA  Q Q I RLQS+  GWN +HR+DATE F +       +  AWE LV  PS  IV  
Sbjct  249   KLACRQRQKIHRLQSKWRGWNNLHRIDATEVFLQLDSEDYSSDNAWETLVVKPSFKIVDQ  308

Query  1010  FICQGT  1027
             F+ + +
Sbjct  309   FLSENS  314



>gb|ABD93935.1| adenylate isopentenyltransferase [Lotus japonicus]
Length=330

 Score =   329 bits (843),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 167/298 (56%), Positives = 210/298 (70%), Gaps = 12/298 (4%)
 Frame = +2

Query  149   CKQTQPMVSFPSGLNISSRWR----KDKVVFVMGATGTGKSRLAIDLATRF-VAEVVNSD  313
             CKQ  P+V+F +GL + S +R    KDKVV +MGATGTGK++LAIDLA  F  AE+VNSD
Sbjct  10    CKQELPLVNFQNGLIMESLFRHHRNKDKVVVIMGATGTGKTKLAIDLAKHFQPAEIVNSD  69

Query  314   KMQVYKGLDIVTNKVREEECQGVPHHLLGVVD-PNVDFTAADFCRQALQAVDAITRKDRL  490
             K+QVYKGLDI TNKV EEEC G+PHHLLG VD PN +FTA DFC  A  A+D+I +KD L
Sbjct  70    KIQVYKGLDITTNKVTEEECGGIPHHLLGAVDDPNYNFTANDFCHHACSAIDSIVKKDGL  129

Query  491   PIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAR  670
             PIIAGGSNSY+ ALV  HAEFR +YECCFLW+DV +PVL+  +  R ++M+E G ++E R
Sbjct  130   PIIAGGSNSYLDALVNHHAEFRLRYECCFLWVDVSLPVLHSSLQARADRMIEAGQVDEVR  189

Query  671   EFFDPAGDYTRGIKRAIGVPEMDQYFRI-LEASDERMRQEVLQTGIDNIKANTCKLASCQ  847
             EFFDP+ DYTRGIKRAIGVPE D + R      D+     +L+  I   K N C LA+ Q
Sbjct  190   EFFDPSADYTRGIKRAIGVPEFDDFLRAEANGEDDMTILRLLEGAIARTKINNCTLANRQ  249

Query  848   LQNILRLQSQLEGW-NIVHRLDATEAFQKR-GGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             +Q I RL      W   +H+LDAT+ F +R  G  A++ EAW+  V A S MI+H+F+
Sbjct  250   VQKIHRLH---RVWRRSMHQLDATDVFLRRSSGDSADSEEAWQDHVLAKSLMILHNFL  304



>gb|KHN37566.1| Adenylate isopentenyltransferase 5, chloroplastic [Glycine soja]
Length=325

 Score =   327 bits (839),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 171/309 (55%), Positives = 217/309 (70%), Gaps = 12/309 (4%)
 Frame = +2

Query  128   IMMSCCFCKQTQPMVSFPSG-LNISSRWR---KDKVVFVMGATGTGKSRLAIDLATRFV-  292
             I +S C CKQ  P+VSF  G L++ S +    K+KVV +MGATGTGK++LAID+A  F  
Sbjct  3     ISISACACKQELPLVSFQKGSLSMESLFHNRNKEKVVVIMGATGTGKTKLAIDVAKHFQP  62

Query  293   AEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAI  472
             AEVVNSDKMQVY+GLDI TNKV EEEC GVPHHLLG VDP ++FTA DFCR A  A+D+I
Sbjct  63    AEVVNSDKMQVYEGLDITTNKVTEEECSGVPHHLLGTVDPYINFTANDFCRHATLAIDSI  122

Query  473   TRKDRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEG  652
               K+ LPIIAGGSNSY+ ALV  + EFR +Y+CCFLW+DV +PVL+  +  RV++M+E G
Sbjct  123   VEKNGLPIIAGGSNSYLDALVNHYPEFRLRYQCCFLWVDVSLPVLHSSLQARVDRMIEAG  182

Query  653   LIEEAREFFDPA-GDYTRGIKRAIGVPEMDQYFRILEAS---DERMRQEVLQTGIDNIKA  820
              + E R+FFDP+  DYT+GI+RAIGVPE D + R  EA+   DER +Q +L+  I  +K 
Sbjct  183   QVNEVRQFFDPSVTDYTKGIRRAIGVPEFDDFLRA-EANGGVDERTKQRLLEAAIARLKI  241

Query  821   NTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMI  1000
             N C LA+ Q+Q I RL   L   N+ HRLDATE F K      EA EAWE  V + S  I
Sbjct  242   NNCTLANRQIQKIHRLHG-LWKRNM-HRLDATEVFLKNATRQEEAEEAWEDHVLSKSRRI  299

Query  1001  VHDFICQGT  1027
             ++ F+ + T
Sbjct  300   LNKFLYEDT  308



>ref|XP_004486153.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Cicer arietinum]
Length=339

 Score =   326 bits (835),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 165/297 (56%), Positives = 207/297 (70%), Gaps = 14/297 (5%)
 Frame = +2

Query  149   CKQTQPMVSFPSGL----NISSRWRKDKVVFVMGATGTGKSRLAIDLATRF-VAEVVNSD  313
             CKQ  P+V+F  GL    ++     KDKVV +MGATGTGK++LAIDLA  F  AE+VNSD
Sbjct  12    CKQELPLVNFQKGLTKMESLFHNRNKDKVVVIMGATGTGKTKLAIDLAKHFQPAEIVNSD  71

Query  314   KMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLP  493
             KMQVYKGLDI TNKV +EEC GVPHHLLGV+DP  +FTA DFC  A  A+D+I  KD LP
Sbjct  72    KMQVYKGLDITTNKVTKEECDGVPHHLLGVIDPTSNFTANDFCHHACLAIDSIVEKDGLP  131

Query  494   IIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEARE  673
             IIAGGSNSY+  LV   +EFR +YECCFLW+DV +PVL+  +  RV++M+E G ++E RE
Sbjct  132   IIAGGSNSYLDTLVNHCSEFRLRYECCFLWVDVSLPVLHSSLQSRVDRMIEAGQVDEVRE  191

Query  674   FFDPAGDYTRGIKRAIGVPEMDQYFRILEA--SDERMRQEVLQTGIDNIKANTCKLASCQ  847
             FF+P GDYT+GI+RAIGVPE    F + EA  +DER ++ +L++ I  +K N C LA+ Q
Sbjct  192   FFNPCGDYTKGIRRAIGVPEFHD-FLVAEANSADERTKKRLLESAIARVKINNCTLANRQ  250

Query  848   LQNILRLQSQLEGWN-IVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             +Q I RL      W   +HRLDATE   K G  G E  E WE  V   S MI+H+F+
Sbjct  251   VQKIRRLNGM---WKRNMHRLDATEPLIKGGSRGCE--EVWENHVLTKSLMILHNFL  302



>ref|XP_004134460.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004173763.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Cucumis sativus]
 gb|KGN57030.1| hypothetical protein Csa_3G150100 [Cucumis sativus]
Length=324

 Score =   325 bits (832),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 165/313 (53%), Positives = 223/313 (71%), Gaps = 10/313 (3%)
 Frame = +2

Query  128   IMMSCCFCKQTQPMV-SFPSGLNISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEV  301
             + ++    KQ QP+V +F    N+   +R KDKVV VMGATGTGKSRLAI+LATRF +E+
Sbjct  5     LSLTSAAGKQVQPLVGNFQGNFNMEQFFRRKDKVVVVMGATGTGKSRLAIELATRFPSEI  64

Query  302   VNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRK  481
             VNSDK+QVY+GLD+VTNKV EEE +G+PHHLL  +DP  +F++ DF   A  A+++I  +
Sbjct  65    VNSDKIQVYEGLDVVTNKVTEEERRGIPHHLLSSIDPKSNFSSRDFTHHASGAIESILAR  124

Query  482   DRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIE  661
             DRLPIIAGGSNSYI+ALV D+AE R +YE CFLW+DV +P+L +FVSDRV++MV+ G +E
Sbjct  125   DRLPIIAGGSNSYIEALVNDYAEARFRYEFCFLWVDVSLPILQKFVSDRVDRMVDGGFVE  184

Query  662   EAREFFDPAGDYTRGIKRAIGVPEMDQYFRI-LEASDERMRQEVLQTGIDNIKANTCKLA  838
             E R+ FDP GDY++GIKRAIGVPE+ ++ R   + +DER+   +L+  I  IK NTC+LA
Sbjct  185   EVRQIFDPEGDYSQGIKRAIGVPELHEFLRAERDGADERVLNILLELAISRIKDNTCRLA  244

Query  839   SCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFIC  1018
               QL+ I  L+S+   WN+  RLDAT         G  + + WE+LV  PS+ IV  F+C
Sbjct  245   FRQLEKIRLLRSKW-NWNL-RRLDATGVILT---DGENSLDVWEKLVLEPSSRIVDQFLC  299

Query  1019  QGT--TTTFLAPP  1051
              G+   TT ++ P
Sbjct  300   DGSRRITTGISTP  312



>ref|XP_008804944.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Phoenix dactylifera]
Length=373

 Score =   327 bits (837),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 161/281 (57%), Positives = 209/281 (74%), Gaps = 6/281 (2%)
 Frame = +2

Query  209   RKD-KVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVP  385
             RKD KVVFV+GATG+GKS+LAI LAT+F  E++NSDKMQVY GLD++TNKV +EE  G+P
Sbjct  10    RKDNKVVFVLGATGSGKSKLAIALATQFDGEIINSDKMQVYGGLDVITNKVTKEESAGIP  69

Query  386   HHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVK-DHAEFRSK  562
             HHLLGVV P+ DFTA DF R+A+ A+D+I  + R+PI+AGGSNSYI+ LV  +  EFRS+
Sbjct  70    HHLLGVVHPDADFTALDFRREAVHAIDSILGRGRVPIVAGGSNSYIEGLVDGEGGEFRSR  129

Query  563   YECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQ  742
             Y+C FLW+D  +P+L+ FVS RV++M E+GL+EEAR  F    DY+RGI+R+IGVPEMD 
Sbjct  130   YQCLFLWVDAALPLLHSFVSARVDRMAEKGLVEEARSLFHANADYSRGIRRSIGVPEMDH  189

Query  743   YFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEA  922
             YFR+  ++DE  R  +L+  +D IKANTCKL   QLQ I R  + L GW++ HR+DA E 
Sbjct  190   YFRMEASADEETRARILEAAVDEIKANTCKLTCIQLQKIHRFCT-LPGWDL-HRIDAGEF  247

Query  923   FQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGTTTTFLA  1045
             F KRG  G EA EAWE++V +PST IV  F+        +A
Sbjct  248   FLKRGQEG-EA-EAWEKVVESPSTEIVRRFLTGAGAVKHMA  286



>ref|XP_010420690.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Camelina sativa]
 ref|XP_010420691.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Camelina sativa]
Length=330

 Score =   325 bits (832),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 172/289 (60%), Positives = 213/289 (74%), Gaps = 9/289 (3%)
 Frame = +2

Query  161   QPMVSFPSGLNISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGL  337
             QP+++F   +     +R KDKVVFVMGATGTGKSRLAIDLATRF AE+VNSDK+QVYKGL
Sbjct  14    QPLLNFQGNMVDGPFFRRKDKVVFVMGATGTGKSRLAIDLATRFPAEIVNSDKIQVYKGL  73

Query  338   DIVTNKVREEECQGVPHHLLGVV-DPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSN  514
             DIVTNKV  EE  GVPHHLLG V D   DFTA DF R+A++AV++I ++DR+PIIAGGSN
Sbjct  74    DIVTNKVTPEESLGVPHHLLGTVHDTYEDFTAEDFQREAIRAVESIVQRDRVPIIAGGSN  133

Query  515   SYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDP-AG  691
             SYI+ALV +  +FR +Y CCFLW+DV  PVL+ FVS+RV+KMVE GL++E R  FDP + 
Sbjct  134   SYIEALVNNCVDFRLRYNCCFLWVDVSRPVLHSFVSERVDKMVEMGLVDEVRRIFDPSSS  193

Query  692   DYTRGIKRAIGVPEMDQYFRI-LEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRL  868
             DY+ GI+RAIGVPE+D++ R  +        + +L+T I NIK NTC LA  QLQ I RL
Sbjct  194   DYSAGIRRAIGVPELDEFLRSEMRNYPAETTERLLETAIKNIKENTCLLACRQLQKIQRL  253

Query  869   QSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
               Q + WN+ HR+DATE F +R   G EA EAWE  VA PS + V  F+
Sbjct  254   YKQWK-WNM-HRVDATEVFLRR---GEEADEAWENAVARPSALAVDRFL  297



>ref|XP_009385519.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=326

 Score =   324 bits (830),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 166/280 (59%), Positives = 209/280 (75%), Gaps = 8/280 (3%)
 Frame = +2

Query  191   NISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEE  370
             +  SR  KDKVVFVMGATGTGKSRLA+D+A  F  E+VNSDKMQVY GLD+VTNKV +EE
Sbjct  3     SFKSRGGKDKVVFVMGATGTGKSRLAVDVAIHFGGEIVNSDKMQVYDGLDVVTNKVTDEE  62

Query  371   CQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHA-  547
               GVPHHLLG + P+ DF+A+DF R A   V++I R+ RLPI+AGGSNSYI+ LV+    
Sbjct  63    RMGVPHHLLGGLPPDADFSASDFRRAATLQVESIARRGRLPIVAGGSNSYIEELVEGAGR  122

Query  548   EFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDP-AGDYTRGIKRAIG  724
             EF  +YECCFLW+DV++PVL++FV++RV++MVE GL+EE R  FDP   DY+RG++RAIG
Sbjct  123   EFWRRYECCFLWVDVQLPVLHKFVAERVDRMVERGLVEEVRGLFDPDVADYSRGVRRAIG  182

Query  725   VPEMDQYFR-ILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVH  901
             VPEMD+Y R     +DE  +  +L+  ID IKANTCKL  CQLQ I RL + L GWN VH
Sbjct  183   VPEMDRYLRAEAAEADEATKARLLEAAIDEIKANTCKLTCCQLQKIHRLCT-LSGWN-VH  240

Query  902   RLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQ  1021
             R+DAT+ F++   +G E  EAW  LVA PS  IV +F+ Q
Sbjct  241   RVDATDVFRR---AGKEVDEAWASLVAGPSVEIVAEFLHQ  277



>ref|XP_002268848.3| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Vitis vinifera]
 ref|XP_010655053.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Vitis vinifera]
 ref|XP_010655054.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Vitis vinifera]
 ref|XP_010655055.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Vitis vinifera]
 ref|XP_010655056.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Vitis vinifera]
 emb|CBI38978.3| unnamed protein product [Vitis vinifera]
Length=310

 Score =   323 bits (829),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 172/294 (59%), Positives = 205/294 (70%), Gaps = 20/294 (7%)
 Frame = +2

Query  146   FCKQTQPMVSFPSG---LNISS-RWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSD  313
              CKQTQP++S P G   + +SS RW K+KV  VMGATGTGKSRL+ID ATRF AE+VNS 
Sbjct  3     MCKQTQPLLSMPPGGLTMAVSSHRWLKEKVAVVMGATGTGKSRLSIDPATRFPAEIVNSH  62

Query  314   KMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLP  493
             KMQVY+GLDI+TNK+ EEE  G PHH LG+  PNVDFTA+DF   A  ++++I    RLP
Sbjct  63    KMQVYEGLDIITNKITEEEQPGAPHHHLGIAHPNVDFTASDFRDMASLSIESILGGRRLP  122

Query  494   IIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEARE  673
             II GGSNSYI A          +YECCFLW+DV  PVL+ FVS RV+KMV  G++EE  +
Sbjct  123   IIVGGSNSYIDA----------RYECCFLWVDVSRPVLHSFVSKRVDKMVGNGMVEEVEQ  172

Query  674   FFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQ  853
              F P  DYTRGI+RAIGVPE+D YF      DE  R +VLQ  +  IKANTCKLA  QL+
Sbjct  173   LFYPNADYTRGIRRAIGVPELDLYFPT-GFLDEEARAKVLQEAVHEIKANTCKLACRQLE  231

Query  854   NILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
              I RL++ L  W I HRLDATE F K      EA EAWE+LVA PSTM+V  F+
Sbjct  232   GIHRLKN-LRKWKI-HRLDATEVFLKH---DREADEAWEKLVARPSTMMVAQFL  280



>ref|XP_006288171.1| hypothetical protein CARUB_v10001408mg [Capsella rubella]
 gb|EOA21069.1| hypothetical protein CARUB_v10001408mg [Capsella rubella]
Length=330

 Score =   323 bits (829),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 171/289 (59%), Positives = 211/289 (73%), Gaps = 9/289 (3%)
 Frame = +2

Query  161   QPMVSFPSGL-NISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGL  337
             QP+++F   + ++    RKDKVVFVMGATGTGKSRLAIDLATRF AE+VNSDK+QVYKGL
Sbjct  14    QPLLNFQGNMVDVPFFRRKDKVVFVMGATGTGKSRLAIDLATRFPAEIVNSDKIQVYKGL  73

Query  338   DIVTNKVREEECQGVPHHLLGVV-DPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSN  514
             DIVTNKV  EE  GVPHHLLG V D   DFTA DF R+A++AV++I ++DR+PIIAGGSN
Sbjct  74    DIVTNKVTPEESLGVPHHLLGTVHDTYQDFTAEDFQREAIRAVESIVQRDRVPIIAGGSN  133

Query  515   SYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDP-AG  691
             SYI+ALV D  +FR +Y CCFLW+DV  PVL+ FVS+RV+KMVE GL++E R  FDP + 
Sbjct  134   SYIEALVNDCVDFRLRYNCCFLWVDVSKPVLHSFVSERVDKMVEMGLVDEVRRIFDPSSS  193

Query  692   DYTRGIKRAIGVPEMDQYFRI-LEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRL  868
             DY+ GI+RAIGVPE+D++ R  +        + +L+T I  IK N C LA  QLQ I RL
Sbjct  194   DYSAGIRRAIGVPELDEFLRSEMRNYPAETTERLLETAIKKIKENNCLLACRQLQKIQRL  253

Query  869   QSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
               Q + WN+ HR+DATE F +R   G EA EAWE  VA P  M V  F+
Sbjct  254   YKQWK-WNM-HRVDATEVFLRR---GEEADEAWENTVARPCAMAVDRFL  297



>ref|XP_008780079.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Phoenix dactylifera]
Length=319

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 160/270 (59%), Positives = 206/270 (76%), Gaps = 5/270 (2%)
 Frame = +2

Query  209   RKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPH  388
             R+ KVVFV+G TG+GKS+LAI LAT+F  EVVNSDKMQVY GLD+++NKV EEE  G+PH
Sbjct  9     RQGKVVFVLGPTGSGKSKLAITLATQFNGEVVNSDKMQVYDGLDVISNKVTEEESAGIPH  68

Query  389   HLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVK-DHAEFRSKY  565
             HL+G V P+ DFTA+DFCR A+ A+D+I R+ R+PI+AGGSNSYI+ALV  + +EFRS+Y
Sbjct  69    HLIGGVHPDADFTASDFCRAAMHAIDSILRRGRVPIVAGGSNSYIEALVDGEGSEFRSRY  128

Query  566   ECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQY  745
             E CF+WIDV++P+L+ FVS RV+KMVE+GL+EEAR  F   GDY++GI+R+IGVPEMD Y
Sbjct  129   ESCFVWIDVDLPLLHFFVSIRVDKMVEQGLVEEARSAFRQDGDYSKGIRRSIGVPEMDSY  188

Query  746   FRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAF  925
             FR+  +  E  R  +L+  +  IK NTC L   QL+ I R  + L GW+ VHR+DATE F
Sbjct  189   FRMEASIGEATRARMLEAAVTEIKFNTCTLTCNQLKKIHRFCT-LPGWD-VHRIDATEFF  246

Query  926   QKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
              KRG  G EA EAWE++V  PS  IV  F+
Sbjct  247   LKRGQEG-EA-EAWEKVVEGPSKEIVQRFL  274



>ref|XP_010454167.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic 
[Camelina sativa]
 ref|XP_010454169.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic 
[Camelina sativa]
Length=330

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 171/289 (59%), Positives = 213/289 (74%), Gaps = 9/289 (3%)
 Frame = +2

Query  161   QPMVSFPSGLNISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGL  337
             QP+++F   +     +R KDKVVFVMGATGTGKSRLAIDLATRF AE+VNSDK+QVYKGL
Sbjct  14    QPLLNFQGNMVDGPFFRRKDKVVFVMGATGTGKSRLAIDLATRFPAEIVNSDKIQVYKGL  73

Query  338   DIVTNKVREEECQGVPHHLLGVV-DPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSN  514
             DIVTNKV  EE  GVPHHLLG V D   DFTA DF R+A++AV++I ++DR+PIIAGGSN
Sbjct  74    DIVTNKVTPEESLGVPHHLLGTVHDTYEDFTAEDFQREAIRAVESIVQRDRVPIIAGGSN  133

Query  515   SYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDP-AG  691
             SYI+ALV +  +FR +Y CCFLW+DV  PVL+ FVS+RV+KMVE GL++E R  FDP + 
Sbjct  134   SYIEALVNNCVDFRLRYNCCFLWVDVSRPVLHSFVSERVDKMVEMGLVDEVRRIFDPSSS  193

Query  692   DYTRGIKRAIGVPEMDQYFRI-LEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRL  868
             DY+ GI+RAIGVPE+D++ R  +        + +L+T I+ IK NTC LA  QLQ I RL
Sbjct  194   DYSAGIRRAIGVPELDEFLRSEMRNYPAETTERLLETAIEKIKENTCLLACRQLQKIQRL  253

Query  869   QSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
               Q + WN+ HR+DATE F +R   G EA EAWE  VA PS + V  F+
Sbjct  254   YKQWK-WNM-HRVDATEVFLRR---GIEADEAWENAVARPSALAVDRFL  297



>dbj|BAB59032.1| cytokinin synthase [Arabidopsis thaliana]
Length=330

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 168/272 (62%), Positives = 205/272 (75%), Gaps = 8/272 (3%)
 Frame = +2

Query  209   RKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPH  388
             RKDKVVFVMGATGTGKSRLAIDLATRF AE+VNSDK+QVYKGLDIVTNKV  EE  GVPH
Sbjct  31    RKDKVVFVMGATGTGKSRLAIDLATRFPAEIVNSDKIQVYKGLDIVTNKVTPEESLGVPH  90

Query  389   HLLGVV-DPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHAEFRSKY  565
             HLLG V D   DFTA DF R+A++AV++I ++DR+PIIAGGSNSYI+ALV D  +FR +Y
Sbjct  91    HLLGTVHDTYEDFTAEDFQREAIRAVESIVQRDRVPIIAGGSNSYIEALVNDCVDFRLRY  150

Query  566   ECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDP-AGDYTRGIKRAIGVPEMDQ  742
              CCFLW+DV  PVL+ FVS+RV+KMVE GL++E R  FDP + DY+ GI+RAIGVPE+D+
Sbjct  151   NCCFLWVDVSRPVLHSFVSERVDKMVEMGLVDEVRRIFDPSSSDYSAGIRRAIGVPELDE  210

Query  743   YFRI-LEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATE  919
             + R  +        + +L+T I+ IK NTC LA  QLQ I RL  Q + WN+ HR+DATE
Sbjct  211   FLRSEMRNYPAETTERLLETAIEKIKENTCLLACRQLQKIQRLYKQWK-WNM-HRVDATE  268

Query  920   AFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
              F +R   G EA EAW+  VA PS + V  F+
Sbjct  269   VFLRR---GEEADEAWDNSVAHPSALAVEKFL  297



>gb|KCW49921.1| hypothetical protein EUGRSUZ_K03385, partial [Eucalyptus grandis]
Length=352

 Score =   323 bits (829),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 161/302 (53%), Positives = 217/302 (72%), Gaps = 12/302 (4%)
 Frame = +2

Query  134   MSCCFCKQT-QPMVSFPSGLNISSRW------RKDKVVFVMGATGTGKSRLAIDLATRFV  292
             +S   CK T QP++   S +  S+R       +K+KVV ++G TG GKSRL+ID+A+ F 
Sbjct  31    ISMVKCKPTAQPLLHAASLVRRSNRGFYKLSPQKEKVVVILGVTGAGKSRLSIDIASHFP  90

Query  293   AEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAI  472
             AE+VNSDK+QV+KGLDIVTNK+ EEE +G+PHHLLG + P+ DFTA++F   AL A+++I
Sbjct  91    AEIVNSDKIQVHKGLDIVTNKITEEEQRGIPHHLLGTIPPDADFTASEFSNSALLAIESI  150

Query  473   TRKDRLPIIAGGSNSYIKALVKDH-AEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEE  649
               +   P+I GGSNSYI+ L+  H   F+S YECCFLW+D  MP+L+ F+S RV+KMVE 
Sbjct  151   RARGNTPVIVGGSNSYIETLIASHDYRFQSNYECCFLWVDAAMPILHSFLSKRVDKMVER  210

Query  650   GLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTC  829
             G++EEAR  FDP G Y+RGI+RAIG+PE+D  FR  +  D +    +L+  ++ IK NTC
Sbjct  211   GMVEEARNAFDPNGQYSRGIRRAIGLPELDLLFRTEKFLDRQAHARLLKEAMEEIKTNTC  270

Query  830   KLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHD  1009
             KLAS QL+ I RL++Q +GWN+ HR+DATE F K G   A+A EAWE LVA PST IV +
Sbjct  271   KLASRQLEKIHRLRNQ-KGWNL-HRMDATEVFCKHG--KADADEAWEELVAGPSTKIVAE  326

Query  1010  FI  1015
             F+
Sbjct  327   FL  328



>ref|XP_006400459.1| hypothetical protein EUTSA_v10015859mg [Eutrema salsugineum]
 gb|ESQ41912.1| hypothetical protein EUTSA_v10015859mg [Eutrema salsugineum]
Length=336

 Score =   323 bits (827),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 174/307 (57%), Positives = 218/307 (71%), Gaps = 14/307 (5%)
 Frame = +2

Query  128   IMMSCCFCKQTQPM-VSFPSGLN---ISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVA  295
             +++       T P+ +S  +GLN   +    RKDKV+FVMGATGTGKSRLAIDLATRF A
Sbjct  6     VLIRRIMSNPTIPLKMSISAGLNMVDVPFFRRKDKVIFVMGATGTGKSRLAIDLATRFPA  65

Query  296   EVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNV--DFTAADFCRQALQAVDA  469
             E+VNSDK+QVYKGLDIVTNKV  EE  GVPHHLLG VD N+  DFTA DF R+A++AV++
Sbjct  66    EIVNSDKIQVYKGLDIVTNKVTPEESLGVPHHLLGTVD-NIYDDFTAEDFQREAIRAVES  124

Query  470   ITRKDRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEE  649
             I  +DR+PIIAGGSNSYI+ALV    +FR +Y CCFLW+DV  PVL+ FVS+RV+KMVE 
Sbjct  125   IVERDRVPIIAGGSNSYIEALVNGCVDFRLRYNCCFLWVDVSRPVLHSFVSERVDKMVEM  184

Query  650   GLIEEAREFFDP-AGDYTRGIKRAIGVPEMDQYFRI-LEASDERMRQEVLQTGIDNIKAN  823
             GL++E R  FDP + DY+ GI+RAIGVPE+D++ R  +  S     + +L+T I+ IK N
Sbjct  185   GLVDEVRRIFDPSSSDYSAGIRRAIGVPELDEFLRAEMRNSPAETTERLLETAIEKIKEN  244

Query  824   TCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIV  1003
              C LA  Q Q I RL  Q + WN+ HR+DATE F++R   G EA EAWE  VA PS   V
Sbjct  245   NCLLACRQRQKIQRLYKQWK-WNM-HRVDATEVFRRR---GEEAEEAWENTVARPSARAV  299

Query  1004  HDFICQG  1024
               F+  G
Sbjct  300   ERFLNYG  306



>ref|XP_010492943.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Camelina sativa]
 ref|XP_010492944.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Camelina sativa]
Length=330

 Score =   322 bits (826),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 171/289 (59%), Positives = 212/289 (73%), Gaps = 9/289 (3%)
 Frame = +2

Query  161   QPMVSFPSGLNISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGL  337
             QP+++F   +     +R KDKVVFVMGATGTGKSRLAIDLATRF AE+VNSDK+QVYKGL
Sbjct  14    QPLLNFKGNMIDGPFFRRKDKVVFVMGATGTGKSRLAIDLATRFPAEIVNSDKIQVYKGL  73

Query  338   DIVTNKVREEECQGVPHHLLGVV-DPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSN  514
             DIVTNKV  EE  GVPHHLLG V D   DFTA DF R+A++AV++I ++DR+PIIAGGSN
Sbjct  74    DIVTNKVTPEESLGVPHHLLGTVHDTYEDFTAEDFQREAIRAVESIVQRDRVPIIAGGSN  133

Query  515   SYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDP-AG  691
             SYI+ALV +  +FR +Y CCFLW+DV  PVL+ FVS+RV+KMVE GL++E R  FDP + 
Sbjct  134   SYIEALVNNCVDFRLRYNCCFLWVDVSRPVLHSFVSERVDKMVEMGLVDEVRRIFDPSSS  193

Query  692   DYTRGIKRAIGVPEMDQYFRI-LEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRL  868
             DY+ GI+RAIGVPE+D++ R  +        + +L+T I  IK NTC LA  QLQ I RL
Sbjct  194   DYSAGIRRAIGVPELDEFLRSEMRNYPAETTERLLETAIKKIKENTCLLACRQLQKIQRL  253

Query  869   QSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
               Q + WN+ HR+DATE F +R   G EA EAWE  VA PS + V  F+
Sbjct  254   YKQWK-WNM-HRVDATEVFLRR---GEEADEAWENAVARPSALAVDRFL  297



>ref|XP_010255880.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Nelumbo nucifera]
Length=330

 Score =   322 bits (826),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 170/320 (53%), Positives = 221/320 (69%), Gaps = 13/320 (4%)
 Frame = +2

Query  125   RIMMSCCFCKQTQPMVSFP-SGLNISS---RWRKDKVVFVMGATGTGKSRLAIDLATRFV  292
             RI MS   CKQ   +++FP SG+++ S   R  K+ VVFVMGATGTGKS+L+IDLAT F 
Sbjct  2     RIAMSTA-CKQAHSLLNFPGSGISMESFNVRRPKNTVVFVMGATGTGKSKLSIDLATHFR  60

Query  293   AEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAI  472
             AE++NSDKMQVY+GLDI TNKV EEE  G+PHHLLGVV P+ DFTA DF R A  AV++I
Sbjct  61    AEIINSDKMQVYEGLDIATNKVTEEEMCGIPHHLLGVVHPDADFTAEDFRRAASLAVESI  120

Query  473   TRKDRLPIIAGGSNSYIKALVKDHA-EFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEE  649
               +D+LPII GGSNSYI+ALV+    EF SKY+C FLW++V +PVL +FVSDRV+ MVE 
Sbjct  121   VSRDKLPIIVGGSNSYIEALVEGGGREFGSKYDCLFLWVNVSLPVLDKFVSDRVDGMVEA  180

Query  650   GLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQ--EVLQTGIDNIKAN  823
             GL++E R+ F P  DY+RGI++AIGVPE D + R   A+         +L    D++K N
Sbjct  181   GLVDEIRKVFKPEADYSRGIRKAIGVPEFDGFLRAEAAATADEETMAGLLGAATDDVKVN  240

Query  824   TCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIV  1003
             TCKL  CQL+ ILRL+  +  WN+ H LDAT+ F+++   G EA EAWE+L+  P+   V
Sbjct  241   TCKLVRCQLEKILRLR-DVRKWNL-HYLDATQVFERQ---GKEAGEAWEKLITGPAKEYV  295

Query  1004  HDFICQGTTTTFLAPPTSPN  1063
               F  +G     +A   +P 
Sbjct  296   RKFRYRGIEDRAVATAAAPT  315



>ref|XP_010942491.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Elaeis guineensis]
Length=309

 Score =   321 bits (823),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 166/282 (59%), Positives = 207/282 (73%), Gaps = 13/282 (5%)
 Frame = +2

Query  173   SFPSGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTN  352
             S PSG        KDKVVFV+G TG+GKS+LAI LAT+F  EVVNSDKMQVY GLD++TN
Sbjct  5     SLPSG--------KDKVVFVLGPTGSGKSKLAITLATQFNGEVVNSDKMQVYDGLDVITN  56

Query  353   KVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKAL  532
             KV +EE  G+PHHL+G V P+ DFTA+DFCR+A+ A+D+I ++  +PIIAGGSNSYI+AL
Sbjct  57    KVTDEESAGIPHHLIGGVHPDADFTASDFCREAMHAIDSILQRGHVPIIAGGSNSYIEAL  116

Query  533   VKDHAE-FRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGI  709
             V      FRS++E CF+WIDV+  +L+ FVS RV+KMVE GL+EEAR  F   GDY++GI
Sbjct  117   VDGEGGVFRSRHESCFVWIDVDPSLLHLFVSTRVDKMVEMGLVEEARSEFHQDGDYSKGI  176

Query  710   KRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGW  889
             +R+IGVPEMD YFR+  + DE  R  +L+  I  IK NTCKL   QLQ I RL S L GW
Sbjct  177   RRSIGVPEMDGYFRMEASVDEATRARMLEAAITEIKFNTCKLTCNQLQKIHRL-STLPGW  235

Query  890   NIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             + VHR+DAT  F KRG  G EA EAWE++VA P   IV+ F+
Sbjct  236   D-VHRIDATGFFLKRGREG-EA-EAWEKVVAGPGKEIVNRFL  274



>ref|NP_197405.1| isopentenyltransferase 5 [Arabidopsis thaliana]
 sp|Q94ID2.2|IPT5_ARATH RecName: Full=Adenylate isopentenyltransferase 5, chloroplastic; 
Short=AtIPT5; AltName: Full=Adenylate dimethylallyltransferase 
5; AltName: Full=Cytokinin synthase 5; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB59041.1| adenylate isopentenyltransferase [Arabidopsis thaliana]
 gb|AED92645.1| isopentenyltransferase 5 [Arabidopsis thaliana]
Length=330

 Score =   322 bits (824),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 167/272 (61%), Positives = 205/272 (75%), Gaps = 8/272 (3%)
 Frame = +2

Query  209   RKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPH  388
             RKDKVVFVMGATGTGKSRLAIDLATRF AE+VNSDK+QVYKGLDIVTNKV  EE  GVPH
Sbjct  31    RKDKVVFVMGATGTGKSRLAIDLATRFPAEIVNSDKIQVYKGLDIVTNKVTPEESLGVPH  90

Query  389   HLLGVV-DPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHAEFRSKY  565
             HLLG V D   DFTA DF R+A++AV++I ++DR+PIIAGGSNSYI+ALV D  +FR +Y
Sbjct  91    HLLGTVHDTYEDFTAEDFQREAIRAVESIVQRDRVPIIAGGSNSYIEALVNDCVDFRLRY  150

Query  566   ECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDP-AGDYTRGIKRAIGVPEMDQ  742
              CCFLW+DV  PVL+ FVS+RV+KMV+ GL++E R  FDP + DY+ GI+RAIGVPE+D+
Sbjct  151   NCCFLWVDVSRPVLHSFVSERVDKMVDMGLVDEVRRIFDPSSSDYSAGIRRAIGVPELDE  210

Query  743   YFRI-LEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATE  919
             + R  +        + +L+T I+ IK NTC LA  QLQ I RL  Q + WN+ HR+DATE
Sbjct  211   FLRSEMRNYPAETTERLLETAIEKIKENTCLLACRQLQKIQRLYKQWK-WNM-HRVDATE  268

Query  920   AFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
              F +R   G EA EAW+  VA PS + V  F+
Sbjct  269   VFLRR---GEEADEAWDNSVAHPSALAVEKFL  297



>ref|XP_011102233.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Sesamum indicum]
Length=307

 Score =   320 bits (821),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 162/271 (60%), Positives = 198/271 (73%), Gaps = 6/271 (2%)
 Frame = +2

Query  212   KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHH  391
             KDKVV V+GATGTGKS L IDLATRF  EV+NSDK+QVYKGLDIVTN V  EEC GVPHH
Sbjct  28    KDKVVVVLGATGTGKSCLEIDLATRFGTEVINSDKIQVYKGLDIVTNMVSNEECSGVPHH  87

Query  392   LLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHAEFRSKYEC  571
             LL  +DP VDFT  DF   AL   DAI +K+RLPII GGSNS+I+ALV ++ EF SKYEC
Sbjct  88    LLRTIDPEVDFTVHDFVHHALLPADAIIQKNRLPIITGGSNSFIQALVINNTEFSSKYEC  147

Query  572   CFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPA-GDYTRGIKRAIGVPEMDQYF  748
             CFLW+DV +PVL+ +VS RV++MV  GL+EE    FDP   DY  GI+RAIGV EMD++F
Sbjct  148   CFLWMDVAIPVLHSYVSKRVDQMVNSGLVEEGNAIFDPKIRDYDYGIRRAIGVSEMDEFF  207

Query  749   RILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQ  928
             R     D   R ++L+  I+ IK NTCKLA  Q + ILR++S++ GW I +RL+ATE + 
Sbjct  208   RSEGLVDGETRAKLLKATINEIKMNTCKLACRQFEKILRMRSEV-GWQI-YRLNATEVYL  265

Query  929   KRGGSGAEAYEAWERLVAAPSTMIVHDFICQ  1021
             + GG   +A EAWE+LV  PST +V  FIC 
Sbjct  266   RCGG---DANEAWEKLVLEPSTNMVAHFICN  293



>gb|EYU43837.1| hypothetical protein MIMGU_mgv1a020459mg [Erythranthe guttata]
Length=315

 Score =   321 bits (822),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 175/324 (54%), Positives = 214/324 (66%), Gaps = 41/324 (13%)
 Frame = +2

Query  125   RIMMSCCFCKQTQ--PMVSFPSGL-NISSRW------RKDKVVFVMGATGTGKSRLAIDL  277
             RI  S C   Q    P+V+FP+GL NI  +       RK+KVV VMGATGTGKSRL+IDL
Sbjct  2     RISFSACKPPQAAAPPLVNFPAGLINIMDKLILPRQRRKEKVVVVMGATGTGKSRLSIDL  61

Query  278   ATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQ  457
             ATRF AE++NSDKMQVY+GLD+VTNKV   EC+GVPHHLLG+ DP+ DFTAADF  +A  
Sbjct  62    ATRFGAEIINSDKMQVYRGLDVVTNKVTAAECRGVPHHLLGIADPDDDFTAADFVERASL  121

Query  458   AVDAITRKDRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEK  637
             A + IT + RLPIIAGGSNS++KALV D   FRS+YECCFLW+DV +PVL+ FVS RV++
Sbjct  122   AAEEITHRGRLPIIAGGSNSFVKALVSDDHYFRSRYECCFLWVDVSLPVLHYFVSKRVDR  181

Query  638   MVEEGLIEEAREFFDPA-GDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNI  814
             MV  GL++EARE F  A GDY+RGI    G                    ++L+  +D I
Sbjct  182   MVVAGLVDEARELFAGAGGDYSRGIAGPSGA-------------------DLLERAVDQI  222

Query  815   KANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPST  994
             KA T  L  CQL+NI RL+  LE    +HRL+ATEA  + GG   +A EAWER+VA P T
Sbjct  223   KACTRNLVCCQLRNIARLEEHLE--RRIHRLNATEALLRHGG---DADEAWERVVAGPGT  277

Query  995   MIVHDFICQGTTTTFLAPPTSPNS  1066
              IV  F+C         PPT P S
Sbjct  278   AIVGRFLCD-------EPPTPPMS  294



>ref|XP_008786948.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Phoenix dactylifera]
Length=364

 Score =   322 bits (826),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 166/288 (58%), Positives = 207/288 (72%), Gaps = 13/288 (5%)
 Frame = +2

Query  164   PMVSFPSGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDI  343
             PM SFP       R RK KVV VMGATGTGKSRLAIDLA RF  EVVNSDKMQ+Y GLD+
Sbjct  29    PMGSFPV------RARKGKVVVVMGATGTGKSRLAIDLAVRFGGEVVNSDKMQLYDGLDV  82

Query  344   VTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYI  523
             VTNKV +EE +G+PHHLLG V P+ D TA+DF   A  A ++I ++  +P++AGGSNSYI
Sbjct  83    VTNKVTDEETRGIPHHLLGGVPPDADLTASDFRLAAGSATNSIAQRGWVPVVAGGSNSYI  142

Query  524   KALVKDHA-EFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYT  700
             + L+     EFRS+Y CCFLW+DV++  L+ FV +RV++MVE GL+EE R  FDP  DY 
Sbjct  143   EELIDGAGREFRSRYACCFLWVDVQLKELHRFVGERVDRMVERGLVEEVRGVFDPEADYG  202

Query  701   RGIKRAIGVPEMDQYFRI-LEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQ  877
             RGI++AIGVPEMD+Y R   E +DE  +  +L+  ID+IKANTCKL  CQLQ I RL++ 
Sbjct  203   RGIRKAIGVPEMDRYLRAEAEGADEWTKARLLEAAIDDIKANTCKLTCCQLQKINRLRT-  261

Query  878   LEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQ  1021
             L GW+ VHR+DATE F+KR   G EA   W+ LV  PS  IV +F+ Q
Sbjct  262   LPGWD-VHRVDATEVFRKR---GEEADRTWDELVCRPSLEIVGEFLNQ  305



>ref|XP_004296948.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
isoform 2 [Fragaria vesca subsp. vesca]
Length=353

 Score =   322 bits (824),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 175/319 (55%), Positives = 220/319 (69%), Gaps = 18/319 (6%)
 Frame = +2

Query  131   MMSCCFCKQTQPMVSF---PSGLNISSRW--RKDKVVFVMGATGTGKSRLAIDLATRFVA  295
             M +C    Q QPM+ F   P+GL+I   +   KDKVV V+GATGTGKSRLAIDLA ++ A
Sbjct  7     MSACQQVVQIQPMIRFQGPPAGLSIDRFFSRNKDKVVIVIGATGTGKSRLAIDLALKYSA  66

Query  296   EVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAIT  475
             E++NSDKMQVYKGLD +TNKV EEEC+GVPHHLLG VDP+ +FTA DF   A  A+++I 
Sbjct  67    EIINSDKMQVYKGLDTLTNKVTEEECKGVPHHLLGTVDPDSNFTATDFKHHASLAIESIL  126

Query  476   RKDRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVE-EG  652
              +DRLPIIAGGSNSYI+ALV +HAEFR +YECCFLW+DV   VL  FVS+RV++MVE  G
Sbjct  127   ERDRLPIIAGGSNSYIEALVDEHAEFRRRYECCFLWVDVAPRVLNSFVSERVDRMVEVGG  186

Query  653   LIEEAREFFDPAG----DYTRGIKRAIGVPEMDQYFRILEA--SDERMRQEVLQTGIDNI  814
             L++E R  FDP      DY+ GI++AIGVPEM  Y    EA  +D+  ++ +L   I NI
Sbjct  187   LVDEVRRMFDPTTADEEDYSTGIRKAIGVPEMHHYL-CGEACGNDKETQEALLLEAISNI  245

Query  815   KANTCKLASCQLQNILRLQSQLEGWN-IVHRLDATEAFQKRGGSGAEAYEAWERLVAAPS  991
             K NTC LA  QLQ I RL+S+   WN  +H LDATEAF  R   G E    W++ V+ P+
Sbjct  246   KKNTCTLAHRQLQKIHRLRSK---WNWSMHCLDATEAFLHR-RRGREGELVWDKQVSRPA  301

Query  992   TMIVHDFICQGTTTTFLAP  1048
             T IV  F+     +T + P
Sbjct  302   TGIVSKFLVDDPMSTTILP  320



>ref|XP_004172767.1| PREDICTED: LOW QUALITY PROTEIN: adenylate isopentenyltransferase 
5, chloroplastic-like [Cucumis sativus]
Length=327

 Score =   320 bits (821),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 163/304 (54%), Positives = 211/304 (69%), Gaps = 13/304 (4%)
 Frame = +2

Query  149   CKQTQ---PMVSFP---SGLNISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVVN  307
             CKQ     P+V+F    + LN+   +R KDKVVFVMGATGTGKSRLAIDLAT F AE++N
Sbjct  9     CKQIAVEPPLVNFQGTNNTLNLEPFFRRKDKVVFVMGATGTGKSRLAIDLATXFPAEIIN  68

Query  308   SDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDR  487
             SDK+QVYKGL ++TNKV E+EC GVPHHLLG+ DPN +FT ADF R A   +++I    R
Sbjct  69    SDKIQVYKGLKVLTNKVTEKECCGVPHHLLGIADPNSNFTVADFRRHASSTINSIVVGKR  128

Query  488   -LPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEE  664
              LPI+AGGSNS+I++LV++  EFR +Y+CCFLW+DV +P+L  FVS+RV++M+E GL+ E
Sbjct  129   CLPILAGGSNSFIESLVEEEPEFRYRYDCCFLWVDVSLPILNSFVSERVDRMLENGLVNE  188

Query  665   AREFFDPAG---DYTRGIKRAIGVPEMDQYFR--ILEASDERMRQEVLQTGIDNIKANTC  829
              R  FDP G   DY  GI+RAIGVPE+D + R  +  A+D++ R  +L+  I   K NT 
Sbjct  189   VRSLFDPNGLGNDYGHGIRRAIGVPELDAFLRAEMDSATDDKTRSRILKAAIXKNKENTI  248

Query  830   KLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHD  1009
             KLA  Q Q I RLQS+  GWN +HR+DAT  F +       +  AWE LV  PS  IV  
Sbjct  249   KLACRQRQKIHRLQSKWRGWNNLHRIDATVVFLQLDSEDYSSDNAWETLVVKPSFKIVDQ  308

Query  1010  FICQ  1021
             F+ +
Sbjct  309   FLSE  312



>gb|EYU46608.1| hypothetical protein MIMGU_mgv1a026307mg [Erythranthe guttata]
Length=320

 Score =   320 bits (821),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 161/291 (55%), Positives = 212/291 (73%), Gaps = 9/291 (3%)
 Frame = +2

Query  146   FCKQTQPMVSFPSGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQV  325
               KQ +P++  P   N   R  K+KVV VMGATGTGKSRL+IDLATRF AEV+NSDKMQV
Sbjct  7     LSKQVRPLLHIPGSDNQLLR-HKEKVVVVMGATGTGKSRLSIDLATRFAAEVINSDKMQV  65

Query  326   YKGLDIVTNKVREEECQGVPHHLLGVV-DPNVDFTAADFCRQALQAVDAITRKDRLPIIA  502
             Y+GLDI TNK+ +EE +GVPHHLLGVV DP  DF+A +F   A  ++ +I  +  LPII 
Sbjct  66    YQGLDIATNKITDEERRGVPHHLLGVVADPETDFSAGNFRAVASISMRSILGRGHLPIIV  125

Query  503   GGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFD  682
             GGSNS+++ALV     F+ +Y+CCFLW+DV MPVL+ FVSDRV+KMVE G+I+E R+F+ 
Sbjct  126   GGSNSFVEALVD--MNFQLRYDCCFLWVDVGMPVLHSFVSDRVDKMVERGMIDEVRDFYR  183

Query  683   PAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNIL  862
             P  DY+RGI+RAIGVPE+D++FR+    D+  R  +L   ID+IK+NT +L+  QL+ I 
Sbjct  184   PNADYSRGIRRAIGVPELDEFFRVESFCDDETRARILAEAIDSIKSNTSRLSRRQLEKIH  243

Query  863   RLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             RL++ ++GW + HRLDAT+ F+KRGG   EA  AWE  VA P   +V  F+
Sbjct  244   RLRN-IKGWRM-HRLDATDVFRKRGG---EAEAAWENTVAGPGAALVSRFL  289



>gb|ABD93934.1| adenylate isopentenyltransferase [Lotus japonicus]
 gb|ABG74607.1| isopentyl transferase [Lotus japonicus]
Length=324

 Score =   320 bits (820),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 167/321 (52%), Positives = 224/321 (70%), Gaps = 14/321 (4%)
 Frame = +2

Query  134   MSCCFCKQTQPMVSFP-SGLNISSRW-RKDKVVFVMGATGTGKSRLAIDLATRFVAEVVN  307
             +S   C+  QP+++ P SG  +S R  +K+KVV VMGATGTGKS+L+IDLAT F +E++N
Sbjct  3     ISMLMCRLRQPLINVPCSGKKLSMRQIQKEKVVLVMGATGTGKSKLSIDLATCFPSEIIN  62

Query  308   SDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDR  487
             SDK+Q+Y GLDIVTNK+ +EE +G+PHHLLG  +PN DFTA DF   +  A+DAIT +D 
Sbjct  63    SDKIQIYDGLDIVTNKISKEEQRGIPHHLLGTQNPNTDFTAGDFSDCSTAAIDAITSRDH  122

Query  488   LPIIAGGSNSYIKALV-KDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEE  664
             LPIIAGGSNSY++AL+  D  +FRS+Y+ C LW+DV MPVL  +V+ RV++M+  G++EE
Sbjct  123   LPIIAGGSNSYLEALIDDDDYKFRSRYDFCCLWVDVAMPVLDSYVAARVDQMLRSGMVEE  182

Query  665   AREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASC  844
              R FF+  GDY+RGI+RAIGVPE D+YFR    +DE  R+ +L+  +  +K NTCKLA  
Sbjct  183   LRPFFNANGDYSRGIRRAIGVPEFDEYFRREGFADEETRKLLLERAVREMKVNTCKLARR  242

Query  845   QLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQG  1024
             QL  I RL++ ++ W I HR+DAT  F KR   G EA EAW ++VA PS MIV  F+ + 
Sbjct  243   QLGKIQRLRN-VKRWEI-HRVDATPVFWKR---GEEADEAWRKVVAEPSAMIVAQFLYKA  297

Query  1025  TTTT------FLAPPTSPNSV  1069
              +        F  P  S  SV
Sbjct  298   KSDVNVVSGGFRVPAGSTESV  318



>ref|XP_002873926.1| cytokinin synthase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50185.1| cytokinin synthase [Arabidopsis lyrata subsp. lyrata]
Length=329

 Score =   320 bits (819),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 169/289 (58%), Positives = 212/289 (73%), Gaps = 9/289 (3%)
 Frame = +2

Query  161   QPMVSFPSGL-NISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGL  337
             QP+++F   + ++    RKDKVVFVMGATGTGKSRLAIDLATRF AE+VNSDK+QVYKGL
Sbjct  13    QPLLNFQGNMVDVPFFRRKDKVVFVMGATGTGKSRLAIDLATRFPAEIVNSDKIQVYKGL  72

Query  338   DIVTNKVREEECQGVPHHLLGVV-DPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSN  514
             DIVTNKV  EE  G+PHHLLG V D   DFTA DF R+A++AV++I ++ R+PIIAGGSN
Sbjct  73    DIVTNKVTPEESLGIPHHLLGTVHDTYEDFTAEDFQREAIRAVESIVQRGRVPIIAGGSN  132

Query  515   SYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFD-PAG  691
             SYI+ALV D  +FR +Y CCFLW+DV  PVL+ FVS+RV+KMVE GL+ E R  FD  + 
Sbjct  133   SYIEALVNDCVDFRLRYNCCFLWVDVSRPVLHSFVSERVDKMVEMGLVGEVRRIFDSSSS  192

Query  692   DYTRGIKRAIGVPEMDQYFRI-LEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRL  868
             DY+ GI+RAIGVPE+D++ R  L  +     + +L+T I+ IK NTC LA  QLQ I RL
Sbjct  193   DYSAGIRRAIGVPELDEFLRAELRNNPAETTERLLETAIEKIKENTCLLACRQLQKIQRL  252

Query  869   QSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
               Q + WN+ HR+DATE F +R   G EA EAW+  VA PS + V  F+
Sbjct  253   YKQWK-WNM-HRVDATEVFLRR---GEEADEAWDNSVAHPSALAVERFL  296



>ref|XP_004296947.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
isoform 1 [Fragaria vesca subsp. vesca]
Length=368

 Score =   321 bits (822),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 174/318 (55%), Positives = 218/318 (69%), Gaps = 16/318 (5%)
 Frame = +2

Query  131   MMSCCFCKQTQPMVSF---PSGLNISSRW--RKDKVVFVMGATGTGKSRLAIDLATRFVA  295
             M +C    Q QPM+ F   P+GL+I   +   KDKVV V+GATGTGKSRLAIDLA ++ A
Sbjct  22    MSACQQVVQIQPMIRFQGPPAGLSIDRFFSRNKDKVVIVIGATGTGKSRLAIDLALKYSA  81

Query  296   EVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAIT  475
             E++NSDKMQVYKGLD +TNKV EEEC+GVPHHLLG VDP+ +FTA DF   A  A+++I 
Sbjct  82    EIINSDKMQVYKGLDTLTNKVTEEECKGVPHHLLGTVDPDSNFTATDFKHHASLAIESIL  141

Query  476   RKDRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVE-EG  652
              +DRLPIIAGGSNSYI+ALV +HAEFR +YECCFLW+DV   VL  FVS+RV++MVE  G
Sbjct  142   ERDRLPIIAGGSNSYIEALVDEHAEFRRRYECCFLWVDVAPRVLNSFVSERVDRMVEVGG  201

Query  653   LIEEAREFFDPAG----DYTRGIKRAIGVPEMDQYFRILEASDERMRQE-VLQTGIDNIK  817
             L++E R  FDP      DY+ GI++AIGVPEM  Y       +++  QE +L   I NIK
Sbjct  202   LVDEVRRMFDPTTADEEDYSTGIRKAIGVPEMHHYLCGEACGNDKETQEALLLEAISNIK  261

Query  818   ANTCKLASCQLQNILRLQSQLEGWN-IVHRLDATEAFQKRGGSGAEAYEAWERLVAAPST  994
              NTC LA  QLQ I RL+S+   WN  +H LDATEAF  R   G E    W++ V+ P+T
Sbjct  262   KNTCTLAHRQLQKIHRLRSK---WNWSMHCLDATEAFLHR-RRGREGELVWDKQVSRPAT  317

Query  995   MIVHDFICQGTTTTFLAP  1048
              IV  F+     +T + P
Sbjct  318   GIVSKFLVDDPMSTTILP  335



>ref|XP_006444118.1| hypothetical protein CICLE_v10021361mg [Citrus clementina]
 gb|ESR57358.1| hypothetical protein CICLE_v10021361mg [Citrus clementina]
Length=300

 Score =   318 bits (815),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 158/289 (55%), Positives = 210/289 (73%), Gaps = 7/289 (2%)
 Frame = +2

Query  194   ISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEEC  373
             + SR +K+KV+ +MGATGTGKSRL+ID+ATRF AE++NSDK+QVY+GLDIVTNK+ EEE 
Sbjct  4     LVSRRQKEKVLILMGATGTGKSRLSIDMATRFPAEIINSDKIQVYEGLDIVTNKITEEEQ  63

Query  374   QGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHAE-  550
              G+PHHLLG+  PN DFTA +FC  A  ++++   K ++PII GGSNSYI+ALV D    
Sbjct  64    CGIPHHLLGIQHPNADFTAQNFCDMASFSIESTLNKGKVPIIVGGSNSYIEALVDDEDYG  123

Query  551   FRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVP  730
             FR KY+CCFLW+DV MPVL  FVS+RV++MV+ G+I+E R+FFDP  DY++G+++AIGVP
Sbjct  124   FRWKYDCCFLWVDVSMPVLRSFVSERVDRMVQNGMIDEVRKFFDPNADYSKGVRKAIGVP  183

Query  731   EMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLD  910
             E D YF++    DE  + ++LQ  I  +K NTCKLA  QL+ I RL + ++ WNI HR D
Sbjct  184   EFDLYFKMEPFLDEENQAKLLQQAIQAVKYNTCKLAFRQLEKIRRLMN-VKRWNI-HRFD  241

Query  911   ATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGTTTTFLAPPTS  1057
             AT+ F+ R   G  A EAWE+ VA PST +V +F+          PP S
Sbjct  242   ATQVFRIR-QHGKAADEAWEKFVAGPSTRLVEEFL---YNVPVEVPPAS  286



>ref|XP_006479751.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Citrus sinensis]
 gb|KDO68788.1| hypothetical protein CISIN_1g020775mg [Citrus sinensis]
Length=321

 Score =   318 bits (816),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 155/275 (56%), Positives = 207/275 (75%), Gaps = 4/275 (1%)
 Frame = +2

Query  194   ISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEEC  373
             + SR +K+KV+ +MGATGTGKSRL+ID+ATRF AE++NSDK+QVY+GLDIVTNK+ EEE 
Sbjct  25    LVSRRQKEKVLILMGATGTGKSRLSIDMATRFPAEIINSDKIQVYEGLDIVTNKITEEEQ  84

Query  374   QGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHAE-  550
              G+PHHLLG+  PN DFTA +FC  A  ++++   K ++PII GGSNSYI+ALV D    
Sbjct  85    CGIPHHLLGIQHPNADFTAQNFCDMASFSIESTLNKGKVPIIVGGSNSYIEALVDDEDYG  144

Query  551   FRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVP  730
             FR KY+CCFLW+DV MPVL  FVS+RV++MV+ G+I+E R+FFDP  DY++G+++AIGVP
Sbjct  145   FRWKYDCCFLWVDVSMPVLRSFVSERVDRMVQNGMIDEVRKFFDPNADYSKGVRKAIGVP  204

Query  731   EMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLD  910
             E D YF++    DE  + ++LQ  I  +K NTCKLA  QL+ I RL + ++ WNI HR D
Sbjct  205   EFDLYFKMEPFLDEENQAKLLQQAIQAVKYNTCKLAFRQLEKIRRLMN-VKRWNI-HRFD  262

Query  911   ATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             AT+ F+ R   G  A EAWE+ VA PST +V +F+
Sbjct  263   ATQVFRIR-QHGKAADEAWEKFVAGPSTRLVEEFL  296



>dbj|BAK64271.1| isopentenyltransferase [Salix japonica]
 dbj|BAM93482.1| isopentenyltransferase, partial [Salix japonica]
Length=250

 Score =   315 bits (808),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 157/255 (62%), Positives = 197/255 (77%), Gaps = 6/255 (2%)
 Frame = +2

Query  230  VMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVD  409
            VMGATGTGKSRL+IDLAT+F AE++NSDKMQVYKGLDIVTNKV EEE  G+PHHLLG+ +
Sbjct  1    VMGATGTGKSRLSIDLATQFPAEIINSDKMQVYKGLDIVTNKVGEEEKSGLPHHLLGIAN  60

Query  410  PNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHA-EFRSKYECCFLWI  586
            PNVDFTAA++C+ A  AV++I+ +  LPIIAGGSNSYI+AL+ D     R +Y+CCFLWI
Sbjct  61   PNVDFTAANYCQMASSAVESISSRGLLPIIAGGSNSYIEALMDDEDFRLRLRYDCCFLWI  120

Query  587  DVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEAS  766
            DV MPVL++FVS RVE+MV  G+I+E R  FDP  DY+ GI+R+IGVPE D++FR  +  
Sbjct  121  DVSMPVLHKFVSRRVEQMVGMGMIDEVRNLFDPRADYSTGIRRSIGVPEFDRFFRAEDFL  180

Query  767  DERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSG  946
            DE  R  +L   I ++K NTCKLA  Q + I RL+ +++GWNI HR+DATE F+    SG
Sbjct  181  DEENRARLLHEAICDVKRNTCKLACRQWEKINRLR-KIKGWNI-HRVDATEVFR---SSG  235

Query  947  AEAYEAWERLVAAPS  991
             EA  AWE+LVA PS
Sbjct  236  KEAEHAWEKLVARPS  250



>ref|XP_010039257.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Eucalyptus grandis]
Length=443

 Score =   322 bits (825),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/272 (57%), Positives = 204/272 (75%), Gaps = 6/272 (2%)
 Frame = +2

Query  206   WR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGV  382
             WR K+KVV ++G TG GKSRL+ID+A+ F AE+VNSDK+QV+KGLDIVTNK+ EEE +G+
Sbjct  85    WRQKEKVVVILGVTGAGKSRLSIDIASHFPAEIVNSDKIQVHKGLDIVTNKITEEEQRGI  144

Query  383   PHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDH-AEFRS  559
             PHHLLG + P+ DFTA++F   AL A+++I  +   P+I GGSNSYI+ L+  H   F+S
Sbjct  145   PHHLLGTIPPDADFTASEFSNSALLAIESIRARGNTPVIVGGSNSYIETLIASHDYRFQS  204

Query  560   KYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMD  739
              YECCFLW+D  MP+L+ F+S RV+KMVE G++EEAR  FDP G Y+RGI+RAIG+PE+D
Sbjct  205   NYECCFLWVDAAMPILHSFLSKRVDKMVERGMVEEARNAFDPNGQYSRGIRRAIGLPELD  264

Query  740   QYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATE  919
               FR  +  D +    +L+  ++ IK NTCKLAS QL+ I RL++Q +GWN+ HR+DATE
Sbjct  265   LLFRTEKFLDRQAHARLLKEAMEEIKTNTCKLASRQLEKIHRLRNQ-KGWNL-HRMDATE  322

Query  920   AFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
              F K G   A+A EAWE LVA PST IV +F+
Sbjct  323   VFCKHG--KADADEAWEELVAGPSTKIVAEFL  352



>ref|XP_009392057.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=397

 Score =   320 bits (821),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 164/291 (56%), Positives = 207/291 (71%), Gaps = 10/291 (3%)
 Frame = +2

Query  149   CKQTQPMVSFPSGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVY  328
             C+   P+V  P+   ++    KDKVVF++G TG+GKS+LAI LA  F  EVVNSDKMQVY
Sbjct  97    CRLLPPLVDVPA---VARMVYKDKVVFILGTTGSGKSKLAIALAKSFRGEVVNSDKMQVY  153

Query  329   KGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGG  508
              GL ++TNKV EEE  GVPHHLLGVV P  DFTA+ F R+A +AV++I  +  LPI+AGG
Sbjct  154   DGLGVITNKVTEEESGGVPHHLLGVVHPEADFTASHFRREATRAVESILGRGGLPIVAGG  213

Query  509   SNSYIKALVKD-HAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDP  685
             SNSYI+ LV+    EFRS+Y+CCFLW+DVE+PVL+EFVS RV+KMVE+GL++EAR  F P
Sbjct  214   SNSYIEELVEGVGGEFRSRYDCCFLWVDVELPVLHEFVSSRVDKMVEQGLVKEARAAFRP  273

Query  686   AGDYTRGIKRAIGVPEMDQYFRILE-ASDERMRQEVLQTGIDNIKANTCKLASCQLQNIL  862
              GDY+RGI R+IGV EMD YFR  + A D   +  +L+  +D IKANTC+LA CQLQ I 
Sbjct  274   DGDYSRGIWRSIGVSEMDGYFRSGDSAGDGETKARMLEAAVDAIKANTCRLACCQLQKIR  333

Query  863   RLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             R  +   GW+ VHR+DATE FQ+RG    E  E WE +V  P   I   F+
Sbjct  334   RFCAM--GWD-VHRIDATEFFQRRGRGSEE--ELWEEVVGEPGAAITRSFL  379



>ref|XP_009120925.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic 
[Brassica rapa]
Length=334

 Score =   318 bits (814),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 174/298 (58%), Positives = 218/298 (73%), Gaps = 16/298 (5%)
 Frame = +2

Query  152   KQTQPMVSF---PSGLNISSR--WR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSD  313
             +  QPM++F    +GLN+     +R KDKVVFVMGATGTGKSRLAIDLATRF AE+VNSD
Sbjct  10    QMIQPMLNFQGISAGLNMVDVPFFRPKDKVVFVMGATGTGKSRLAIDLATRFPAEIVNSD  69

Query  314   KMQVYKGLDIVTNKVREEECQGVPHHLLGVV-DPNVDFTAADFCRQALQAVDAITRKDRL  490
             K+QVYKGLDIVTNKV  EE  GVPHHLLG V + + DFTA D+ R+AL+AV +I  +DR+
Sbjct  70    KIQVYKGLDIVTNKVTPEESLGVPHHLLGTVENTHEDFTAEDYQREALRAVKSIVERDRV  129

Query  491   PIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAR  670
             PIIAGGSNSYI+ALV +  +FR +Y+CCFLW+DV+ PVL  FVSDRV+KMVE GL++E R
Sbjct  130   PIIAGGSNSYIEALVNNCVDFRLRYKCCFLWVDVDRPVLNSFVSDRVDKMVEMGLVDEVR  189

Query  671   EFFDP-AGDYTRGIKRAIGVPEMDQYFRILEASD--ERMRQEVLQTGIDNIKANTCKLAS  841
               FDP + DY+ GI+RAI VPE+D++ R  E  D    +  ++L+T I  IK N C LA 
Sbjct  190   RIFDPSSSDYSSGIRRAIAVPELDEFLRA-EKRDYPAEVTGKLLETAIKKIKENNCLLAC  248

Query  842   CQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
              Q Q I RL  Q + WN+ HR+DATE F +R   G EA EAWE +VA PS + V+ F+
Sbjct  249   RQYQKIKRLYKQWK-WNM-HRIDATEVFLRR---GEEADEAWENMVARPSALAVNRFL  301



>gb|KEH36761.1| adenylate isopentenyltransferase [Medicago truncatula]
Length=339

 Score =   318 bits (814),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 167/323 (52%), Positives = 210/323 (65%), Gaps = 26/323 (8%)
 Frame = +2

Query  149   CKQTQPMVSFPSGLN----ISSRWRKDKVVFVMGATGTGKSRLAIDLATRF-VAEVVNSD  313
             CKQ   +++F  GLN    +     KDKVV +MGATGTGK++LAI+LA  F  AE+VNSD
Sbjct  12    CKQEVSLINFQKGLNKMESLFHNRNKDKVVVIMGATGTGKTKLAIELAKHFQPAEIVNSD  71

Query  314   KMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLP  493
             KMQVYKGLDI TNKV EEEC GVPHHLLGV DP  +FTA DFC  A  A+D+I  KD LP
Sbjct  72    KMQVYKGLDITTNKVTEEECDGVPHHLLGVFDPTTNFTANDFCYHACSAIDSIVEKDGLP  131

Query  494   IIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEARE  673
             IIAGGSNSY+  LV    EFR +YECCFLW+DV +PVL+  +  RV++M+E G ++E RE
Sbjct  132   IIAGGSNSYLDTLVNHCTEFRLRYECCFLWVDVSLPVLHSSLQSRVDRMIEAGQVDEVRE  191

Query  674   FFDPAGDYTRGIKRAIGVPEMDQYFRILEA--SDERMRQEVLQTGIDNIKANTCKLASCQ  847
             FFDP GDYT+GI+RAIGVPE    F + EA  +DER ++ +L+  I  +K N C LA+ Q
Sbjct  192   FFDPFGDYTKGIRRAIGVPEFHD-FLVAEANSADERTKKRLLEAAISRLKINNCTLANRQ  250

Query  848   LQNILRLQSQLEGWN-IVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQG  1024
             +Q I RL      W   +HRLDATE   + G   ++  E WE  V A S +I+++F+   
Sbjct  251   VQKIRRLNGM---WKRSMHRLDATETHLRSGSHTSK--EVWEDHVLAKSLVILYNFLYGE  305

Query  1025  T------------TTTFLAPPTS  1057
             T               F APP S
Sbjct  306   THAHSRILSPTNVIANFSAPPQS  328



>ref|XP_009126292.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Brassica rapa]
 ref|XP_009126293.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Brassica rapa]
 dbj|BAE43828.1| isopentenyltransferase [Brassica rapa subsp. pekinensis]
Length=331

 Score =   317 bits (811),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 175/307 (57%), Positives = 217/307 (71%), Gaps = 22/307 (7%)
 Frame = +2

Query  134   MSCCFCKQTQ---PMVSF---PSGLN---ISSRWRKDKVVFVMGATGTGKSRLAIDLATR  286
             M  C     Q   P+++F    +GLN   +    RKDKVVFVMGATGTGKSRLAIDLATR
Sbjct  1     MKPCMTALRQTIPPLLNFKEISTGLNMVDVPYFRRKDKVVFVMGATGTGKSRLAIDLATR  60

Query  287   FVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVV-DPNVDFTAADFCRQALQAV  463
             F AE+VNSDK+QVYKGLDIVTNKV  EE  GVPHHLLG V D + DFTA DF R+A++AV
Sbjct  61    FPAEIVNSDKIQVYKGLDIVTNKVTPEESLGVPHHLLGTVEDTHEDFTAEDFQREAIRAV  120

Query  464   DAITRKDRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMV  643
              +I  +DR+PIIAGGSNSYI+ALV +  +FR +Y CCFLW+DV+ PVL+ FVS+RV+KMV
Sbjct  121   KSIVERDRVPIIAGGSNSYIEALVNNCVDFRLRYNCCFLWVDVDKPVLHSFVSERVDKMV  180

Query  644   EEGLIEEAREFFDP-AGDYTRGIKRAIGVPEMDQYFR--ILEASDERMRQEVLQTGIDNI  814
             E GL++E R  FDP + DY+ GI+RAIGVPE+D++ R  +L     ++    L+T I  I
Sbjct  181   EMGLVDEVRRIFDPTSDDYSTGIRRAIGVPELDEFLRAELLNYPTSKL----LETAIKKI  236

Query  815   KANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPST  994
             K + C LAS Q Q I RL  Q + WN+ HRLDATE F +R   G EA +AWE  VA PS 
Sbjct  237   KDSNCLLASRQYQKIQRLYKQWK-WNM-HRLDATEVFLRR---GEEADDAWEDKVARPSA  291

Query  995   MIVHDFI  1015
             + V  F+
Sbjct  292   LAVDRFL  298



>emb|CDY47191.1| BnaAnng08610D [Brassica napus]
Length=331

 Score =   317 bits (811),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 175/307 (57%), Positives = 217/307 (71%), Gaps = 22/307 (7%)
 Frame = +2

Query  134   MSCCFCKQTQ---PMVSF---PSGLN---ISSRWRKDKVVFVMGATGTGKSRLAIDLATR  286
             M  C     Q   P+++F    +GLN   +    RKDKVVFVMGATGTGKSRLAIDLATR
Sbjct  1     MKPCMTALRQAIPPLLNFKEISTGLNMVDVPYFRRKDKVVFVMGATGTGKSRLAIDLATR  60

Query  287   FVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVV-DPNVDFTAADFCRQALQAV  463
             F AE+VNSDK+QVYKGLDIVTNKV  EE  GVPHHLLG V D + DFTA DF R+A++AV
Sbjct  61    FPAEIVNSDKIQVYKGLDIVTNKVTPEESLGVPHHLLGTVEDTHEDFTAEDFQREAIRAV  120

Query  464   DAITRKDRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMV  643
              +I  +DR+PIIAGGSNSYI+ALV +  +FR +Y CCFLW+DV+ PVL+ FVS+RV+KMV
Sbjct  121   KSIVERDRVPIIAGGSNSYIEALVNNCVDFRLRYNCCFLWVDVDKPVLHSFVSERVDKMV  180

Query  644   EEGLIEEAREFFDP-AGDYTRGIKRAIGVPEMDQYFR--ILEASDERMRQEVLQTGIDNI  814
             E GL++E R  FDP + DY+ GI+RAIGVPE+D++ R  +L     ++    L+T I  I
Sbjct  181   EMGLVDEVRRIFDPTSDDYSTGIRRAIGVPELDEFLRAELLNYPTSKL----LETAIKKI  236

Query  815   KANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPST  994
             K + C LAS Q Q I RL  Q + WN+ HRLDATE F +R   G EA +AWE  VA PS 
Sbjct  237   KDSNCLLASRQYQKIQRLYKQWK-WNM-HRLDATEVFLRR---GEEADDAWEDKVARPSA  291

Query  995   MIVHDFI  1015
             + V  F+
Sbjct  292   LAVDRFL  298



>emb|CDX92563.1| BnaA10g16020D [Brassica napus]
Length=334

 Score =   316 bits (810),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 174/298 (58%), Positives = 217/298 (73%), Gaps = 16/298 (5%)
 Frame = +2

Query  152   KQTQPMVSF---PSGLNISSR--WR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSD  313
             +  QPM++F    +GLN+     +R KDKVVFVMGATGTGKSRLAIDLATRF AE+VNSD
Sbjct  10    QMIQPMLNFQGISAGLNMVDVPFFRPKDKVVFVMGATGTGKSRLAIDLATRFPAEIVNSD  69

Query  314   KMQVYKGLDIVTNKVREEECQGVPHHLLGVV-DPNVDFTAADFCRQALQAVDAITRKDRL  490
             K+QVYKGLDIVTNKV  EE  GVPHHLLG V + + DFTA D+ R+AL+AV +I  +DR+
Sbjct  70    KIQVYKGLDIVTNKVTPEESLGVPHHLLGTVENTHEDFTAEDYQREALRAVKSIVERDRV  129

Query  491   PIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAR  670
             PIIAGGSNSYI+ALV +  +FR +Y+CCFLW+DV+ PVL  FVSDRV+KMVE GL++E R
Sbjct  130   PIIAGGSNSYIEALVNNCVDFRLRYKCCFLWVDVDRPVLNSFVSDRVDKMVEMGLVDEVR  189

Query  671   EFFDP-AGDYTRGIKRAIGVPEMDQYFRILEASD--ERMRQEVLQTGIDNIKANTCKLAS  841
               FDP + DY+ GI+RAI VPE+D++ R  E  D    +  ++L+T I  IK N C LA 
Sbjct  190   RIFDPSSSDYSSGIRRAIAVPELDEFLRA-EKRDYPAEVTGKLLETAIKKIKENNCLLAC  248

Query  842   CQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
              Q Q I RL  Q + WN+ HR+DATE F +R   G EA EAWE +VA PS + V  F+
Sbjct  249   RQYQKIKRLYKQWK-WNM-HRVDATEVFLRR---GEEADEAWESMVARPSALAVDRFL  301



>ref|XP_011082638.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Sesamum indicum]
Length=317

 Score =   315 bits (807),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 164/312 (53%), Positives = 212/312 (68%), Gaps = 20/312 (6%)
 Frame = +2

Query  128   IMMSCCFCKQTQPMVSFPSGLNISSRWR----KDKVVFVMGATGTGKSRLAIDLATRFVA  295
             + +S    +Q QP +  P+  N     R    KDKVV V+GATGTGKSRL+IDLATRF A
Sbjct  1     MKLSLPLYRQIQPSLYVPT--NNYQLLRQPPPKDKVVVVLGATGTGKSRLSIDLATRFAA  58

Query  296   EVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAIT  475
             EV+NSDKMQVY+GLD+ TNK+ +EE  GVPHHLLG+VDP  DF+A+DF   A  ++ +I 
Sbjct  59    EVINSDKMQVYQGLDVATNKITDEERCGVPHHLLGIVDPESDFSASDFRAMASVSLKSIL  118

Query  476   RKDRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGL  655
             R+  LP++ GGSNS+++ALV     FRS+Y+CCFLW+DV  PVL  FVSDRV++MVE G+
Sbjct  119   RRRHLPVVVGGSNSFVEALV--DKSFRSRYDCCFLWVDVARPVLDSFVSDRVDRMVERGM  176

Query  656   IEEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKL  835
             ++E R+FF P  DY++GI+RAIGVPE D +FR     DE  +       ID IK NT +L
Sbjct  177   VKEVRDFFKPNADYSKGIRRAIGVPEFDMFFRAESFCDEETQARNFADAIDKIKTNTSRL  236

Query  836   ASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             A  QL+ I RL++  +GW ++HRLDAT+ F+KRGG   EA  AWE LVA P   +V  FI
Sbjct  237   ARRQLEKIHRLRNT-KGW-MMHRLDATDVFRKRGG---EADAAWEDLVAGPGIAVVRRFI  291

Query  1016  -------CQGTT  1030
                    C G T
Sbjct  292   YNMEPVGCGGVT  303



>emb|CDY13945.1| BnaC09g38810D [Brassica napus]
Length=334

 Score =   313 bits (803),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 170/297 (57%), Positives = 216/297 (73%), Gaps = 14/297 (5%)
 Frame = +2

Query  152   KQTQPMVSF---PSGLNISSR--WR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSD  313
             +  QPM++F    +GLN+     +R KDKVVF+MGATGTGKSRLAIDLATRF AE+VNSD
Sbjct  10    QMIQPMLNFQRISAGLNMVDVPFFRPKDKVVFIMGATGTGKSRLAIDLATRFPAEIVNSD  69

Query  314   KMQVYKGLDIVTNKVREEECQGVPHHLLGVV-DPNVDFTAADFCRQALQAVDAITRKDRL  490
             K+QVYKGLDIVTNKV  EE  GVPHHLLG V + + DF A D+ R+AL+AV +I  ++R+
Sbjct  70    KIQVYKGLDIVTNKVTPEESLGVPHHLLGTVENTHEDFAAEDYQREALRAVKSIVERNRV  129

Query  491   PIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAR  670
             PIIAGGSNSYI+ALV +  +FR +Y+CCFLW+DV+ PVL  FVSDRV+KMVE GL++E R
Sbjct  130   PIIAGGSNSYIEALVNNCVDFRLRYKCCFLWVDVDRPVLNSFVSDRVDKMVEMGLVDEVR  189

Query  671   EFFDP-AGDYTRGIKRAIGVPEMDQYFRI-LEASDERMRQEVLQTGIDNIKANTCKLASC  844
               FDP + DY+ GI+RAIGVPE+D++ R  L +      +++L+T I  IK N C LA  
Sbjct  190   RIFDPSSSDYSAGIRRAIGVPELDEFLRAELCSYPAETTEKLLETAIKKIKENNCLLACR  249

Query  845   QLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             Q Q I RL  Q + WN+  R+DATE F +R   G EA EAWE +VA PS + V  F+
Sbjct  250   QYQKIKRLYKQWK-WNM-RRIDATEVFLRR---GEEADEAWENMVARPSALAVDRFL  301



>ref|XP_003518930.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Glycine max]
Length=327

 Score =   313 bits (802),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 157/299 (53%), Positives = 218/299 (73%), Gaps = 8/299 (3%)
 Frame = +2

Query  128   IMMSCCFCKQTQPMVSFP-SGLNISSRW-RKDKVVFVMGATGTGKSRLAIDLATRFVAEV  301
             + +S   C+ TQP+++ P SG  +  R   K+KVV VMGATG GKSRL+IDLAT F +E+
Sbjct  1     MTISLFMCRVTQPIINVPCSGKKLIVRQIEKEKVVVVMGATGAGKSRLSIDLATCFPSEI  60

Query  302   VNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRK  481
             +N+DK+QV++GLDIVTNK+ +EE +GVPHHLLG + PN+DF+  DFC  + +A+D+ITR 
Sbjct  61    INADKIQVFEGLDIVTNKISKEEQRGVPHHLLGTIKPNMDFSVNDFCDTSSEAIDSITRC  120

Query  482   DRLPIIAGGSNSYIKALV-KDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLI  658
              +LPI+ GGSNSY++AL+  D  +FRS+Y+   LW+DVEM VL  +V+DRV+ M  +G++
Sbjct  121   QKLPIVVGGSNSYLEALMDDDDYKFRSRYDILCLWVDVEMSVLKSYVADRVDHMFYKGMV  180

Query  659   EEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLA  838
             +E R F+ P GDY+RG+KRAIGVPE  +YF   E +DE  +Q +L+  +  IK NTCKLA
Sbjct  181   DELRPFYSPNGDYSRGVKRAIGVPEFHEYFGREEVADEETKQRLLEQAVKEIKLNTCKLA  240

Query  839   SCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
               QL  I RL++ ++ W+I HRLDAT  F+ R   G EA +AW+RLVA PS +IV  F+
Sbjct  241   MKQLGKIRRLRN-VKRWHI-HRLDATPVFRMR---GEEANDAWKRLVAKPSALIVARFL  294



>gb|KCW84294.1| hypothetical protein EUGRSUZ_B01146 [Eucalyptus grandis]
Length=292

 Score =   311 bits (798),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 157/274 (57%), Positives = 203/274 (74%), Gaps = 6/274 (2%)
 Frame = +2

Query  233   MGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDP  412
             MGATGTGKSRLAIDLAT F  EV+NSDKMQVYKGL+IVTNKV +EEC+ +PHHLLG VDP
Sbjct  1     MGATGTGKSRLAIDLATHFPGEVINSDKMQVYKGLNIVTNKVTKEECREIPHHLLGFVDP  60

Query  413   NVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDV  592
             + DFTA DF      A+ +I+R+DR+PIIAGGSNS+I+ALV    EFRS+++CCFLW+DV
Sbjct  61    DSDFTATDFRDHTSLALPSISRQDRVPIIAGGSNSFIEALVDGDPEFRSRHDCCFLWVDV  120

Query  593   EMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEAS--  766
              +  L  FVS+RV++MVE GL++E R  ++P  D T+GI+RAIGV EMD YFR+ EA+  
Sbjct  121   SLSELCPFVSERVDRMVEAGLVDEVRSMYNPKADNTKGIRRAIGVGEMDDYFRV-EATDA  179

Query  767   DERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSG  946
             D++ +   L+  I  IK NT  LA  Q + I RL + +  WN+ HR+DATE F++RG   
Sbjct  180   DDKTKARFLEASITKIKDNTRSLARDQRKKICRLYN-MWSWNM-HRIDATEVFERRGSKE  237

Query  947   AEAYEAWERLVAAPSTMIVHDFICQGTTTTFLAP  1048
             A A EAWERLV  PS+MIV  F+ +  +TT ++P
Sbjct  238   A-ADEAWERLVLRPSSMIVDRFLDEAPSTTIISP  270



>emb|CDY02590.1| BnaC02g08450D [Brassica napus]
Length=334

 Score =   313 bits (802),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 172/306 (56%), Positives = 215/306 (70%), Gaps = 17/306 (6%)
 Frame = +2

Query  134   MSCCFCKQTQ---PMVSF---PSGLN---ISSRWRKDKVVFVMGATGTGKSRLAIDLATR  286
             M  C     Q   P+++F    +GLN   +    RKDKVVFVMGATGTGKSRLAIDLATR
Sbjct  1     MKPCMTALRQAIPPLLNFKEISTGLNMVDVPFFRRKDKVVFVMGATGTGKSRLAIDLATR  60

Query  287   FVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVV-DPNVDFTAADFCRQALQAV  463
             F AE++NSDK+QVYKGLDIVTNKV  EE  GVPHHLLG V + + DF A DF R A++AV
Sbjct  61    FPAEIINSDKIQVYKGLDIVTNKVTPEESLGVPHHLLGTVENTHDDFMAEDFQRDAIRAV  120

Query  464   DAITRKDRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMV  643
              +I  +DR+PIIAGGSNSYI+ALV +  +FR +Y CCFLW+DV+ PVL+ FVS+RV+KMV
Sbjct  121   KSIVERDRVPIIAGGSNSYIEALVNNCVDFRLRYNCCFLWVDVDKPVLHSFVSERVDKMV  180

Query  644   EEGLIEEAREFFDP-AGDYTRGIKRAIGVPEMDQYFRI-LEASDERMRQEVLQTGIDNIK  817
             E GL++E R  FDP + DY+ GI+RAIGVPE+D++ R  L        +++L+T I  IK
Sbjct  181   EMGLVDEVRRIFDPSSSDYSAGIRRAIGVPELDEFLRAELLNYPAETTEKLLETAIKKIK  240

Query  818   ANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTM  997
              + C LAS Q Q I RL  Q + WN+ HRLDATE F +R   G EA +AWE  VA PS +
Sbjct  241   DSNCLLASRQYQKIQRLYKQWK-WNM-HRLDATEVFLRR---GEEADDAWEDKVARPSAL  295

Query  998   IVHDFI  1015
              V  F+
Sbjct  296   AVDRFL  301



>gb|ACX55059.1| isopentenyltransferase [Vitis vinifera]
Length=242

 Score =   309 bits (792),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/241 (63%), Positives = 187/241 (78%), Gaps = 5/241 (2%)
 Frame = +2

Query  152  KQTQPMVSFPSG---LNISS-RWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKM  319
            KQTQP++S P G   +++S  RW K KVV VMGATGTGKSRL+IDLATRF AE+VNSDKM
Sbjct  1    KQTQPLLSIPPGDLTMDVSGHRWPKGKVVVVMGATGTGKSRLSIDLATRFPAEIVNSDKM  60

Query  320  QVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPII  499
            QVY+GLDIVTNK+ EEE +GVPHHLL +  PNVDFTA+DF   A  ++++I  + RLPI+
Sbjct  61   QVYEGLDIVTNKITEEEQRGVPHHLLRIAHPNVDFTASDFRDMASLSIESILGRGRLPIV  120

Query  500  AGGSNSYIKALVKD-HAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREF  676
             GGSNSYI+ALV D +++FRS+YECCFLW+DV   VL+ FVS RV+KMVE+G++EE ++ 
Sbjct  121  VGGSNSYIEALVGDEYSKFRSRYECCFLWVDVSRSVLHSFVSKRVDKMVEKGMVEEVQQL  180

Query  677  FDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQN  856
            F P  DYTRGI+RAIGVPE+D YFR     DE  R  VLQ  +  IKANTCKLA  QL+ 
Sbjct  181  FHPNADYTRGIRRAIGVPELDLYFRTEGFLDEEARARVLQEAVHEIKANTCKLACRQLEK  240

Query  857  I  859
            I
Sbjct  241  I  241



>ref|XP_010684312.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=325

 Score =   312 bits (800),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 160/296 (54%), Positives = 211/296 (71%), Gaps = 13/296 (4%)
 Frame = +2

Query  152   KQTQPMVSFPSGL---NISSRWR--KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDK  316
             KQ QP++  P+ L    + + W+  +DKVVF+MGATGTGKSRL+IDLAT F AE++NSDK
Sbjct  5     KQAQPLLKIPTSLLKKEVLNPWKQQRDKVVFIMGATGTGKSRLSIDLATSFPAEIINSDK  64

Query  317   MQVYKGLDIVTNKV-REEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLP  493
             +QVYKGLDIVTNK+ R+E+C GVPHHLL +V+PNVD+ + DFC  A  AV++I ++D+LP
Sbjct  65    IQVYKGLDIVTNKITRQEQC-GVPHHLLDIVNPNVDYKSKDFCLMATHAVESILQQDKLP  123

Query  494   IIAGGSNSYIKALVKD-HAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAR  670
             II GGSNSYI++LV D    F+  Y+CCFLW+DV + VL++ VS+RV+KMV+ GL++E R
Sbjct  124   IIVGGSNSYIESLVSDPKYGFKFNYDCCFLWVDVSVSVLHKSVSNRVDKMVQSGLVDEVR  183

Query  671   EFFDP-AGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQ  847
               FDP   DYTRGI++AIGVPE D +FR     DE  R + LQ  I  IK NTCKL + Q
Sbjct  184   GIFDPYNSDYTRGIRQAIGVPEFDTFFRTEHHLDESDRDKQLQGAISEIKENTCKLVNKQ  243

Query  848   LQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             L+ I  L   L+ W + +RLDATE F    G+   A +AW ++V  PS  IV  F+
Sbjct  244   LKKI-HLLKHLKAWEL-YRLDATEVFN--NGNEDVANDAWHKMVTQPSLEIVTQFL  295



>ref|XP_011102013.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Sesamum indicum]
Length=306

 Score =   311 bits (798),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/250 (62%), Positives = 188/250 (75%), Gaps = 3/250 (1%)
 Frame = +2

Query  212  KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHH  391
            KDKVV V+GATGTGKSRLAIDL TRF AEV+NSDK+QVYKGLDIVTNKV  EEC GVPHH
Sbjct  7    KDKVVVVLGATGTGKSRLAIDLTTRFGAEVINSDKIQVYKGLDIVTNKVSNEECHGVPHH  66

Query  392  LLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHAEFRSKYEC  571
            LLG++DP VDFT  DF   AL A  AI +K+RLPIIAGGSNS+I+ALV D+ EF S YEC
Sbjct  67   LLGIIDPEVDFTVHDFVHHALLAAHAIVQKNRLPIIAGGSNSFIQALVTDNTEFSSMYEC  126

Query  572  CFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPA-GDYTRGIKRAIGVPEMDQYF  748
            CFLW+DV  PVL+ +VS R ++MV+ GL+EE + FFDP   DY  GI+RAIGVPE D++F
Sbjct  127  CFLWMDVANPVLHSYVSKRADQMVDSGLVEEGKAFFDPKIRDYDYGIRRAIGVPETDEFF  186

Query  749  RILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQ  928
            R     D   R ++L+  ID IK NTCKLA  Q++ ILR++ +  GW I +RL+ATE F 
Sbjct  187  RSEGLVDGETRAKLLKEAIDEIKMNTCKLACRQVEKILRMREEF-GWQI-YRLNATEVFL  244

Query  929  KRGGSGAEAY  958
            +  G   +A+
Sbjct  245  RCCGDANDAW  254



>gb|KHN18893.1| Adenylate isopentenyltransferase 3, chloroplastic [Glycine soja]
Length=321

 Score =   311 bits (798),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 156/293 (53%), Positives = 215/293 (73%), Gaps = 8/293 (3%)
 Frame = +2

Query  146   FCKQTQPMVSFP-SGLNISSRW-RKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKM  319
              C+ TQP+++ P SG  +  R   K+KVV VMGATG GKSRL+IDLAT F +E++N+DK+
Sbjct  1     MCRVTQPIINVPCSGKKLIVRQIEKEKVVVVMGATGAGKSRLSIDLATCFPSEIINADKI  60

Query  320   QVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPII  499
             QV++GLDIVTNK+ +EE +GVPHHLLG + PN+DF+  DFC  + +A+D+ITR  +LPI+
Sbjct  61    QVFEGLDIVTNKISKEEQRGVPHHLLGTIKPNMDFSVNDFCDTSSEAIDSITRCQKLPIV  120

Query  500   AGGSNSYIKALV-KDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREF  676
              GGSNSY++AL+  D  +FRS+Y+   LW+DVEM VL  +V+DRV+ M  +G+++E R F
Sbjct  121   VGGSNSYLEALMDDDDYKFRSRYDILCLWVDVEMSVLKSYVADRVDHMFYKGMVDELRPF  180

Query  677   FDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQN  856
             + P GDY+RG+KRAIGVPE  +YF   E +DE  +Q +L+  +  IK NTCKLA  QL  
Sbjct  181   YSPNGDYSRGVKRAIGVPEFHEYFGREEVADEETKQRLLEQAVKEIKLNTCKLAMKQLGK  240

Query  857   ILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             I RL++ ++ W+I HRLDAT  F+ R   G EA +AW+RLVA PS +IV  F+
Sbjct  241   IRRLRN-VKRWHI-HRLDATPVFRMR---GEEANDAWKRLVAKPSALIVARFL  288



>ref|XP_009387145.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=404

 Score =   315 bits (806),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 161/288 (56%), Positives = 208/288 (72%), Gaps = 8/288 (3%)
 Frame = +2

Query  176   FPSGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNK  355
             FP G   +    KDKVV V+GATGTGKSRLA+DLA  F  E+VNSDKMQVY GLD+VTNK
Sbjct  55    FPMGSFETRSGPKDKVVLVLGATGTGKSRLAVDLAAYFDGEIVNSDKMQVYDGLDVVTNK  114

Query  356   VREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALV  535
             V +EE  G+PHHL+G +  + +FTA+DF R+A+ AV++I R+ RLPI+AGGSNSYI+A++
Sbjct  115   VTDEERAGIPHHLIGGIPRDAEFTASDFRREAILAVESIVRRGRLPIVAGGSNSYIEAMI  174

Query  536   KDHA-EFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPA-GDYTRGI  709
             +    EFR +YECCFLW+DV++PVL+ FV++RV+ MV  GL++E R  FDP   DY+RGI
Sbjct  175   EGAGREFRRRYECCFLWVDVQLPVLHAFVAERVDCMVGRGLVQEVRGLFDPGVVDYSRGI  234

Query  710   KRAIGVPEMDQYFRILEA-SDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEG  886
             +RAIGVPEMD+Y R     +DE  +  +L+  +D IKANTCKL  CQLQ I RL S L G
Sbjct  235   RRAIGVPEMDRYLRAEGTETDEEAKARLLEVALDEIKANTCKLTCCQLQKIHRL-STLSG  293

Query  887   WNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGTT  1030
             WN V+++DATE  +K+   G +  EAW   VA PS  IV  F+ Q  T
Sbjct  294   WN-VNKVDATEVLRKK---GKKEDEAWAAQVACPSIEIVAKFLQQTIT  337



>ref|XP_010524014.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Tarenaya hassleriana]
Length=320

 Score =   310 bits (795),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 165/305 (54%), Positives = 216/305 (71%), Gaps = 11/305 (4%)
 Frame = +2

Query  125   RIMMSCCFCKQTQPMVSF------PSGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATR  286
             +I MS C      P + F      P+ L+++    KDKVV +MGATGTGKSRL++DLATR
Sbjct  3     KICMSVCQQPLPPPQLDFSPARLNPNFLSLNLHPPKDKVVIIMGATGTGKSRLSVDLATR  62

Query  287   FVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVD  466
             F AE++NSDK+QV++GLDI+TNK+  EE  GVPHHLLGV+ PN DFTAA+F + A  +V+
Sbjct  63    FPAEIINSDKIQVHQGLDILTNKITAEESCGVPHHLLGVLPPNADFTAANFRQMANLSVE  122

Query  467   AITRKDRLPIIAGGSNSYIKALVKDH-AEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMV  643
             +I  + +LPII GGSNS+++ALV D    FRSKYECCFLW+DV MPVL+ FVS+RV+KMV
Sbjct  123   SILSRGKLPIIVGGSNSHVEALVDDEDYRFRSKYECCFLWVDVSMPVLHGFVSERVDKMV  182

Query  644   EEGLIEEAREFFDP-AGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKA  820
             E+G++EE RE FD    DYTRG ++AIGVPE+D YFR     D R R+E+L+  I+++K 
Sbjct  183   EKGMVEEVREIFDLWDTDYTRGSRKAIGVPELDSYFRAEPFLDSREREELLREVIEDVKR  242

Query  821   NTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMI  1000
             NTC LA  Q Q I RL  + + W+I  RLDAT  F++R  S  +A  AWERL   PST  
Sbjct  243   NTCALACRQRQKIERL-VRAKKWSI-QRLDATAVFRQR-RSTVDADVAWERLAVGPSTHA  299

Query  1001  VHDFI  1015
             +  F+
Sbjct  300   LSRFL  304



>dbj|BAE75937.1| adenylate isopentenyltransferase [Pisum sativum]
 dbj|BAE75939.1| adenylate isopentenyltransferase [Pisum sativum]
Length=340

 Score =   311 bits (796),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/296 (52%), Positives = 204/296 (69%), Gaps = 12/296 (4%)
 Frame = +2

Query  149   CKQTQPMVSFPSGL----NISSRWRKDKVVFVMGATGTGKSRLAIDLATRFV-AEVVNSD  313
             CKQ  P+++F  GL    ++     KDKVV +MGATGTGK++LAIDLA  F  +E+VNSD
Sbjct  13    CKQELPLINFQKGLTKMESLFHNRNKDKVVVIMGATGTGKTKLAIDLAKHFQPSEIVNSD  72

Query  314   KMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLP  493
             K+QVYKGLDI TNKV E+EC GVPHHLLG  DP  +FTA DFC  A  A+D+I +KD LP
Sbjct  73    KIQVYKGLDITTNKVTEQECDGVPHHLLGSFDPTTNFTANDFCYHACSAIDSIVQKDGLP  132

Query  494   IIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEARE  673
             IIAGGSNSY+  LV   +EFR +YECCFLW+DV +PVL+  +  RV++M+E G ++E RE
Sbjct  133   IIAGGSNSYLDTLVNHCSEFRLRYECCFLWVDVALPVLHSSLQSRVDRMIEAGQVDEVRE  192

Query  674   FFDPAGDYTRGIKRAIGVPEMDQYFRI-LEASDERMRQEVLQTGIDNIKANTCKLASCQL  850
             FFDP+GDYT+GI+RAIGVPE   +      ++DER ++++L+  I  +K N C LA+ Q 
Sbjct  193   FFDPSGDYTKGIRRAIGVPEFHDFLTAEANSADERTKKKLLEAAITRVKINNCTLANRQR  252

Query  851   QNILRLQSQLEGWN-IVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             Q I RL      W   ++RLDATE   + G    +  E WE  V + S +I+++F+
Sbjct  253   QKIQRLNGM---WKRSMYRLDATETIIRSGTRARK--ETWEDQVLSKSLIILYNFL  303



>ref|XP_010532708.1| PREDICTED: LOW QUALITY PROTEIN: adenylate isopentenyltransferase 
7, mitochondrial-like [Tarenaya hassleriana]
Length=319

 Score =   309 bits (792),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 157/312 (50%), Positives = 213/312 (68%), Gaps = 15/312 (5%)
 Frame = +2

Query  137   SCCFCKQTQPMVSFPS--GLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNS  310
             S    KQ QP++SF    G+++     KDKVVFVMGATGTGKSRLA+DLATRF AE++NS
Sbjct  4     SLSSLKQVQPILSFKGKFGIDVPFLRPKDKVVFVMGATGTGKSRLAVDLATRFPAEIINS  63

Query  311   DKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRL  490
             DK+Q+++GL + TNKV  +E     HH+LG++DPN  FT+ DF   A Q + +I  KD+L
Sbjct  64    DKIQLHEGLHVATNKVTPQEX----HHMLGIIDPNASFTSFDFRCLASQVISSIVAKDKL  119

Query  491   PIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAR  670
             PI+AGGSNSYI+ALV    EF   Y+CCF+W+DV +PVL  F+S RV++M+E GL++E R
Sbjct  120   PIVAGGSNSYIEALVSQSTEFLRNYQCCFIWVDVSLPVLNSFISRRVDRMMEAGLVQEVR  179

Query  671   EFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQL  850
             + +DP  DY+ GI+RAIGVPE+DQY R+    D   ++++L   + NIK NT  LA  QL
Sbjct  180   KMYDPKADYSVGIRRAIGVPELDQYLRMESLVDRGTQRKMLDLAVKNIKQNTEILACRQL  239

Query  851   QNILRLQSQLEGWN-IVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFIC--Q  1021
             Q I RL    + WN  +HR+DATE F + G    +A EAWE LVA PST I++ F+   +
Sbjct  240   QKIHRL---YKNWNSCMHRIDATEVFLRHGN---DADEAWENLVARPSTRIINKFLLPEE  293

Query  1022  GTTTTFLAPPTS  1057
                TT + P ++
Sbjct  294   NPLTTVVLPEST  305



>ref|XP_004508369.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Cicer arietinum]
Length=311

 Score =   306 bits (785),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 162/292 (55%), Positives = 204/292 (70%), Gaps = 17/292 (6%)
 Frame = +2

Query  161   QPMVSFPSGLNISS---RWRKDKVVFVMGATGTGKSRLAIDLATRF-VAEVVNSDKMQVY  328
             +P VSF   L  +S   + RK+KVV +MGATGTGKS+LAIDLAT F  AE++NSDKMQVY
Sbjct  11    KPPVSFQPALMDNSFFHQHRKEKVVVIMGATGTGKSKLAIDLATLFRPAEIINSDKMQVY  70

Query  329   KGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGG  508
             KGLDI TNKV EEEC+GVPHHLLG +DPN +F++ +FC  A  A+ +I  +D LPIIAGG
Sbjct  71    KGLDITTNKVTEEECRGVPHHLLGTIDPNSNFSSNEFCHHATLAIGSIVGRDGLPIIAGG  130

Query  509   SNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDP-  685
             SNSYI ALV  H EFRS+YECCFLW+DV  PVL+  +S RV +M+E G I+E REFFD  
Sbjct  131   SNSYIDALVNHHNEFRSRYECCFLWLDVAFPVLHSSLSARVYRMIEAGQIKEVREFFDEN  190

Query  686   AGDYTRGIKRAIGVPEMDQYFRI-LEA-SDERMRQEVLQTGIDNIKANTCKLASCQLQNI  859
               DY RGI+RAIGVPE D++FR  LE  +DE   +++L+  ID +K N CKLA+ Q+Q I
Sbjct  191   NNDYNRGIRRAIGVPEFDKFFRAELEGKTDEITMKKLLEDAIDAVKINNCKLANKQVQKI  250

Query  860   LRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
              RL    +    +HR+DAT+   K+        + WE  V A S  IVH F+
Sbjct  251   NRLYGMWK--KNMHRIDATDVLLKK--------DCWEDRVLAKSVRIVHKFL  292



>ref|XP_008791009.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic 
[Phoenix dactylifera]
Length=296

 Score =   306 bits (783),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 156/262 (60%), Positives = 194/262 (74%), Gaps = 7/262 (3%)
 Frame = +2

Query  233   MGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDP  412
             MGATGTGKSRLAIDLA  F  EVVNSDKMQ+Y GLD+VTNKV +EE  G+PHHLLG V  
Sbjct  40    MGATGTGKSRLAIDLAVHFGGEVVNSDKMQLYDGLDVVTNKVTDEETCGIPHHLLGGVPR  99

Query  413   NVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHA-EFRSKYECCFLWID  589
             + +FTA+DF R A +AVDAI R+ RLP++AGGSNSYI+ L+     EFRS+YECCFLW+D
Sbjct  100   DAEFTASDFRRAAGRAVDAIARRGRLPVVAGGSNSYIEELIDGAGREFRSRYECCFLWVD  159

Query  590   VEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYFRIL-EAS  766
             V+   L++FV++RV++M+E GL+EE R  FDP  DY RGI++AIGVPEMD Y R   E +
Sbjct  160   VQSKELHQFVAERVDRMLERGLVEEVRGIFDPEADYGRGIRKAIGVPEMDGYLRAEGEGA  219

Query  767   DERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSG  946
             DE  +  +L+  ID IKA+TCKL  CQLQ I RL++ L GW+ V R+DAT+ F+KR   G
Sbjct  220   DEGAKARLLEAAIDEIKASTCKLTCCQLQKINRLRA-LPGWD-VRRVDATDVFRKR---G  274

Query  947   AEAYEAWERLVAAPSTMIVHDF  1012
              EA EAW  LV+ PS   V  F
Sbjct  275   EEADEAWGELVSRPSIETVQKF  296



>ref|NP_001237359.1| isopentenyl transferase [Glycine max]
 gb|AAT28191.1| isopentenyl transferase [Glycine max]
Length=342

 Score =   307 bits (786),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 162/312 (52%), Positives = 209/312 (67%), Gaps = 24/312 (8%)
 Frame = +2

Query  152   KQTQPMVSFPSG-------LNISSRWRKDKVVFVMGATGTGKSRLAIDLATRF-VAEVVN  307
             KQ  P+VSF  G        +  +   KDKVV +MGATG GK++LAID+A  F  AE+VN
Sbjct  15    KQELPLVSFQKGSLMMESLFHHRNNSNKDKVVVIMGATGAGKTKLAIDVAKHFQPAEIVN  74

Query  308   SDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDR  487
             SDKMQVYKGLDI TNKV EEEC GVPHHLLG VDP ++F+A DFCR A  A+D+I  K+ 
Sbjct  75    SDKMQVYKGLDITTNKVTEEECGGVPHHLLGTVDPYINFSANDFCRYATLAIDSIVEKNG  134

Query  488   LPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEA  667
             LPIIAGGSNSY+ ALV  + EFR +Y+CCFLW+DV +PVL+  +  RV++M+E G + + 
Sbjct  135   LPIIAGGSNSYLDALVNHYPEFRLRYQCCFLWVDVALPVLHSSLQARVDRMIEAGQVNDV  194

Query  668   REFFDPA-GDYTRGIKRAIGVPEMDQYFRILEAS---DERMRQEVLQTGIDNIKANTCKL  835
             R+FFDP+  DYT+GI+RAIGVPE D + R  EA+   DER +Q +LQ  I  +K N C L
Sbjct  195   RDFFDPSVTDYTKGIRRAIGVPEFDDFLRA-EANGRLDERTKQRLLQAAIARLKINNCTL  253

Query  836   ASCQLQNILRLQSQLEGWN-IVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDF  1012
             A+ Q+Q I RL +    W   +HRLDATE F  RG     + +AW   V A + +I+H F
Sbjct  254   ANRQIQKIHRLHA---FWKRNMHRLDATEVF--RG-----SRDAWRDHVLAKTLIILHKF  303

Query  1013  ICQGTTTTFLAP  1048
             +     T  + P
Sbjct  304   LYGEKKTPHVVP  315



>gb|EYU45613.1| hypothetical protein MIMGU_mgv1a022025mg, partial [Erythranthe 
guttata]
Length=293

 Score =   305 bits (781),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 154/273 (56%), Positives = 198/273 (73%), Gaps = 6/273 (2%)
 Frame = +2

Query  203   RWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGV  382
             R R++KVV VMGATGTGKSRL++DLATRF  EV+NSDKMQVYKGLD+ TNK    + +GV
Sbjct  2     RRRQEKVVVVMGATGTGKSRLSVDLATRFYGEVINSDKMQVYKGLDVATNKSTAADRRGV  61

Query  383   PHHLLGVVD-PNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHAEFRS  559
             PHHLLG+VD P+  FTAA+F R++  A + I+ + RLPIIAGGSNS ++AL     +FRS
Sbjct  62    PHHLLGIVDDPDAAFTAAEFVRRSSMAAEEISGRGRLPIIAGGSNSLVEALTVADRQFRS  121

Query  560   KYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMD  739
             +YECCFLW+ V  PVL+  VS+RV++MV  GL+EEA EFF+P+GDY+RGI+RAIGVPE+ 
Sbjct  122   RYECCFLWVYVSAPVLHSVVSERVDRMVAGGLVEEAAEFFNPSGDYSRGIRRAIGVPELH  181

Query  740   QYFRILE-ASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDAT  916
             ++F+       E    ++L+  I  IK NTCKL   QL  I RL+ +L G  + HRLDAT
Sbjct  182   EFFKNGPFVGGEAAGADLLEAAIVEIKENTCKLTRRQLGKIWRLREKLAGRRM-HRLDAT  240

Query  917   EAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
               F  RGG   EA EAWE++V  PST I+  F+
Sbjct  241   GVFLNRGG---EAVEAWEKMVVGPSTRILARFL  270



>dbj|BAE75936.1| adenylate isopentenyltransferase [Pisum sativum]
 dbj|BAE75938.1| adenylate isopentenyltransferase [Pisum sativum]
Length=327

 Score =   306 bits (783),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 163/312 (52%), Positives = 204/312 (65%), Gaps = 27/312 (9%)
 Frame = +2

Query  161   QPMVSFP------SGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFV-AEVVNSDKM  319
             +PMVSF         L    + RK+KVV VMGATGTGKS+LAIDLA  F  AE++NSDKM
Sbjct  16    KPMVSFQPPLMDNDNLRFHQQHRKEKVVVVMGATGTGKSKLAIDLANHFPPAEIINSDKM  75

Query  320   QVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPII  499
             QVYKGLDI TNKV EEEC+GVPHHLLG  DP+  FT+ +FC  A  A+ +I  +D LPII
Sbjct  76    QVYKGLDITTNKVTEEECRGVPHHLLGTADPDSSFTSNEFCEHATLAIGSIVGRDGLPII  135

Query  500   AGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFF  679
             AGGSNS+I+ALV  H EFR KYECCFLW+DV +PVL+  +S RV++M+E G + E R+FF
Sbjct  136   AGGSNSFIEALVNHHHEFRMKYECCFLWVDVSIPVLHSSLSARVDRMIEAGQVNEVRDFF  195

Query  680   DPAG---DYTRGIKRAIGVPEMDQYFRILE--ASDERMRQEVLQTGIDNIKANTCKLASC  844
             +      DYTRGI+RAIGVPE D++FR      +DER  +++L+  +D +K N C LAS 
Sbjct  196   NQKNFDYDYTRGIRRAIGVPEFDKFFRNESQGVTDERTMKKLLEVAVDALKMNNCNLASK  255

Query  845   QLQNILRLQSQLEGWN-IVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI--  1015
             Q+Q I RL      W   +HRLDATE   K         + WE  V A S  IVH F+  
Sbjct  256   QVQKIHRLYGM---WKRNMHRLDATEVVLKE--------DNWEDRVLAKSLRIVHKFLYE  304

Query  1016  -CQGTTTTFLAP  1048
              C   T+  + P
Sbjct  305   DCSHVTSGGVVP  316



>ref|XP_011101071.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Sesamum indicum]
Length=308

 Score =   305 bits (781),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 166/307 (54%), Positives = 208/307 (68%), Gaps = 8/307 (3%)
 Frame = +2

Query  134   MSCCFCKQTQP-MVSFPSGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNS  310
             MS    K  Q  M++F     ++    KDKVV V+GATGTGK RLAI L TRF AEV+NS
Sbjct  1     MSISAWKPAQSRMMNFSVRSMMNKHQGKDKVVVVLGATGTGKLRLAIVLVTRFGAEVINS  60

Query  311   DKMQVYKGLDIVTNKVREEEC-QGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDR  487
             DK+QVYKGLDIVT+K R     +GVPHHLLG++ P VDF   DF   AL   DAI +K+ 
Sbjct  61    DKIQVYKGLDIVTSKTRRXXXXRGVPHHLLGIIYPEVDFNIHDFVDHALLGADAIVQKNW  120

Query  488   LPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEA  667
             LPI AGGSNS+I+ALV D  EF SKYECCFLW+DV +PVL+ +VS RV++MV  GL+EE 
Sbjct  121   LPIFAGGSNSFIQALVSDDPEFPSKYECCFLWMDVAIPVLHSYVSKRVDQMVVSGLVEEN  180

Query  668   REFFDPA-GDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASC  844
             + FFDP   DY  GI+RAIGVPEMD++FR     D   R ++L+   D +K NT KLA  
Sbjct  181   KAFFDPKICDYDYGIRRAIGVPEMDEFFRSEGLVDGETRAKLLKAATDKLKRNTSKLACR  240

Query  845   QLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQG  1024
             Q++NILR++ +  GW I H+L+ATE F +      +A EAWE+LV  PST IV  FIC+ 
Sbjct  241   QVENILRMREEF-GWRI-HQLNATEVFLQ---CSRDANEAWEKLVVEPSTNIVARFICKE  295

Query  1025  TTTTFLA  1045
                T L+
Sbjct  296   NIDTKLS  302



>ref|XP_004495223.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Cicer arietinum]
Length=326

 Score =   306 bits (783),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 152/306 (50%), Positives = 221/306 (72%), Gaps = 10/306 (3%)
 Frame = +2

Query  128   IMMSCCFCKQTQPMVS-FP-SGLNISSRW-RKDKVVFVMGATGTGKSRLAIDLATRFVAE  298
             I MS C   + QP++S  P SG  ++ R  +K+ VV VMGATGTGKS+L+IDL+T F +E
Sbjct  3     ISMSMCRLIR-QPLISNVPCSGKKLNVRQIQKENVVLVMGATGTGKSKLSIDLSTYFPSE  61

Query  299   VVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITR  478
             ++NSDK+Q+Y+GLDIVTNK+ +EE +GVPHHLLG  +PN++FT+ DF  ++  A+D+IT 
Sbjct  62    IINSDKIQIYEGLDIVTNKITKEEQRGVPHHLLGTHNPNIEFTSNDFREKSTSAIDSITN  121

Query  479   KDRLPIIAGGSNSYIKALV-KDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGL  655
             ++ LPI+ GGSNSY++ALV  D  +FRS+Y  C LW+DV MPVL+ +V  RV++M+  G+
Sbjct  122   REHLPIVVGGSNSYLEALVDDDDYKFRSRYNFCCLWVDVSMPVLHSYVEQRVDQMLNNGM  181

Query  656   IEEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKL  835
             + E R F++P GDY++GI++AIGVPE D+YFR+    D+  R+ +++  +  +K NT KL
Sbjct  182   VNELRPFYNPNGDYSKGIRKAIGVPEFDEYFRMENLVDDESRKLLVEKAVSEMKMNTWKL  241

Query  836   ASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             A  QL+ I  L++ ++ W I HRLDAT  F+K   SG EA EAW+++VA PS MI+  F+
Sbjct  242   ARKQLRKIHWLKN-VKRWEI-HRLDATPVFKK---SGKEADEAWKKIVAEPSAMILAHFL  296

Query  1016  CQGTTT  1033
                + T
Sbjct  297   YNSSNT  302



>ref|XP_011102014.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like, 
partial [Sesamum indicum]
Length=238

 Score =   302 bits (774),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 148/234 (63%), Positives = 180/234 (77%), Gaps = 3/234 (1%)
 Frame = +2

Query  212  KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHH  391
            KDKVV V+GAT TGKSRLAID+  RF AEV+NSDK+QVYKGLDIVTNKV  EEC GVPHH
Sbjct  7    KDKVVVVLGATSTGKSRLAIDIGPRFGAEVINSDKIQVYKGLDIVTNKVSNEECHGVPHH  66

Query  392  LLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHAEFRSKYEC  571
            LLG++ P VDFT  DF   AL A DAI +K+RLPIIAGGSNS+I+ALV D+ EF SKYEC
Sbjct  67   LLGIIVPEVDFTVHDFVHHALLATDAIVQKNRLPIIAGGSNSFIQALVTDNTEFSSKYEC  126

Query  572  CFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPA-GDYTRGIKRAIGVPEMDQYF  748
            CFLW+DV +PVL+ +VS RV++MV+ GL+EE + FFDP   DY  GI+RAIGVPEMD++F
Sbjct  127  CFLWMDVAIPVLHSYVSKRVDQMVDSGLVEEGKAFFDPKIRDYDYGIRRAIGVPEMDEFF  186

Query  749  RILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLD  910
            R     D   R  +L+  ID IK NTCKLA  Q++ ILR++ +  GW I +RL+
Sbjct  187  RSEGLVDGETRAMLLKAAIDEIKMNTCKLACRQVEKILRMREEF-GWQI-YRLN  238



>ref|XP_010545085.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic 
[Tarenaya hassleriana]
Length=321

 Score =   305 bits (780),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 163/305 (53%), Positives = 215/305 (70%), Gaps = 14/305 (5%)
 Frame = +2

Query  125   RIMMSCCFCKQTQPMVSF------PSGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATR  286
             +I MS C        + F      P  L+++    KDKVV +MGATGTGKSRL++DLATR
Sbjct  3     KICMSVCRPPLPPSQLDFSPTRLNPDILSLNPHPPKDKVVVIMGATGTGKSRLSVDLATR  62

Query  287   FVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVD  466
             F AE++NSDK+Q ++GLDIVTNK+  EE  GVPHHLLGV+ PN DFTAA+F + A  +V+
Sbjct  63    FPAEIINSDKIQAHQGLDIVTNKITAEESCGVPHHLLGVLPPNADFTAANFQQMANLSVE  122

Query  467   AITRKDRLPIIAGGSNSYIKALV-KDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMV  643
             +I  + +LPII GGSNSY++ALV  D  +FRSKY+CCFLW+DV MPVL  FVS+RV+KM 
Sbjct  123   SIVSRGKLPIIVGGSNSYVEALVDDDDCKFRSKYDCCFLWVDVSMPVLQGFVSERVDKMA  182

Query  644   EEGLIEEAREFFDPA-GDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKA  820
             E+G++EE RE FD +  DYTRGI++AIGV E D YFR     +   R+E+L+  I+ IK 
Sbjct  183   EKGMVEEVREMFDYSDSDYTRGIRKAIGVKEFDWYFRAEPFLNNGEREEMLREVIEEIKR  242

Query  821   NTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMI  1000
             NTC LA  Q + I RL+ +++GW+I  RLDAT  F+++G    +A   WER+VAAPST  
Sbjct  243   NTCALACRQREKIERLR-RVKGWSI-QRLDATAVFRQKG----DADGTWERMVAAPSTPA  296

Query  1001  VHDFI  1015
             V  F+
Sbjct  297   VARFL  301



>gb|KHN33068.1| Adenylate isopentenyltransferase 5, chloroplastic [Glycine soja]
Length=351

 Score =   305 bits (782),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 162/311 (52%), Positives = 207/311 (67%), Gaps = 22/311 (7%)
 Frame = +2

Query  119   STRIMMSCCFCKQTQPMVSFPSG-------LNISSRWRKDKVVFVMGATGTGKSRLAIDL  277
             ST      C CKQ  P+VSF  G        +  +   KDKVV +MGATG GK++LAID+
Sbjct  4     STSACACACACKQELPLVSFQKGSLMMESLFHHRNNSNKDKVVVIMGATGAGKTKLAIDV  63

Query  278   ATRFV-AEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQAL  454
             A  F  AE+VNSDKMQVYKGLDI TNKV EEEC GVPHHLLG VDP ++F+A DFCR A 
Sbjct  64    AKHFQPAEIVNSDKMQVYKGLDITTNKVTEEECGGVPHHLLGTVDPYINFSANDFCRYAT  123

Query  455   QAVDAITRKDRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVE  634
              A+D+I  K+ LPIIAGGSNSY+ ALV  + EFR +Y+CCFLW+DV +PVL+  +  RV+
Sbjct  124   LAIDSIVEKNGLPIIAGGSNSYLDALVNHYPEFRLRYQCCFLWVDVALPVLHSSLQARVD  183

Query  635   KMVEEGLIEEAREFFDPA-GDYTRGIKRAIGVPEMDQYFRILEAS---DERMRQEVLQTG  802
             +M+E G + E R+FFDP+  DYT+GI+RAIGVPE D + R  EA+   DER +Q +LQ  
Sbjct  184   RMIEAGQVNEVRDFFDPSVTDYTKGIRRAIGVPEFDDFLRA-EANGRLDERTKQRLLQAA  242

Query  803   IDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVA  982
             I  +K N C LA+ Q+Q I RL    +    +HRLDATE F         + +AW   V 
Sbjct  243   IARLKINNCTLANRQIQKIHRLHGLWK--RNMHRLDATEVF-------LGSRDAWHDHVL  293

Query  983   APSTMIVHDFI  1015
             A S +++H F+
Sbjct  294   AKSLIVLHKFL  304



>ref|XP_007144614.1| hypothetical protein PHAVU_007G170100g [Phaseolus vulgaris]
 gb|ESW16608.1| hypothetical protein PHAVU_007G170100g [Phaseolus vulgaris]
Length=322

 Score =   303 bits (777),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 154/299 (52%), Positives = 212/299 (71%), Gaps = 8/299 (3%)
 Frame = +2

Query  128   IMMSCCFCKQTQPMVSFP-SGLNISSRW-RKDKVVFVMGATGTGKSRLAIDLATRFVAEV  301
             + +S   C+  QP+++ P SG  ++ R   K+KVV VMGATG GKSRL+IDLA  F +E+
Sbjct  1     MTISMLMCRLRQPIINIPCSGKRLNVRQIEKEKVVVVMGATGAGKSRLSIDLAKCFPSEI  60

Query  302   VNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRK  481
             +NSDK+QVY+GLDIVTNK+ +E+ +GV HHLLG ++P+ DFT  DF   +  A++ ITR 
Sbjct  61    INSDKIQVYQGLDIVTNKIPKEDQRGVHHHLLGTINPDTDFTPTDFIDTSSSAIETITRA  120

Query  482   DRLPIIAGGSNSYIKALV-KDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLI  658
              +LPII GGSNSY++AL+  D   FRS+Y+   LW+DV MPVL  +V++RV+ M   G++
Sbjct  121   QKLPIIVGGSNSYLEALIDDDDYNFRSRYDFICLWVDVAMPVLQSYVAERVDDMFRNGMV  180

Query  659   EEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLA  838
             +E R F+ P GDY+RGI+RAIGVPE D+YFR  E  DE  +Q +L+  I  IK NT KLA
Sbjct  181   DELRPFYSPNGDYSRGIRRAIGVPEFDEYFRREEFVDEETKQRLLEDAIKEIKLNTWKLA  240

Query  839   SCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
               QL+ I RL++ ++ W I HRLDAT  F++R   G EA EAW+++VA PS M+V  F+
Sbjct  241   MKQLRKIHRLRN-VKRWEI-HRLDATPVFRRR---GEEANEAWKKVVAEPSAMVVARFL  294



>ref|XP_007162406.1| hypothetical protein PHAVU_001G149400g [Phaseolus vulgaris]
 gb|ESW34400.1| hypothetical protein PHAVU_001G149400g [Phaseolus vulgaris]
Length=305

 Score =   303 bits (776),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 152/313 (49%), Positives = 213/313 (68%), Gaps = 9/313 (3%)
 Frame = +2

Query  128   IMMSCCFCKQTQPMVSFPSGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVN  307
             + MS   C+ TQP+ + PS         K+KVV VMGATG+GK+RL++DLAT F +E++N
Sbjct  1     MTMSRVMCRPTQPLKNVPSSGQSQMMRPKEKVVLVMGATGSGKTRLSVDLATCFPSEIIN  60

Query  308   SDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDR  487
             SDKMQVY+GL+IVTNK  +EE +G+PHHLLG+ +P+ +FTA+DFC  A +A+++ITR+D+
Sbjct  61    SDKMQVYEGLEIVTNKATKEEQRGIPHHLLGIQNPDTEFTASDFCDVASRAIESITRRDK  120

Query  488   LPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEA  667
             +PI+ GGSNSY++ALV+    F  ++E CFLW+DV +PVL+ +V+ RV+ M+  G++ E 
Sbjct  121   VPIVVGGSNSYMEALVE---RFGPRFEWCFLWVDVSVPVLHSYVAQRVDHMLRCGMVNEL  177

Query  668   REFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQ  847
             R FF+  GDY RGI++AIGV E   YFR    +    R  +LQ  + ++K NTC LA  Q
Sbjct  178   RPFFNVNGDYARGIRKAIGVSEFHAYFRREATASGETRMRLLQEAVRDVKRNTCHLACKQ  237

Query  848   LQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGT  1027
             L  I  L+S +EGW I HR+ AT  FQKR   G +A EAW  +VA P   IV  F+    
Sbjct  238   LGRIHMLRS-VEGWKI-HRVCATPVFQKR---GHDANEAWNNMVAQPCASIVSQFLSSAN  292

Query  1028  TTT-FLAPPTSPN  1063
             +T+  +AP   PN
Sbjct  293   STSGRVAPSMQPN  305



>ref|NP_567138.1| adenylate isopentenyltransferase 3 [Arabidopsis thaliana]
 sp|Q93WC9.1|IPT3_ARATH RecName: Full=Adenylate isopentenyltransferase 3, chloroplastic; 
Short=AtIPT3; AltName: Full=Adenylate dimethylallyltransferase 
3; AltName: Full=Cytokinin synthase 3; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB59030.1| cytokinin synthase [Arabidopsis thaliana]
 dbj|BAB59043.1| adenylate isopentenyltransferase [Arabidopsis thaliana]
 gb|AAM78100.1| AT3g63110/T20O10_210 [Arabidopsis thaliana]
 gb|AAN46854.1| At3g63110/T20O10_210 [Arabidopsis thaliana]
 gb|AEE80436.1| adenylate isopentenyltransferase 3 [Arabidopsis thaliana]
Length=336

 Score =   304 bits (778),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 158/305 (52%), Positives = 214/305 (70%), Gaps = 14/305 (5%)
 Frame = +2

Query  134   MSCCFCKQT---QPMVSFPSG------LNISSRWRKDKVVFVMGATGTGKSRLAIDLATR  286
             +S   CKQ     P + FP        L ++    KDKVV +MGATGTGKSRL++D+ATR
Sbjct  5     ISMAMCKQPLPPSPTLDFPPARFGPNMLTLNPYGPKDKVVVIMGATGTGKSRLSVDIATR  64

Query  287   FVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVD  466
             F AE++NSDK+QV++GLDIVTNK+  EE  GVPHHLLGV+ P  D TAA++C  A  +++
Sbjct  65    FRAEIINSDKIQVHQGLDIVTNKITSEESCGVPHHLLGVLPPEADLTAANYCHMANLSIE  124

Query  467   AITRKDRLPIIAGGSNSYIKALVKD-HAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMV  643
             ++  + +LPII GGSNSY++ALV D   +FRS+Y+CCFLW+DV +PVL+ FVS+RV+KMV
Sbjct  125   SVLNRGKLPIIVGGSNSYVEALVDDKENKFRSRYDCCFLWVDVALPVLHGFVSERVDKMV  184

Query  644   EEGLIEEAREFFD-PAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKA  820
             E G++EE REFFD    DY+RGIK+AIG PE D++FR  +  +   R+E+L   ++ IK 
Sbjct  185   ESGMVEEVREFFDFSNSDYSRGIKKAIGFPEFDRFFRNEQFLNVEDREELLSKVLEEIKR  244

Query  821   NTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMI  1000
             NT +LA  Q + I RL+ +++ W+I  R+DAT  F KR  S  +A  AWERLVA PST  
Sbjct  245   NTFELACRQREKIERLR-KVKKWSI-QRVDATPVFTKR-RSKMDANVAWERLVAGPSTDT  301

Query  1001  VHDFI  1015
             V  F+
Sbjct  302   VSRFL  306



>ref|XP_002878496.1| ATIPT3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54755.1| ATIPT3 [Arabidopsis lyrata subsp. lyrata]
Length=336

 Score =   303 bits (777),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 158/305 (52%), Positives = 219/305 (72%), Gaps = 14/305 (5%)
 Frame = +2

Query  134   MSCCFCKQTQPM---VSFPSG------LNISSRWRKDKVVFVMGATGTGKSRLAIDLATR  286
             +S   CKQ  P+   + FP        L+++    KDKVV +MGATGTGKSRL++D+ATR
Sbjct  5     VSMAMCKQPLPLSPALDFPPARFGPNMLSLNPFGPKDKVVVIMGATGTGKSRLSVDIATR  64

Query  287   FVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVD  466
             F AE++NSDK+QV++GLDIVTNK+  EE  GVPHHLLGV+ P  D TA ++C  A  +++
Sbjct  65    FRAEIINSDKIQVHQGLDIVTNKITSEESCGVPHHLLGVLPPEADLTAPNYCHMANLSIE  124

Query  467   AITRKDRLPIIAGGSNSYIKALVKDH-AEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMV  643
             ++  + +LPII GGSNSY++ALV D   +FRS+Y+CCFLW+DV +PVL+ FVS+RV+KMV
Sbjct  125   SVLNRGKLPIIVGGSNSYVEALVDDEDNKFRSRYDCCFLWVDVALPVLHGFVSERVDKMV  184

Query  644   EEGLIEEAREFFDPA-GDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKA  820
             E G++EE R+FFD +  DY+RGIK+AIGVPE D++FR  +  +   R+E+L   +++IK 
Sbjct  185   ENGMVEEVRDFFDFSDSDYSRGIKKAIGVPEFDRFFRNEQFLNVEDREELLIKVVEDIKR  244

Query  821   NTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMI  1000
             NT +LA  Q + I RL+ +++ W+I  R+DAT  F KR  S  +A  AWERLVA PST I
Sbjct  245   NTFELACRQREKIERLR-KVKKWSI-QRVDATPVFTKR-RSKTDADVAWERLVAGPSTDI  301

Query  1001  VHDFI  1015
             V  F+
Sbjct  302   VSRFL  306



>ref|XP_009782718.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic 
[Nicotiana sylvestris]
Length=322

 Score =   303 bits (776),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 156/308 (51%), Positives = 211/308 (69%), Gaps = 17/308 (6%)
 Frame = +2

Query  137   SCCFCKQTQPMV-SFPSGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSD  313
             S   CKQ  P + + P         +KDKVVFVMG TG GKSRL+IDLAT+F  E+VNSD
Sbjct  7     SSLMCKQVWPTLRNLP---------QKDKVVFVMGVTGAGKSRLSIDLATQFRGEIVNSD  57

Query  314   KMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLP  493
             K+QVYKGLDI TNK+ +EE  GVPHHLLGV+DP  +FT  +FC  A  AV++IT + +LP
Sbjct  58    KIQVYKGLDIATNKITQEERCGVPHHLLGVIDPYKEFTTKNFCNMASLAVNSITDRGKLP  117

Query  494   IIAGGSNSYIKALVKDHAE-FRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAR  670
             II GGSNS+I+ALV D++  FR++Y+CCFLW+DV M VL  F+ +RV+KM+E+G+ +E R
Sbjct  118   IIVGGSNSFIEALVHDNSHNFRTRYDCCFLWVDVSMNVLNSFLYERVDKMMEQGMTDEVR  177

Query  671   EFFDPAG-DYTRGIKRAIGVPEMDQYFR--ILEASDERMRQEVLQTGIDNIKANTCKLAS  841
               F+P   DYT+GI++AIGVPE D YFR  +  + D   R+ +L+  I+ +K N C LAS
Sbjct  178   SMFNPKNTDYTKGIRKAIGVPEFDSYFRAELSNSVDVETRERLLKEAINEVKINNCILAS  237

Query  842   CQLQNILRLQSQLEGWNIVHRLDATEAF-QKRGGSGAEAYEAWERLVAAPSTMIVHDFIC  1018
              QL+ I RL + ++GW I  RLDATE F +K+  +  EA E W+ +V   S  IV  F+C
Sbjct  238   KQLEKIKRLIN-VKGWKI-QRLDATEVFRRKQRNAEEEAEEIWKNMVMGQSIKIVGKFLC  295

Query  1019  QGTTTTFL  1042
             +   +  +
Sbjct  296   ENNRSKMV  303



>ref|XP_003520560.2| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Glycine max]
 gb|KHN19877.1| Adenylate isopentenyltransferase 3, chloroplastic [Glycine soja]
Length=309

 Score =   301 bits (771),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 151/300 (50%), Positives = 208/300 (69%), Gaps = 12/300 (4%)
 Frame = +2

Query  128   IMMSCCFCKQTQPMVSFPSGLNISSRWR----KDKVVFVMGATGTGKSRLAIDLATRFVA  295
             + MS   C+ TQP+ + PS  +IS + +    K+KVV VMGATG+GK+RL+IDLAT F +
Sbjct  3     MTMSRVMCRPTQPLKNVPSNSSISGQNQIIRPKEKVVLVMGATGSGKTRLSIDLATCFPS  62

Query  296   EVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAIT  475
             E++NSDK+QVY GLD+VTNK  +EE +GVPHHLLG  +PN +FTA+DFC  A  A+++IT
Sbjct  63    EIINSDKIQVYSGLDVVTNKATKEEQRGVPHHLLGTQNPNTEFTASDFCHMASHAIESIT  122

Query  476   RKDRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGL  655
              ++++PII GGSNSYI+ALV    +F  +Y+ C LW+DV   VL+ +V+ RV+ M+  G+
Sbjct  123   HREKVPIIVGGSNSYIEALVD---KFGPRYDWCCLWVDVSTSVLHSYVAQRVDHMLGGGM  179

Query  656   IEEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKL  835
             + E R FF P GDY++GI++AIGVPE D YFR    S    R  +LQ  + ++K NTC L
Sbjct  180   VNELRPFFSPNGDYSKGIRKAIGVPEFDAYFRREAFSSNETRVSLLQDAVRDVKRNTCHL  239

Query  836   ASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             A  Q+  I RL+S ++GW I HR+ AT  FQKR   G EA +AW+ +VA P   IV  F+
Sbjct  240   ACKQIGRIHRLRS-VKGWKI-HRVCATPVFQKR---GQEANDAWKNIVAQPCASIVSHFL  294



>ref|XP_003553453.2| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Glycine max]
Length=312

 Score =   301 bits (770),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 154/311 (50%), Positives = 210/311 (68%), Gaps = 13/311 (4%)
 Frame = +2

Query  128   IMMSCCFCKQTQPMVSFP----SGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVA  295
             + MS   C+ TQP+ + P    SG N   R  K+KVV VMGATG+GK+RL+IDLAT F +
Sbjct  3     MTMSRVMCRPTQPLKNVPTNTSSGQNQIIR-PKEKVVLVMGATGSGKTRLSIDLATCFPS  61

Query  296   EVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAIT  475
             E++NSDKMQVY GLD+VTNK  +EE +G+PHHLLG  +PN +FTA+DFC  A  A+++IT
Sbjct  62    EIINSDKMQVYSGLDVVTNKATKEEQRGIPHHLLGTQNPNKEFTASDFCDMASHAIESIT  121

Query  476   RKDRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGL  655
              ++++PII GGSNSY++ALV    +F ++YE C LW+DV  PVL+ +V+ RV++M+  G+
Sbjct  122   NREKVPIIVGGSNSYMEALVD---KFGTRYEWCCLWVDVSTPVLHSYVAQRVDQMIGGGM  178

Query  656   IEEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKL  835
             + E R FF P GDY++GI++AIGVPE  +YFR    S   MR  +LQ  +  +K NTC L
Sbjct  179   VNELRPFFSPNGDYSKGIRKAIGVPEFHEYFRREAFSSTEMRMRLLQDAVREVKRNTCHL  238

Query  836   ASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             A  QL  I  L+S ++GW I HR+ AT  FQKR   G EA +AW+ +VA P   IV  F+
Sbjct  239   ACKQLGRIQWLRS-VKGWKI-HRVCATPVFQKR---GQEANDAWKNVVAQPCASIVSQFL  293

Query  1016  CQGTTTTFLAP  1048
                   +   P
Sbjct  294   YSANAVSGRVP  304



>emb|CAB87756.1| tRNA isopentenyl transferase-like protein [Arabidopsis thaliana]
Length=330

 Score =   301 bits (772),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 157/301 (52%), Positives = 212/301 (70%), Gaps = 14/301 (5%)
 Frame = +2

Query  146   FCKQT---QPMVSFPSG------LNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAE  298
              CKQ     P + FP        L ++    KDKVV +MGATGTGKSRL++D+ATRF AE
Sbjct  3     MCKQPLPPSPTLDFPPARFGPNMLTLNPYGPKDKVVVIMGATGTGKSRLSVDIATRFRAE  62

Query  299   VVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITR  478
             ++NSDK+QV++GLDIVTNK+  EE  GVPHHLLGV+ P  D TAA++C  A  +++++  
Sbjct  63    IINSDKIQVHQGLDIVTNKITSEESCGVPHHLLGVLPPEADLTAANYCHMANLSIESVLN  122

Query  479   KDRLPIIAGGSNSYIKALVKD-HAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGL  655
             + +LPII GGSNSY++ALV D   +FRS+Y+CCFLW+DV +PVL+ FVS+RV+KMVE G+
Sbjct  123   RGKLPIIVGGSNSYVEALVDDKENKFRSRYDCCFLWVDVALPVLHGFVSERVDKMVESGM  182

Query  656   IEEAREFFD-PAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCK  832
             +EE REFFD    DY+RGIK+AIG PE D++FR  +  +   R+E+L   ++ IK NT +
Sbjct  183   VEEVREFFDFSNSDYSRGIKKAIGFPEFDRFFRNEQFLNVEDREELLSKVLEEIKRNTFE  242

Query  833   LASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDF  1012
             LA  Q + I RL+ +++ W+I  R+DAT  F KR  S  +A  AWERLVA PST  V  F
Sbjct  243   LACRQREKIERLR-KVKKWSI-QRVDATPVFTKR-RSKMDANVAWERLVAGPSTDTVSRF  299

Query  1013  I  1015
             +
Sbjct  300   L  300



>gb|KHN45368.1| Adenylate isopentenyltransferase 3, chloroplastic [Glycine soja]
Length=308

 Score =   300 bits (768),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 154/309 (50%), Positives = 209/309 (68%), Gaps = 13/309 (4%)
 Frame = +2

Query  134   MSCCFCKQTQPMVSFP----SGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEV  301
             MS   C+ TQP+ + P    SG N   R  K+KVV VMGATG+GK+RL+IDLAT F +E+
Sbjct  1     MSRVMCRPTQPLKNVPTNTSSGQNQIIR-PKEKVVLVMGATGSGKTRLSIDLATCFPSEI  59

Query  302   VNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRK  481
             +NSDKMQVY GLD+VTNK  +EE +G+PHHLLG  +PN +FTA+DFC  A  A+++IT +
Sbjct  60    INSDKMQVYSGLDVVTNKATKEEQRGIPHHLLGTQNPNKEFTASDFCDMASHAIESITNR  119

Query  482   DRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIE  661
             +++PII GGSNSY++ALV    +F ++YE C LW+DV  PVL+ +V+ RV++M+  G++ 
Sbjct  120   EKVPIIVGGSNSYMEALVD---KFGTRYEWCCLWVDVSTPVLHSYVAQRVDQMIGGGMVN  176

Query  662   EAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLAS  841
             E R FF P GDY++GI++AIGVPE  +YFR    S   MR  +LQ  +  +K NTC LA 
Sbjct  177   ELRPFFSPNGDYSKGIRKAIGVPEFHEYFRREAFSSTEMRMRLLQDAVREVKRNTCHLAC  236

Query  842   CQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQ  1021
              QL  I  L+S ++GW I HR+ AT  FQKR   G EA +AW+ +VA P   IV  F+  
Sbjct  237   KQLGRIQWLRS-VKGWKI-HRVCATPVFQKR---GQEANDAWKNVVAQPCASIVSQFLYS  291

Query  1022  GTTTTFLAP  1048
                 +   P
Sbjct  292   ANAVSGRVP  300



>gb|AEQ30076.1| adenylate isopentenyltransferase [Orobanche ramosa]
Length=294

 Score =   300 bits (767),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 149/278 (54%), Positives = 197/278 (71%), Gaps = 12/278 (4%)
 Frame = +2

Query  185   GLNISSR-WRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVR  361
               NIS +   K+KVV VMGATGTGKSRL+IDLATRF AEV+NSDKMQVY+GLDI TNK+ 
Sbjct  4     SFNISKKITSKEKVVVVMGATGTGKSRLSIDLATRFAAEVINSDKMQVYRGLDITTNKIT  63

Query  362   EEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKD  541
             E E   VPHHLLG++DP +DF+A +F   AL ++ +I  +++LPII GGSNS+++AL+  
Sbjct  64    EAERCNVPHHLLGIIDPEIDFSALNFRDMALISIRSILDRNKLPIIVGGSNSFLEALMD-  122

Query  542   HAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAI  721
                F S Y+CCFLW+DVEM +L+ FVSDRV+KM+E+G++ E R F+ P GDY++GI R+I
Sbjct  123   -TNFTSNYQCCFLWVDVEMSILHSFVSDRVDKMIEQGMVNEVRNFYRPNGDYSKGIHRSI  181

Query  722   GVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVH  901
             GVPE D++FR     DE   + +L   +D IK NT +LA  QL+ I RL+    GW + H
Sbjct  182   GVPEFDKFFRTESFRDE---ERMLTEAVDLIKTNTNRLAQRQLEKIRRLKDM--GWRM-H  235

Query  902   RLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
              LDAT+ F+K    G EA +AW+  VA P   IV  F+
Sbjct  236   HLDATDVFRKH---GIEADKAWDNTVAGPGAKIVSKFL  270



>ref|XP_009627634.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic 
[Nicotiana tomentosiformis]
Length=325

 Score =   300 bits (769),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 156/307 (51%), Positives = 211/307 (69%), Gaps = 12/307 (4%)
 Frame = +2

Query  137   SCCFCKQTQPMVSFPSGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDK  316
             S   CKQ      +P+ L++ +  +KDKV+FVMG TG GKSRL+IDLAT+F  EVVNSDK
Sbjct  7     STLMCKQV-----WPNLLHLRNLPQKDKVLFVMGVTGAGKSRLSIDLATQFRGEVVNSDK  61

Query  317   MQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPI  496
             +QVYKGLDI TNK+ +EE   +PHHLLGV+DP  +FT  +FC  A  AV +IT   +LPI
Sbjct  62    IQVYKGLDIATNKITQEERCNIPHHLLGVIDPYKEFTTKNFCNMASLAVSSITDCGKLPI  121

Query  497   IAGGSNSYIKALVKDHAE-FRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEARE  673
             I GGSNS+I+ALV D++  FR++Y+CCFLW+DV M VL  F+ +RV+KM+E G+IEE R 
Sbjct  122   IVGGSNSFIEALVHDNSHNFRTRYDCCFLWVDVSMNVLNSFLYERVDKMMEIGMIEEVRN  181

Query  674   FFDPAG-DYTRGIKRAIGVPEMDQYFR--ILEASDERMRQEVLQTGIDNIKANTCKLASC  844
              F+P   DYT+GI++AIGVPE D YFR  +  + D   R+ +L+  I+ +K N C LAS 
Sbjct  182   MFNPKNTDYTKGIRKAIGVPEFDSYFRAELSNSVDVETRERLLKEAINEVKINNCILASK  241

Query  845   QLQNILRLQSQLEGWNIVHRLDATEAF-QKRGGSGAEAYEAWERLVAAPSTMIVHDFICQ  1021
             QL+ I RL + ++GW I  RLDATE F +K+  +  EA E W+ +V   S  IV  F+C+
Sbjct  242   QLEKIKRLIN-VKGWKI-QRLDATEVFRRKQRNAEEEAEEIWKNIVMGQSIKIVGKFLCE  299

Query  1022  GTTTTFL  1042
                +  +
Sbjct  300   NNRSKMV  306



>emb|CDX85119.1| BnaC07g07870D [Brassica napus]
Length=332

 Score =   300 bits (769),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 156/294 (53%), Positives = 204/294 (69%), Gaps = 12/294 (4%)
 Frame = +2

Query  152   KQTQPMVSFPSGL---NISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKM  319
             KQ QP++SF + L   N++S  R ++KVVFVMGATG+GKSRLAIDLATRF  E++NSDK+
Sbjct  9     KQVQPILSFKNKLSMVNVNSFLRPQEKVVFVMGATGSGKSRLAIDLATRFQTEIINSDKI  68

Query  320   QVYKGLDIVTNKVREEECQGVPHHLLGVVDPNV-DFTAADFCRQALQAVDAITRKDRLPI  496
             QVYKGLD++TNKV  +EC+GVPHHLLGV D    + TA DFCR A Q +  ++  ++LPI
Sbjct  69    QVYKGLDVLTNKVTPQECRGVPHHLLGVFDSEAGNLTATDFCRLASQEISTLSANNKLPI  128

Query  497   IAGGSNSYIKALVKDHAEF-RSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEARE  673
             +AGGSNSYI+AL    + F  +KY+CCF+W+DV +PVL  FVS RV++M+E GL+EE RE
Sbjct  129   VAGGSNSYIEALANHSSGFLLNKYQCCFIWVDVSLPVLNSFVSKRVDRMMEAGLLEEVRE  188

Query  674   FFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQ  853
               DP  DY+ GI+RAIGVPE+ +Y       D   ++++L   +  IK NT  LA  QL 
Sbjct  189   VHDPKADYSVGIRRAIGVPELHEYLCYESLVDRATQRKMLDAAVKKIKENTEILACRQLL  248

Query  854   NILRLQSQLEGWNI-VHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDF  1012
              I RL  +   W + +HR+DATE F KR     EA +AWE LVA P+  IV  F
Sbjct  249   KIQRLSKK---WKLSMHRVDATEVFLKRNEE--EADKAWENLVARPTKRIVDKF  297



>ref|XP_006850780.1| hypothetical protein AMTR_s00025p00094380 [Amborella trichopoda]
 gb|ERN12361.1| hypothetical protein AMTR_s00025p00094380 [Amborella trichopoda]
Length=332

 Score =   300 bits (768),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 166/321 (52%), Positives = 211/321 (66%), Gaps = 23/321 (7%)
 Frame = +2

Query  131   MMSCCFCK---QTQPMVSFPSGL--NISSRWR---KDKVVFVMGATGTGKSRLAIDLATR  286
             MM    C+   Q  P+   P  L  +++  WR   KDKVV VMGATGTGKSRL+IDLA R
Sbjct  7     MMRLSGCRHRVQATPLARPPRPLRPHLALAWRGSGKDKVVVVMGATGTGKSRLSIDLAAR  66

Query  287   FVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDP--NVDFTAADFCRQALQA  460
             F AE++N+DKMQ+Y+GLDIVTNKV  EE +GVPHHLLG +DP  + DF   DF   A QA
Sbjct  67    FPAEIINADKMQLYQGLDIVTNKVPVEERRGVPHHLLGTLDPKSHQDFDCNDFRDLASQA  126

Query  461   VDAITRKDRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKM  640
             V +I+ +  LPI+AGGSNSYI ALV   A  + +YECCFLW+D  +PVL++FVSDRVE M
Sbjct  127   VLSISSRGHLPIVAGGSNSYIDALVSGPAPGQMRYECCFLWVDAALPVLHQFVSDRVEDM  186

Query  641   VEEGLIEEAREFFDPAG---DYTRGIKRAIGVPEMDQYFRILEASDERM--RQEVLQTGI  805
             VE GL+ + R  FD +G   D++RG+ +AIGVPEMD+  +    +   +  R  +++  +
Sbjct  187   VEAGLVADVRALFDTSGGRVDFSRGLGKAIGVPEMDRLIKSERQASLSLHERAALIREAM  246

Query  806   DNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAA  985
             + IKANTCKLA CQLQ I RL+S L GW + HRLDAT            A EAWERLV  
Sbjct  247   EEIKANTCKLACCQLQKIQRLRS-LRGWEL-HRLDATAVLD--AADRPSADEAWERLVVQ  302

Query  986   PSTMIVHDFICQGTTTTFLAP  1048
             PS  +V  F+    T T +AP
Sbjct  303   PSARVVRRFL----TATAVAP  319



>gb|ABD93933.1| adenylate isopentenyltransferase [Lotus japonicus]
Length=342

 Score =   299 bits (765),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 158/282 (56%), Positives = 201/282 (71%), Gaps = 13/282 (5%)
 Frame = +2

Query  212   KDKVVFVMGATGTGKSRLAIDLATRFV-AEVVNSDKMQVYKGLDIVTNKVREEECQGVPH  388
             KDKVV +MGATG+GKS+LAIDLAT F  AEVVNSDK+Q+Y GLDI TNKV EEEC+GVPH
Sbjct  36    KDKVVVIMGATGSGKSKLAIDLATHFPPAEVVNSDKIQMYSGLDIATNKVTEEECRGVPH  95

Query  389   HLLGVV-DPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHAEFRSKY  565
             HLLG   +PN++FTA+DFC+QA  A+ +I ++D LPIIAGGSNS+I ALV    EFR  Y
Sbjct  96    HLLGTFENPNMNFTASDFCKQASSAIGSIVKRDGLPIIAGGSNSFIDALVNHTPEFRFNY  155

Query  566   ECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPA---GDYTRGIKRAIGVPEM  736
             ECCFLW+DV +PVL+  +S RV++M++ G ++E R+FF  A    DYTRGI+RAIGVPE 
Sbjct  156   ECCFLWVDVSLPVLHNSLSRRVDRMIDAGQVDEVRQFFLNAHHQSDYTRGIRRAIGVPEF  215

Query  737   DQYFRILEAS--DERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWN-IVHRL  907
             D++ R  EAS  DER ++++L T I  +K N C LAS Q+Q I RL +    W   +HRL
Sbjct  216   DRFLRA-EASGADERTKRKLLDTAIAELKVNNCNLASRQVQKIHRLYNM---WKRSMHRL  271

Query  908   DATEAFQKRG-GSGAEAYEAWERLVAAPSTMIVHDFICQGTT  1030
             D TE   K G  S  EA + WE  V + S  I+  F+ + TT
Sbjct  272   DPTEVLLKNGCCSPEEAEKVWEDHVFSKSRRIIQKFLYEETT  313



>ref|XP_006406003.1| hypothetical protein EUTSA_v10022241mg [Eutrema salsugineum]
 gb|ESQ47456.1| hypothetical protein EUTSA_v10022241mg [Eutrema salsugineum]
Length=332

 Score =   298 bits (764),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 155/299 (52%), Positives = 204/299 (68%), Gaps = 12/299 (4%)
 Frame = +2

Query  137   SCCFCKQTQPMVSFPSGL---NISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVV  304
             S    KQ QP++SF + L   N++S    ++KVVFVMGATG+GK+RLAIDLATRF  E++
Sbjct  4     SISALKQVQPILSFKNKLSMVNVNSFLPPQEKVVFVMGATGSGKTRLAIDLATRFRGEII  63

Query  305   NSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNV-DFTAADFCRQALQAVDAITRK  481
             NSDK+Q+YKGLD++TNKV  +EC+GVPHHLLGV D    + TA DF R A Q +  ++  
Sbjct  64    NSDKIQLYKGLDVLTNKVTPQECRGVPHHLLGVFDSEAGNLTATDFSRLASQEISTLSAN  123

Query  482   DRLPIIAGGSNSYIKALVKDHAEF-RSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLI  658
              +LPI+AGGSNSYI+AL    + F  + Y CCF+W+DV +PVL  FVS RV++M+E GL+
Sbjct  124   HKLPIVAGGSNSYIEALANHSSGFLLNNYHCCFIWVDVSLPVLNSFVSKRVDRMMEAGLL  183

Query  659   EEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLA  838
             EE RE +DP  DY+ GI+RAIGVPE+ +Y R     D   ++++L   +  IK NT  LA
Sbjct  184   EEVREIYDPKADYSVGIRRAIGVPELHEYLRYESLVDRATQRKMLDVAVKKIKENTEILA  243

Query  839   SCQLQNILRLQSQLEGWNI-VHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDF  1012
               QL  I RL  +   W + +HR+DATE F +R  +G EA EAWE LVA PS  IV  F
Sbjct  244   CRQLLKIKRLSKK---WKLSMHRVDATEVFLRR--NGEEAEEAWENLVARPSERIVDKF  297



>ref|XP_006298111.1| hypothetical protein CARUB_v10014152mg [Capsella rubella]
 gb|EOA31009.1| hypothetical protein CARUB_v10014152mg [Capsella rubella]
Length=331

 Score =   298 bits (763),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 157/300 (52%), Positives = 203/300 (68%), Gaps = 12/300 (4%)
 Frame = +2

Query  134   MSCCFCKQTQPMVSFPSGL---NISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEV  301
              S    +Q QP++SF + L   N++S    K+KVVFVMGATG+GKSRLAIDLATRF +EV
Sbjct  3     FSISALRQVQPILSFKNKLSMVNVNSFLNPKEKVVFVMGATGSGKSRLAIDLATRFQSEV  62

Query  302   VNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNV-DFTAADFCRQALQAVDAITR  478
             +NSDK+Q+YKGLD++TNKV  +EC+GVPHHLLGV D    + TA  +   A QA+  ++ 
Sbjct  63    INSDKIQLYKGLDVLTNKVTPQECRGVPHHLLGVFDSEFGNLTATQYSNLASQAITKLSA  122

Query  479   KDRLPIIAGGSNSYIKALVKDHAEF-RSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGL  655
               +LPI+AGGSNSYI+AL    A F  + YECCF+W+DV +PVL  FVS RV++M+E GL
Sbjct  123   NHKLPIVAGGSNSYIEALANHSAGFLLNNYECCFIWVDVSLPVLNSFVSKRVDRMMEAGL  182

Query  656   IEEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKL  835
             +EE RE F+P  DY+ GI+RAIGVPE+ +Y R     D   ++ +L   + NIK NT  L
Sbjct  183   LEEVREVFNPKADYSVGIRRAIGVPELHEYLRYESLVDSATQRMMLDVAVKNIKKNTEIL  242

Query  836   ASCQLQNILRLQSQLEGWNI-VHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDF  1012
             A  QL+ I RL  +   W + +HR+DATE F KR     E  EAWE LVA PS  IV  F
Sbjct  243   ACRQLKKIQRLNKK---WKLSMHRVDATEVFLKRNVE--EQDEAWESLVARPSERIVDKF  297



>ref|XP_007045420.1| TRNA delta(2)-isopentenylpyrophosphate transferase, putative 
[Theobroma cacao]
 gb|EOY01252.1| TRNA delta(2)-isopentenylpyrophosphate transferase, putative 
[Theobroma cacao]
Length=329

 Score =   298 bits (762),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 145/271 (54%), Positives = 192/271 (71%), Gaps = 8/271 (3%)
 Frame = +2

Query  212   KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHH  391
             K+KV+FVMGAT TGKS+L+IDLAT+F  EV+NSDK+QV+KGLDI+TNKV EEE +GVPHH
Sbjct  63    KNKVIFVMGATATGKSKLSIDLATKFHGEVINSDKIQVFKGLDIITNKVTEEESRGVPHH  122

Query  392   LLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHA-EFRSKYE  568
             L+G+VDP  DFT  DFC   L+A+D I +   +PIIAGGSNSY++ LV+D + +FR  ++
Sbjct  123   LIGIVDPEEDFTVGDFCHHVLKAIDTILKNGHIPIIAGGSNSYLEKLVEDPSIKFREYFD  182

Query  569   CCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYF  748
             CCF+W+D  +PVLYE V  RV++MV  GL+EE R  F P  DYTRGIKRAIG PEM+ YF
Sbjct  183   CCFIWVDASLPVLYERVGKRVDEMVMNGLVEEVRAVFVPGADYTRGIKRAIGAPEMENYF  242

Query  749   RILE--ASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEA  922
              +      DE ++ ++L    + IK NT KL   QL+ I RL+ +L GW + HR+DAT  
Sbjct  243   LVENNIKVDEAIKTKILANAFEEIKINTRKLVDSQLRKIQRLRDEL-GWKM-HRIDATSV  300

Query  923   FQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
              +K    G +A + W+ +V   S  IV DF+
Sbjct  301   HEKH---GKDAEDTWKDVVLKKSLEIVGDFL  328



>dbj|BAE43829.1| isopentenyltransferase [Brassica rapa subsp. pekinensis]
 emb|CDX77492.1| BnaA07g06300D [Brassica napus]
Length=332

 Score =   298 bits (762),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 156/294 (53%), Positives = 204/294 (69%), Gaps = 12/294 (4%)
 Frame = +2

Query  152   KQTQPMVSFPSGL---NISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKM  319
             KQ QP++SF + L   N++S  R ++KVVFVMGATG+GKSRLAIDLATRF  E++NSDK+
Sbjct  9     KQVQPILSFKNKLSMVNVNSFLRPQEKVVFVMGATGSGKSRLAIDLATRFQTEIINSDKI  68

Query  320   QVYKGLDIVTNKVREEECQGVPHHLLGVVDPNV-DFTAADFCRQALQAVDAITRKDRLPI  496
             QVYKGLD++TNKV  +EC+GVPHHLLGV D    + TA DFCR A Q +  ++  ++LPI
Sbjct  69    QVYKGLDVLTNKVTPQECRGVPHHLLGVFDSEAGNLTATDFCRLASQEISTLSANNKLPI  128

Query  497   IAGGSNSYIKALVKDHAEF-RSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEARE  673
             +AGGSNSYI+AL    + F  +KY+CCF+W+DV +PVL  FVS RV++M+E GL+EE RE
Sbjct  129   VAGGSNSYIEALANHSSGFLLNKYQCCFIWVDVSLPVLNSFVSKRVDRMMEAGLLEEVRE  188

Query  674   FFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQ  853
               DP  DY+ GI+RAIGVPE+ +Y       D   ++++L   +  IK NT  LA  QL 
Sbjct  189   VHDPKADYSVGIRRAIGVPELHEYLCYESLVDRGTQRKMLDAAVKKIKENTEILACRQLL  248

Query  854   NILRLQSQLEGWNI-VHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDF  1012
              I RL  +   W + +HR+DATE F KR  +  EA EAWE LVA  +  IV  F
Sbjct  249   KIQRLSKK---WKLSMHRVDATEVFLKR--TEEEADEAWENLVARQTKRIVDKF  297



>dbj|BAB59033.1| cytokinin synthase [Arabidopsis thaliana]
Length=329

 Score =   298 bits (762),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 154/294 (52%), Positives = 204/294 (69%), Gaps = 12/294 (4%)
 Frame = +2

Query  152   KQTQPMVSFPSGL---NISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKM  319
             KQ QP++ F + L   N++S    K+KVVFVMGATG+GKSRLAIDLATRF  E++NSDK+
Sbjct  9     KQVQPILCFKNKLSKVNVNSFLHPKEKVVFVMGATGSGKSRLAIDLATRFQGEIINSDKI  68

Query  320   QVYKGLDIVTNKVREEECQGVPHHLLGVVDPNV-DFTAADFCRQALQAVDAITRKDRLPI  496
             Q+YKGLD++TNKV  +EC+GVPHHLLGV D    + TA  + R A QA+  ++  ++LPI
Sbjct  69    QLYKGLDVLTNKVTPKECRGVPHHLLGVFDSEAGNLTATQYSRLASQAISKLSANNKLPI  128

Query  497   IAGGSNSYIKALVKDHAEF-RSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEARE  673
             +AGGSNSYI+ALV   + F  + Y+CCF+W+DV +PVL  FVS RV++M+E GL+EE RE
Sbjct  129   VAGGSNSYIEALVNHSSGFLLNNYDCCFIWVDVSLPVLNSFVSKRVDRMMEAGLLEEVRE  188

Query  674   FFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQ  853
              F+P  +Y+ GI+RAIGVPE+ +Y R     D   + ++L   + NIK NT  LA  QL+
Sbjct  189   VFNPKANYSVGIRRAIGVPELHEYLRNESLVDRATKSKMLDVAVKNIKKNTEILACRQLK  248

Query  854   NILRLQSQLEGWNI-VHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDF  1012
              I RL  +   W + +HR+DATE F KR  +  E  EAWE LVA PS  IV  F
Sbjct  249   KIQRLHKK---WKMSMHRVDATEVFLKR--NVEEQDEAWENLVARPSERIVDKF  297



>ref|XP_006423200.1| hypothetical protein CICLE_v10029953mg [Citrus clementina]
 gb|ESR36440.1| hypothetical protein CICLE_v10029953mg [Citrus clementina]
Length=311

 Score =   297 bits (760),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/285 (50%), Positives = 191/285 (67%), Gaps = 7/285 (2%)
 Frame = +2

Query  206   WRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVP  385
             + K KVVFVMGAT TGK++L+IDLA  F  E +NSDK+QVYKGLDI TNKV E E QGVP
Sbjct  3     FNKKKVVFVMGATATGKTKLSIDLAIHFSGEAINSDKIQVYKGLDIATNKVTESERQGVP  62

Query  386   HHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDH-AEFRSK  562
             HHLLG VDP  D+   +FC  AL+A+D I     LPII GGSN+YI+ALV+D    FR+ 
Sbjct  63    HHLLGFVDPEADYPVEEFCEHALRAIDKIIENGHLPIIVGGSNTYIEALVEDSIINFRAN  122

Query  563   YECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQ  742
             Y+CCFLW+DV+  VLY++V  RV+KMVE GL++E R+ FDP  DY RGI+R+IG PE+ +
Sbjct  123   YDCCFLWMDVDPLVLYKYVGIRVDKMVEAGLVDEVRDMFDPNADYNRGIRRSIGAPELHE  182

Query  743   YFRI----LEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLD  910
             Y ++       +    ++ +L+  I   K NTCKL   Q+Q I RL+++L GW I HR+D
Sbjct  183   YLKLESNMKNETTNNNKELLLKKAIQETKDNTCKLVDKQVQKIKRLRNEL-GWKI-HRID  240

Query  911   ATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGTTTTFLA  1045
             AT   ++R     +A +AWE +V  P   IV DF+ +     ++ 
Sbjct  241   ATYVLERRMKDAEDAEDAWEEVVLKPGVAIVEDFLNKSNKNNYVG  285



>ref|XP_003536902.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Glycine max]
Length=344

 Score =   298 bits (762),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 152/305 (50%), Positives = 218/305 (71%), Gaps = 9/305 (3%)
 Frame = +2

Query  128   IMMSCCFCKQTQPMVSFP-SGLNISSRW-RKDKVVFVMGATGTGKSRLAIDLATRFVAEV  301
             + +S   C+ TQ +++ P SG  ++ R   K+K+V VMGATG GKSRL+IDLAT F +E+
Sbjct  1     MTISMFMCRLTQSIINVPCSGKKLNMRQIEKEKIVVVMGATGAGKSRLSIDLATCFPSEI  60

Query  302   VNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRK  481
             +NSDK+QVY+GLDIVTNK+ +E+ +GVPHHLLG+++PN+DF+A DFC  + + + +ITR 
Sbjct  61    INSDKIQVYEGLDIVTNKISKEDQRGVPHHLLGIINPNMDFSANDFCDTSSEIIASITRS  120

Query  482   DRLPIIAGGSNSYIKALV-KDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLI  658
             +RLPII GGSNSY++AL+  D  + RS+++   LW+DV MP L  +V++RV+ M+  G++
Sbjct  121   ERLPIIVGGSNSYLEALIDDDDYKCRSRFDFLCLWVDVAMPDLQSYVAERVDDMLYNGMV  180

Query  659   EEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERM-RQEVLQTGIDNIKANTCKL  835
             +E R F+ P GDY+RG++RAIGVPE D+YFR  E   +   R  +L+  +  +K NTCKL
Sbjct  181   DELRPFYSPNGDYSRGVRRAIGVPEFDEYFRREEEVVDEETRTRLLEEAVKEMKLNTCKL  240

Query  836   ASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             A  QL  I RL++ ++ W I HRLDAT  F++R   G EA EAW++LVA PS MIV  F+
Sbjct  241   AMKQLGKIRRLRN-VKRWEI-HRLDATPVFRRR---GEEANEAWKKLVAEPSAMIVARFL  295

Query  1016  CQGTT  1030
                 +
Sbjct  296   YNSNS  300



>ref|NP_566735.1| adenylate isopentenyltransferase 7 [Arabidopsis thaliana]
 sp|Q94ID1.2|IPT7_ARATH RecName: Full=Adenylate isopentenyltransferase 7, mitochondrial; 
Short=AtIPT7; AltName: Full=Adenylate dimethylallyltransferase 
7; AltName: Full=Cytokinin synthase 7; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB02782.1| tRNA isopentenyl transferase-like protein [Arabidopsis thaliana]
 dbj|BAB59046.1| adenylate isopentenyltransferase [Arabidopsis thaliana]
 dbj|BAE99312.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE76788.1| adenylate isopentenyltransferase 7 [Arabidopsis thaliana]
Length=329

 Score =   297 bits (761),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 153/294 (52%), Positives = 204/294 (69%), Gaps = 12/294 (4%)
 Frame = +2

Query  152   KQTQPMVSFPSGL---NISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKM  319
             KQ QP++ F + L   N++S    K+KV+FVMGATG+GKSRLAIDLATRF  E++NSDK+
Sbjct  9     KQVQPILCFKNKLSKVNVNSFLHPKEKVIFVMGATGSGKSRLAIDLATRFQGEIINSDKI  68

Query  320   QVYKGLDIVTNKVREEECQGVPHHLLGVVDPNV-DFTAADFCRQALQAVDAITRKDRLPI  496
             Q+YKGLD++TNKV  +EC+GVPHHLLGV D    + TA  + R A QA+  ++  ++LPI
Sbjct  69    QLYKGLDVLTNKVTPKECRGVPHHLLGVFDSEAGNLTATQYSRLASQAISKLSANNKLPI  128

Query  497   IAGGSNSYIKALVKDHAEF-RSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEARE  673
             +AGGSNSYI+ALV   + F  + Y+CCF+W+DV +PVL  FVS RV++M+E GL+EE RE
Sbjct  129   VAGGSNSYIEALVNHSSGFLLNNYDCCFIWVDVSLPVLNSFVSKRVDRMMEAGLLEEVRE  188

Query  674   FFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQ  853
              F+P  +Y+ GI+RAIGVPE+ +Y R     D   + ++L   + NIK NT  LA  QL+
Sbjct  189   VFNPKANYSVGIRRAIGVPELHEYLRNESLVDRATKSKMLDVAVKNIKKNTEILACRQLK  248

Query  854   NILRLQSQLEGWNI-VHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDF  1012
              I RL  +   W + +HR+DATE F KR  +  E  EAWE LVA PS  IV  F
Sbjct  249   KIQRLHKK---WKMSMHRVDATEVFLKR--NVEEQDEAWENLVARPSERIVDKF  297



>ref|XP_003528670.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Glycine max]
Length=336

 Score =   296 bits (759),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 161/312 (52%), Positives = 210/312 (67%), Gaps = 20/312 (6%)
 Frame = +2

Query  128   IMMSCCFCKQTQPMVSF-PS-----GLNISSRW--RKDKVVFVMGATGTGKSRLAIDLAT  283
             + +S   CK   P+ SF P+      +N  S +  +K+KVV +MGATGTGKS+LAI+LAT
Sbjct  5     LSVSAALCK---PVASFNPASHSLRNMNSLSLFMNKKEKVVVIMGATGTGKSKLAIELAT  61

Query  284   RFV-AEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQA  460
             +F  AE+VNSDKMQVY+GL+I TNKV EEE +GVPHHLLG V+PN  FTA DFC QA  A
Sbjct  62    QFPPAEIVNSDKMQVYEGLNITTNKVTEEERRGVPHHLLGTVNPNTSFTAQDFCDQATLA  121

Query  461   VDAITRKDRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKM  640
             V +I  +D LPIIAGGSNS++ ALV  H EFR +Y+CCFLW+DV +PVL+  +S RV++M
Sbjct  122   VGSILGRDGLPIIAGGSNSFLDALVNHHTEFRLRYDCCFLWVDVSLPVLHSSLSARVDRM  181

Query  641   VEEGLIEEAREFFDPAG-DYTRGIKRAIGVPEMDQYFRI-LEASDERMRQEVLQTGIDNI  814
             +  G + E R+ F     DYT GI++AIGVPE   +FR   + +D+R +Q +LQ  I ++
Sbjct  182   IHSGQLHEVRQSFQYHNQDYTLGIRKAIGVPEFHDFFRAEADGADQRTKQRLLQAAIASL  241

Query  815   KANTCKLASCQLQNILRLQSQLEGWN-IVHRLDATEAFQKRGGSGAEAYEAWERLVAAPS  991
             K N C LA  QLQ I RL S    W   +HRLDATE F K   +  EA EAWE  V + +
Sbjct  242   KTNNCTLAKRQLQKIHRLYSM---WKRNMHRLDATEVFLK--TTRQEAEEAWEDHVLSKT  296

Query  992   TMIVHDFICQGT  1027
               I+H F+ + T
Sbjct  297   RRILHKFLYEDT  308



>ref|XP_006487203.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Citrus sinensis]
Length=311

 Score =   296 bits (757),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 143/285 (50%), Positives = 191/285 (67%), Gaps = 7/285 (2%)
 Frame = +2

Query  206   WRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVP  385
             + K KVVFVMGAT TGK++L+IDLA  F  E +NSDK+QVYKGLDI TNKV E E QGVP
Sbjct  3     FNKKKVVFVMGATATGKTKLSIDLAIHFSGEAINSDKIQVYKGLDIATNKVTESERQGVP  62

Query  386   HHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDH-AEFRSK  562
             HHLLG VDP  D+   +FC  AL+A+D I     LPII GGSN+YI+ALV+D    FR+ 
Sbjct  63    HHLLGFVDPEADYPVEEFCEHALRAIDKIIENGHLPIIVGGSNTYIEALVEDSIINFRAN  122

Query  563   YECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQ  742
             Y+CCFLW+DV+  VLY++V  RV+KMVE GL++E R+ FDP  DY RGI+R+IG PE+ +
Sbjct  123   YDCCFLWMDVDPLVLYKYVGIRVDKMVEAGLVDEVRDMFDPNADYNRGIRRSIGAPELHE  182

Query  743   YFR----ILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLD  910
             Y +    +   +    ++ +L+  I   K NTCKL   Q+Q I RL+++L GW I HR+D
Sbjct  183   YLQFESNMKNETTNNNKELLLKKAIQETKDNTCKLVDKQVQKIKRLRNEL-GWKI-HRID  240

Query  911   ATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGTTTTFLA  1045
             AT   ++R     +A +AWE +V  P   IV DF+ +     ++ 
Sbjct  241   ATYVLERRMKDAEDAEDAWEEVVLKPGVAIVEDFLNKSNKNNYVG  285



>ref|XP_002883441.1| cytokinin synthase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59700.1| cytokinin synthase [Arabidopsis lyrata subsp. lyrata]
Length=328

 Score =   296 bits (758),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 153/294 (52%), Positives = 204/294 (69%), Gaps = 12/294 (4%)
 Frame = +2

Query  152   KQTQPMVSFPSGL---NISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKM  319
             KQ QP++SF + L   N++S    K+KVVFVMGATG+GKSRLAIDLATRF  E++NSDK+
Sbjct  9     KQVQPILSFKNKLCKVNVNSFLHPKEKVVFVMGATGSGKSRLAIDLATRFQGEIINSDKI  68

Query  320   QVYKGLDIVTNKVREEECQGVPHHLLGVVDPNV-DFTAADFCRQALQAVDAITRKDRLPI  496
             Q+YKGLD++TNKV  +EC+GVPHHLLGV D    + TA ++ R A Q +  ++  ++LPI
Sbjct  69    QLYKGLDVLTNKVTPKECRGVPHHLLGVFDSEAGNITATEYSRLASQEISKLSANNKLPI  128

Query  497   IAGGSNSYIKALVKDHAEF-RSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEARE  673
             +AGGSNSYI+AL    + F  + Y+CCF+W+DV +PVL  FVS RV++M+E GL+EE RE
Sbjct  129   VAGGSNSYIEALANHSSGFLLNNYDCCFIWVDVSLPVLNSFVSKRVDRMMEAGLLEEVRE  188

Query  674   FFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQ  853
              F+P  +Y+ GI+RAIGVPE+ +Y R     D   + ++L   + NIK NT  LA  QL+
Sbjct  189   MFNPKANYSVGIRRAIGVPELHEYLRNESLVDRATQSKMLDVAVKNIKKNTEILACRQLK  248

Query  854   NILRLQSQLEGWNI-VHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDF  1012
              I RL  +   W + +HR+DATE F KR  +  E  EAWE LVA PS  IV  F
Sbjct  249   KIQRLHKK---WKLSMHRVDATEVFLKR--NVEEQDEAWENLVARPSERIVDKF  297



>ref|XP_009102596.1| PREDICTED: adenylate isopentenyltransferase 7, mitochondrial 
[Brassica rapa]
Length=332

 Score =   296 bits (758),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 155/294 (53%), Positives = 204/294 (69%), Gaps = 12/294 (4%)
 Frame = +2

Query  152   KQTQPMVSFPSGL---NISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKM  319
             KQ QP++SF + L   N++S  R ++KVVFVMGATG+GKSRLAIDLATRF  +++NSDK+
Sbjct  9     KQVQPILSFKNKLSMVNVNSFLRPQEKVVFVMGATGSGKSRLAIDLATRFQTDIINSDKI  68

Query  320   QVYKGLDIVTNKVREEECQGVPHHLLGVVDPNV-DFTAADFCRQALQAVDAITRKDRLPI  496
             QVYKGLD++TNKV  +EC+GVPHHLLGV D    + TA DFCR A Q +  ++  ++LPI
Sbjct  69    QVYKGLDVLTNKVTPQECRGVPHHLLGVFDSEAGNLTATDFCRLASQEISTLSANNKLPI  128

Query  497   IAGGSNSYIKALVKDHAEF-RSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEARE  673
             +AGGSNSYI+AL    + F  +KY+CCF+W+DV +PVL  FVS RV++M+E GL+EE RE
Sbjct  129   VAGGSNSYIEALANHSSGFLLNKYQCCFIWVDVSLPVLNSFVSKRVDRMMEAGLLEEVRE  188

Query  674   FFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQ  853
               DP  DY+ GI+RAIGVPE+ +Y       D   ++++L   +  IK NT  LA  QL 
Sbjct  189   VHDPKADYSVGIRRAIGVPELHEYLCYESLVDRGTQRKMLDAAVKKIKENTEILACRQLL  248

Query  854   NILRLQSQLEGWNI-VHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDF  1012
              I RL  +   W + +HR+DATE F KR  +  EA EAWE LVA  +  IV  F
Sbjct  249   KIQRLSKK---WKLSMHRVDATEVFLKR--TEEEADEAWENLVARQTKRIVDKF  297



>ref|XP_007045376.1| TRNA delta(2)-isopentenylpyrophosphate transferase [Theobroma 
cacao]
 gb|EOY01208.1| TRNA delta(2)-isopentenylpyrophosphate transferase [Theobroma 
cacao]
Length=321

 Score =   296 bits (757),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 142/271 (52%), Positives = 194/271 (72%), Gaps = 8/271 (3%)
 Frame = +2

Query  212   KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHH  391
             K KV+FVMGAT TGKS+L+IDLAT F  E++NSDK+QVY+GLDI+TNK+ E E +G+PHH
Sbjct  55    KTKVIFVMGATATGKSKLSIDLATYFSGEIINSDKIQVYEGLDIITNKITEAEGRGIPHH  114

Query  392   LLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHA-EFRSKYE  568
             ++G VDPN DFT  DFCR ALQ +D I++K +LPIIAGGSNSY++ LV+D   +F+  +E
Sbjct  115   MIGFVDPNKDFTVDDFCRHALQNIDIISKKGQLPIIAGGSNSYLETLVEDSKFKFQDNFE  174

Query  569   CCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYF  748
             CCF+W+DV   VLY+ V++RV++MVE GL+EEAR    P  DYT+GI+RAIG PEM  YF
Sbjct  175   CCFIWLDVSKSVLYKRVANRVDEMVEAGLVEEARGMLVPEADYTKGIRRAIGAPEMHNYF  234

Query  749   RILEAS--DERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEA  922
              + + +  D+  + E+L   I+ IK NTCKL   Q + I RL+ +L GW + HR+DAT  
Sbjct  235   MLEKDTNIDDSTKNEILAHAIEEIKVNTCKLVDSQFRKIQRLREEL-GWKM-HRIDATSV  292

Query  923   FQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
              +K    G +A + W + V   +  IV +F+
Sbjct  293   HEK---CGKDAEDEWMKEVLEKTITIVDEFL  320



>ref|XP_009116977.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Brassica rapa]
 dbj|BAE43827.1| isopentenyltransferase [Brassica rapa subsp. pekinensis]
 emb|CDY63340.1| BnaA09g55640D [Brassica napus]
Length=332

 Score =   296 bits (758),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 161/308 (52%), Positives = 213/308 (69%), Gaps = 20/308 (6%)
 Frame = +2

Query  134   MSCCFCKQTQPMVSF---------PSGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATR  286
             +S   CKQ+ P  +          P+ L ++    K+KVV +MGATGTGKSRL++DLATR
Sbjct  5     ISMAMCKQSLPPSTNLEFSPARFGPNMLTLNPYVPKEKVVVIMGATGTGKSRLSVDLATR  64

Query  287   FVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVD  466
             F AE++NSDK+QV++GLDIVTNK+  EE  GVPHHLL V+ P  D TAA+FC  A  +V+
Sbjct  65    FQAEIINSDKIQVHQGLDIVTNKITTEERCGVPHHLLSVLPPQADLTAANFCHMANLSVE  124

Query  467   AITRKDRLPIIAGGSNSYIKALV-KDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMV  643
             ++  + +LPII GGSNSY++ALV  D  +FRSKY+CCFLW+DV +PVL  FVS+RV+KMV
Sbjct  125   SVLNRGKLPIIVGGSNSYVEALVDDDDYKFRSKYDCCFLWVDVALPVLNRFVSERVDKMV  184

Query  644   EEGLIEEAREFFDPA-GDYTRGIKRAIGVPEMDQYFR---ILEASDERMRQEVLQTGIDN  811
             + G++EEAR+FFD +  DY+RGIK+AIGVPE D +FR    L   D   R+ +L   +D 
Sbjct  185   QNGMVEEARDFFDYSDSDYSRGIKKAIGVPEFDIFFRNEPFLNLGD---REALLNKVVDE  241

Query  812   IKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPS  991
             IK+NT KLA  Q + I RL+ +++ W I  RLDAT    +R  S  +A  AWERLVA PS
Sbjct  242   IKSNTFKLACRQREKIERLR-KIKKWCI-QRLDATPVITRR-RSKVDADVAWERLVARPS  298

Query  992   TMIVHDFI  1015
             T  V  F+
Sbjct  299   TEAVSRFL  306



>emb|CDX93935.1| BnaC04g20940D [Brassica napus]
Length=334

 Score =   296 bits (758),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 160/305 (52%), Positives = 210/305 (69%), Gaps = 14/305 (5%)
 Frame = +2

Query  134   MSCCFCKQTQP---MVSFPSG------LNISSRWRKDKVVFVMGATGTGKSRLAIDLATR  286
             +S   CKQ  P    ++FP        L +S    KDKVV +MGATGTGKSRL++DLATR
Sbjct  5     ISMAMCKQPLPPSTALNFPPANFGPNMLTLSPSGPKDKVVVIMGATGTGKSRLSVDLATR  64

Query  287   FVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVD  466
             F AE++NSDK+QV++GLDIVTNK+  EE  GVPHHLLGV+ P  D TA +F   A  +V+
Sbjct  65    FPAEIINSDKIQVHQGLDIVTNKITTEESCGVPHHLLGVLPPEADLTAVNFRHMANLSVE  124

Query  467   AITRKDRLPIIAGGSNSYIKALV-KDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMV  643
             +I  + +LPII GGSNSY++ALV  D  +FRS+Y+CCFLW+DV +PVL+ FV++RV+KMV
Sbjct  125   SILSRGKLPIIVGGSNSYVEALVDDDDYKFRSRYDCCFLWVDVALPVLHGFVNERVDKMV  184

Query  644   EEGLIEEAREFFDPA-GDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKA  820
             E G++EE R+FFD +  +Y+RGIK+AIGVPE D +FR     +   R+E+L   +D IK 
Sbjct  185   ENGMVEEVRDFFDYSDSNYSRGIKKAIGVPEFDMFFRNEPFLNMGDREELLSKVVDEIKR  244

Query  821   NTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMI  1000
             NT  LA  Q   I RL+ +++ W I  RLDAT  F +R  S  +A  AWERLVA PST  
Sbjct  245   NTFGLACKQRNKIERLR-RIKKWCI-QRLDATPVFTRR-KSKVDADVAWERLVAGPSTDA  301

Query  1001  VHDFI  1015
             V  F+
Sbjct  302   VSRFL  306



>emb|CDY67797.1| BnaCnng56440D [Brassica napus]
Length=332

 Score =   295 bits (756),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 161/308 (52%), Positives = 212/308 (69%), Gaps = 20/308 (6%)
 Frame = +2

Query  134   MSCCFCKQTQP---MVSF------PSGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATR  286
             +S   CKQ+ P    + F      P+ L ++    K+KVV +MGATGTGKSRL++DLATR
Sbjct  5     ISMAMCKQSLPPSTTLDFSPARFGPNMLTLNPYVPKEKVVVIMGATGTGKSRLSVDLATR  64

Query  287   FVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVD  466
             F AE++NSDK+QV++GLDIVTNK+  EE  GVPHHLL V+ P  D TAA+FC  A  +V+
Sbjct  65    FQAEIINSDKIQVHQGLDIVTNKITTEERCGVPHHLLSVLPPQADLTAANFCHMANLSVE  124

Query  467   AITRKDRLPIIAGGSNSYIKALV-KDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMV  643
             ++  + +LPII GGSNSY++ALV  D  +FRSKY+CCFLW+DV +PVL  FVS+RV+KMV
Sbjct  125   SVLNRGKLPIIVGGSNSYVEALVDDDDYKFRSKYDCCFLWVDVALPVLNRFVSERVDKMV  184

Query  644   EEGLIEEAREFFDPAG-DYTRGIKRAIGVPEMDQYFR---ILEASDERMRQEVLQTGIDN  811
             + G++EEAR FFD +  DY+RGIK+AIGVPE D +FR    L   D   R+ +L   +D 
Sbjct  185   QNGMVEEARNFFDYSNSDYSRGIKKAIGVPEFDIFFRNEPFLSVGD---REALLNKVVDE  241

Query  812   IKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPS  991
             IK+NT KLA  Q + I RL+ +++ W I  R DAT    +R  S  +A  AWERLVA PS
Sbjct  242   IKSNTFKLACRQREKIERLR-KIKKWCI-QRFDATPVITRR-RSKVDADVAWERLVARPS  298

Query  992   TMIVHDFI  1015
             T  V  F+
Sbjct  299   TEAVSRFL  306



>ref|XP_010512718.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=337

 Score =   294 bits (753),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 159/306 (52%), Positives = 215/306 (70%), Gaps = 15/306 (5%)
 Frame = +2

Query  134   MSCCFCKQT---QPMVSFPSG------LNISSRWRKDKVVFVMGATGTGKSRLAIDLATR  286
             +S   CKQ     P + FP        L ++    KDKVV +MGATGTGKSRL++DLATR
Sbjct  5     ISMAMCKQPLPPSPALDFPPARFDRNMLTLNPYGPKDKVVVIMGATGTGKSRLSVDLATR  64

Query  287   F-VAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAV  463
             F  AE++NSDK+QV++GLDIVTNK+  EE  GVPHHLLGV+ P  D TAA++ + A  ++
Sbjct  65    FRAAEIINSDKIQVHQGLDIVTNKITSEESCGVPHHLLGVLPPEADLTAANYRQMANLSI  124

Query  464   DAITRKDRLPIIAGGSNSYIKALVKDH-AEFRSKYECCFLWIDVEMPVLYEFVSDRVEKM  640
             ++I  + +LPII GGSNSY++ALV D   +FRS+Y+CCFLW+DV +PVL+ FVS+RV+KM
Sbjct  125   ESILNRGKLPIIVGGSNSYMEALVDDEDKQFRSRYDCCFLWVDVALPVLHGFVSERVDKM  184

Query  641   VEEGLIEEAREFFDPA-GDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIK  817
             VE G++EE RE FD +  +Y+RGIK+AIGVPE D++FR  +  +   R+E+L+  +++IK
Sbjct  185   VENGMVEEVREIFDYSDSNYSRGIKKAIGVPEFDRFFRNEQFLNVGDREELLRKVVEDIK  244

Query  818   ANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTM  997
              NT  LA  Q + I RL+ +++ W I  RLDAT  F KR  S  +A  AWERLVA PST 
Sbjct  245   RNTFGLACRQREKIERLR-KVKKWCI-QRLDATPVFTKR-RSKTDADVAWERLVAGPSTA  301

Query  998   IVHDFI  1015
              V  F+
Sbjct  302   AVSRFM  307



>gb|KFK35473.1| hypothetical protein AALP_AA5G288800 [Arabis alpina]
Length=339

 Score =   294 bits (752),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 158/305 (52%), Positives = 210/305 (69%), Gaps = 14/305 (5%)
 Frame = +2

Query  134   MSCCFCKQT---QPMVSFPSG------LNISSRWRKDKVVFVMGATGTGKSRLAIDLATR  286
             +S   CKQ     P + FP        L ++    KDKVV +MGATGTGKSRL++DLATR
Sbjct  5     ISMAMCKQPLPPSPALDFPPARFGPNMLTLNPYGPKDKVVVIMGATGTGKSRLSVDLATR  64

Query  287   FVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVD  466
             F AE++NSDK+QV++GLDIVTNK+  EE  GVPHHLLGV+ P  D TA++F   A  +V+
Sbjct  65    FPAEIINSDKIQVHQGLDIVTNKITTEESCGVPHHLLGVLPPEADLTASNFRHMANSSVE  124

Query  467   AITRKDRLPIIAGGSNSYIKALVKDH-AEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMV  643
             +I  + +LPII GGSNSY++ALV D   +FRS+Y+CCFLW+DV +PVL+ FV++RV+KMV
Sbjct  125   SILSRGKLPIIVGGSNSYVEALVDDEDYKFRSRYDCCFLWVDVALPVLHGFVNERVDKMV  184

Query  644   EEGLIEEAREFFDPA-GDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKA  820
             + G+++E RE FD +  DY+RGIK+AIGVPE D +FR     + R R+E+L   ++ IK 
Sbjct  185   DNGMVDEVREVFDFSDSDYSRGIKKAIGVPEFDMFFRHEPFLNMRGREELLSKVVEEIKR  244

Query  821   NTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMI  1000
             NT  LA  Q + I RL+ +++ W I  RLDAT  F +R  S   A  AWERLVA PST  
Sbjct  245   NTFGLACKQREKIERLR-KVKKWCI-QRLDATPVFTRR-RSKVNADVAWERLVAGPSTDA  301

Query  1001  VHDFI  1015
             V  F+
Sbjct  302   VSRFL  306



>ref|XP_010512717.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=337

 Score =   293 bits (751),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 159/306 (52%), Positives = 214/306 (70%), Gaps = 15/306 (5%)
 Frame = +2

Query  134   MSCCFCKQT---QPMVSFPSG------LNISSRWRKDKVVFVMGATGTGKSRLAIDLATR  286
             +S   CKQ     P + FP        L ++    KDKVV +MGATGTGKSRL++DLATR
Sbjct  5     ISMAMCKQPLPPSPALDFPPARFDRNMLTLNPYGPKDKVVVIMGATGTGKSRLSVDLATR  64

Query  287   F-VAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAV  463
             F  AE++NSDK+QV++GLDIVTNK+  EE  GVPHHLLGV+ P  D TAA++ + A  ++
Sbjct  65    FRAAEIINSDKIQVHQGLDIVTNKITSEESCGVPHHLLGVLPPEADLTAANYRQMANLSI  124

Query  464   DAITRKDRLPIIAGGSNSYIKALVKDH-AEFRSKYECCFLWIDVEMPVLYEFVSDRVEKM  640
             ++I  + +LPII GGSNSY++ALV D   +FRS+Y+CCFLW+DV +PVL+ FVS+RV+KM
Sbjct  125   ESILNRGKLPIIVGGSNSYMEALVDDEDKQFRSRYDCCFLWVDVALPVLHGFVSERVDKM  184

Query  641   VEEGLIEEAREFFDPA-GDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIK  817
             VE G++EE RE FD +  +Y+RGIK+AIGVPE D++FR  +  +   R E+L+  +++IK
Sbjct  185   VENGMVEEVREIFDYSDSNYSRGIKKAIGVPEFDRFFRNEQFLNVGDRXELLRKVVEDIK  244

Query  818   ANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTM  997
              NT  LA  Q + I RL+ +++ W I  RLDAT  F KR  S  +A  AWERLVA PST 
Sbjct  245   RNTFGLACRQREKIERLR-KVKKWCI-QRLDATPVFTKR-RSKTDADVAWERLVAGPSTA  301

Query  998   IVHDFI  1015
              V  F+
Sbjct  302   AVSRFM  307



>ref|XP_010468886.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic 
[Camelina sativa]
Length=337

 Score =   293 bits (751),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 159/306 (52%), Positives = 214/306 (70%), Gaps = 15/306 (5%)
 Frame = +2

Query  134   MSCCFCKQT---QPMVSFPSG------LNISSRWRKDKVVFVMGATGTGKSRLAIDLATR  286
             +S   CKQ     P + FP        L ++    KDKVV +MGATGTGKSRL++DLATR
Sbjct  5     ISMAMCKQPLPPSPALDFPPARFDRNMLTLNPYGPKDKVVVIMGATGTGKSRLSVDLATR  64

Query  287   F-VAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAV  463
             F  AE++NSDK+QV++GLDIVTNK+  EE  GVPHHLLGV+ P  D TAA++ + A  ++
Sbjct  65    FRAAEIINSDKIQVHQGLDIVTNKITSEESCGVPHHLLGVLPPEADLTAANYRQMANLSI  124

Query  464   DAITRKDRLPIIAGGSNSYIKALVKDH-AEFRSKYECCFLWIDVEMPVLYEFVSDRVEKM  640
             ++I  + +LPII GGSNSY++ALV D   +FRS+Y+CCFLW+DV +PVL+ FVS+RV+KM
Sbjct  125   ESILNRGKLPIIVGGSNSYMEALVDDEDKQFRSRYDCCFLWVDVALPVLHGFVSERVDKM  184

Query  641   VEEGLIEEAREFFDPA-GDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIK  817
             VE G++EE RE FD +   Y+RGIK+AIGVPE D++FR  +  +   R+E+L+  ++ IK
Sbjct  185   VENGMVEEVREIFDYSDSSYSRGIKKAIGVPEFDRFFRNEQFLNVGDREELLRKVVEEIK  244

Query  818   ANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTM  997
              NT  LA  Q + I RL+ +++ W I  RLDAT  F KR  S  +A  AWERLVA PST+
Sbjct  245   RNTFGLACRQREKIERLR-KVKKWCI-QRLDATPVFTKR-RSKMDADVAWERLVAGPSTV  301

Query  998   IVHDFI  1015
              V  F+
Sbjct  302   AVSRFL  307



>ref|XP_006293019.1| hypothetical protein CARUB_v10019297mg [Capsella rubella]
 gb|EOA25917.1| hypothetical protein CARUB_v10019297mg [Capsella rubella]
Length=339

 Score =   293 bits (751),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 160/310 (52%), Positives = 213/310 (69%), Gaps = 21/310 (7%)
 Frame = +2

Query  134   MSCCFCKQT---QPMVSFPSG-------LNISSRWRKDKVVFVMGATGTGKSRLAIDLAT  283
             +S   CKQ     P + FP         L ++    KDKVV +MGATGTGKSRL+IDLAT
Sbjct  5     ISMAMCKQPLPPSPALDFPPARFGPSNMLTLNPYGPKDKVVVIMGATGTGKSRLSIDLAT  64

Query  284   RF-VAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQA  460
             RF  AE++NSDK+QV++GLDIVTNK+  EE  GVPHHLLGV+ P  D TAA++   A  +
Sbjct  65    RFRAAEIINSDKIQVHQGLDIVTNKITSEESCGVPHHLLGVLPPEADLTAANYRHMANVS  124

Query  461   VDAITRKDRLPIIAGGSNSYIKALVKDHA-EFRSKYECCFLWIDVEMPVLYEFVSDRVEK  637
             +++I  + +LPII GGSNSY++ALV D   +FRS+Y+CCFLW+DV +PVL+ FVS+RV+K
Sbjct  125   IESILNRGKLPIIVGGSNSYVEALVDDEENKFRSRYDCCFLWVDVALPVLHGFVSERVDK  184

Query  638   MVEEGLIEEAREFFDPA-GDYTRGIKRAIGVPEMDQYF---RILEASDERMRQEVLQTGI  805
             MVE G++EE RE FD +  +Y+RGIK+AIGVPE D++F   R L A D   R E+L+  +
Sbjct  185   MVENGMVEEVREIFDYSDSNYSRGIKKAIGVPEFDKFFRNERFLNAGD---RGELLRKVV  241

Query  806   DNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAA  985
             + IK NT  LA  Q + I RL+ +++ W I  +LDAT  F K+  S  +A  AWERLVA 
Sbjct  242   EEIKRNTFGLACKQREKIERLR-KVKKWCI-QKLDATPVFTKQRRSKTDADVAWERLVAG  299

Query  986   PSTMIVHDFI  1015
             P T+ V  F+
Sbjct  300   PGTIAVSRFM  309



>gb|KEH32204.1| adenylate isopentenyltransferase [Medicago truncatula]
Length=360

 Score =   294 bits (752),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 158/295 (54%), Positives = 201/295 (68%), Gaps = 21/295 (7%)
 Frame = +2

Query  161   QPMVSF-PSGLNISSRWR----KDKVVFVMGATGTGKSRLAIDLATRFV-AEVVNSDKMQ  322
             +P+VSF P  ++ +S ++    K+KV+ +MGAT TGKS+LAIDLAT F  AE++NSDK+Q
Sbjct  42    KPLVSFQPPLMDNNSLFQQHRNKEKVLVIMGATATGKSKLAIDLATHFPPAEIINSDKIQ  101

Query  323   VYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIA  502
             VYKGLDI TNKV EEEC+GV HHLLG +DPN DFT+ +FC QA  A  +I  +D LPIIA
Sbjct  102   VYKGLDITTNKVTEEECRGVHHHLLGTIDPNSDFTSKEFCEQATMATGSIVARDGLPIIA  161

Query  503   GGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFD  682
             GGSNSYI+ALV  H EF ++YECCFLW+DV   VL   +S RV++M+E G ++E RE F+
Sbjct  162   GGSNSYIEALVNHHHEFHTRYECCFLWVDVSRQVLQSSLSTRVDRMIEAGQVDEVREIFN  221

Query  683   PAG-DYTRGIKRAIGVPEMDQYFRI-LEAS-DERMRQEVLQTGIDNIKANTCKLASCQLQ  853
                 DYTRGI+RAIGVPE DQ+FR  LE   DER  +++L+  ID +K N  KLA+ Q+Q
Sbjct  222   KENHDYTRGIRRAIGVPEFDQFFRAELEGKVDERTMKKLLEVAIDALKINNIKLANRQVQ  281

Query  854   NILRLQSQLEGWN-IVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
              I RL      W   +HRLDATE   K         + WE  V   S  IVH F+
Sbjct  282   KIHRLYGM---WKRNMHRLDATEVVLKE--------KTWEDCVLTKSLRIVHKFL  325



>ref|XP_003550509.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic 
[Glycine max]
Length=340

 Score =   293 bits (750),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 157/311 (50%), Positives = 203/311 (65%), Gaps = 14/311 (5%)
 Frame = +2

Query  128   IMMSCCFCKQTQPMVSFPSGLNISS-------RWRKDKVVFVMGATGTGKSRLAIDLATR  286
             + +S   CK      +  S  N+ S       R  K+KVV +MGATGTGKS+LAIDLAT+
Sbjct  4     VSVSAAVCKPVVASFNPASLRNMDSLSLFRHHRNNKEKVVVIMGATGTGKSKLAIDLATQ  63

Query  287   FV-AEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAV  463
             F  AE+VNSDKMQVY+GLDI TNKV EEE +GV HHLLG V+PN +FTA DFC  A  AV
Sbjct  64    FPPAEIVNSDKMQVYEGLDITTNKVTEEERRGVLHHLLGTVNPNTNFTAQDFCDHATLAV  123

Query  464   DAITRKDRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMV  643
              +I  +D LPIIAGGSNS++ ALV  H EFR +YECCFLW+DV +PVL+  +S RV++M+
Sbjct  124   GSILGRDGLPIIAGGSNSFLDALVNHHTEFRLRYECCFLWVDVSLPVLHSSLSARVDRMI  183

Query  644   EEGLIEEAREFFDPAG-DYTRGIKRAIGVPEMDQYFRI-LEASDERMRQEVLQTGIDNIK  817
               G + E R+ F     DYT G+++AIGVPE   +FR   + +DER +Q +L+  I ++K
Sbjct  184   HAGQVHEVRKSFQYHNDDYTVGLRKAIGVPEFHDFFRAEADGADERTKQRLLEAAIASLK  243

Query  818   ANTCKLASCQLQNILRLQSQLEGWN-IVHRLDATEAFQKRGGSGAEAYEAWERLVAAPST  994
              N C LA+ Q+Q I RL      W   +HRLDATE F K      EA EAWE  V + S 
Sbjct  244   TNNCSLANRQVQKIHRLYGM---WKRNMHRLDATEVFLKNATRQEEAEEAWEDHVLSKSR  300

Query  995   MIVHDFICQGT  1027
              I++ F+ + T
Sbjct  301   RILNKFLYEDT  311



>ref|XP_010413197.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Camelina sativa]
Length=337

 Score =   293 bits (750),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 159/306 (52%), Positives = 215/306 (70%), Gaps = 15/306 (5%)
 Frame = +2

Query  134   MSCCFCKQT---QPMVSFPSG------LNISSRWRKDKVVFVMGATGTGKSRLAIDLATR  286
             +S   CKQ     P + FP        L ++    KDKVV +MGATGTGKSRL++DLATR
Sbjct  5     ISMAMCKQPLPPSPALDFPPARFDRNMLTLNPYGPKDKVVVIMGATGTGKSRLSVDLATR  64

Query  287   F-VAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAV  463
             F  AE++NSDK+QV++GLDIVTNK+  EE  GVPHHLLGV+ P  D TAA++ + A  ++
Sbjct  65    FRAAEIINSDKIQVHQGLDIVTNKITSEESCGVPHHLLGVLLPEADLTAANYRQMANLSI  124

Query  464   DAITRKDRLPIIAGGSNSYIKALVKDH-AEFRSKYECCFLWIDVEMPVLYEFVSDRVEKM  640
             ++I  + +LPII GGSNSY++ALV D   +FRS+Y+CCFLW+DV +PVL+ FVS+RV+KM
Sbjct  125   ESILNRGKLPIIVGGSNSYMEALVDDEDKQFRSRYDCCFLWVDVALPVLHGFVSERVDKM  184

Query  641   VEEGLIEEAREFFDPA-GDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIK  817
             VE G++EE RE FD +  +Y+RGIK+AIGVPE D++FR  +  +   R+E+L+  ++ IK
Sbjct  185   VENGMVEEVREIFDYSDSNYSRGIKKAIGVPEFDRFFRNEQFLNVGDREELLRKVVEEIK  244

Query  818   ANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTM  997
              NT  LA  Q + I RL+ +++ W I  RLDAT  F KR  S  +A  AWERLVA PST+
Sbjct  245   RNTFGLACRQREKIERLR-KVKKWCI-QRLDATPVFTKR-RSKMDADVAWERLVAGPSTV  301

Query  998   IVHDFI  1015
              V  F+
Sbjct  302   AVSRFL  307



>ref|XP_009778781.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Nicotiana sylvestris]
Length=338

 Score =   292 bits (747),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 152/312 (49%), Positives = 210/312 (67%), Gaps = 12/312 (4%)
 Frame = +2

Query  134   MSCCFCKQTQPMVSFPS-GLNISSRWRK----DKVVFVMGATGTGKSRLAIDLATRFVAE  298
             +S   C QT P +   +  L+     R+    DK+V VMGATG GKSRL++DLAT F  E
Sbjct  6     ISTIMCNQTWPSLRISNVSLDNMPFHRQPPKMDKLVVVMGATGAGKSRLSVDLATHFGGE  65

Query  299   VVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITR  478
             +VNSDK+QVYKGLD+ TNK+ EEE  G+ HHLLG +DP+ +FTA++FC  A  A+++IT 
Sbjct  66    IVNSDKIQVYKGLDVATNKITEEERCGIRHHLLGAIDPHKEFTASNFCDMASLAINSITC  125

Query  479   KDRLPIIAGGSNSYIKALVKDHA-EFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGL  655
             + +LPII GGSNS+I+AL+ D   E  ++Y  CFLW+DV M VL  F++ RV+KM+E+GL
Sbjct  126   RGKLPIIVGGSNSFIEALIYDKTYELYTRYNFCFLWVDVSMHVLNSFLTKRVDKMIEKGL  185

Query  656   IEEAREFFDPAG-DYTRGIKRAIGVPEMDQYFRILEAS--DERMRQEVLQTGIDNIKANT  826
             + E R  F+P   DY++GI++AIGVPE D+YFR   ++  DE  R ++L+  I+ +K N 
Sbjct  186   VNEVRNIFNPKNEDYSKGIRKAIGVPEFDRYFRAESSNSIDEETRIKLLEEAINEVKINN  245

Query  827   CKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGG-SGAEAYEAWERLVAAPSTMIV  1003
             CKLAS QL+ I RL + ++GWN VHRLDATE + KRG        E W+ LV   S  IV
Sbjct  246   CKLASQQLEKIKRLIN-VKGWN-VHRLDATEVYTKRGNEEEVMVEELWKNLVVGQSKRIV  303

Query  1004  HDFICQGTTTTF  1039
               F+C+   ++ 
Sbjct  304   DRFLCENYKSSM  315



>gb|AAM65536.1| cytokinin synthase [Arabidopsis thaliana]
Length=329

 Score =   291 bits (745),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 151/294 (51%), Positives = 202/294 (69%), Gaps = 12/294 (4%)
 Frame = +2

Query  152   KQTQPMVSFPSGL---NISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKM  319
             KQ QP++ F + L   N++S    K+KV+FVM ATG+GKSRLAIDLATRF  E++NSDK+
Sbjct  9     KQVQPILCFKNKLSKVNVNSFLHPKEKVIFVMEATGSGKSRLAIDLATRFQGEIINSDKI  68

Query  320   QVYKGLDIVTNKVREEECQGVPHHLLGVVDPNV-DFTAADFCRQALQAVDAITRKDRLPI  496
             Q+YKGLD++TNKV  +EC+GVPHHLLGV D    + TA  + R A QA+  ++  ++LPI
Sbjct  69    QLYKGLDVLTNKVTPKECRGVPHHLLGVFDSEAGNLTATQYSRLASQAISKLSANNKLPI  128

Query  497   IAGGSNSYIKALVKDHAEFR-SKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEARE  673
             +AGGS SYI+ALV   + F  + Y+CCF+W+DV +PVL  FVS RV++M+E GL+EE RE
Sbjct  129   VAGGSKSYIEALVNHSSGFLLNNYDCCFIWVDVSLPVLNSFVSKRVDRMMEAGLLEEVRE  188

Query  674   FFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQ  853
              F+P  +Y+ GI+RAIGVPE+ +Y R     D   + ++L   + NIK NT  LA  QL+
Sbjct  189   VFNPKANYSVGIRRAIGVPELHEYLRNESLVDRATKSKMLDVAVKNIKKNTEILACRQLK  248

Query  854   NILRLQSQLEGWNI-VHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDF  1012
              I RL  +   W + +HR+DATE F KR  +  E  EAWE LVA PS  IV  F
Sbjct  249   KIQRLHKK---WKMSMHRVDATEVFLKR--NVEEQDEAWENLVARPSERIVDKF  297



>ref|XP_004987245.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Setaria italica]
Length=345

 Score =   291 bits (745),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 147/283 (52%), Positives = 193/283 (68%), Gaps = 10/283 (4%)
 Frame = +2

Query  212   KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHH  391
             K KVV V+GAT TGKS+LA+DLA RF  EVVNSDK+QV+ GL IVTNKV  EEC+GVPHH
Sbjct  13    KGKVVVVIGATATGKSKLAVDLALRFGGEVVNSDKIQVHDGLAIVTNKVTAEECRGVPHH  72

Query  392   LLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHAEFRSKYEC  571
             L+GVV P+ D+TAADFCR A +AV +I  + R+PIIAGGSN Y++AL+     FR +YEC
Sbjct  73    LIGVVSPDADYTAADFCRDATRAVGSIHARGRIPIIAGGSNRYLEALLDWEPAFRRRYEC  132

Query  572   CFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYFR  751
             CFLW+D ++PVL  ++  RV+ M+E+GL++E R  F P  DY+RGI+RAIGVPEMD+YFR
Sbjct  133   CFLWVDGDLPVLDRYIRGRVDCMLEQGLVDEVRGIFQPDADYSRGIRRAIGVPEMDKYFR  192

Query  752   I-----LEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDAT  916
             +     L+  D+ +R ++L   +D IKANTC L   QL+ I RL   +  W++  RLDAT
Sbjct  193   LEAVGELDGDDDELRAQLLSVAVDEIKANTCGLVRRQLRKIRRLLG-ISRWSL-RRLDAT  250

Query  917   EAFQKRGGSGAEA---YEAWERLVAAPSTMIVHDFICQGTTTT  1036
                  +     +      AWE  VA P+T  V  F+ +   TT
Sbjct  251   AVLMLKTSVARDPETERAAWEADVAGPATRAVATFLGRNGQTT  293



>gb|EPS74194.1| hypothetical protein M569_00558, partial [Genlisea aurea]
Length=286

 Score =   289 bits (740),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 147/291 (51%), Positives = 206/291 (71%), Gaps = 10/291 (3%)
 Frame = +2

Query  152   KQTQPMVSFPSGLNISSRWR--KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQV  325
             KQ +P+   P+  N+  R    ++KVV VMGATGTGKSRL+IDLA  F  EV+NSDKMQV
Sbjct  3     KQIRPLPQLPTMANLLLRQNPPENKVVVVMGATGTGKSRLSIDLAEYFGGEVINSDKMQV  62

Query  326   YKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAG  505
             ++GLDI TNK+ +EE   VPHHLLG+ DP  +F+A +F   A  AV +I  +  LP+I G
Sbjct  63    FRGLDITTNKITDEERSCVPHHLLGISDPLSEFSAGNFRTLATAAVGSILSRGNLPLIVG  122

Query  506   GSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDP  685
             GSNSY++AL+   + FRSK+ECCFLW+DV +P L+  +S+RV++MV +G+IEE +EF+ P
Sbjct  123   GSNSYVEALID--SNFRSKFECCFLWVDVALPELHVSLSERVDRMVHKGMIEEVKEFYRP  180

Query  686   AGDYTRGIKRAIGVPEMDQYFRILE-ASDERMRQEVLQTGIDNIKANTCKLASCQLQNIL  862
              GDY+ GI ++IGVPE+D++FR+     D+  R+++L   ID +K NT KLA  QL+ I 
Sbjct  181   DGDYSYGILKSIGVPELDRFFRVESLCDDQETRRKILTEAIDAVKINTSKLAFRQLEKIR  240

Query  863   RLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             RL++ + GW + HRLDATEA +K  G   E+  AW+R V+AP+  +V  F+
Sbjct  241   RLKT-VNGWRL-HRLDATEALKKPAG---ESDAAWDRNVSAPAFSVVSRFL  286



>ref|XP_010488441.1| PREDICTED: adenylate isopentenyltransferase 7, mitochondrial-like 
[Camelina sativa]
Length=331

 Score =   290 bits (743),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 152/299 (51%), Positives = 201/299 (67%), Gaps = 12/299 (4%)
 Frame = +2

Query  137   SCCFCKQTQPMVSFP---SGLNISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVV  304
             S    KQ QP++SF    S +N++S    K+KVVFVMGATG+GK+RLAIDLATRF  E++
Sbjct  4     SISALKQVQPILSFKNKVSMVNVNSFLHPKEKVVFVMGATGSGKTRLAIDLATRFQTEII  63

Query  305   NSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNV-DFTAADFCRQALQAVDAITRK  481
             NSDK+Q+YKGLD++TNKV  +E +GVPHHLLGV+D    + TA  + R A QA+  ++  
Sbjct  64    NSDKIQLYKGLDVLTNKVTPQESRGVPHHLLGVLDSEFGNLTAIQYSRLASQAISTLSAN  123

Query  482   DRLPIIAGGSNSYIKALVKDHAEFR-SKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLI  658
              +LPI+AGGSNSYI+AL    + F  + YECCF+W+DV +PVL  FVS RV++M+E GL+
Sbjct  124   HKLPIVAGGSNSYIEALANHTSGFLLNNYECCFIWVDVSLPVLNSFVSKRVDRMMETGLL  183

Query  659   EEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLA  838
             EE RE F+P  DY+ GI+RAIGVPE+ +Y R     D   ++ +L   + NIK NT  LA
Sbjct  184   EEVREVFNPKADYSVGIRRAIGVPELHEYLRYESLVDRATQRMMLDVAVKNIKKNTELLA  243

Query  839   SCQLQNILRLQSQLEGWNI-VHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDF  1012
               Q + I RL  +   W + +HR+DATE F K      E  EAW+ LVA PS  IV  F
Sbjct  244   CRQFKKIQRLNKK---WKLSMHRVDATEVFLKHNVE--EQDEAWDSLVARPSERIVDKF  297



>ref|XP_009603455.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=337

 Score =   290 bits (742),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 154/312 (49%), Positives = 211/312 (68%), Gaps = 12/312 (4%)
 Frame = +2

Query  134   MSCCFCKQTQPMVSFPS-GLNISSRWRK----DKVVFVMGATGTGKSRLAIDLATRFVAE  298
             +S   C QT P +   + GL+     R+    DK+V VMGATG GKSRL++DLAT F  E
Sbjct  6     ISTVMCNQTWPSLRISNVGLDNMPFHRQPPKMDKLVVVMGATGAGKSRLSVDLATHFGGE  65

Query  299   VVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITR  478
             +VNSDK+QVYKGLD+ TNK+ EEE  G+PHHLLG +DP+ +F A +FC  A  A+++IT 
Sbjct  66    IVNSDKIQVYKGLDVATNKITEEERCGIPHHLLGAIDPHKEFEAKNFCDMASLAINSITC  125

Query  479   KDRLPIIAGGSNSYIKALVKDHA-EFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGL  655
             + +LPII GGSNS+I+AL  D   E  ++Y  CFLW+DV M VL  F++ RV+KMVE+GL
Sbjct  126   RGKLPIIVGGSNSFIEALFYDKTYEVYTRYNFCFLWVDVSMHVLNSFLTKRVDKMVEKGL  185

Query  656   IEEAREFFDPA-GDYTRGIKRAIGVPEMDQYFR--ILEASDERMRQEVLQTGIDNIKANT  826
             + E R  F+P   DY++GI++AIGVPE D+YFR  +  + DE  R ++L+  I+ +K N 
Sbjct  186   VNEVRNMFNPKNADYSKGIRKAIGVPEFDRYFRAELSNSVDEETRIKLLEEVINEVKINN  245

Query  827   CKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEA-WERLVAAPSTMIV  1003
             CKLAS QL+ I RL + ++GWN VHRLDATE ++KRG    E  E  W+ LV   S  I+
Sbjct  246   CKLASQQLEKIKRLIN-VKGWN-VHRLDATEVYKKRGNEEEEMVEELWKNLVVGQSKRIM  303

Query  1004  HDFICQGTTTTF  1039
               F+C+   ++ 
Sbjct  304   DRFLCENYRSSM  315



>ref|XP_010068121.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Eucalyptus grandis]
 ref|XP_010068622.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Eucalyptus grandis]
Length=303

 Score =   288 bits (738),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 151/295 (51%), Positives = 204/295 (69%), Gaps = 9/295 (3%)
 Frame = +2

Query  197   SSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQ  376
             + +  K KVVF+MGATGTGKS+L+I+LA  +  EV+NSDK+QVYKGLD+VTNKV + EC+
Sbjct  7     APKLNKPKVVFIMGATGTGKSKLSINLAVHYQTEVINSDKIQVYKGLDVVTNKVTDLECR  66

Query  377   GVPHHLLGVV-DPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHA-E  550
             GVPHHLLGV+ DP+VDF+  DFCR AL A++ IT++ R  I+AGGSNS+I+ LV+D    
Sbjct  67    GVPHHLLGVIDDPDVDFSVHDFCRDALTAINQITQRGRAAIVAGGSNSFIEVLVEDPTYN  126

Query  551   FRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVP  730
             F+S Y+CCF+W+DV  PVL E VS RV++MV  GLI+E R  F P  DY+RGI+RAIGVP
Sbjct  127   FKSIYDCCFIWLDVSPPVLNERVSKRVDEMVAAGLIDEVRGVFVPQPDYSRGIRRAIGVP  186

Query  731   EMDQYFRILE--ASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHR  904
             EMD++ R       DE+ ++ +L   I+ IK NT KL   Q++ I R+  +  GWNI  R
Sbjct  187   EMDRFLRAENRLIDDEKPKEVLLDEAINEIKVNTFKLTCRQVEKI-RMLREERGWNI-RR  244

Query  905   LDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGTTTTFLAPPTSPNSV  1069
             +DAT  F+  G +  E  +AW  LV  PS  +V DF+ +G   +F  P   P ++
Sbjct  245   IDATGVFESPGAADVE--KAWRSLVLEPSLAMVGDFL-KGHEKSFSRPNQFPATL  296



>ref|XP_009138635.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Brassica rapa]
 emb|CDX89173.1| BnaA04g00130D [Brassica napus]
Length=334

 Score =   290 bits (741),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 158/310 (51%), Positives = 210/310 (68%), Gaps = 14/310 (5%)
 Frame = +2

Query  134   MSCCFCKQTQ--------PMVSF-PSGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATR  286
             +S   CKQ          P  +F P+ L +S    KDKVV +MGATGTGKSRL++D+ATR
Sbjct  5     ISMAMCKQPLAPSTALNFPPANFGPNMLTLSPSGPKDKVVVIMGATGTGKSRLSVDIATR  64

Query  287   FVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVD  466
             F AE++NSDK+QV++GLDIVTNK+  EE  GVPHHLLGV+ P  D TA +F   A  +V+
Sbjct  65    FPAEIINSDKIQVHQGLDIVTNKITTEESCGVPHHLLGVLPPEADLTAVNFRHMANLSVE  124

Query  467   AITRKDRLPIIAGGSNSYIKALVKDH-AEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMV  643
             +I  + +LPII GGSNSY++ALV D   +FRS+Y+CCFLW+DV +PVL+  V++RV+KMV
Sbjct  125   SILSRGKLPIIVGGSNSYVEALVDDEDYKFRSRYDCCFLWVDVALPVLHGSVNERVDKMV  184

Query  644   EEGLIEEAREFFDPA-GDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKA  820
               G++EE R+FFD +  +Y+RGIK+AIGVPE D +FR     +   R+E+L   +D IK 
Sbjct  185   ANGMVEEVRDFFDYSDSNYSRGIKKAIGVPEFDMFFRNEPFLNTGDREELLSKVVDEIKR  244

Query  821   NTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMI  1000
             NT  LA  Q   I RL+ +++ W I  RLDAT  F +R  S  +A  AWERLVA PST  
Sbjct  245   NTFGLACKQRNKIERLR-KIKKWCI-QRLDATPVFTRR-RSKVDADVAWERLVAGPSTDA  301

Query  1001  VHDFICQGTT  1030
             V  F+   T+
Sbjct  302   VSRFLLDFTS  311



>ref|XP_003590677.1| Adenylate isopentenyltransferase [Medicago truncatula]
 gb|AES60928.1| adenylate isopentenyltransferase [Medicago truncatula]
Length=327

 Score =   287 bits (735),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 146/299 (49%), Positives = 204/299 (68%), Gaps = 10/299 (3%)
 Frame = +2

Query  134   MSCCFCKQT-QPMVSFP--SGLNISSRW-RKDKVVFVMGATGTGKSRLAIDLATRFVAEV  301
             +S   C+   QP+ S    SG  ++ R  +K+ VV VMGATGTGKS+L+IDLA  F +E+
Sbjct  3     ISLSMCRLIRQPLTSNVQCSGKKLNMRQIQKENVVLVMGATGTGKSKLSIDLANYFPSEI  62

Query  302   VNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRK  481
             +NSDK+Q+Y+GLDIVTNK+  EE +G+PHHLLG  +PN++FT+ DF  ++  A+D I   
Sbjct  63    INSDKIQIYEGLDIVTNKITLEEQKGIPHHLLGTHNPNIEFTSNDFREKSTSAIDLIMSG  122

Query  482   DRLPIIAGGSNSYIKALV-KDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLI  658
               LPII GGSNSY++ALV  D   FRS+Y  C LW+DV MP+L  ++  RV++M+  G++
Sbjct  123   GNLPIIVGGSNSYLEALVDDDDYNFRSRYNFCCLWVDVSMPILRSYIDQRVDQMLNSGMV  182

Query  659   EEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLA  838
              E R F++P GDY++GI++AIGVPE D+YFR     D+  R+ +L   +  +K NT KLA
Sbjct  183   NELRPFYNPNGDYSKGIRKAIGVPEFDEYFRRESYVDDETRKMLLDKAVSEMKINTWKLA  242

Query  839   SCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
               QL  I  L++ ++ WNI HRLDAT  F+K    G EA E W+++VA PS MIV  F+
Sbjct  243   KKQLGKIDWLKN-VKRWNI-HRLDATPVFKKH---GKEADETWKKIVAEPSAMIVAQFL  296



>ref|XP_006653174.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Oryza brachyantha]
Length=342

 Score =   288 bits (737),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 150/285 (53%), Positives = 190/285 (67%), Gaps = 14/285 (5%)
 Frame = +2

Query  212   KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHH  391
             K KVV VMGAT TGKS+LAIDLA RF  EV+NSDK+QV+ GLD+VTNKV +EE  GVPHH
Sbjct  7     KSKVVVVMGATATGKSKLAIDLALRFGGEVINSDKIQVHDGLDVVTNKVTDEERAGVPHH  66

Query  392   LLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHAEFRSKYEC  571
             L+G V P VD+  ADFCR A +AV ++  + RLPIIAGGSN Y++AL+     FR ++E 
Sbjct  67    LIGGVHPEVDYEVADFCRDAARAVGSVLARGRLPIIAGGSNRYLEALLDGEPGFRRRHEL  126

Query  572   CFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYFR  751
             CFLW+D ++PVL  ++ DRV+ MVE+GL+ E RE F    DY+RGI+R+IGVPEMD +FR
Sbjct  127   CFLWVDAQLPVLRSYMHDRVDCMVEQGLVGEVRELFRLDADYSRGIRRSIGVPEMDAFFR  186

Query  752   ILEAS--------DERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRL  907
               EAS        DE +R  +L   I  IKANTCKLA  QL  I RL+  L GW++ HRL
Sbjct  187   -HEASKALAGADDDEELRARLLAAAIGEIKANTCKLAHRQLLKIHRLRG-LAGWSL-HRL  243

Query  908   DATEAFQ---KRGGSGAEAYEAWERLVAAPSTMIVHDFICQGTTT  1033
             D T A     +R  S A  + AW+  V  P+  +V  F+  G   
Sbjct  244   DVTRALALKVERTSSKAAQHAAWDADVVEPAARVVETFLHGGNVA  288



>ref|XP_010512656.1| PREDICTED: adenylate isopentenyltransferase 7, mitochondrial 
[Camelina sativa]
Length=330

 Score =   287 bits (734),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 151/299 (51%), Positives = 200/299 (67%), Gaps = 12/299 (4%)
 Frame = +2

Query  137   SCCFCKQTQPMVSFP---SGLNISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVV  304
             S    KQ QP++SF    S +N++S    K+KVVFVMGATG+GK+RLAIDLATRF  E++
Sbjct  4     SISALKQVQPILSFKNKVSMVNVNSFLHPKEKVVFVMGATGSGKTRLAIDLATRFQTEII  63

Query  305   NSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNV-DFTAADFCRQALQAVDAITRK  481
             NSDK+Q+YKGLD++TNKV  +E +GVPH LLGV+D    + TA  + R A QA+  ++  
Sbjct  64    NSDKIQLYKGLDVLTNKVTPQESRGVPHQLLGVLDSEFGNLTAIQYSRLASQAISTLSAN  123

Query  482   DRLPIIAGGSNSYIKALVKDHAEFR-SKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLI  658
              +LPI+AGGSNSYI+AL    + F  + YECCF+W+DV +PVL  FVS RV++M+E GL+
Sbjct  124   HKLPIVAGGSNSYIEALANHTSGFLLNNYECCFIWVDVSLPVLNSFVSKRVDRMMETGLL  183

Query  659   EEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLA  838
             EE RE F+P  DY+ GI+RAIGVPE+ +Y R     D   ++ +L   + NIK NT  LA
Sbjct  184   EEVREVFNPKADYSVGIRRAIGVPELHEYLRYESLVDRATQRMMLDVAVKNIKKNTELLA  243

Query  839   SCQLQNILRLQSQLEGWNI-VHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDF  1012
               Q + I RL  +   W + +HR+DATE F K      E  EAW+ LVA PS  IV  F
Sbjct  244   CRQFKKIQRLNKK---WKLSMHRVDATEVFLKHNVE--EQDEAWDSLVARPSERIVDKF  297



>ref|XP_006402308.1| hypothetical protein EUTSA_v10006499mg [Eutrema salsugineum]
 gb|ESQ43761.1| hypothetical protein EUTSA_v10006499mg [Eutrema salsugineum]
Length=339

 Score =   286 bits (732),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 158/308 (51%), Positives = 210/308 (68%), Gaps = 20/308 (6%)
 Frame = +2

Query  134   MSCCFCKQT---QPMVSFPSG------LNISSRWRKDKVVFVMGATGTGKSRLAIDLATR  286
             +S   CKQ     P + FP        LN++    KDKVV +MGATGTGKSRL++DLATR
Sbjct  5     ISMAMCKQPLPPSPALDFPPARFGPNMLNLNPYGPKDKVVVIMGATGTGKSRLSVDLATR  64

Query  287   FVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVD  466
             F AE++NSDK+QV++GLDIVTNK+  +E  GVPHHLLGV+ P  D TA++F   A  +V+
Sbjct  65    FPAEIINSDKIQVHQGLDIVTNKITADESCGVPHHLLGVLPPEADLTASNFRHMANLSVE  124

Query  467   AITRKDRLPIIAGGSNSYIKALVKDH-AEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMV  643
             ++  + +LPII GGSNSY++ALV D    FRS+Y+CCFLW+DV++ VL  FVS+RV+KMV
Sbjct  125   SVINRGKLPIIVGGSNSYVEALVDDEDYTFRSRYDCCFLWVDVKLDVLRGFVSERVDKMV  184

Query  644   EEGLIEEAREFFDPA-GDYTRGIKRAIGVPEMDQYFR---ILEASDERMRQEVLQTGIDN  811
             E+G++EE RE FD +  DY+RGIK+AIGVPE D++FR    L   D   ++E+L   ++ 
Sbjct  185   EKGMVEEVREIFDFSDSDYSRGIKKAIGVPEFDRFFRNEPFLNVGD---KEELLSKVVEE  241

Query  812   IKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPS  991
             IK NT  LA  Q   I RL  +++ W I  RLDAT  F +R  S  +A  AWE+LVA PS
Sbjct  242   IKRNTFGLACRQRDKIDRL-IKIKKWCI-QRLDATPVFTRR-RSTVDADVAWEKLVAGPS  298

Query  992   TMIVHDFI  1015
             T  V  F+
Sbjct  299   TDAVSRFL  306



>gb|AEA03283.1| isopentenyltransferase [Cucumis sativus]
Length=334

 Score =   286 bits (731),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 140/257 (54%), Positives = 191/257 (74%), Gaps = 4/257 (2%)
 Frame = +2

Query  128  IMMSCCFCKQTQPMV-SFPSGLNISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEV  301
            + ++    KQ QP+V +F    N+   +R KDKVV VMGATGTGKSRLAI+LATRF +E+
Sbjct  5    LSLTSAAGKQVQPLVGNFQGNFNMEQFFRRKDKVVVVMGATGTGKSRLAIELATRFPSEI  64

Query  302  VNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRK  481
            VNSDK+QVY+GLD+VTNKV EEE +G+PHHLL  +DP  +F++ DF   A  A+++I  +
Sbjct  65   VNSDKIQVYEGLDVVTNKVTEEERRGIPHHLLSSIDPKSNFSSRDFTHHASGAIESILAR  124

Query  482  DRLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIE  661
            DRLPIIAGGSNSYI+ALV D+AE R +YE CFLW+DV +P+L +FVSDRV++MV+ G +E
Sbjct  125  DRLPIIAGGSNSYIEALVNDYAEARFRYEFCFLWVDVSLPILQKFVSDRVDRMVDGGFVE  184

Query  662  EAREFFDPAGDYTRGIKRAIGVPEMDQYFRI-LEASDERMRQEVLQTG-IDNIKANTCKL  835
            E R+ FDP GDY++GIKRAIGVPE+ ++ R   + +DER+   +L+ G    +K NTC+L
Sbjct  185  EVRQIFDPEGDYSQGIKRAIGVPELHEFLRAERDGADERVLNILLELGDFKKLKDNTCRL  244

Query  836  ASCQLQNILRLQSQLEG  886
            A    +  +RL  + +G
Sbjct  245  AFPSTREGIRLSFEEKG  261



>ref|XP_007210848.1| hypothetical protein PRUPE_ppa015780mg, partial [Prunus persica]
 gb|EMJ12047.1| hypothetical protein PRUPE_ppa015780mg, partial [Prunus persica]
Length=292

 Score =   284 bits (727),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 143/272 (53%), Positives = 194/272 (71%), Gaps = 11/272 (4%)
 Frame = +2

Query  212   KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHH  391
             K KV+FV+G+TG GK++L+IDLATR+  E++NSDK+QVYKGLDIVTNK  + E +G+ HH
Sbjct  24    KTKVIFVLGSTGCGKTKLSIDLATRYNGEIINSDKIQVYKGLDIVTNKATKPEQRGILHH  83

Query  392   LLGVV-DPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHA-EFRSKY  565
             LLG + DP  DFT  DFC Q  +A+D IT+++R+PIIAGGSN+YI+ALV+D    F+ KY
Sbjct  84    LLGSIQDPEADFTVQDFCLQVPKALDEITKRNRVPIIAGGSNTYIEALVEDPTLRFQDKY  143

Query  566   ECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQY  745
             +CCF+W+DV +PVLY  VS+RV++MV+ GL++E RE F P  DY RGI+RAIG PEM  Y
Sbjct  144   DCCFIWLDVSLPVLYNRVSERVDEMVDAGLVDELREMFVPGADYERGIRRAIGAPEMHAY  203

Query  746   F--RILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATE  919
             F   +  ++DE  ++ + + GI   K NT KLA  Q+Q I RL ++   W+I HR+D T 
Sbjct  204   FMAEMDHSADEAGKEFLFKDGIQKTKDNTLKLAESQVQKIERLGTK---WDI-HRIDVTA  259

Query  920   AFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
               + R   G +A  AWE LV  PS  IV +F+
Sbjct  260   VHESR---GKKAVVAWENLVLKPSFSIVSEFL  288



>ref|XP_009400154.1| PREDICTED: adenylate isopentenyltransferase 7, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=334

 Score =   286 bits (731),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 148/269 (55%), Positives = 195/269 (72%), Gaps = 6/269 (2%)
 Frame = +2

Query  212   KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHH  391
             K+KVVFV+G TG+GKS+LAI LA  F  EVVNSDKMQVY G+ ++TNKV EEE + VPHH
Sbjct  10    KEKVVFVLGVTGSGKSKLAIALAKCFNGEVVNSDKMQVYDGIPVITNKVTEEEKEDVPHH  69

Query  392   LLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVK-DHAEFRSKYE  568
             L+G V+P  +FTAADF R+A + V+AI  + RLPIIAGGSNSY+K LV+ D   FRS+Y+
Sbjct  70    LIGGVNPEGNFTAADFRREATRLVEAILARGRLPIIAGGSNSYVKKLVEGDGCGFRSRYD  129

Query  569   CCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYF  748
             CCF+W+DV++ VL +FV  RV+KMVE GL+EEAR  F P GDY+ GI+ +IGV EM  YF
Sbjct  130   CCFVWVDVDLTVLRDFVYARVDKMVELGLVEEARSMFKPDGDYSTGIRLSIGVREMHLYF  189

Query  749   RILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQ  928
             +  E +DE  +  +L+  +D +KANT  L   QLQ I     ++ GW++ HR+D+TE F+
Sbjct  190   QSEEGADEETKARLLEASLDKVKANTFDLTCGQLQKIQGF--RVMGWDL-HRVDSTEFFR  246

Query  929   KRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             +R G GAE  E W+ +V APS  IV  F+
Sbjct  247   QR-GQGAEE-ELWKEVVWAPSAEIVRSFL  273



>ref|XP_004148309.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004163632.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Cucumis sativus]
 gb|KGN44317.1| hypothetical protein Csa_7G253720 [Cucumis sativus]
Length=339

 Score =   285 bits (730),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 138/274 (50%), Positives = 199/274 (73%), Gaps = 8/274 (3%)
 Frame = +2

Query  209   RKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPH  388
             +K K+VFVMG+T TGKS+L++DLAT F +E++NSDK+Q YKGLDI+TNK+ + + +GVPH
Sbjct  12    KKHKIVFVMGSTATGKSKLSVDLATFFPSEIINSDKIQFYKGLDIITNKINQSDRRGVPH  71

Query  389   HLLGVV-DPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDH-AEFRSK  562
             HLLGV+ DP+ D TA +FC     A+  +  +  LPI+ GGSN+YI+ALV++   +FRS+
Sbjct  72    HLLGVIHDPDADLTAGEFCSLVEDAIADVISRGCLPIVVGGSNNYIEALVENPITDFRSR  131

Query  563   YECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQ  742
             ++CCFLW DV +PVLY++++ RV++MVE GL+EE RE F P  DY+RGI+RAIG PE+D 
Sbjct  132   FDCCFLWTDVALPVLYKYIAKRVDQMVELGLVEEVREMFVPGADYSRGIRRAIGAPELDS  191

Query  743   YFRILEASDER-MRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATE  919
             YF+  + ++E   + ++L++GI  IK NTC+LA  Q   I RL+ ++ GW + HR+DAT 
Sbjct  192   YFKAEKNNEEETYKNDLLKSGIHEIKENTCRLALRQFGKIHRLRDEI-GWGL-HRIDATA  249

Query  920   AFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQ  1021
              F+K   SG EA + W   V  PS  IV +F+ +
Sbjct  250   VFEK---SGEEAADEWMNGVLKPSLGIVGEFLNE  280



>ref|XP_010932022.1| PREDICTED: uncharacterized protein LOC105052792 [Elaeis guineensis]
Length=575

 Score =   293 bits (749),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 150/266 (56%), Positives = 193/266 (73%), Gaps = 8/266 (3%)
 Frame = +2

Query  233   MGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDP  412
             MGATGTGKSRLAIDLA RF  EVVNSDKMQ+Y G+D+VTNKV +EE +G+PHHLLG + P
Sbjct  258   MGATGTGKSRLAIDLAVRFNGEVVNSDKMQLYDGVDVVTNKVTDEETRGIPHHLLGGILP  317

Query  413   NVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHAE--FRSKYECCFLWI  586
             + DFTA+DF R A +A+ +I ++ RLP++AGGSNSYI+ L++       RS+YECCFLW+
Sbjct  318   DADFTASDFRRVAGRAISSIAQRGRLPVVAGGSNSYIEELIEGGGRECGRSRYECCFLWV  377

Query  587   DVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYFRI-LEA  763
             DV+   L+ FV +RV++MVE GL+EE R  FDP  DY RGI++AIGVPEMD Y R   E 
Sbjct  378   DVQPKELHRFVGERVDRMVERGLVEEVRRVFDPEADYGRGIRKAIGVPEMDGYLRAEKEG  437

Query  764   SDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGS  943
               E  +  +L+  ID IKANT KL   QLQ I RL++ L GW+ VHR+DATE F++    
Sbjct  438   VGEWTKARLLELAIDEIKANTRKLTCRQLQKIHRLRA-LPGWD-VHRVDATEVFRR---G  492

Query  944   GAEAYEAWERLVAAPSTMIVHDFICQ  1021
             G EA ++W+ LV+ PS  IV  F+ Q
Sbjct  493   GEEADQSWDELVSRPSIEIVGQFLSQ  518



>gb|KDO51454.1| hypothetical protein CISIN_1g044048mg [Citrus sinensis]
Length=269

 Score =   282 bits (722),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/266 (52%), Positives = 180/266 (68%), Gaps = 7/266 (3%)
 Frame = +2

Query  233   MGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDP  412
             MGAT TGK++L+IDLA  F  E +NSDK+QVYKGLDI TNKV E E QGVPHHLLG VDP
Sbjct  1     MGATATGKTKLSIDLAIHFSGEAINSDKIQVYKGLDIATNKVTESERQGVPHHLLGFVDP  60

Query  413   NVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDH-AEFRSKYECCFLWID  589
               D+   +FC  AL+A+D I     LPII GGSN+YI+ALV+D    FR+ Y+CCF+W+D
Sbjct  61    EADYPVEEFCEHALRAIDKIIENGHLPIIVGGSNTYIEALVEDSIINFRANYDCCFIWMD  120

Query  590   VEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYFR----IL  757
             V+  VLY++V  RV+KMVE GL++E R+ FDP  DY RGI+R+IG PE+ +Y +    + 
Sbjct  121   VDPLVLYKYVGIRVDKMVETGLVDEVRDMFDPNADYNRGIRRSIGAPELHEYLKLESNVK  180

Query  758   EASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRG  937
               +    +  +L+  I  IK NTCKL   Q+Q I RL+++L GW I HR+DAT   + R 
Sbjct  181   NETTNNNKDLLLKKAIQEIKDNTCKLVDKQVQKIKRLRNEL-GWKI-HRIDATYVLEGRM  238

Query  938   GSGAEAYEAWERLVAAPSTMIVHDFI  1015
                 +A +AWE +V  P   IV DF+
Sbjct  239   KDAEDAEDAWEEVVLKPGVAIVEDFL  264



>ref|XP_002457830.1| hypothetical protein SORBIDRAFT_03g014490 [Sorghum bicolor]
 gb|EES02950.1| hypothetical protein SORBIDRAFT_03g014490 [Sorghum bicolor]
Length=368

 Score =   285 bits (729),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 147/282 (52%), Positives = 189/282 (67%), Gaps = 23/282 (8%)
 Frame = +2

Query  233   MGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDP  412
             MGAT TGKS+LAIDLA RF  EV+NSDK+QV+ GLD+VTNKV   ECQGVPHHL+G V P
Sbjct  24    MGATATGKSKLAIDLALRFGGEVINSDKIQVHDGLDVVTNKVTAAECQGVPHHLIGGVSP  83

Query  413   NVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHAE-----------FRS  559
             + D+TAADFCR A +AV+++  + R+PIIAGGSN Y++AL+ D  E           FR 
Sbjct  84    DADYTAADFCRDATRAVESVAERRRVPIIAGGSNRYLEALLDDGGEEPAAADAGGGGFRR  143

Query  560   KYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFF-DPAGDYTRGIKRAIGVPEM  736
             +Y+CCF+W+D ++ VL  ++  RV+ M+++GL+ E R FF    GDY+RGI+RAIGVPEM
Sbjct  144   RYQCCFVWVDSDLAVLDRYIGSRVDCMLDQGLVSEVRPFFRHDDGDYSRGIRRAIGVPEM  203

Query  737   DQYFRI-----LEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVH  901
             D YFR      L+  DER R  +L   +D IKANTC LA  QL  I RLQ  L GW+ +H
Sbjct  204   DGYFRTEAAGALDGDDER-RARLLAAAVDEIKANTCVLARRQLDKIHRLQG-LRGWSDIH  261

Query  902   RLDATEAFQKRGGSGAEAYE----AWERLVAAPSTMIVHDFI  1015
             RLD TE  + + G GA        AWE  V +P+  IV  F+
Sbjct  262   RLDVTEVLRIKVGDGARNPNAQRVAWETDVVSPAARIVGRFL  303



>ref|XP_007045377.1| TRNA delta(2)-isopentenylpyrophosphate transferase, putative 
[Theobroma cacao]
 gb|EOY01209.1| TRNA delta(2)-isopentenylpyrophosphate transferase, putative 
[Theobroma cacao]
Length=321

 Score =   283 bits (725),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 137/271 (51%), Positives = 191/271 (70%), Gaps = 8/271 (3%)
 Frame = +2

Query  212   KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHH  391
             K KV+FVMGAT TGKS+L+IDLAT F  E++NSDK+QVY+GLDI+TNK+ E E +G+PHH
Sbjct  55    KTKVIFVMGATATGKSKLSIDLATYFSGEIINSDKIQVYEGLDIITNKITEAEGRGIPHH  114

Query  392   LLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHA-EFRSKYE  568
             ++G VDPN DFT  DFCR ALQ +D I++K +LPIIAGGSNSY++ LV+D   +F+  +E
Sbjct  115   MIGFVDPNRDFTVDDFCRHALQNIDIISKKGKLPIIAGGSNSYVETLVEDSKFKFQDNFE  174

Query  569   CCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYF  748
             CCF+W+DV   VLY+ V+++V++MVE GL+EE R  F P  DYT+ I+RAIG PEM  YF
Sbjct  175   CCFIWLDVSKNVLYKRVANQVDEMVEAGLVEEVRGMFVPEADYTKRIRRAIGAPEMHDYF  234

Query  749   RILEAS--DERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEA  922
              + + +  ++  + E L   I+ IK NTC L   Q + I RL+ +L GW + HR+DAT  
Sbjct  235   MLEKDTNINDSTKNEKLAHAIEEIKVNTCMLVDSQFRKIQRLREEL-GWKM-HRIDATSV  292

Query  923   FQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
              +K    G +A + W + V   +  I+ +F+
Sbjct  293   HEK---CGKDAEDEWMKEVLEKTITIMDEFL  320



>ref|XP_010466712.1| PREDICTED: adenylate isopentenyltransferase 7, mitochondrial-like 
[Camelina sativa]
Length=330

 Score =   283 bits (725),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 150/299 (50%), Positives = 199/299 (67%), Gaps = 12/299 (4%)
 Frame = +2

Query  137   SCCFCKQTQPMVSFP---SGLNISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVV  304
             S    KQ QP++SF    S +N++S    K+KVVFVMGATG+GK+RLAIDLATRF  E++
Sbjct  4     SISALKQVQPILSFKNKVSMVNVNSFLHPKEKVVFVMGATGSGKTRLAIDLATRFQTEII  63

Query  305   NSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNV-DFTAADFCRQALQAVDAITRK  481
             NSDK+Q+YKGLD++TNKV  +E +GVPHHLLGV+D    + TA  + R A QA+  ++  
Sbjct  64    NSDKIQLYKGLDVLTNKVTPQESRGVPHHLLGVLDSEFGNLTAIQYSRLASQAISTLSAN  123

Query  482   DRLPIIAGGSNSYIKALVKDHAEF-RSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLI  658
              +LPI+AGGSNSYI+AL    + F  + YECCF+W+DV +PVL  FVS RV++M+E GL+
Sbjct  124   HKLPIVAGGSNSYIEALANHTSGFLLNNYECCFIWVDVSLPVLNSFVSKRVDRMMETGLL  183

Query  659   EEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLA  838
             EE RE F+P  DY+ GI+RAIGV E+ +Y R     D   ++ +L   +  IK NT  LA
Sbjct  184   EEVREVFNPKADYSVGIRRAIGVSELHEYLRYESIVDRATQRMMLDVAVKCIKKNTELLA  243

Query  839   SCQLQNILRLQSQLEGWNI-VHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDF  1012
               Q + I RL  +   W + +HR+DATE F K      E  EAW+ LVA PS  IV  F
Sbjct  244   CRQFKKIQRLNKK---WKLSMHRVDATEVFMKHNVE--EQDEAWDSLVARPSERIVDKF  297



>gb|KHN03782.1| Adenylate isopentenyltransferase 3, chloroplastic [Glycine soja]
Length=293

 Score =   282 bits (721),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 142/268 (53%), Positives = 197/268 (74%), Gaps = 7/268 (3%)
 Frame = +2

Query  233   MGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDP  412
             MGATG GKSRL+IDLAT F +E++NSDK+QVY+GLDIVTNK+ +E+ +GVPHHLLG+++P
Sbjct  1     MGATGAGKSRLSIDLATCFPSEIINSDKIQVYEGLDIVTNKISKEDQRGVPHHLLGIINP  60

Query  413   NVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALV-KDHAEFRSKYECCFLWID  589
             N+DF+A DFC  + + + +ITR +RLPII GGSNSY++AL+  D  + RS+++   LW+D
Sbjct  61    NMDFSANDFCDTSSEIIASITRSERLPIIVGGSNSYLEALIDDDDYKCRSRFDFLCLWVD  120

Query  590   VEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYF-RILEAS  766
             V MP L  +V++RV+ M+  G+++E R F+ P GDY+RG++RAIGVPE D+YF R  E  
Sbjct  121   VAMPDLQSYVAERVDDMLYNGMVDELRPFYSPNGDYSRGVRRAIGVPEFDEYFRREEEVV  180

Query  767   DERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSG  946
             DE  R  +L+  +  +K NTCKLA  QL  I RL++ ++ W I HRLDAT  F++R   G
Sbjct  181   DEETRTRLLEEAVKEMKLNTCKLAMKQLGKIRRLRN-VKRWEI-HRLDATPVFRRR---G  235

Query  947   AEAYEAWERLVAAPSTMIVHDFICQGTT  1030
              EA EAW++LVA PS MIV  F+    +
Sbjct  236   EEANEAWKKLVAEPSAMIVARFLYNSNS  263



>ref|XP_008447303.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Cucumis melo]
Length=339

 Score =   283 bits (725),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 140/283 (49%), Positives = 202/283 (71%), Gaps = 9/283 (3%)
 Frame = +2

Query  182   SGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVR  361
             SG+  SS  +K K+VFV+G+T TGKS+L++DLAT F +E++NSDK+Q YKGLDI+TNK+ 
Sbjct  4     SGVEYSSN-KKHKIVFVLGSTATGKSKLSVDLATFFPSEIINSDKIQFYKGLDIITNKIN  62

Query  362   EEECQGVPHHLLGVV-DPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVK  538
             + + +GVPHHLLGV+ +P+ D TA +FCR    ++  +  +  LPI+ GGSN+YI+ALV+
Sbjct  63    QSDRRGVPHHLLGVIHEPDADLTAGEFCRLVEDSIADVISRGCLPIVVGGSNNYIEALVE  122

Query  539   DH-AEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKR  715
             +   +FRS+++CCFLW DV +PVLY+++  RV++MVE GL+EE  E F P  DY+RGI+R
Sbjct  123   NPITDFRSRFDCCFLWTDVALPVLYKYIGKRVDQMVELGLVEEVGEMFVPGADYSRGIRR  182

Query  716   AIGVPEMDQYFRILEASDER-MRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWN  892
             AIG PE++ YF+  + ++E   ++E+L++ I  IK NTCKLA  Q   I RL+ +L GW 
Sbjct  183   AIGAPELESYFKAEKNNEEETYKKELLKSAIHEIKENTCKLALRQFGKIHRLRDEL-GWG  241

Query  893   IVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQ  1021
             + HR+D T  F+K   SG EA + W   V  PS  IV DF+ +
Sbjct  242   L-HRIDVTAVFEK---SGEEAADEWMNAVLKPSLGIVGDFLNE  280



>ref|XP_008675872.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Zea mays]
 gb|ABY78886.1| isopentenyl transferase IPT7 [Zea mays]
 tpg|DAA54558.1| TPA: isopentenyl transferase IPT7 [Zea mays]
Length=352

 Score =   283 bits (725),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 151/292 (52%), Positives = 196/292 (67%), Gaps = 15/292 (5%)
 Frame = +2

Query  182   SGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVR  361
             +G   S    K KVV VMGAT TGKS+LAIDLA RF  EVVNSDK+QV+ GLD+VTNKV 
Sbjct  5     NGATASGGDNKAKVVLVMGATATGKSKLAIDLALRFGGEVVNSDKIQVHDGLDVVTNKVT  64

Query  362   EEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKD  541
               E QGVPHHL+  V P+ D+T ADFCR A++AV++I  + R+PIIAGGSN Y++AL+  
Sbjct  65    AAERQGVPHHLIDGVAPDADYTTADFCRDAVRAVESILERGRVPIIAGGSNRYLEALLDG  124

Query  542   H--AEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFF--DPAGDYTRGI  709
                A FR +YECCFLW+D ++ VL  ++  RV+ M+E+GL+ E R FF  D A DY+RGI
Sbjct  125   EPPAGFRGRYECCFLWVDSDLAVLDRYIGSRVDCMLEQGLVREVRAFFRHDDA-DYSRGI  183

Query  710   KRAIGVPEMDQYFRI------LEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQ  871
             +RAIGVPEMD YFR+          D+++R  +L   ++ IKANTC LA  QLQ I RL 
Sbjct  184   RRAIGVPEMDMYFRMEAAGALDGDDDDQLRVRLLAAAVNEIKANTCGLARRQLQKIHRLH  243

Query  872   SQLEGWNIVHRLDATEAFQKRGGSGAEA---YEAWERLVAAPSTMIVHDFIC  1018
               L+GW+ +HRLD TE  Q + G+        +AWE  V +P+  IV  F+ 
Sbjct  244   G-LQGWSDIHRLDVTEVLQLKVGNAGNPKAQRDAWETDVVSPAARIVGMFLA  294



>ref|XP_007154132.1| hypothetical protein PHAVU_003G093100g [Phaseolus vulgaris]
 gb|ESW26126.1| hypothetical protein PHAVU_003G093100g [Phaseolus vulgaris]
Length=327

 Score =   282 bits (721),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/275 (52%), Positives = 192/275 (70%), Gaps = 7/275 (3%)
 Frame = +2

Query  212   KDKVVFVMGATGTGKSRLAIDLATRFV-AEVVNSDKMQVYKGLDIVTNKVREEECQGVPH  388
             K+KVV ++GATGTGKS+L+IDLAT F  AE+VNSDKMQVY+GLDI TNKV EEEC+GVPH
Sbjct  33    KEKVVVIVGATGTGKSKLSIDLATHFPPAEIVNSDKMQVYEGLDITTNKVTEEECRGVPH  92

Query  389   HLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHAEFRSKYE  568
             HLLG V  N+DF+  DFC  A  AV +I ++D LPIIAGGSNS++ ALV  + +FR +Y 
Sbjct  93    HLLGTVQSNMDFSVNDFCHHATLAVGSILKRDGLPIIAGGSNSFLDALVNHYPDFRLRYH  152

Query  569   CCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAG-DYTRGIKRAIGVPEMDQY  745
             C FLW+DV +PVL+  +S RV++M+  G ++E R+FF     DYT GI++AIGVPE   +
Sbjct  153   CLFLWVDVSLPVLHSSLSARVDRMIRAGQVDEVRQFFQYHNDDYTVGIRKAIGVPEFHSF  212

Query  746   FRI-LEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEA  922
             F+   + +DER + ++LQ  I +IK N C LA+ Q   I RL +  +    +HRLDAT+ 
Sbjct  213   FQAEADGADERTKDKLLQAAIASIKINNCNLATRQRHKIHRLHAIFK--RNMHRLDATDV  270

Query  923   FQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGT  1027
             F +   +  EA +AWE  V + S  I+H+F+   T
Sbjct  271   FLR--STPQEAEQAWEDHVLSKSRRILHNFLYDDT  303



>ref|XP_008229695.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Prunus mume]
Length=281

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/272 (52%), Positives = 194/272 (71%), Gaps = 11/272 (4%)
 Frame = +2

Query  212   KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHH  391
             K KV+FV+G+TG GK++L+IDLATR+  E++NSDK+QVY+GLDIVTNK  + E +G+ HH
Sbjct  13    KTKVIFVLGSTGCGKTKLSIDLATRYNGEIINSDKIQVYEGLDIVTNKATKPEQRGILHH  72

Query  392   LLGVV-DPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHA-EFRSKY  565
             LLG + DP  DFT  DFC Q  +A+D IT+++R+PIIAGGSN+YI+ALV+D    F+ KY
Sbjct  73    LLGSIQDPEADFTVQDFCLQVPKALDDITKRNRVPIIAGGSNTYIEALVEDPTLRFQDKY  132

Query  566   ECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQY  745
             +CCF+W+DV +PVLY  VS+RV++MV+ GL++E RE F P  DY RGI+RAIG PEM  Y
Sbjct  133   DCCFIWLDVSLPVLYNRVSERVDEMVDAGLVDELREMFVPGADYERGIRRAIGAPEMHAY  192

Query  746   F--RILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATE  919
             F   +  ++DE  ++ + + GI   K NT KLA  Q+Q I RL+++   W+I HR+D T 
Sbjct  193   FMAEMDHSADEARKEFLFKDGIQKTKDNTLKLAESQVQKIERLRTK---WDI-HRIDVTA  248

Query  920   AFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
               +     G +A  AWE LV  PS  IV +F+
Sbjct  249   VHE---SCGKKAVVAWENLVLKPSFSIVSEFL  277



>ref|XP_006355868.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Solanum tuberosum]
Length=323

 Score =   281 bits (718),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 151/306 (49%), Positives = 206/306 (67%), Gaps = 12/306 (4%)
 Frame = +2

Query  125   RIMMSCCFCKQTQPMVSFPSGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVV  304
             R+M S   CKQ    V  P+ L + +   KDK+V VMG TG GKS+L+IDLAT+F  E++
Sbjct  3     RMMNSAQMCKQ----VRRPNLLQLRNFLPKDKIVVVMGVTGAGKSKLSIDLATQFNGEII  58

Query  305   NSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKD  484
             NSDK+QVYKGL+I TNK+ EEE  GVPHH LGV+DP  +FT  +FC  A   V++IT + 
Sbjct  59    NSDKIQVYKGLEIATNKITEEERCGVPHHCLGVIDPYKEFTTKNFCNMASFTVNSITNRG  118

Query  485   RLPIIAGGSNSYIKALVKDHA--EFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLI  658
             +LPII GGSNS+I+A V ++    F ++Y+ CFLW+D  M VL  F+ +RV+KMV++GL+
Sbjct  119   KLPIIVGGSNSFIEAFVHNNNSYNFSTRYDFCFLWVDASMNVLNSFLYERVDKMVDQGLV  178

Query  659   EEAREFFDPAG-DYTRGIKRAIGVPEMDQYFR--ILEASDERMRQEVLQTGIDNIKANTC  829
             +E R+ F+P   DYT+GI++AIGVPE D YFR  +  + D + R+ +L+  I  +K N C
Sbjct  179   DEVRQMFNPKNTDYTKGIRKAIGVPEFDSYFRAELSNSVDRQTRERMLKEAITEVKINNC  238

Query  830   KLASCQLQNILRLQSQLEGWNIVHRLDATEAFQK-RGGSGAEAYEAWERLVAAPSTMIVH  1006
              LAS QL  I RL + ++GW I HRLDATE F+K R     EA E W+ +V   S  IVH
Sbjct  239   ILASKQLDKINRLIN-VKGWKI-HRLDATEVFKKQRIAEEKEAEEIWKNIVMGQSRKIVH  296

Query  1007  DFICQG  1024
              F+ + 
Sbjct  297   KFLYEN  302



>ref|XP_002519092.1| tRNA delta(2)-isopentenylpyrophosphate transferase, putative 
[Ricinus communis]
 gb|EEF43303.1| tRNA delta(2)-isopentenylpyrophosphate transferase, putative 
[Ricinus communis]
Length=338

 Score =   281 bits (719),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 142/291 (49%), Positives = 201/291 (69%), Gaps = 9/291 (3%)
 Frame = +2

Query  152   KQTQPMVSFPSGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYK  331
             K +  +++  +G  + ++  K K VF++GAT TGKS+L++DLA+ F AE++NSDK+QVYK
Sbjct  52    KDSAAIITNTTG-RVENQVNKKKTVFILGATATGKSKLSVDLASHFDAEIINSDKIQVYK  110

Query  332   GLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKD-RLPIIAGG  508
             GLDIVTNK+ E+  +G+PHHLLG +DP  DFTA DFC    +A+  IT  + R+PII GG
Sbjct  111   GLDIVTNKIPEDNRKGIPHHLLGFMDPEADFTAQDFCNHVCKAMTHITEYNGRVPIIVGG  170

Query  509   SNSYIKALVKD-HAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDP  685
             SN++I+ALV+D H+ F++ Y+ CFLW+DV +PVLY+ V  RV++MV+ GL++E RE    
Sbjct  171   SNNFIRALVEDPHSSFKANYDSCFLWMDVALPVLYKHVGKRVDQMVKAGLVDEVRETAVS  230

Query  686   AGDYTRGIKRAIGVPEMDQYFRILEA-SDERMRQEVLQTGIDNIKANTCKLASCQLQNIL  862
               DYTRG+ RAIG+PEM +++   +  SDE  ++ +L   ID IK NTC+L   QL  I 
Sbjct  231   GSDYTRGVWRAIGLPEMHEFYYAEKTMSDENTKKMLLDAAIDRIKENTCRLVDAQLGKID  290

Query  863   RLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             R+  +L GW I HR+DAT   +K   S  EA EAW ++V  PS  IV  F+
Sbjct  291   RMIHEL-GWKI-HRIDATCVVEK---SEDEAVEAWNKVVLKPSIEIVRGFL  336



>ref|XP_011101075.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Sesamum indicum]
Length=270

 Score =   278 bits (712),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 146/270 (54%), Positives = 178/270 (66%), Gaps = 38/270 (14%)
 Frame = +2

Query  212   KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHH  391
             KDKVV V+GA GTGKSRLAIDLATR  AEV+NSDK+Q YKGLD+VTNKV  EE   VPHH
Sbjct  16    KDKVVVVLGAIGTGKSRLAIDLATRLGAEVINSDKIQFYKGLDVVTNKVSNEEYHSVPHH  75

Query  392   LLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHAEFRSKYEC  571
             LLG++DP  DF   DF  QAL A DAI +K+RLPIIAGGSNS+I+AL  D+ EF SKYEC
Sbjct  76    LLGIIDPEADFIVHDFVDQALLAADAIVQKNRLPIIAGGSNSFIQALFNDNTEFLSKYEC  135

Query  572   CFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYFR  751
             CFLW+DV +PVL+                                  RAIGV EMD++FR
Sbjct  136   CFLWMDVAIPVLHS---------------------------------RAIGVAEMDEFFR  162

Query  752   ILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQK  931
                 +D  +R ++ +  ID IK NTCKLA  Q++ ILR++ +  GW I HRL+ATE F +
Sbjct  163   SEGLADGEIRAKLFKAAIDEIKINTCKLACRQVEKILRMREEF-GWKI-HRLNATEVFLR  220

Query  932   RGGSGAEAYEAWERLVAAPSTMIVHDFICQ  1021
             RGG   +A EAWE++V   ST IV  FIC+
Sbjct  221   RGG---DANEAWEKVVLESSTNIVARFICK  247



>gb|KHN17317.1| Adenylate isopentenyltransferase 5, chloroplastic [Glycine soja]
Length=303

 Score =   280 bits (715),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 138/283 (49%), Positives = 199/283 (70%), Gaps = 7/283 (2%)
 Frame = +2

Query  212   KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHH  391
             K KV+F+MGATGTGK++L+I+L T+F +EV+NSDK+QVYKGLDI+TNKV E E  G+PHH
Sbjct  14    KKKVLFIMGATGTGKTKLSINLGTQFPSEVINSDKIQVYKGLDIITNKVPESERNGIPHH  73

Query  392   LLGVV-DPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKD-HAEFRSKY  565
             LLG++ DP+ DFT  DFC+  L A+D I     LPII GGSN+Y+  L++D +  F SKY
Sbjct  74    LLGIIDDPDYDFTIDDFCKHVLIALDLIIENGHLPIIVGGSNTYLATLLEDPNIAFHSKY  133

Query  566   ECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQY  745
             +CCF+W+DV +PVL++++  RV++M++EG+++E RE F P  DY+RG++RAIGVPE+ +Y
Sbjct  134   DCCFIWVDVSLPVLFQYLDKRVDEMLDEGVVDEIREAFVPGADYSRGVRRAIGVPELGEY  193

Query  746   FRI-LEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEA  922
             F +  E SDE  ++++LQ  I   K NTCKLA  QL  I R+  +L GW +  ++D+T+ 
Sbjct  194   FLVEKEISDEAEKEKMLQRAIARTKKNTCKLAEMQLLKIHRMNYEL-GWGMT-KIDSTQV  251

Query  923   FQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGTTTTFLAPP  1051
             F+     G +    ++ +V  PS  IV  F+ Q TT  +   P
Sbjct  252   FEAI-LKGVDYKHLYQEIVFKPSMEIVKRFL-QETTQMWGKTP  292



>ref|XP_010653719.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Vitis vinifera]
 emb|CBI32805.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   278 bits (710),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 137/262 (52%), Positives = 189/262 (72%), Gaps = 6/262 (2%)
 Frame = +2

Query  233   MGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDP  412
             MG+TG+GKSRL+ID+A+ ++ EV+NSDKMQVYKGLDI+TNK+ E + +GVPHHL+G V+P
Sbjct  1     MGSTGSGKSRLSIDIASHYLGEVINSDKMQVYKGLDIITNKMAESDRRGVPHHLIGEVEP  60

Query  413   NVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHA-EFRSKYECCFLWID  589
             +VDFTA DFC  A  A++ I  + R+PII GGSNS+++ALV++ + EF+S+YE CF+W++
Sbjct  61    DVDFTAEDFCMAATSAIERIVEQGRVPIIVGGSNSFVEALVQNPSVEFKSRYEPCFIWLN  120

Query  590   VEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILEASD  769
             V  P+L  ++S RV+ MV  GL+EE +  F P  DY RGI R+IGVPEMD Y R      
Sbjct  121   VAPPILDTYLSKRVDDMVRGGLVEEVKAVFSPNLDYKRGIYRSIGVPEMDAYLRADRMVG  180

Query  770   ERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGA  949
                R+ +L+  ID+IKANTCKLAS Q+  I  L+++L GWN+ H++D T  F+K    G 
Sbjct  181   YIERETLLKEAIDDIKANTCKLASKQVGKIETLRNKL-GWNM-HQIDTTPVFEK---CGE  235

Query  950   EAYEAWERLVAAPSTMIVHDFI  1015
             EA  AWE LV  P+  I+  F+
Sbjct  236   EADAAWEMLVKKPTFGIIDSFL  257



>ref|XP_002519099.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF43310.1| ATP binding protein, putative [Ricinus communis]
Length=290

 Score =   278 bits (711),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/274 (50%), Positives = 195/274 (71%), Gaps = 8/274 (3%)
 Frame = +2

Query  209   RKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPH  388
             +K KVVF++GATGTGK++L+IDLAT + AE++NSDK+QVY GLDIVTNK  E E +G+PH
Sbjct  19    KKKKVVFILGATGTGKTKLSIDLATHYKAEIINSDKIQVYHGLDIVTNKATEAERKGIPH  78

Query  389   HLLGVV-DPNVDFTAADFCRQALQAVDAITRKDR-LPIIAGGSNSYIKALVKDHAEFRSK  562
             HLLG + DP  DFT  DFC Q  +A++ I   +   PI+ GGSN+YIKALV+D   F+ +
Sbjct  79    HLLGFLQDPEADFTIRDFCIQVHRAINHIINDNGCTPIVVGGSNTYIKALVEDDESFKGE  138

Query  563   YECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQ  742
             ++ CFLW+DVE+ VLY+ VS R+++MV+ GL++E R FF P  DY++G+ RAIGVPEM++
Sbjct  139   FDACFLWMDVELSVLYKRVSKRIDQMVDAGLVDEIRGFFAPGIDYSKGVWRAIGVPEMEK  198

Query  743   YFRILE-ASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATE  919
             YF   +  +DE  ++ +L   I   K NTCKL + Q+  I   + +L GW + HRL+AT 
Sbjct  199   YFLAEKNMADETTKRILLDAAIQETKENTCKLVNSQIAKINMFRKKL-GWKL-HRLNATS  256

Query  920   AFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQ  1021
              F+K   +G EA +AW+++V  PS  IV DF+ +
Sbjct  257   VFEK---AGIEADDAWKKMVLNPSLKIVGDFLGE  287



>gb|KDP46221.1| hypothetical protein JCGZ_10061 [Jatropha curcas]
Length=309

 Score =   277 bits (709),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 142/283 (50%), Positives = 186/283 (66%), Gaps = 8/283 (3%)
 Frame = +2

Query  176   FPSGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNK  355
             + S   I    +K+K +F+MGAT TGKS+L++D+AT F AE++NSDKMQ YKGLDIVTNK
Sbjct  30    YSSTSTIEPVIKKNKTLFIMGATCTGKSKLSVDIATHFQAEIINSDKMQFYKGLDIVTNK  89

Query  356   VREEECQGVPHHLLGVV-DPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKAL  532
             + E E  G+PHHLLG V DP  DFTA DF       +  I     LPII GGSN+YIK L
Sbjct  90    LAESERNGIPHHLLGFVEDPEADFTAQDFSNHVNSTITQIINNGSLPIIVGGSNNYIKQL  149

Query  533   VKD-HAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGI  709
             V+   + F+ K++ CF+W+DV +PVLYE  + RV+ MV+ GL+EE R   +P  DY+RG+
Sbjct  150   VESPSSNFKEKFDSCFIWLDVAVPVLYEHAAKRVDLMVQSGLVEEVRSMVEPGSDYSRGV  209

Query  710   KRAIGVPEMDQYFRILE-ASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEG  886
              RAIGVPEMDQ+    +  +DERM++  L   ID IK NTC+L   QL+ I  +  +L G
Sbjct  210   WRAIGVPEMDQFLYAEKYNADERMKKIFLDLAIDRIKENTCRLVDSQLRKIHDMIYEL-G  268

Query  887   WNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             W + HR+DAT   +K    G EA EAW + V  PS  IV DF+
Sbjct  269   WEL-HRIDATSVREK---DGEEAVEAWNKEVLEPSLEIVRDFL  307



>ref|NP_001244915.1| adenylate isopentenyltransferase [Solanum lycopersicum]
 gb|AEE39459.1| isopentenyltransferase 1 [Solanum lycopersicum]
 dbj|BAM08997.1| adenylate isopentenyltransferase [Solanum lycopersicum]
Length=323

 Score =   277 bits (709),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 150/305 (49%), Positives = 205/305 (67%), Gaps = 12/305 (4%)
 Frame = +2

Query  128   IMMSCCFCKQTQPMVSFPSGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVN  307
             +M S   CKQ    V + + L + +  +KDKVV VMG TG GKS+L+IDLAT+F  E++N
Sbjct  4     MMNSAQMCKQ----VRWQNLLQLQNFLQKDKVVVVMGVTGAGKSKLSIDLATQFDGEIIN  59

Query  308   SDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDR  487
             SDK+QVYKGLDI TNK+ EEE  GVPHH LGV+DP  +FT  +FC  A   V++IT + +
Sbjct  60    SDKIQVYKGLDIATNKITEEERCGVPHHCLGVIDPYKEFTTKNFCNMASFTVNSITNRGK  119

Query  488   LPIIAGGSNSYIKALVKDHA--EFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIE  661
             LPII GGSNS+I+A V +     F ++Y+ CFLW+D  M VL  F+ +RV+KMV++G+++
Sbjct  120   LPIIVGGSNSFIEAFVHNSNSYNFSTRYDFCFLWVDASMNVLNSFLYERVDKMVDQGMVD  179

Query  662   EAREFFDPAG-DYTRGIKRAIGVPEMDQYFR--ILEASDERMRQEVLQTGIDNIKANTCK  832
             E R+ F+P   DYT+GI++AIGVPE D YFR  +  + D +  + +L+  I  IK N C 
Sbjct  180   EVRQIFNPKNMDYTKGIRKAIGVPEFDSYFRAELSNSVDRQTLERMLEEAITEIKINNCI  239

Query  833   LASCQLQNILRLQSQLEGWNIVHRLDATEAFQK-RGGSGAEAYEAWERLVAAPSTMIVHD  1009
             LAS QL+ I RL S ++GW I HRLDA+E F+K R     EA E W+ +V   S  IVH 
Sbjct  240   LASKQLEKIKRLIS-VKGWKI-HRLDASEVFKKQRIAEEKEAEEIWKNMVMGQSRKIVHK  297

Query  1010  FICQG  1024
             F+ + 
Sbjct  298   FLYEN  302



>ref|XP_003551849.2| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Glycine max]
Length=333

 Score =   277 bits (709),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 132/280 (47%), Positives = 196/280 (70%), Gaps = 6/280 (2%)
 Frame = +2

Query  200   SRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQG  379
             S   K KV+F+MGATGTGK++L+I+L T+F +EV+NSDK+QVYKGLDI+TNKV E E  G
Sbjct  31    SLAEKKKVLFIMGATGTGKTKLSINLGTQFPSEVINSDKIQVYKGLDIITNKVPESERNG  90

Query  380   VPHHLLGVVD-PNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKD-HAEF  553
             +PHHLLG++D P+ DFT  DFC+  L A+D I     LPII GGSN+Y+  L++D +  F
Sbjct  91    IPHHLLGIIDDPDYDFTVDDFCKHVLIALDLIIENGHLPIIVGGSNTYLATLLEDPNIAF  150

Query  554   RSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPE  733
             RSKY+CCF+W+DV +PVL++++  RV++M+++G+++E RE F P  DY+RG++RAIGVPE
Sbjct  151   RSKYDCCFIWVDVSLPVLFQYLDKRVDEMLDKGVVDEIRETFVPGADYSRGVRRAIGVPE  210

Query  734   MDQYFRI-LEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLD  910
             + +YF +  +  DE  ++++LQ  I   K NTCKLA  QL  I ++  +  GW +  ++D
Sbjct  211   LGEYFLVEKKIDDETKKEKMLQGAIARTKENTCKLAEAQLLKIHKMNYEF-GWGMT-KID  268

Query  911   ATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGTT  1030
             +T+ F+     G +    +  +V  PS  IV  F+ + T+
Sbjct  269   STQVFEAV-LKGMDYKHLYHEIVFKPSVDIVKRFLHETTS  307



>gb|KEH21991.1| adenylate isopentenyltransferase [Medicago truncatula]
Length=304

 Score =   275 bits (702),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 134/277 (48%), Positives = 193/277 (70%), Gaps = 7/277 (3%)
 Frame = +2

Query  209   RKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPH  388
             +K+KV+F++GATGTGK++L+I+L T F AE++NSDK+QVYKGLDI TNKV E E   +PH
Sbjct  11    KKNKVLFILGATGTGKTKLSINLGTHFPAEIINSDKIQVYKGLDIATNKVPESERCSIPH  70

Query  389   HLLGVVD-PNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHA-EFRSK  562
             H+LG++D P  DFT  DFC   L+++D IT K  LPII GGSNSY+K LV+D A  F SK
Sbjct  71    HILGIIDDPEYDFTMNDFCNHVLESLDLITGKGHLPIIVGGSNSYLKKLVEDPAISFLSK  130

Query  563   YECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQ  742
             Y+CCF+W+DV +P LY++V  RV++MV+ G+++E RE+F P  D T+GI+RAIGVPE+D 
Sbjct  131   YDCCFIWVDVSLPTLYQYVGKRVDEMVQAGMVDEIREYFVPGADNTKGIRRAIGVPELDS  190

Query  743   YFRILEAS--DERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDAT  916
             +F I + S   + +++++L+  I+N K NTC LA  QL  I  +   L   ++V+++D+T
Sbjct  191   FFAIEKKSCIGDAIKEKILKEAIENTKQNTCILAKNQLSKIQNMARML--GSMVYKIDST  248

Query  917   EAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGT  1027
             E F+     G +     +  V  PS  IV  F+ + T
Sbjct  249   EVFEAL-LRGEDYKHVHQESVIKPSKEIVKRFLEETT  284



>ref|XP_010096214.1| Adenylate isopentenyltransferase 3 [Morus notabilis]
 gb|EXB63609.1| Adenylate isopentenyltransferase 3 [Morus notabilis]
Length=314

 Score =   274 bits (700),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/274 (50%), Positives = 195/274 (71%), Gaps = 10/274 (4%)
 Frame = +2

Query  209   RKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPH  388
             +K KV+F+MGATGTGKS+L++D+ATRF AE++NSDK+Q YKGLDIVTNK+ E E  GVPH
Sbjct  9     KKPKVIFIMGATGTGKSKLSVDIATRFPAEIINSDKIQCYKGLDIVTNKLHESERGGVPH  68

Query  389   HLLGVV-DPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHAEFRSKY  565
             HLLG + +P+  FTA DFC  A +++  IT + R PI+ GGSNSY+ ALV    +FR+KY
Sbjct  69    HLLGFISNPDAQFTAEDFCCHANKSISIITGRGRTPIVVGGSNSYLAALVD--TDFRAKY  126

Query  566   ECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQY  745
               CF+W+DVE+ VL+++V++RV++MVE GL+EE RE+F+P  DY+RGI+RAIGVPEMD+Y
Sbjct  127   SLCFIWLDVELLVLFDYVNERVDQMVETGLVEEIREYFEPGLDYSRGIRRAIGVPEMDEY  186

Query  746   F----RILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDA  913
             F    + L+  +   ++  L+  I+  K  T  L   Q++ I RL+ +L GW + HR+D 
Sbjct  187   FLSEKQQLKDGNNLDKEVFLRPAIEETKLKTQMLVRRQVEKIRRLRDEL-GWEL-HRIDP  244

Query  914   TEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             T  F++R  +  +A  AW  +V  P   IV +F+
Sbjct  245   TAVFKRRRAAEDKA-AAWNEVVLTPCLKIVGEFL  277



>gb|KHN17318.1| Adenylate isopentenyltransferase 5, chloroplastic [Glycine soja]
Length=333

 Score =   273 bits (699),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/280 (47%), Positives = 195/280 (70%), Gaps = 6/280 (2%)
 Frame = +2

Query  200   SRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQG  379
             S   K KV+F+MGATGTGK++L+I+L T+F +EV+NSDK+QVYKGLDI+TNKV E E  G
Sbjct  31    SLAEKKKVLFIMGATGTGKTKLSINLGTQFPSEVINSDKIQVYKGLDIITNKVPESERNG  90

Query  380   VPHHLLGVV-DPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKD-HAEF  553
             +PHHLLG++ DP+ DFT  DFC+  L A+D I     LPII GGSN+Y+  L++D +  F
Sbjct  91    IPHHLLGIIDDPDYDFTVDDFCKHVLIALDLIIENGHLPIIVGGSNTYLATLLEDPNIAF  150

Query  554   RSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPE  733
             RSKY+CCF+W+DV + VL++++  RV++M+++G+++E RE F P  DY+RG++RAIGVPE
Sbjct  151   RSKYDCCFIWVDVSLLVLFQYLDKRVDEMLDKGVVDEIRETFVPGADYSRGVRRAIGVPE  210

Query  734   MDQYFRI-LEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLD  910
             + +YF +  +  DE  ++++LQ  I   K NTCKLA  QL  I ++  +  GW +  ++D
Sbjct  211   LGEYFLVEKKIDDETKKEKMLQGAIARTKENTCKLAEAQLLKIHKMNYEF-GWGMT-KID  268

Query  911   ATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGTT  1030
             +T+ F+     G +    +  +V  PS  IV  F+ + T+
Sbjct  269   STQVFEAV-LKGMDYKHLYHEIVFKPSVDIVKRFLHETTS  307



>ref|XP_003596250.1| Adenylate isopentenyltransferase [Medicago truncatula]
 gb|AES66501.1| adenylate isopentenyltransferase [Medicago truncatula]
Length=304

 Score =   271 bits (694),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 131/277 (47%), Positives = 194/277 (70%), Gaps = 7/277 (3%)
 Frame = +2

Query  209   RKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPH  388
             +K+KV+F++GATGTGK++L+I+L+T + AE++NSDK+QVYKGLDIVTNKV E E   +PH
Sbjct  11    KKNKVLFILGATGTGKTKLSINLSTYYPAEIINSDKIQVYKGLDIVTNKVLESERCSIPH  70

Query  389   HLLGVVD-PNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHA-EFRSK  562
             H+LG++D P  DFT  DFC+  L+++D I     LPII GGSNSY++ LV+D    F SK
Sbjct  71    HILGIIDDPEYDFTMNDFCKHVLESLDLIIGNGHLPIIVGGSNSYLRKLVEDPTIAFLSK  130

Query  563   YECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQ  742
             Y+CCF+W+DV +P L+++V  RV++MVE G+++E RE+F P  D T+GI+RAIGVPE+D 
Sbjct  131   YDCCFIWVDVSLPTLFKYVGKRVDEMVEGGMVDEIREYFVPGADNTKGIRRAIGVPELDS  190

Query  743   YFRILEAS--DERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDAT  916
             +F I + S  D+ +++ +L+  I+  K NTC LA  QL  I  +   LE  ++V+++D+T
Sbjct  191   FFAIEKKSGIDDAIKEMILKKAIEETKQNTCILAKNQLSKIQNMTHMLE--SMVYKIDST  248

Query  917   EAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGT  1027
             E F+     G +     + +V  PS  IV  F+ + T
Sbjct  249   EVFEAL-LRGEDYKHLHQEIVIKPSKEIVKRFLEETT  284



>emb|CDM82045.1| unnamed protein product [Triticum aestivum]
Length=350

 Score =   273 bits (697),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 143/276 (52%), Positives = 183/276 (66%), Gaps = 11/276 (4%)
 Frame = +2

Query  212   KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHH  391
             K KVV VMGAT TGKS+LA+ LA RF  EVVNSDK+QV+ GL +VTNK    E  GVPHH
Sbjct  19    KAKVVIVMGATATGKSKLAVALALRFDGEVVNSDKIQVHDGLAVVTNKATAREQAGVPHH  78

Query  392   LLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHAEFRSKYEC  571
             L+G V P+ D+ AADF R A +AV++I  + RLPIIAGGSNSY++AL+     FR +YEC
Sbjct  79    LIGGVHPDADYAAADFRRDATRAVESILSRGRLPIIAGGSNSYLEALLDGEPGFRRRYEC  138

Query  572   CFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYFR  751
             CFLW+D +  VL  +V DRV+ MVE+GL+ E REFF     Y+RGI+RAIGVPEMD YFR
Sbjct  139   CFLWVDADTSVLERYVGDRVDCMVEQGLVGEVREFFRTDAGYSRGIRRAIGVPEMDTYFR  198

Query  752   ILEA----SDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATE  919
             +  A     D+ +R  +L+  ++ IK NTC+L   QL+ I RL+  L GW+I  RLD T 
Sbjct  199   MEAAGALDGDDELRAGLLEAAVEQIKENTCRLVCSQLRKIHRLRC-LPGWSI-RRLDVTR  256

Query  920   AFQKRGGSGAEAYEA----WERLVAAPSTMIVHDFI  1015
                 + G  A+  EA    WE  V  P+  +V  F+
Sbjct  257   VLSLKVGK-AKDEEAERTLWESDVVGPAARVVETFL  291



>emb|CBI32356.3| unnamed protein product [Vitis vinifera]
Length=275

 Score =   270 bits (690),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 154/308 (50%), Positives = 185/308 (60%), Gaps = 63/308 (20%)
 Frame = +2

Query  152   KQTQPMVSFPSG---LNISS-RWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKM  319
             KQTQP++S P G   +++S  RW K KVV VMGATGTGKSRL+IDLATRF AE+VNSDKM
Sbjct  9     KQTQPLLSIPPGDLTMDVSGHRWPKGKVVVVMGATGTGKSRLSIDLATRFPAEIVNSDKM  68

Query  320   QVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPII  499
             QVY+GLDIVTNK+ EEE +GVPHHLL +  PN                            
Sbjct  69    QVYEGLDIVTNKITEEEQRGVPHHLLRIAHPN----------------------------  100

Query  500   AGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFF  679
                                    CCFLW+DV   VL+ FVS RV+KMVE+G++EE ++ F
Sbjct  101   -----------------------CCFLWVDVSRSVLHSFVSKRVDKMVEKGMVEEVQQLF  137

Query  680   DPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNI  859
              P  DYTRGI+RAIGVPE+D YFR     DE  R  VLQ  +  IKANTCKLA  QL+ I
Sbjct  138   HPNADYTRGIRRAIGVPELDLYFRTEGFLDEEARARVLQEAVHEIKANTCKLACRQLEKI  197

Query  860   LRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGTTTTF  1039
              RL++ +  W I HRL ATE  +K      EA EAWE+LVA PSTM+V  F+     T  
Sbjct  198   HRLKN-VRKWKI-HRLGATEVLRK---CDREADEAWEKLVARPSTMMVAQFLYSVGATRS  252

Query  1040  LA---PPT  1054
             +A   PPT
Sbjct  253   IATTSPPT  260



>gb|KCW62877.1| hypothetical protein EUGRSUZ_G00473, partial [Eucalyptus grandis]
 gb|KCW64242.1| hypothetical protein EUGRSUZ_G01887, partial [Eucalyptus grandis]
Length=256

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/257 (54%), Positives = 183/257 (71%), Gaps = 8/257 (3%)
 Frame = +2

Query  233  MGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVV-D  409
            MGATGTGKS+L+I+LA  +  EV+NSDK+QVYKGLD+VTNKV + EC+GVPHHLLGV+ D
Sbjct  1    MGATGTGKSKLSINLAVHYQTEVINSDKIQVYKGLDVVTNKVTDLECRGVPHHLLGVIDD  60

Query  410  PNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHA-EFRSKYECCFLWI  586
            P+VDF+  DFCR AL A++ IT++ R  I+AGGSNS+I+ LV+D    F+S Y+CCF+W+
Sbjct  61   PDVDFSVHDFCRDALTAINQITQRGRAAIVAGGSNSFIEVLVEDPTYNFKSIYDCCFIWL  120

Query  587  DVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYFRILE--  760
            DV  PVL E VS RV++MV  GLI+E R  F P  DY+RGI+RAIGVPEMD++ R     
Sbjct  121  DVSPPVLNERVSKRVDEMVAAGLIDEVRGVFVPQPDYSRGIRRAIGVPEMDRFLRAENRL  180

Query  761  ASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQKRGG  940
              DE+ ++ +L   I+ IK NT KL   Q++ I R+  +  GWNI  R+DAT  F+  G 
Sbjct  181  IDDEKPKEVLLDEAINEIKVNTFKLTCRQVEKI-RMLREERGWNI-RRIDATGVFESPGA  238

Query  941  SGAEAYEAWERLVAAPS  991
            +  E  +AW  LV  PS
Sbjct  239  ADVE--KAWRSLVLEPS  253



>ref|XP_009371878.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009339404.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009349433.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Pyrus x bretschneideri]
Length=284

 Score =   268 bits (686),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 144/277 (52%), Positives = 191/277 (69%), Gaps = 16/277 (6%)
 Frame = +2

Query  209   RKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPH  388
             +K KVVF+MG TG GK++L+IDLAT +  EV+NSDK+Q YKGLDIVTNK  E E +G+ H
Sbjct  12    KKAKVVFIMGPTGCGKTKLSIDLATHYGGEVINSDKIQAYKGLDIVTNKATESEQRGIRH  71

Query  389   HLLGVV-DPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHA-EFRSK  562
             HLLG V DP  DF+  +FCR+   ++D ITR++ LPIIAGGSNSYI+AL++D   EFR+K
Sbjct  72    HLLGFVEDPVADFSIDEFCRRVQTSIDEITRRNCLPIIAGGSNSYIEALIEDPVIEFRNK  131

Query  563   YECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQ  742
             Y+CCF+W+DV +PVLY  VS RV++MV  GL++E RE F P  +Y  GI+RAIG PEM  
Sbjct  132   YDCCFIWLDVSLPVLYNRVSKRVDEMVAAGLVDELREMFAPGVNYDGGIRRAIGAPEMHP  191

Query  743   YFRILEAS-----DERMRQE-VLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHR  904
             YF + E +     D+++R+E +L+ GI   K NTCKLA  Q+Q I  L  +   W ++HR
Sbjct  192   YF-MAEMNNNIVDDDKVRKEFLLKDGIWKTKENTCKLAERQVQKIQLLSDK---W-VIHR  246

Query  905   LDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             ++ T   +     G EA  AWE LV  PS  IV  F+
Sbjct  247   IEVTAVHE---NCGKEAVVAWETLVLKPSFTIVDVFL  280



>gb|KEH32922.1| adenylate isopentenyltransferase [Medicago truncatula]
Length=303

 Score =   269 bits (687),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 129/281 (46%), Positives = 190/281 (68%), Gaps = 7/281 (2%)
 Frame = +2

Query  185   GLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVRE  364
              L  S+   K KV+F++GATGTGK++L+I+L T+F +E++NSDK+QVYKGLDIVTNKV+E
Sbjct  2     ALTTSTLTEKKKVLFILGATGTGKTKLSINLGTQFPSEIINSDKIQVYKGLDIVTNKVQE  61

Query  365   EECQGVPHHLLGVV-DPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKD  541
              E   +PHH+LG++ DP  DFT  DFC   L+A++ IT    LPII GGSNSY+K L++D
Sbjct  62    SERHSIPHHILGIIDDPEYDFTVDDFCNHVLEALNLITENGHLPIIVGGSNSYLKKLIED  121

Query  542   HA-EFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRA  718
                 F SKY+CCF+W+DV +P+L  ++  RV++MVE G+++E R+FF P  DYT+GI+RA
Sbjct  122   PTIAFHSKYDCCFIWVDVSLPILCPYLDKRVDEMVESGMVDEIRDFFVPGADYTKGIRRA  181

Query  719   IGVPEMDQYFRI--LEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWN  892
             IGVPE+  YF I   E  D+  ++++L+  I   K NT  LA  QL  I  +  +L   +
Sbjct  182   IGVPELHSYFEIEKKECIDDAQKEKILKEAITKTKQNTFILAENQLSKIRNMADKL--GS  239

Query  893   IVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             +++ +++TE F+     G + +   + +V  PS  IV  F+
Sbjct  240   MINNINSTEVFEAI-LRGEDYHHLHQEIVINPSMKIVKRFL  279



>ref|XP_008373615.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Malus domestica]
Length=284

 Score =   268 bits (685),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 145/281 (52%), Positives = 193/281 (69%), Gaps = 16/281 (6%)
 Frame = +2

Query  197   SSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQ  376
              S  +K KVVF+MG TG GK++L+IDLAT +  EV+NSDK+QVYKGLDIVTNK  E E +
Sbjct  8     GSXHKKAKVVFIMGPTGCGKTKLSIDLATNYGGEVINSDKIQVYKGLDIVTNKATESEQR  67

Query  377   GVPHHLLGVV-DPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHA-E  550
             G+ HHLLG V DP  DF+  +F R+   ++D IT+++ LPIIAGGSNSYI+AL++D   +
Sbjct  68    GIRHHLLGFVEDPVADFSVDEFRRRVQTSIDEITKRNCLPIIAGGSNSYIEALIEDPVID  127

Query  551   FRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVP  730
             FR+KY+CCF+W+DV +PVLY  VS RV++MV  GL++E RE F P  +Y  GI+RAIG P
Sbjct  128   FRNKYDCCFIWLDVSLPVLYNHVSKRVDEMVAAGLVDELREMFAPGVNYDGGIRRAIGAP  187

Query  731   EMDQYFRILEAS-----DERMRQE-VLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWN  892
             EM  YF + E +     D+++R+E +L+ GI   K NTCKLA  Q+Q I  L  +   W+
Sbjct  188   EMHPYF-MAEMNNNIVDDDKVRKEFLLKDGIWKTKENTCKLAERQVQKIKLLSDK---WD  243

Query  893   IVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             I HR+D T  ++     G EA  AWE LV  PS  IV  F+
Sbjct  244   I-HRIDVTAVYEN---CGKEAVVAWETLVLKPSFTIVGGFL  280



>gb|ADY80563.1| adenylate isopentenyltransferase [Malus domestica]
Length=284

 Score =   268 bits (685),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 144/277 (52%), Positives = 192/277 (69%), Gaps = 16/277 (6%)
 Frame = +2

Query  209   RKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPH  388
             +K KVVF+MG TG GK++L+IDLAT +  EV+NSDK+QVYKGLDIVTNK  E E +G+ H
Sbjct  12    KKAKVVFIMGPTGCGKTKLSIDLATNYGGEVINSDKIQVYKGLDIVTNKATESEQRGIRH  71

Query  389   HLLGVV-DPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHA-EFRSK  562
             HLLG V DP  DF+  +F R+   ++D IT+++ LPIIAGGSNSYI+AL++D   +FR+K
Sbjct  72    HLLGFVEDPVADFSVDEFRRRVQTSIDEITKRNCLPIIAGGSNSYIEALIEDPVIDFRNK  131

Query  563   YECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQ  742
             Y+CCF+W+DV +PVLY  VS RV++MV  GL++E RE F P  +Y  GI+RAIG PEM  
Sbjct  132   YDCCFIWLDVSLPVLYNHVSKRVDEMVAAGLVDELREMFAPGVNYDGGIRRAIGAPEMHP  191

Query  743   YFRILEAS-----DERMRQE-VLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHR  904
             YF + E +     D+++R+E +L+ GI   K NTCKLA  Q+Q I  L  +   W+I HR
Sbjct  192   YF-MAEMNNNIVDDDKVRKEFLLKDGIWKTKENTCKLAERQVQKIKLLSDK---WDI-HR  246

Query  905   LDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             +D T  ++     G EA  AWE LV  PS  IV  F+
Sbjct  247   IDVTAVYEN---CGKEAVVAWETLVLKPSFTIVGGFL  280



>ref|XP_003598773.1| Isopentenyltransferase [Medicago truncatula]
 gb|AES69024.1| adenylate isopentenyltransferase [Medicago truncatula]
Length=303

 Score =   266 bits (679),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/281 (46%), Positives = 190/281 (68%), Gaps = 7/281 (2%)
 Frame = +2

Query  185   GLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVRE  364
              L  S+   K KV+F++G+TGTGK++L+I+L T+F +E++NSDK+QVYKGLDIVTNKV+E
Sbjct  2     ALTTSTLTEKKKVLFILGSTGTGKTKLSINLGTQFPSEIINSDKIQVYKGLDIVTNKVQE  61

Query  365   EECQGVPHHLLGVVD-PNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKD  541
              E   +PHH+LG++D P  DFT  DFC+  L+A+D I     LPII GGSNSY+K LV D
Sbjct  62    SERCSIPHHILGIIDDPEYDFTVDDFCKHVLEALDLIIENGHLPIIVGGSNSYLKKLVDD  121

Query  542   HA-EFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRA  718
                 F SKY+CCF+W+DV +P+L+ ++  RV++MVE G+++E REFF P  D T+GI+RA
Sbjct  122   PVIAFHSKYDCCFIWVDVSLPILFPYLDKRVDEMVEAGMVDEIREFFVPGADNTKGIRRA  181

Query  719   IGVPEMDQYFRI--LEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWN  892
             IGVPE+D YF I   +  D+  ++++L+  I   K NT KLA  Q   I  +  +L   +
Sbjct  182   IGVPELDSYFEIEMKKGIDDAEKEKILKEAIRKTKQNTFKLAENQHSKIQNMADKL--GS  239

Query  893   IVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             ++ ++++TE F+     G +    ++ +V  PS  IV  F+
Sbjct  240   MIKKINSTEVFEVI-LRGEDYQHLYQDIVIKPSMKIVKRFL  279



>gb|EPS59563.1| hypothetical protein M569_15242, partial [Genlisea aurea]
Length=263

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/240 (54%), Positives = 179/240 (75%), Gaps = 5/240 (2%)
 Frame = +2

Query  212  KDKVVFVMGATGTGKSRLAIDLATRF-VAEVVNSDKMQVYKGLDIVTNKVREEECQGVPH  388
            ++K+V V+GATGTGKSRL+IDLA+ F  AEV+NSDK+Q+Y+GLDI TNK+ E E +GVPH
Sbjct  1    ENKLVVVVGATGTGKSRLSIDLASYFGAAEVINSDKVQIYRGLDITTNKITEGESRGVPH  60

Query  389  HLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHAEFRSKYE  568
            HLLGV DP  +FTA +F   A  +V ++  +  LP+IAGGSNSYI+AL+     FRS+YE
Sbjct  61   HLLGVADPFSEFTAGNFRAVAEASVKSVLTRGNLPLIAGGSNSYIEALID--PGFRSRYE  118

Query  569  CCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYF  748
            CCFLW+DV MP L+  +S+RV++M+  G+IEE ++F+   GDY+RGI ++IGVPE+  +F
Sbjct  119  CCFLWVDVAMPELHTSLSERVDRMIGNGMIEEVQKFYQKNGDYSRGILKSIGVPELHGFF  178

Query  749  RILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAFQ  928
            R  + + E  R ++L  GID +K NT +LA  QL+ ILR ++   GW + HRLDAT+AF+
Sbjct  179  RSDDDAGEEARMKLLSEGIDAVKLNTSRLACRQLRKILRFRTA-GGWRL-HRLDATDAFK  236



>gb|AEV76968.1| isopentenyltransferase 7, partial [Triticum aestivum]
Length=233

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/224 (57%), Positives = 162/224 (72%), Gaps = 4/224 (2%)
 Frame = +2

Query  212  KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHH  391
            K KVV VMGAT TGKS+LAIDLA RF  EVVNSDK+QV+ GLD+VTNK    E  GVPHH
Sbjct  6    KAKVVIVMGATATGKSKLAIDLALRFGGEVVNSDKIQVHDGLDVVTNKATARERAGVPHH  65

Query  392  LLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHAEFRSKYEC  571
            L+G V P+ D+TAADF R A +AV+++  + RLPIIAGGSNSY++AL+     FR +YEC
Sbjct  66   LIGGVHPDADYTAADFRRDATRAVESVLARGRLPIIAGGSNSYLEALLDGEPGFRRRYEC  125

Query  572  CFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYFR  751
            CFLW+D +  VL  +V DRV+ MVE+GL+ E R F+    DY+RGI+RAIGVPEMD YFR
Sbjct  126  CFLWVDSDTAVLERYVGDRVDCMVEQGLVGEVRGFYRTDADYSRGIRRAIGVPEMDTYFR  185

Query  752  ILEA----SDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQ  871
            +  A     D+  R  +L+  +D I+ANTC+L   QL+ I RL+
Sbjct  186  MEAAGALDGDDGRRAGLLEAAVDEIRANTCRLVCSQLRKIHRLR  229



>ref|XP_003598728.1| Adenylate isopentenyltransferase [Medicago truncatula]
 gb|AES68979.1| adenylate isopentenyltransferase [Medicago truncatula]
Length=303

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/291 (46%), Positives = 199/291 (68%), Gaps = 14/291 (5%)
 Frame = +2

Query  188   LNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREE  367
             L  S+   K KV+FVMG TGTGK++L+I+L T+F +E++NSDK+QVYKGLDIVTNKV++ 
Sbjct  3     LTTSTLTNKKKVLFVMGTTGTGKTKLSINLGTQFPSEIINSDKIQVYKGLDIVTNKVQKS  62

Query  368   ECQGVPHHLLGVV-DPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDH  544
             E   +PHH+LG++ DP+ DFT  DFC+  L+A+D IT+   LPII GGSNSY+K L++D 
Sbjct  63    ERCSIPHHILGIIDDPDYDFTMDDFCKHVLEALDLITQNGHLPIIVGGSNSYLKKLLEDP  122

Query  545   A-EFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAI  721
                F SKY+C F+W+DV +P+L+ ++  RV++MV  G+++E R+FF P  D T+GI+RAI
Sbjct  123   TIAFHSKYDCSFIWLDVSLPILFPYLDKRVDEMVAVGMVDEIRDFFVPGADNTKGIRRAI  182

Query  722   GVPEMDQYF--RILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNI  895
             GVPE+D YF   + +  D+  ++++LQ  I   K NT  LA  QL  I  + ++    ++
Sbjct  183   GVPELDSYFEMEMKKGVDDAQKEKILQESIRKTKQNTFILAENQLSKIQNMAAKF--GSM  240

Query  896   VHRLDATEAFQK--RGGSGAEAYEAW-ERLVAAPSTMIVHDFICQGTTTTF  1039
             ++++D+TE F+   RG    E Y+   + +V  PS  IV  F+ +GT+  F
Sbjct  241   INKIDSTEVFEAILRG----EDYQHLHQEIVIKPSMKIVKRFL-EGTSHGF  286



>ref|XP_008671619.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Zea mays]
 tpg|DAA39491.1| TPA: hypothetical protein ZEAMMB73_312423 [Zea mays]
Length=347

 Score =   266 bits (680),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 144/270 (53%), Positives = 187/270 (69%), Gaps = 11/270 (4%)
 Frame = +2

Query  212   KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHH  391
             + K V VMGATGTGKSRLA+DLA +F  EV+NSDK+Q++ GL++ TNKV EEE  GVPHH
Sbjct  56    RHKAVVVMGATGTGKSRLAVDLALQFGGEVINSDKIQLHAGLEVTTNKVTEEERAGVPHH  115

Query  392   LLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVK-DHAEFRSKYE  568
             LLGV  P+V+FTAADF R+A +A  AIT + RLPIIAGGSNSY++ LV  D    R  Y+
Sbjct  116   LLGVAHPDVEFTAADFRREASRAAGAITARGRLPIIAGGSNSYVEELVDGDGRALREGYD  175

Query  569   CCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDP-AGDYTRGIKRAIGVPEMDQY  745
             CCFLW+DV+  VL+ +V+ RV++M   GL++E    FDP   DY+RGI RAIG PE+D Y
Sbjct  176   CCFLWVDVQPAVLHGYVARRVDEMCARGLVDEVAAAFDPRRTDYSRGIWRAIGAPELDAY  235

Query  746   FRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAF  925
              R   + DE  R  +L   I++IK+NT +L+  Q   I RL ++L G   V R+DATE F
Sbjct  236   LRW--SGDEGERARLLAAAIEDIKSNTRRLSCRQRAKIQRL-AKLWG---VRRVDATEVF  289

Query  926   QKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             ++RG +   A EAW+RLVA P    V  F+
Sbjct  290   RRRGDA---ADEAWQRLVATPCIDAVRSFL  316



>gb|AAY29690.1| putative cytokinin synthase 1 [Populus tremula x Populus alba]
Length=252

 Score =   263 bits (671),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 161/220 (73%), Gaps = 2/220 (1%)
 Frame = +2

Query  194  ISSRWR-KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEE  370
            +S R R K KVV VMG T  GKSR +++LAT+F AE++NSDKMQVYKGLDIVTNKV EEE
Sbjct  32   LSPRSRQKXKVVIVMGPTXXGKSRXSLELATQFPAEIINSDKMQVYKGLDIVTNKVAEEE  91

Query  371  CQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHA-  547
              GVPHHLLG+ +P VDFTAA++C  A  AV++I  +  LPII GGSNSYI+AL+ D   
Sbjct  92   KSGVPHHLLGIANPTVDFTAANYCHTASLAVESILTRGLLPIIVGGSNSYIEALMDDEDF  151

Query  548  EFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGV  727
              R  Y+CCFLWIDV MP+L++F+S RVE+MV  G+I+E R  FDP  DY+ GI+R+IGV
Sbjct  152  RLRLNYDCCFLWIDVSMPMLHKFISRRVEQMVSVGMIDEVRNIFDPYADYSAGIRRSIGV  211

Query  728  PEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQ  847
            PE D+YFR     DE  R  +L   I ++K NTCKLA  Q
Sbjct  212  PEFDKYFRAEAFLDEENRDRLLHEAICDVKRNTCKLACRQ  251



>ref|XP_003621856.1| Adenylate isopentenyltransferase [Medicago truncatula]
 gb|AES78074.1| adenylate isopentenyltransferase [Medicago truncatula]
Length=304

 Score =   264 bits (675),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 129/277 (47%), Positives = 190/277 (69%), Gaps = 7/277 (3%)
 Frame = +2

Query  209   RKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPH  388
             +K+KV+F++GATGTGK++L+I L T + AE++NSDK+QVYKGLDIVTNKV E E   +PH
Sbjct  11    KKNKVLFILGATGTGKTKLSISLGTHYPAEIINSDKIQVYKGLDIVTNKVPESERCSIPH  70

Query  389   HLLGVV-DPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHA-EFRSK  562
             HLLG++ DP  DFT  DFC+  L+++D I   + LPII GGSNSY+K LV+D +  F SK
Sbjct  71    HLLGIIDDPEYDFTMNDFCKHVLESLDLIIGNEHLPIIVGGSNSYLKKLVEDPSIAFFSK  130

Query  563   YECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQ  742
             Y+CCF+WIDV +P L+++V  RV++MVE G+++E RE+F P  D T+GI+RAIGVPE++ 
Sbjct  131   YDCCFIWIDVSLPTLFQYVGKRVDEMVEAGMVDEIREYFVPRADNTKGIRRAIGVPELNS  190

Query  743   YFRILEAS--DERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDAT  916
             +F I + +  D+  ++++L+  I   K NTC L   QL  I  +       ++V+R+D+T
Sbjct  191   FFEIEKKNGIDDAQKEKILKEAIGKTKHNTCILVENQLLKIHNMADMF--GSMVYRIDST  248

Query  917   EAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGT  1027
             + F+     G +     + +V  PS  IV  F+ + T
Sbjct  249   KVFEAL-LRGEDYKHLHQEIVIKPSKEIVKRFLEETT  284



>ref|XP_003565777.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Brachypodium distachyon]
Length=333

 Score =   265 bits (677),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 139/281 (49%), Positives = 191/281 (68%), Gaps = 10/281 (4%)
 Frame = +2

Query  209   RKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPH  388
             +K+KVVFVMGAT TGKS+LA+DLA +F  EV+NSDK+Q++ GL IVTNK+   E  GVPH
Sbjct  14    KKNKVVFVMGATATGKSKLAVDLALQFGGEVINSDKIQLHDGLPIVTNKITPNEQSGVPH  73

Query  389   HLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKD-HAEFRSKY  565
             HL+G + P+ D++ +DF R A +AV+ +  +  LPI+AGGSN Y++AL+    + FR ++
Sbjct  74    HLIGGLHPDSDYSPSDFRRDATRAVENVLSRGALPIVAGGSNRYLEALLDGPSSSFRRRF  133

Query  566   ECCFLWIDV--EMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMD  739
             ECCF+W+D   ++ +L E+V  RV+ MVE+GL+EE R FF   GDY+RGI+RAIGVPEMD
Sbjct  134   ECCFVWVDAGGDVALLEEYVRQRVDAMVEQGLVEEVRGFFREDGDYSRGIRRAIGVPEMD  193

Query  740   QYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNI----VHRL  907
              YFR +EA+ E +R  VL+  ++ IK NTC LA  Q+  I RL S L GWNI    V R+
Sbjct  194   AYFR-MEAAGELIRAGVLEAAVEQIKRNTCVLARRQVGKIRRL-SGLPGWNIRRVHVGRV  251

Query  908   DATE-AFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGT  1027
              A + A +KR        E WE+ V  P+   V  F+ +G 
Sbjct  252   LALKVAGEKRKEDAGAERELWEKDVLGPAARTVEVFLAKGA  292



>ref|XP_008373754.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Malus domestica]
Length=284

 Score =   263 bits (672),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 142/277 (51%), Positives = 190/277 (69%), Gaps = 16/277 (6%)
 Frame = +2

Query  209   RKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPH  388
             +K KVVF+ G TG GK++L+IDLAT +  EV+NSDK+QVYKGLDIVTNK  E E +G+ H
Sbjct  12    KKAKVVFIXGPTGCGKTKLSIDLATNYGGEVINSDKIQVYKGLDIVTNKATESEQRGIRH  71

Query  389   HLLGVV-DPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHA-EFRSK  562
             HLLG V DP  DF+  +F R+   ++D IT+++ LPIIAGGSNSYI+AL++D   +FR+K
Sbjct  72    HLLGFVEDPVADFSVDEFRRRVQTSIDEITKRNCLPIIAGGSNSYIEALIEDPVIDFRNK  131

Query  563   YECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQ  742
             Y+CCF+W+DV +PVLY  VS RV++MV  G ++E RE F P  +Y  GI+RAIG PEM  
Sbjct  132   YDCCFIWLDVSLPVLYNHVSKRVDEMVAAGXVDELREMFAPGVNYDGGIRRAIGAPEMHP  191

Query  743   YFRILEAS-----DERMRQE-VLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHR  904
             YF + E +     D+++R+E +L+ GI   K NTCKLA  Q+Q I  L  +   W+I HR
Sbjct  192   YF-MAEMNNNIVDDDKVRKEFLLKDGIWKTKENTCKLAERQVQKIKLLSDK---WDI-HR  246

Query  905   LDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             +D T  ++     G EA  AWE LV  PS  IV  F+
Sbjct  247   IDVTAVYEN---CGKEAVVAWETLVLKPSFTIVGGFL  280



>gb|KEH21511.1| adenylate isopentenyltransferase [Medicago truncatula]
Length=300

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/277 (47%), Positives = 188/277 (68%), Gaps = 11/277 (4%)
 Frame = +2

Query  209   RKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPH  388
             +K+KV+F++GATGTGK++L+I+L   + AE++NSDK+QVYKGLDIVTNK        +PH
Sbjct  11    KKNKVLFILGATGTGKTKLSINLGPHYPAEIINSDKIQVYKGLDIVTNK----RALQIPH  66

Query  389   HLLGVV-DPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHA-EFRSK  562
             H+LG++ DP  DFT  DFC   ++++D I     LPII GGSNSY+K LV+D A  F SK
Sbjct  67    HILGIINDPEYDFTMYDFCNHVVESLDLIIGNGHLPIIVGGSNSYLKKLVEDPAISFLSK  126

Query  563   YECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQ  742
             YECCF+W+DV +P LY++V  RV++MV+ G+I+E RE+F P  D T+GI+RAIGVPE+D 
Sbjct  127   YECCFIWVDVSLPTLYQYVGKRVDEMVQTGMIDEIREYFVPGADNTKGIRRAIGVPELDS  186

Query  743   YFRILEAS--DERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDAT  916
             +F I + S  D+ +++ +L+  I+  K NTC LA  QL  I  +   L   ++V+++D+T
Sbjct  187   FFAIEKKSGIDDAIKENILKEAIEKTKQNTCILAKNQLSKIQNMAHML--GSMVYKIDST  244

Query  917   EAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGT  1027
             E F+     G +     + +V  PS  IV  F+ + T
Sbjct  245   EVFETL-LRGEDYKHLHQEIVIKPSKEIVKRFLEETT  280



>gb|ADG96011.1| isopentenyltransferase [Bambusa oldhamii]
Length=344

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 146/275 (53%), Positives = 181/275 (66%), Gaps = 9/275 (3%)
 Frame = +2

Query  212   KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHH  391
             K K V VMG+TGTGK+RLA+DLA RF  EV+NSDKMQVY GLD+ TNKV  EEC GVPHH
Sbjct  49    KQKAVVVMGSTGTGKTRLAVDLALRFGGEVINSDKMQVYAGLDVATNKVTAEECAGVPHH  108

Query  392   LLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVK-DHAEFRSKYE  568
             L+GV  P+ +FTAADF  +A +A  A+T + RLPIIAGGSNSYI+ LV  D   FR +Y+
Sbjct  109   LIGVAHPDAEFTAADFRCEASRAAGAVTARGRLPIIAGGSNSYIEELVDGDSHAFRERYD  168

Query  569   CCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDP-AGDYTRGIKRAIGVPEMDQY  745
             CCFLW+DV++PVL+ FV  RV+KM   GL+ E    FDP   DY+RGI RAIGVPE+D Y
Sbjct  169   CCFLWVDVQLPVLHGFVGRRVDKMFRRGLVGEVAAAFDPRRTDYSRGIWRAIGVPELDAY  228

Query  746   FRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAF  925
              R   + +E  R  +L   I+ IK+NT +L+  Q   I RL      W + H +DATEAF
Sbjct  229   LRSYCSGNEEERARLLAIAIEEIKSNTRRLSCRQRTKIQRLAKL---WRVRH-VDATEAF  284

Query  926   QKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGTT  1030
             ++     A A EAWER V  P    V   +    T
Sbjct  285   RR---RRAAADEAWERHVTVPCVASVRALLYDDVT  316



>ref|XP_002459547.1| hypothetical protein SORBIDRAFT_02g006400 [Sorghum bicolor]
 gb|EER96068.1| hypothetical protein SORBIDRAFT_02g006400 [Sorghum bicolor]
Length=324

 Score =   263 bits (672),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 144/274 (53%), Positives = 188/274 (69%), Gaps = 11/274 (4%)
 Frame = +2

Query  212   KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHH  391
             K K V VMGATGTGKSRLA+DLA +F  EV+NSDK+QV+ GL++ TNKV EEE  GVPHH
Sbjct  26    KHKAVMVMGATGTGKSRLAVDLALQFGGEVINSDKIQVHAGLEVTTNKVTEEERAGVPHH  85

Query  392   LLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVK-DHAEFRSKYE  568
             LLGV  P+ +FTAADF R+A +A  AIT + R+PIIAGGSNSY++ LV  D   FR +Y+
Sbjct  86    LLGVARPDEEFTAADFRREASRAACAITARGRVPIIAGGSNSYVEELVDGDRHAFRDRYD  145

Query  569   CCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDP-AGDYTRGIKRAIGVPEMDQY  745
             CCFLW+DV+  VL+ +V+ RV++M   GL++E    FDP   DY+RGI RAIG PE+D Y
Sbjct  146   CCFLWVDVQRAVLHGYVARRVDEMCARGLVDEVAAAFDPRRTDYSRGIWRAIGAPELDAY  205

Query  746   FR----ILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDA  913
              R      +   +  R  +L   I++IK+NT +L+  Q   I RL ++L G   V R+DA
Sbjct  206   LRWSGDEGDGDGDGERARLLAAAIEDIKSNTRRLSCRQRAKIQRL-AKLWG-CAVRRVDA  263

Query  914   TEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             TE F++RG    +A EAW+RLVAAP    V  F+
Sbjct  264   TEVFRRRGD---DADEAWQRLVAAPCIDAVRSFL  294



>ref|XP_011031808.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Populus euphratica]
Length=344

 Score =   263 bits (673),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 136/298 (46%), Positives = 189/298 (63%), Gaps = 9/298 (3%)
 Frame = +2

Query  125   RIMMSCCFCKQTQPMVSFPSGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVV  304
             R+   C + +     +  P   N  S   K K +FVMG T TGKS+L+IDLAT F  E++
Sbjct  32    RLQFQCHWIRHRNKQIISPLSANDGST--KQKALFVMGTTATGKSKLSIDLATHFQGEII  89

Query  305   NSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKD  484
             NSDK+QVYKGLDIVTNKV E E +GVPHHLLG V+P  +FT  DFC     A+  I    
Sbjct  90    NSDKIQVYKGLDIVTNKVSENESRGVPHHLLGFVEPGEEFTTQDFCNHVHMAMRQIVGNG  149

Query  485   RLPIIAGGSNSYIKALVKDHAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEE  664
              +PIIAGGSN YI+ALV+D   F+  Y+ CFLW+DV +P+L+   + RV+KM++ GL+ E
Sbjct  150   NIPIIAGGSNRYIEALVED-PLFKDNYDTCFLWVDVALPILFARAAKRVDKMLDAGLVNE  208

Query  665   AREFFDPAGDYTRGIKRAIGVPEMDQYFRI-LEASDERMRQEVLQTGIDNIKANTCKLAS  841
              R  F P  D+  GI RAIG+PE++ YF+  ++ +DE  R+ +L TGI  +K NT KL +
Sbjct  209   VRGMFIPGIDHNSGIWRAIGIPELEPYFQAEMQMADEVTRKMLLDTGIKEMKENTKKLIN  268

Query  842   CQLQNILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
              QL  I  L ++ +GW + HR+DAT  +++   SG    + W+  V  PS  I+ +F+
Sbjct  269   KQLTKIKYLANE-KGWKL-HRIDATSVYER---SGKVDEDVWDSKVLRPSLEILINFL  321



>gb|KHN03044.1| Adenylate isopentenyltransferase 5, chloroplastic [Glycine soja]
Length=322

 Score =   262 bits (670),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/217 (58%), Positives = 162/217 (75%), Gaps = 3/217 (1%)
 Frame = +2

Query  209  RKDKVVFVMGATGTGKSRLAIDLATRFV-AEVVNSDKMQVYKGLDIVTNKVREEECQGVP  385
            +K+KVV +MGATGTGKS+LAI+LAT+F  AE+VNSDKMQVY+GL+I TNKV EEE +GVP
Sbjct  37   KKEKVVVIMGATGTGKSKLAIELATQFPPAEIVNSDKMQVYEGLNITTNKVTEEERRGVP  96

Query  386  HHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHAEFRSKY  565
            HHLLG V+PN  FTA DFC QA  AV +I  +D LPIIAGGSNS++ ALV  H EFR +Y
Sbjct  97   HHLLGTVNPNTSFTAQDFCDQATLAVGSILGRDGLPIIAGGSNSFLDALVNHHTEFRLRY  156

Query  566  ECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAG-DYTRGIKRAIGVPEMDQ  742
            +CCFLW+DV +PVL+  +S RV++M+  G + E R+ F     DYT GI++AIGVPE   
Sbjct  157  DCCFLWVDVSLPVLHSSLSARVDRMIHSGQLHEVRQSFQYHNQDYTLGIRKAIGVPEFHD  216

Query  743  YFRI-LEASDERMRQEVLQTGIDNIKANTCKLASCQL  850
            +FR   + +D+R +Q +LQ  I ++K N C LA  QL
Sbjct  217  FFRAEADGADQRTKQRLLQAAIASLKTNNCTLAKRQL  253



>ref|XP_004981325.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Setaria italica]
Length=346

 Score =   261 bits (668),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 149/274 (54%), Positives = 187/274 (68%), Gaps = 11/274 (4%)
 Frame = +2

Query  212   KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHH  391
             K K V V+GATGTGKSRLAIDLA RF  EV+NSDKMQ+YKGLD+ TNKV   EC GVPHH
Sbjct  52    KHKAVVVLGATGTGKSRLAIDLALRFGGEVINSDKMQLYKGLDVATNKVSPGECAGVPHH  111

Query  392   LLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVK-DHAEFRSKYE  568
             LLGV  P+ +FTAADF R+A +A   +  + R+P+IAGGSNSY++ LV+ D   FR ++E
Sbjct  112   LLGVAHPDAEFTAADFRREAARAAAGVAARGRVPVIAGGSNSYVEELVEGDRRAFRERFE  171

Query  569   CCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDP-AGDYTRGIKRAIGVPEMDQY  745
             CCFLW+D ++PVL++FV+ RV++M   GL+EE    FDP   DY+RGI RAIGVPE+D Y
Sbjct  172   CCFLWVDAQLPVLHDFVARRVDEMCRRGLVEEVAAAFDPRRTDYSRGIWRAIGVPELDAY  231

Query  746   FRI--LEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATE  919
              R   L+   +  R  +L   +D IKANT +LA  Q   I RL      W  V R+DATE
Sbjct  232   LRSHGLDGVGDDERARMLAAAVDEIKANTSRLAFRQRGKIQRLARM---WR-VRRVDATE  287

Query  920   AFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQ  1021
              F KRG +   A EAW+RLVAAP    V  F+ +
Sbjct  288   VFLKRGHA---ADEAWQRLVAAPCIDAVRSFLLE  318



>gb|KEH26138.1| adenylate isopentenyltransferase [Medicago truncatula]
 gb|KEH26139.1| adenylate isopentenyltransferase [Medicago truncatula]
Length=312

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/273 (47%), Positives = 190/273 (70%), Gaps = 7/273 (3%)
 Frame = +2

Query  209   RKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPH  388
             +K+K++F++GATGTGK++L+I+L TR+ AE++NSDK+QVYKGL IVTNKV E E   +PH
Sbjct  11    KKNKILFILGATGTGKTKLSINLGTRYPAEIINSDKIQVYKGLHIVTNKVPESERCSIPH  70

Query  389   HLLGVV-DPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHA-EFRSK  562
             HLLG++ DP  DFT  DFC+  L+++D I    RLPII GGSNSYIK LV++    F SK
Sbjct  71    HLLGIIDDPEYDFTMNDFCKNVLESIDLIIGNGRLPIIVGGSNSYIKKLVEEPTIAFLSK  130

Query  563   YECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQ  742
             Y+C F+W+DV +P L+++V  RV++MVE G+++E RE++ P  D ++GI+RAIGVPE+D 
Sbjct  131   YDCFFIWVDVSLPTLFQYVGKRVDEMVESGMVDEIREYYAPGADNSKGIRRAIGVPELDS  190

Query  743   YFRILEAS--DERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDAT  916
             +F+I + +  D+  ++++L   I   K NTC L   QL  I  + +Q+ G ++V+++D+T
Sbjct  191   FFQIEKKNDIDDAQKEKILAEAIRKTKQNTCILVQNQLLKIKNM-AQILG-SMVYKIDST  248

Query  917   EAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             E F+     G +     +  V  PS  IV  F+
Sbjct  249   EVFEAL-LKGEDYKHLHQENVVKPSIEIVKRFL  280



>gb|ABY78885.1| isopentenyl transferase IPT6 [Zea mays]
Length=338

 Score =   261 bits (666),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 145/277 (52%), Positives = 180/277 (65%), Gaps = 14/277 (5%)
 Frame = +2

Query  212   KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHH  391
             K K V V+GATGTGKSRLAIDLA RF  EV+NSDK+Q Y GLD+ TNKV   E   VPHH
Sbjct  47    KHKAVVVLGATGTGKSRLAIDLALRFGGEVINSDKIQAYAGLDVATNKVGPAERAAVPHH  106

Query  392   LLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVK-DHAEFRSKYE  568
             LLGVV P+ +FTAADF R+A  A   +  + R+PIIAGGSNSY++ LV+ D   FR +Y+
Sbjct  107   LLGVVHPDAEFTAADFRREAAGAAARVASRGRVPIIAGGSNSYVEELVEGDRRAFRERYD  166

Query  569   CCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDP-AGDYTRGIKRAIGVPEMDQY  745
             CCFLW+D  +PVL+ FV+ RV++M   GL++E    FDP   DY+RGI RAIGVPEMD Y
Sbjct  167   CCFLWVDARLPVLHGFVARRVDEMCRRGLVDEVAAAFDPRRTDYSRGIWRAIGVPEMDAY  226

Query  746   FR-----ILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLD  910
              R       +  ++  R  +L   +D IK NT +LA  Q   I RL      W  V R+D
Sbjct  227   LRAGGHGDGDGDEQEQRARMLAAALDEIKVNTSRLALRQRGKIQRLARM---WR-VRRVD  282

Query  911   ATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQ  1021
             ATE F KRG +   A EAW+RLVAAP    V  F+ +
Sbjct  283   ATEVFLKRGHA---ADEAWQRLVAAPCIDAVRSFLLE  316



>gb|EAY92293.1| hypothetical protein OsI_14013 [Oryza sativa Indica Group]
Length=357

 Score =   261 bits (667),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 149/286 (52%), Positives = 190/286 (66%), Gaps = 10/286 (3%)
 Frame = +2

Query  212   KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHH  391
             K K V VMGATGTGKSRLA+DLA RF  EV+NSDKMQ++ GLD+VTNKV EEEC GVPHH
Sbjct  51    KHKAVVVMGATGTGKSRLAVDLALRFGGEVINSDKMQIHSGLDVVTNKVTEEECAGVPHH  110

Query  392   LLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVK-DHAEFRSKYE  568
             L+GV  P+ +FTAADF R+A +A      + RLPIIAGGSNSY++ LV+ D   FR +YE
Sbjct  111   LIGVARPDDEFTAADFRREAARAAAGAVERGRLPIIAGGSNSYVEELVEGDGRAFRERYE  170

Query  569   CCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDP-AGDYTRGIKRAIGVPEMDQY  745
             CCFLW+DV++ VL  FV+ RV++M   GL+ E    FDP   DY+RGI RAIGVPE+D Y
Sbjct  171   CCFLWVDVDLEVLRGFVARRVDEMCRRGLVREVAAAFDPRRTDYSRGIWRAIGVPELDAY  230

Query  746   FRIL-EASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEA  922
              R   + +DE  R  +L   +  IK+NT +LA  Q + I RL      W    R+DATE 
Sbjct  231   LRSRGDGADEEERARMLAAAVAEIKSNTFRLACRQHRKIERLDRM---WR-ARRVDATEV  286

Query  923   FQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGTTTTFLAPPTSP  1060
             F++RG +   A +AW+RLVAAP    V  F+ +    + +A    P
Sbjct  287   FRRRGHA---ADDAWQRLVAAPCIDAVRSFLFEDQERSSIAAGKPP  329



>gb|ABR67048.1| isopentenyltransferase [Gossypium hirsutum]
Length=229

 Score =   257 bits (656),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/213 (58%), Positives = 162/213 (76%), Gaps = 5/213 (2%)
 Frame = +2

Query  128  IMMSCCFCKQTQPMVSFPSGLNISSRWR----KDKVVFVMGATGTGKSRLAIDLATRFVA  295
            +++S   CKQT  ++  PSG+  S+ +R    K+KVV +MGATGTGKSRL+IDLATR  A
Sbjct  1    MIVSLSLCKQTMSLLDIPSGVLKSNFFRPRLEKEKVVILMGATGTGKSRLSIDLATRLPA  60

Query  296  EVVNSDKMQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAIT  475
            E++NSDK+QV+ GLDI TNK+ EEE   +PHH+LGV+ P  DFTA DF   A  A+D+I 
Sbjct  61   EIINSDKIQVHAGLDIATNKIPEEERCRLPHHMLGVISPYTDFTATDFVDMASHAMDSIL  120

Query  476  RKDRLPIIAGGSNSYIKALVKDHA-EFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEG  652
             + ++PIIAGGSNSYI+ALV D    FRS+YECCFL +DV MPVL+++VS+RV+KMVE G
Sbjct  121  SRSQVPIIAGGSNSYIEALVDDEDFRFRSRYECCFLCVDVAMPVLHQYVSERVDKMVEMG  180

Query  653  LIEEAREFFDPAGDYTRGIKRAIGVPEMDQYFR  751
            +++E R FFD   +Y  GI++AIGVPE D+YFR
Sbjct  181  MVDEVRSFFDANANYAVGIRKAIGVPEFDRYFR  213



>ref|XP_008665655.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Zea mays]
 tpg|DAA52118.1| TPA: isopentenyl transferase IPT6 [Zea mays]
Length=338

 Score =   260 bits (665),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 145/277 (52%), Positives = 180/277 (65%), Gaps = 14/277 (5%)
 Frame = +2

Query  212   KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHH  391
             K K V V+GATGTGKSRLAIDLA RF  EV+NSDK+Q Y GLD+ TNKV   E   VPHH
Sbjct  47    KHKAVVVLGATGTGKSRLAIDLALRFGGEVINSDKIQAYAGLDVATNKVGPAERAAVPHH  106

Query  392   LLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVK-DHAEFRSKYE  568
             LLGVV P+ +FTAADF R+A  A   +  + R+PIIAGGSNSY++ LV+ D   FR +Y+
Sbjct  107   LLGVVHPDAEFTAADFRREAAGAAARVASRGRVPIIAGGSNSYVEELVEGDRRAFRERYD  166

Query  569   CCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDP-AGDYTRGIKRAIGVPEMDQY  745
             CCFLW+D  +PVL+ FV+ RV++M   GL++E    FDP   DY+RGI RAIGVPEMD Y
Sbjct  167   CCFLWVDARLPVLHGFVARRVDEMCRRGLVDEVAAAFDPRRTDYSRGIWRAIGVPEMDAY  226

Query  746   FR-----ILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLD  910
              R       +  ++  R  +L   +D IK NT +LA  Q   I RL      W  V R+D
Sbjct  227   LRAGGHGDGDGDEQEQRARMLAAALDEIKVNTSRLALRQRGKIQRLARM---WR-VRRVD  282

Query  911   ATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQ  1021
             ATE F KRG +   A EAW+RLVAAP    V  F+ +
Sbjct  283   ATEVFLKRGHA---ADEAWQRLVAAPCIDAVRSFLLE  316



>ref|XP_004251342.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Solanum lycopersicum]
Length=289

 Score =   257 bits (657),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 138/272 (51%), Positives = 185/272 (68%), Gaps = 9/272 (3%)
 Frame = +2

Query  212   KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHH  391
             K KV+F+MGATGTGKSRL++DLAT F  E++NSDKMQVYKGL+IVTNK+   E QGV H+
Sbjct  11    KKKVIFIMGATGTGKSRLSVDLATHFRGEIINSDKMQVYKGLEIVTNKITHTETQGVRHY  70

Query  392   LLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHA-EFRSKYE  568
             LLG ++P+ DFTA DFC QA+  ++ I +   +PII GGSNSYI+ LV+D    F+ KY+
Sbjct  71    LLGEIEPDSDFTAEDFCLQAVIYIEKILKTQCVPIIVGGSNSYIEKLVEDPVFMFKYKYD  130

Query  569   CCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYF  748
              CF+WIDVE  VL   V  RV++MV+ GL++E R+ F P  DYT+GI+R+IGVPEMD+Y 
Sbjct  131   SCFIWIDVEQSVLNRRVDMRVDQMVKAGLVDEVRQIFIPDADYTKGIRRSIGVPEMDRYL  190

Query  749   R---ILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATE  919
             R    ++  DE  +Q +LQ  I +IK NT  L   QL  I RL+S+ + W+ VH + AT+
Sbjct  191   REETNIDGDDES-KQMILQDSISSIKRNTRMLICNQLAKIQRLRSE-KMWS-VHHIIATD  247

Query  920   AFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
              F++      +  EAW   V  P   IV  F+
Sbjct  248   VFKEDREEDLD--EAWTNTVLQPCLDIVKIFL  277



>ref|XP_004955804.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Setaria italica]
Length=347

 Score =   259 bits (662),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 148/270 (55%), Positives = 185/270 (69%), Gaps = 10/270 (4%)
 Frame = +2

Query  212   KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHH  391
             K K V VMGATGTGKSRLA+DLA +F  EV+NSDK+QV+ GLD+ TNKV EEE  GVPHH
Sbjct  58    KHKAVVVMGATGTGKSRLAVDLALQFGGEVINSDKIQVHAGLDVATNKVTEEERAGVPHH  117

Query  392   LLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVK-DHAEFRSKYE  568
             LLGV  P+ DFTAADF R+A +A  AI  + RL IIAGGSNSY++ LV  D   FR +++
Sbjct  118   LLGVAHPDDDFTAADFRREASRAAGAIAARGRLAIIAGGSNSYVEELVDGDRRAFRERFD  177

Query  569   CCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFD-PAGDYTRGIKRAIGVPEMDQY  745
             CCFLW+DV++PVL  +V+ RV+ M   GL+ E    FD    DY+RGI RAIG PE+D Y
Sbjct  178   CCFLWVDVQLPVLRGYVARRVDDMCARGLVSEIAAAFDRRRADYSRGIWRAIGAPELDAY  237

Query  746   FRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAF  925
              R     DE  R  +L   + +IK+NTC+LA  Q   I RL S+L  W  V R+DATE F
Sbjct  238   LR-WSGDDEGERDRLLAAAVQDIKSNTCRLACRQRAKIQRL-SKL--WR-VRRVDATEVF  292

Query  926   QKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             ++RG    +A EAW+RLVAAP   +V  F+
Sbjct  293   RRRGD---DADEAWQRLVAAPCIDVVRSFL  319



>ref|XP_003598733.1| Isopentenyltransferase [Medicago truncatula]
 gb|AES68984.1| adenylate isopentenyltransferase [Medicago truncatula]
 gb|KEH33075.1| adenylate isopentenyltransferase [Medicago truncatula]
Length=302

 Score =   257 bits (656),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/280 (45%), Positives = 192/280 (69%), Gaps = 13/280 (5%)
 Frame = +2

Query  197   SSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQ  376
             +S   + KV+F++GATGTGK++L+I+L T+F +E++NSDK+QVYKGLDIVTNKV+E E  
Sbjct  5     TSTLTEKKVLFILGATGTGKTKLSINLGTQFPSEIINSDKIQVYKGLDIVTNKVQESERC  64

Query  377   GVPHHLLGVVD-PNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHA-E  550
              +PHH+LG++D P  DFT  +FC+  L+A+D I     LPII GGSNSY+K L++D    
Sbjct  65    SIPHHILGIIDDPEYDFTMDEFCKHVLEALDLIIENGHLPIIVGGSNSYLKKLLEDPTIA  124

Query  551   FRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVP  730
             FRSKY+CCF+W+DV +P+L+ ++  RV++MV+ G+++E R+FF P  D T+GI+RAIGV 
Sbjct  125   FRSKYDCCFIWLDVSLPILFPYLDKRVDEMVQAGMVDEIRDFFVPGADNTKGIRRAIGVS  184

Query  731   EMDQYFRI--LEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHR  904
             E+D YF I   +  D+  ++++L+  I   K NT  LA  QL  I  +  +L   ++V +
Sbjct  185   ELDSYFEIEMKKGIDDAQKEKILKEAIRKTKQNTFILAENQLSKIQNMSDKL--GSMVKK  242

Query  905   LDATEAFQK--RGGSGAEAYE-AWERLVAAPSTMIVHDFI  1015
             +++T+ F+   RG    E Y+   + +V  PS  IV  F+
Sbjct  243   INSTKVFEAILRG----ENYQDLHQEIVIKPSMKIVKRFL  278



>ref|XP_010313571.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Solanum lycopersicum]
Length=289

 Score =   256 bits (655),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 134/272 (49%), Positives = 187/272 (69%), Gaps = 9/272 (3%)
 Frame = +2

Query  212   KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHH  391
             K KV+F++GATGTG+SRL++DLAT F  E++NSDKMQVYKGL+IVTNK+   E QGV H+
Sbjct  11    KKKVIFIIGATGTGESRLSVDLATHFRGEIINSDKMQVYKGLEIVTNKITHTEKQGVRHY  70

Query  392   LLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHA-EFRSKYE  568
             LLG ++P+ DFTA DFC QA+  ++ I +  R+PII GGSNSYI+ LV+D    F+ KY+
Sbjct  71    LLGEIEPDTDFTAEDFCLQAIIYIEKILKTQRVPIIVGGSNSYIEKLVEDPVFMFKYKYD  130

Query  569   CCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYF  748
              CF+WIDVE  VL   V  R+++MV+ GL++E R+ F P  DYT+GI+R+IGVPEMD+Y 
Sbjct  131   SCFIWIDVEHSVLNRRVDIRIDQMVKAGLVDEVRQIFIPDADYTKGIRRSIGVPEMDRYL  190

Query  749   R---ILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATE  919
             R    ++  DE  ++ +LQ  I +IK N+  L   QL+ I RL S+ + W+ VH + AT+
Sbjct  191   REETNIDGDDES-KKMILQASISSIKRNSRMLYCNQLEKIQRLISE-KMWS-VHHIIATD  247

Query  920   AFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
              F++      +  EAW  +V  P   IV  F+
Sbjct  248   VFKQDREEDLD--EAWTNIVLQPCLDIVKRFL  277



>ref|XP_007139147.1| hypothetical protein PHAVU_008G005300g [Phaseolus vulgaris]
 gb|ESW11141.1| hypothetical protein PHAVU_008G005300g [Phaseolus vulgaris]
Length=293

 Score =   256 bits (654),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/288 (44%), Positives = 195/288 (68%), Gaps = 8/288 (3%)
 Frame = +2

Query  194   ISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEEC  373
             ++S   K KV+F++GATGTGK++L+I+LA +F +E++NSDK+QVYKGLDI+TNK  E E 
Sbjct  1     MASLVGKRKVLFILGATGTGKTKLSINLAMQFPSEIINSDKIQVYKGLDIITNKASESER  60

Query  374   QGVPHHLLGVVD-PNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKD-HA  547
              G+PHHL G++D P+ DFT+ DFC   L A+D I +   LPII GGSN+Y+ AL++D + 
Sbjct  61    CGIPHHLFGIIDDPDSDFTSDDFCNHVLVALDIIFQNGHLPIIVGGSNTYLGALLEDPNI  120

Query  548   EFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGV  727
              F SKY+CCF+W+DV +PVL+ ++  RV++MV+ G++EE RE+F    DY+RGI+RAIGV
Sbjct  121   AFCSKYDCCFIWVDVSLPVLFPYLDKRVDEMVDAGVVEEIREYFVAGADYSRGIRRAIGV  180

Query  728   PEMDQYFRI-LEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHR  904
             PE+ +YF +  E  DE  ++++LQ  I   K NT +L+  QL  I ++  + +    + R
Sbjct  181   PELGEYFLVEKEMDDEVQKEKMLQHAITKTKENTRRLSEMQLWKIQKMNYERK----MTR  236

Query  905   LDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGTTTTFLAP  1048
             +D+T+ F+     G +    ++ +V  PS  +V  F+ + T    + P
Sbjct  237   IDSTKVFEVV-LKGEDYKHLYQEIVFKPSMELVQKFLEKTTEVKKIMP  283



>ref|XP_002466230.1| hypothetical protein SORBIDRAFT_01g003950 [Sorghum bicolor]
 gb|EER93228.1| hypothetical protein SORBIDRAFT_01g003950 [Sorghum bicolor]
Length=336

 Score =   258 bits (658),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 145/270 (54%), Positives = 181/270 (67%), Gaps = 10/270 (4%)
 Frame = +2

Query  212   KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHH  391
             K K V V+GATGTGKSRLAIDLA RF  EV+NSDK+Q Y GLD+ TNK+   EC GV HH
Sbjct  46    KHKAVVVLGATGTGKSRLAIDLALRFGGEVINSDKIQAYAGLDVATNKIGPAECAGVAHH  105

Query  392   LLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVK-DHAEFRSKYE  568
             LLGVV P+ +FT ADF R+A +A   +  + R+PIIAGGSNSY++ LV+ D   FR +YE
Sbjct  106   LLGVVHPDAEFTPADFRREAARAAAGVASRGRVPIIAGGSNSYVEELVEGDRRAFRERYE  165

Query  569   CCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDP-AGDYTRGIKRAIGVPEMDQY  745
             CCFLW+D ++PVL++FV+ RV++M   GL++E    FDP   DY+RGI RAIGVPE+D Y
Sbjct  166   CCFLWVDAKLPVLHDFVARRVDEMCRRGLVDEVAAAFDPRRTDYSRGIWRAIGVPELDAY  225

Query  746   FRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEAF  925
              R     D+  R  +L   +D IK NT +LA  Q   I RL      W  V R+DATE F
Sbjct  226   LRA-RGHDDEQRARMLVAAVDEIKVNTSRLALRQRGKIQRLARM---WR-VRRVDATEVF  280

Query  926   QKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
              KRG +   A EAW+RLVAAP    V  F+
Sbjct  281   LKRGHA---ADEAWQRLVAAPCIDAVRSFL  307



>ref|XP_003559269.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Brachypodium distachyon]
Length=362

 Score =   258 bits (659),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 144/282 (51%), Positives = 185/282 (66%), Gaps = 9/282 (3%)
 Frame = +2

Query  212   KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHH  391
             K K V V+GATGTGKSRLAIDLA RF  EV+N+DKMQ+Y GLD+ TNKV   EC GVPHH
Sbjct  51    KQKAVVVLGATGTGKSRLAIDLALRFGGEVINADKMQLYAGLDVATNKVTPRECSGVPHH  110

Query  392   LLGVVD-PNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVK-DHAEFRSKY  565
             LLGVV  P+ DF+A DF R+A +A  ++  + R+P++AGGSNSY++ LV  + A FR ++
Sbjct  111   LLGVVGCPDDDFSAHDFRREAGRAAASVAARGRVPVLAGGSNSYVEELVDGEGAAFRERF  170

Query  566   ECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAG-DYTRGIKRAIGVPEMDQ  742
             E CFLW+DV++PVL  FVS RV+ MV  GL+ E     DP   DY+RG+ RAIGVPE+D 
Sbjct  171   ELCFLWVDVQLPVLKGFVSRRVDDMVRRGLVREVAAAVDPERVDYSRGLWRAIGVPELDA  230

Query  743   YFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEA  922
             Y R L A      + +L+  ++ IK NTC LA+ Q   I RL      W  V R+DATE 
Sbjct  231   YLRQLRAGAGE-DEGLLEAAVEEIKGNTCALAARQRGKIQRLARM---WRGVRRVDATEV  286

Query  923   F--QKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGTTTTFL  1042
             F  Q+R G    A EAW+RLVA P    V  F+ +    +F+
Sbjct  287   FVQQQRSGGRRGADEAWQRLVAGPCFDAVRAFLMEEQECSFI  328



>ref|XP_010313572.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Solanum lycopersicum]
Length=289

 Score =   256 bits (653),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 135/272 (50%), Positives = 185/272 (68%), Gaps = 9/272 (3%)
 Frame = +2

Query  212   KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHH  391
             K KV+F+MGATGTGKSRL++DLAT F  E++NSDKMQVYKGL+IVTNK+   E QGV H+
Sbjct  11    KKKVIFIMGATGTGKSRLSVDLATHFRGEIINSDKMQVYKGLEIVTNKITHTEKQGVRHY  70

Query  392   LLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHA-EFRSKYE  568
             LLG ++P+ DFTA DFC QA+  ++ I +   +PII GGSNSYI+ LV+D    F+ KY+
Sbjct  71    LLGEIEPDTDFTAKDFCLQAIIYIEKILKTQCVPIIVGGSNSYIEKLVEDPVFMFKYKYD  130

Query  569   CCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYF  748
              CF+WIDVE  VL   V  RV++MV+ GL++E R+ F P  DYT+GI+++IGVPEMD+Y 
Sbjct  131   SCFIWIDVEQSVLNRRVDMRVDQMVKAGLVDEVRQIFIPDADYTKGIRQSIGVPEMDRYL  190

Query  749   R---ILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATE  919
             R    ++  DE  ++ +LQ  I +IK NT  L   QL  I RL S+ + W+ VH + AT+
Sbjct  191   REETNIDGDDES-KKMILQASISSIKRNTRMLICNQLDKIQRLISE-KMWS-VHHMIATD  247

Query  920   AFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
              F++      +  EAW  ++  P   IV  F+
Sbjct  248   VFKQDREEDLD--EAWTNIILQPCLDIVKRFL  277



>ref|NP_001051662.1| Os03g0810100 [Oryza sativa Japonica Group]
 gb|AAT77921.1| putative adenylate isopentenyltransferase [Oryza sativa Japonica 
Group]
 dbj|BAE47447.1| adenylate isopentenyltransferase [Oryza sativa Japonica Group]
 gb|ABF99483.1| cytokinin synthase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13576.1| Os03g0810100 [Oryza sativa Japonica Group]
 dbj|BAG92128.1| unnamed protein product [Oryza sativa Japonica Group]
Length=357

 Score =   258 bits (658),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 148/286 (52%), Positives = 188/286 (66%), Gaps = 10/286 (3%)
 Frame = +2

Query  212   KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHH  391
             K K V VMGATGTGKSRLA+DLA RF  EV+NSDKMQ++ GLD+VTNKV EEEC GVPHH
Sbjct  51    KHKAVVVMGATGTGKSRLAVDLALRFGGEVINSDKMQIHSGLDVVTNKVTEEECAGVPHH  110

Query  392   LLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVK-DHAEFRSKYE  568
             L+ V  P+ +FTAADF R+A +A      + RLPIIAGGSNSY++ LV+ D   FR +YE
Sbjct  111   LISVARPDDEFTAADFRREAARAAAGAVERGRLPIIAGGSNSYVEELVEGDGRAFRERYE  170

Query  569   CCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDP-AGDYTRGIKRAIGVPEMDQY  745
             CCFLW+DV++ VL  FV+ RV++M   GL+ E    FDP   DY+RGI RAIGVPE+D Y
Sbjct  171   CCFLWVDVDLEVLRGFVARRVDEMCRRGLVREVAAAFDPRRTDYSRGIWRAIGVPELDAY  230

Query  746   FRIL-EASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEA  922
              R   + +DE  R  +L   +  IK NT +LA  Q + I RL      W    R+DATE 
Sbjct  231   LRSRGDGADEEERARMLAAAVAEIKLNTFRLACRQHRKIERLDRM---WR-ARRVDATEV  286

Query  923   FQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGTTTTFLAPPTSP  1060
             F++RG +   A +AW+RLVAAP    V  F+ +    + +A    P
Sbjct  287   FRRRGHA---ADDAWQRLVAAPCIDAVRSFLFEDQERSSIAAGKPP  329



>ref|XP_010512976.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Camelina sativa]
Length=278

 Score =   254 bits (650),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 136/273 (50%), Positives = 185/273 (68%), Gaps = 11/273 (4%)
 Frame = +2

Query  209   RKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPH  388
             RKDKV+F+MGATGTGKSRL++DLATRF  E++N+DK+QVY+GLDIV+NK+  EE +GVPH
Sbjct  9     RKDKVLFIMGATGTGKSRLSVDLATRFSGEIINTDKIQVYRGLDIVSNKITSEEKRGVPH  68

Query  389   HLLGVVDPNVD--FTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHAEFRSK  562
             HLL V+ P     FT ADFC +A   ++AIT + +LPI+ GGSNS+++ LV D     S+
Sbjct  69    HLLSVLPPEAGGYFTTADFCDRASFLIEAITDRGKLPIVVGGSNSFLEDLVMDG----SR  124

Query  563   YECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAG--DYTRGIKRAIGVPEM  736
             Y CCFLW+DV +PVL   +S+RV+KMV  G++EE RE F+ +   +Y+ GIK A+G+ E 
Sbjct  125   YNCCFLWVDVAVPVLRGVLSERVDKMVANGMVEEVRELFNSSDLKNYSEGIKNAVGISEF  184

Query  737   DQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDAT  916
             +++F+     D   RQ +    ++ IK NTC LA  Q + I RL + +  W  V RLDAT
Sbjct  185   EKFFKHEPFLDAGERQVLFSEVVEEIKRNTCGLACRQREKIQRLIN-VNKW-CVQRLDAT  242

Query  917   EAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
                  R    A+A  AWE LVA PST+ V  F+
Sbjct  243   PVITTRRWK-ADADVAWECLVAGPSTIYVSRFL  274



>ref|XP_011037608.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Populus euphratica]
Length=338

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 131/280 (47%), Positives = 188/280 (67%), Gaps = 7/280 (3%)
 Frame = +2

Query  182   SGLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVR  361
             S L+ S   +K K +FVMG T TGKS+L+IDLAT F+ E++NSDK+QVYKGLDI+TNK+ 
Sbjct  43    SSLHTSDDNKKQKALFVMGTTATGKSKLSIDLATHFLGEIINSDKIQVYKGLDILTNKIS  102

Query  362   EEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKD  541
             E + +GVPHHLLG V+P  +FT  DFC  A +A+  IT    +PIIAGGSN YI+ALV+D
Sbjct  103   ENDRRGVPHHLLGFVEPGEEFTTQDFCNHAHKAMKHITGDGNIPIIAGGSNRYIEALVED  162

Query  542   HA-EFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRA  718
                 F+  Y+ CFLW+DV +P+L++  + RV++M++ GL++E R  F P  D+  G+ RA
Sbjct  163   PLFNFKDSYDTCFLWVDVALPILFDRAAKRVDEMLDAGLVDEVRGMFIPGIDHNSGLWRA  222

Query  719   IGVPEMDQYFRI-LEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNI  895
             IG+ EM+ YF+  +E +DE   + +L  GI  +K NT KL + QL  I  L ++ +GW  
Sbjct  223   IGIAEMEPYFQAEMEMADEVTMKILLDAGIKEMKENTKKLINKQLTKIKYLANK-KGWKF  281

Query  896   VHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
              HR+DAT  +++   S     +AW++ V  PS  IV +F+
Sbjct  282   -HRIDATCVYER---SAKVDEDAWDKKVLRPSLDIVTNFL  317



>ref|XP_010313569.1| PREDICTED: LOW QUALITY PROTEIN: adenylate isopentenyltransferase 
5, chloroplastic-like [Solanum lycopersicum]
Length=289

 Score =   254 bits (649),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 137/278 (49%), Positives = 187/278 (67%), Gaps = 9/278 (3%)
 Frame = +2

Query  194   ISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEEC  373
             I+++  K KV+FVMGATGTGKSRL++DLAT F  E++NSDKMQVYKGL+IVTNK+     
Sbjct  5     INNKEFKKKVIFVMGATGTGKSRLSVDLATHFRGEIINSDKMQVYKGLEIVTNKITHTXK  64

Query  374   QGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHA-E  550
              GV H+LLG ++P+ DFTA DFC QA+  ++ I +  R+PII GGSNSYI+  V+DH   
Sbjct  65    XGVRHYLLGEIEPDSDFTAEDFCLQAIIYIEKILKTQRVPIIVGGSNSYIEKHVEDHVFM  124

Query  551   FRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVP  730
             F+ KY  CF+WIDVE  VL   V  RV++MV+ GL++E R+ F P  DYT+GI+R+IGVP
Sbjct  125   FKYKYGSCFIWIDVEQSVLNRKVDMRVDQMVKAGLVDEVRQIFIPDADYTKGIRRSIGVP  184

Query  731   EMDQYFR---ILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVH  901
             E+D+Y R    ++  DE  ++ +LQ  I +IK NT  L   QL  I RL S+ + W+ VH
Sbjct  185   ELDRYLREETNIDGDDES-KKIILQDLISSIKRNTRMLICNQLDKIQRLISE-KMWS-VH  241

Query  902   RLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
              + AT+ F++      +  EAW  +V  P   IV  F+
Sbjct  242   HIIATDVFKEDRKEDLD--EAWTNIVLLPCLDIVKRFL  277



>gb|KDP21488.1| hypothetical protein JCGZ_21959 [Jatropha curcas]
Length=253

 Score =   253 bits (645),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 126/240 (53%), Positives = 166/240 (69%), Gaps = 8/240 (3%)
 Frame = +2

Query  317   MQVYKGLDIVTNKVREEECQGVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPI  496
             MQVYKGL++ TNK+ EEE  GVPHHLLGVV+PN DFTA DFC  A   +++I+ +  LPI
Sbjct  1     MQVYKGLEVTTNKITEEESSGVPHHLLGVVNPNADFTAKDFCNMASLTIESISIRGLLPI  60

Query  497   IAGGSNSYIKALVKD-HAEFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEARE  673
             I GGSNSYI+ALV D   +FRS+Y+CCFLW+DV M VL EF+  RV++MV +G+++E R 
Sbjct  61    IVGGSNSYIEALVDDPEFKFRSRYDCCFLWVDVSMLVLKEFLYKRVDEMVNKGMVDEVRN  120

Query  674   FFDPAGDYTRGIKRAIGVPEMDQYFRILEASDERMRQEVLQTGIDNIKANTCKLASCQLQ  853
              FDP  DY+RGI+++IGVPE+D++FR     DE     VLQ  I  IK+N  KLA  Q++
Sbjct  121   IFDPNADYSRGIRKSIGVPELDKHFRSELFLDEEESARVLQEAIREIKSNNYKLALRQVE  180

Query  854   NILRLQSQLEGWNIVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFICQGTTT  1033
              I RL++ ++GWNI HR+DATE F+ +        E W+ LV  PS  IV  F+   T T
Sbjct  181   KIRRLKN-VKGWNI-HRIDATEFFRNKDDD-----EMWKTLVGRPSIAIVRRFLYSLTAT  233



>ref|XP_003598771.1| tRNA dimethylallyltransferase [Medicago truncatula]
 gb|AES69022.1| adenylate isopentenyltransferase [Medicago truncatula]
Length=288

 Score =   253 bits (646),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 124/281 (44%), Positives = 190/281 (68%), Gaps = 7/281 (2%)
 Frame = +2

Query  185   GLNISSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVRE  364
              L  S+   K KV+F++GATGTGK++L+I+L T+F +E++NSDK+QVYKGLDIVTNKV+E
Sbjct  2     ALTTSTLAEKKKVLFILGATGTGKTKLSINLGTQFPSEIINSDKIQVYKGLDIVTNKVQE  61

Query  365   EECQGVPHHLLGVV-DPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKD  541
              E   +PHHLLG++ DP  DFT  +FC+  L+A+  I    RLPII GGSNSY+K LV+D
Sbjct  62    SERCSIPHHLLGIIDDPEYDFTVDEFCKHVLEALALIIANGRLPIIVGGSNSYLKKLVED  121

Query  542   HA-EFRSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRA  718
              +  F S Y+C F+W+DV +P+L+ ++  RV++MV  G+++E REFF P  D T+GI+RA
Sbjct  122   PSIAFHSTYDCSFVWLDVSLPILFPYLDKRVDEMVGAGMVDEIREFFVPGADNTKGIRRA  181

Query  719   IGVPEMDQYF--RILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWN  892
             IGVPE+D YF   + +  D+  ++++L+  I   K NT  LA  Q   I  + ++L   +
Sbjct  182   IGVPELDSYFEMEMKKGVDDAEKEKILKEAIRKTKQNTFILAENQHLKIQNMANKL--GS  239

Query  893   IVHRLDATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             +++++++T+ F+     G +    ++ +V  PS  IV  F+
Sbjct  240   MINKINSTKVFEAI-LRGEDYQHLYQEIVIKPSMKIVKRFL  279



>ref|XP_011007543.1| PREDICTED: LOW QUALITY PROTEIN: adenylate isopentenyltransferase 
3, chloroplastic [Populus euphratica]
Length=224

 Score =   250 bits (638),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 156/220 (71%), Gaps = 1/220 (0%)
 Frame = +2

Query  215  DKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHHL  394
            +KVV  MG TGTGKSRL+I+LAT+F AE++NSDK+QVYKGLD VT+KV EEE  G+PHHL
Sbjct  3    EKVVTAMGPTGTGKSRLSIELATQFPAEIINSDKIQVYKGLDTVTHKVAEEEISGIPHHL  62

Query  395  LGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHA-EFRSKYEC  571
            LG+ +PN DFT+ DFCR A  AV++I+ +  +PII  GSN+YI+AL+ D     RSK EC
Sbjct  63   LGIANPNADFTSTDFCRMASLAVESISTRRLVPIIVRGSNTYIEALMDDEDFRLRSKXEC  122

Query  572  CFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQYFR  751
            C LWID  MPV +EFVS RV++MV  G+I+E R    P  DY+ GI+R+IGVPE D+YFR
Sbjct  123  CILWIDESMPVPHEFVSRRVDQMVNIGMIDEVRNLLIPXADYSTGIRRSIGVPEYDKYFR  182

Query  752  ILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQ  871
                 DE  R   L   I ++K  TCKLA  Q +   RL+
Sbjct  183  DEAYLDEENRARXLHESIGDVKDTTCKLACRQWEKSNRLR  222



>ref|XP_003598726.1| Isopentenyltransferase [Medicago truncatula]
 gb|AES68977.1| adenylate isopentenyltransferase [Medicago truncatula]
Length=305

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/275 (46%), Positives = 190/275 (69%), Gaps = 13/275 (5%)
 Frame = +2

Query  212   KDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPHH  391
             K KV+F++GATGTGK++L+I+L T+F +E++NSDK+QVY GLDIVTNKV+E E   +PHH
Sbjct  13    KKKVLFILGATGTGKTKLSINLGTQFPSEIINSDKIQVYNGLDIVTNKVQESERCSIPHH  72

Query  392   LLGVVD-PNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHAE-FRSKY  565
             +LG++D P  DFT  DF +  L+A+D IT+ + LPII GGSNSY+K L++D    F SKY
Sbjct  73    ILGIIDDPEYDFTMDDFRKHVLEALDLITQNEHLPIIVGGSNSYLKKLLEDPTNAFHSKY  132

Query  566   ECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQY  745
             +CCF+W+DV +P+L+ ++  RV++MV  G+++E R+FF P  D T+GI+RAIGVPE+D Y
Sbjct  133   DCCFIWLDVSLPILFPYLDKRVDEMVAAGMVDEIRDFFVPGADNTKGIRRAIGVPELDSY  192

Query  746   F--RILEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATE  919
             F   + +  D+  ++++L+  I   K NT  LA  Q+  I  +   L G  +++++++TE
Sbjct  193   FEMEMKKGIDDVEKEKILKESIRKTKQNTFILAENQVSKIQNMADTL-GL-MINKINSTE  250

Query  920   AFQK--RGGSGAEAYEAW-ERLVAAPSTMIVHDFI  1015
              F+   RG    E Y+   + +V  PS  IV  F+
Sbjct  251   VFEAILRG----EDYQKLHQEIVIKPSMKIVKRFL  281



>ref|XP_004250601.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Solanum lycopersicum]
Length=290

 Score =   251 bits (642),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 133/276 (48%), Positives = 183/276 (66%), Gaps = 7/276 (3%)
 Frame = +2

Query  197   SSRWRKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQ  376
             +  + K KV+F+MGATGTGKS L++D+AT F  E++NSDK+QVYKGL+IVTNK+   E Q
Sbjct  7     NEEFNKKKVIFIMGATGTGKSHLSVDIATHFRGEIINSDKIQVYKGLEIVTNKITHAEKQ  66

Query  377   GVPHHLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHA-EF  553
             GV H+LLG ++P+ DFTA DFC QA+  ++ I + +R+PII GGSNSYI+ LV+D    F
Sbjct  67    GVRHYLLGEIEPDSDFTAEDFCLQAVVYIEKIQKTERVPIIIGGSNSYIEKLVEDPVFMF  126

Query  554   RSKYECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPE  733
             + KY+ CF+WIDVE  VL   V  RV++MV+ GL++E R+ F P   YT+GI+R+I VPE
Sbjct  127   KYKYDSCFIWIDVEQSVLNRKVDMRVDQMVKAGLVDEVRQIFIPDAYYTKGIRRSISVPE  186

Query  734   MDQYFRILEA--SDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRL  907
             MD+YFR       D+  +  +LQ  I +IK NT  L   QL  I RL S+ + W+ VH +
Sbjct  187   MDKYFREQTNIDGDDDSKNMILQASISSIKRNTRMLICNQLDKIQRLISE-KMWS-VHHI  244

Query  908   DATEAFQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
              AT+ F++      +  EAW   V  P   IV  F+
Sbjct  245   IATDVFKEDKEEDTD--EAWTNTVLQPCLDIVKRFL  278



>ref|XP_002306084.1| hypothetical protein POPTR_0004s15810g [Populus trichocarpa]
 gb|EEE86595.1| hypothetical protein POPTR_0004s15810g [Populus trichocarpa]
Length=333

 Score =   253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/271 (48%), Positives = 183/271 (68%), Gaps = 7/271 (3%)
 Frame = +2

Query  209   RKDKVVFVMGATGTGKSRLAIDLATRFVAEVVNSDKMQVYKGLDIVTNKVREEECQGVPH  388
             +K K +FVMG T TGKS+L+IDLAT F  E++NSDK+QVYKGLD++TNK+ E E +GVPH
Sbjct  51    KKQKALFVMGTTATGKSKLSIDLATHFQGEIINSDKIQVYKGLDMLTNKISEIERRGVPH  110

Query  389   HLLGVVDPNVDFTAADFCRQALQAVDAITRKDRLPIIAGGSNSYIKALVKDHA-EFRSKY  565
             HLLG V+P  +FT  DFC    +A+  IT    +PIIAGGSN YI+ALV+D    F+  Y
Sbjct  111   HLLGFVEPGEEFTTQDFCNHVHKAMKHITGDGSIPIIAGGSNRYIEALVEDPLFNFKDSY  170

Query  566   ECCFLWIDVEMPVLYEFVSDRVEKMVEEGLIEEAREFFDPAGDYTRGIKRAIGVPEMDQY  745
             + CFLW+DV +P+L++  + RV++M++ GL+EE R  F P  D+  GI RAIG+ EM+ Y
Sbjct  171   DTCFLWVDVALPILFDRAAKRVDEMLDAGLVEEVRGMFIPGIDHNSGIWRAIGIAEMEPY  230

Query  746   FRI-LEASDERMRQEVLQTGIDNIKANTCKLASCQLQNILRLQSQLEGWNIVHRLDATEA  922
             F+  +E +DE   + +L+TGI  +K NT KL + QL  I  L ++ +GW   HR+DAT  
Sbjct  231   FQAEMEMADEVTMKILLETGIKEMKENTKKLINKQLTKIKYLANK-KGWKF-HRIDATCV  288

Query  923   FQKRGGSGAEAYEAWERLVAAPSTMIVHDFI  1015
             +++   S     + W++ V  PS  IV +F+
Sbjct  289   YER---SAKVDEDVWDKKVLRPSLEIVTNFL  316



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4412942777432