BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c12163_g1_i1 len=1555 path=[1583:0-1554]

Length=1555
                                                                      Score     E

ref|XP_009588096.1|  PREDICTED: cellulose synthase A catalytic su...    796   0.0     
ref|XP_009588107.1|  PREDICTED: cellulose synthase A catalytic su...    796   0.0     
ref|XP_009588113.1|  PREDICTED: cellulose synthase A catalytic su...    796   0.0     
ref|XP_009781300.1|  PREDICTED: cellulose synthase A catalytic su...    789   0.0     
ref|XP_009781299.1|  PREDICTED: cellulose synthase A catalytic su...    788   0.0     
ref|XP_004247500.1|  PREDICTED: cellulose synthase A catalytic su...    785   0.0     
ref|XP_006358416.1|  PREDICTED: cellulose synthase A catalytic su...    777   0.0     
ref|XP_009370338.1|  PREDICTED: cellulose synthase A catalytic su...    769   0.0     
emb|CDP03783.1|  unnamed protein product                                769   0.0     
ref|XP_003533679.1|  PREDICTED: cellulose synthase A catalytic su...    768   0.0     
emb|CBI37171.3|  unnamed protein product                                765   0.0     
ref|XP_002273521.1|  PREDICTED: cellulose synthase A catalytic su...    767   0.0     Vitis vinifera
ref|XP_008339052.1|  PREDICTED: cellulose synthase A catalytic su...    767   0.0     
ref|XP_004487957.1|  PREDICTED: cellulose synthase A catalytic su...    764   0.0     
ref|XP_008348984.1|  PREDICTED: cellulose synthase A catalytic su...    766   0.0     
ref|XP_010262430.1|  PREDICTED: cellulose synthase A catalytic su...    764   0.0     
gb|AGW52058.1|  cellulose synthase 4                                    761   0.0     
gb|AGW52077.1|  cellulose synthase 4                                    761   0.0     
ref|XP_004289981.1|  PREDICTED: cellulose synthase A catalytic su...    761   0.0     
ref|XP_002301856.1|  hypothetical protein POPTR_0002s25970g             761   0.0     Populus trichocarpa [western balsam poplar]
gb|AGW52051.1|  cellulose synthase 4                                    761   0.0     
gb|AGW52040.1|  cellulose synthase 4                                    761   0.0     
gb|AGW52078.1|  cellulose synthase 4                                    760   0.0     
gb|ACJ38666.1|  cellulose synthase                                      759   0.0     Betula luminifera [liang ye hua]
ref|XP_011024455.1|  PREDICTED: cellulose synthase A catalytic su...    759   0.0     
gb|AGG91493.1|  cellulose synthase A4                                   759   0.0     
gb|AGW52057.1|  cellulose synthase 4                                    759   0.0     
ref|XP_011024456.1|  PREDICTED: cellulose synthase A catalytic su...    759   0.0     
gb|AGW52052.1|  cellulose synthase 4                                    758   0.0     
gb|AES65133.2|  cellulose synthase-like protein                         758   0.0     
gb|KHN47729.1|  Cellulose synthase A catalytic subunit 4 [UDP-for...    759   0.0     
gb|AGW52043.1|  cellulose synthase 4                                    758   0.0     
gb|ACT78709.1|  cellulose synthase 4                                    758   0.0     
gb|AGW52037.1|  cellulose synthase 4                                    758   0.0     
gb|AGW52065.1|  cellulose synthase 4                                    758   0.0     
gb|AGW52042.1|  cellulose synthase 4                                    758   0.0     
gb|AII73573.1|  cellulose synthase 4                                    757   0.0     
ref|XP_003594882.1|  Cellulose synthase                                 757   0.0     
ref|XP_007199679.1|  hypothetical protein PRUPE_ppa000641mg             757   0.0     
gb|AGW52045.1|  cellulose synthase 4                                    757   0.0     
ref|XP_006443764.1|  hypothetical protein CICLE_v10018639mg             756   0.0     
gb|KDO60380.1|  hypothetical protein CISIN_1g001574mg                   756   0.0     
gb|AGW52072.1|  cellulose synthase 4                                    756   0.0     
ref|XP_007138849.1|  hypothetical protein PHAVU_009G242700g             755   0.0     
gb|AGW52073.1|  cellulose synthase 4                                    755   0.0     
gb|AGW52047.1|  cellulose synthase 4                                    755   0.0     
gb|AGW52061.1|  cellulose synthase 4                                    755   0.0     
ref|XP_004140572.1|  PREDICTED: cellulose synthase A catalytic su...    754   0.0     
ref|XP_006479463.1|  PREDICTED: cellulose synthase A catalytic su...    755   0.0     
gb|KDO60379.1|  hypothetical protein CISIN_1g001574mg                   754   0.0     
gb|AGW52070.1|  cellulose synthase 4                                    754   0.0     
gb|AGW52062.1|  cellulose synthase 4                                    754   0.0     
gb|AEE60895.1|  cellulose synthase                                      753   0.0     
gb|AGW52039.1|  cellulose synthase 4                                    752   0.0     
ref|XP_008459950.1|  PREDICTED: cellulose synthase A catalytic su...    752   0.0     
gb|AGW52038.1|  cellulose synthase 4                                    752   0.0     
ref|XP_008235611.1|  PREDICTED: cellulose synthase A catalytic su...    751   0.0     
gb|EYU46412.1|  hypothetical protein MIMGU_mgv1a000605mg                751   0.0     
ref|XP_010556863.1|  PREDICTED: cellulose synthase A catalytic su...    750   0.0     
gb|AAC78476.1|  cellulose synthase                                      748   0.0     Populus tremula x Populus alba [gray poplar]
ref|XP_008339053.1|  PREDICTED: cellulose synthase A catalytic su...    748   0.0     
gb|AAT09894.1|  cellulose synthase                                      748   0.0     Populus tremula x Populus tremuloides
gb|AAQ08987.1|  xylem-specific cellulose synthase                       746   0.0     Populus tremuloides
gb|ACC59197.1|  cellulose synthase                                      746   0.0     Betula platyphylla [Asian white birch]
gb|KDP26483.1|  hypothetical protein JCGZ_17641                         747   0.0     
ref|XP_011080097.1|  PREDICTED: cellulose synthase A catalytic su...    741   0.0     
ref|XP_003532664.1|  PREDICTED: cellulose synthase A catalytic su...    740   0.0     
ref|XP_010091789.1|  OsCesA4 protein                                    755   0.0     
ref|XP_007158869.1|  hypothetical protein PHAVU_002G188600g             737   0.0     
ref|XP_002526560.1|  Cellulose synthase A catalytic subunit 6 [UD...    738   0.0     Ricinus communis
ref|XP_010934249.1|  PREDICTED: cellulose synthase A catalytic su...    736   0.0     
gb|KFK31669.1|  hypothetical protein AALP_AA6G143600                    736   0.0     
gb|KHG02090.1|  Cellulose synthase A catalytic subunit 4 [UDP-for...    735   0.0     
ref|XP_008785168.1|  PREDICTED: cellulose synthase A catalytic su...    734   0.0     
ref|NP_001289665.1|  cellulose synthase A catalytic subunit 4           731   0.0     
ref|XP_007050191.1|  Cellulose synthase A4 isoform 1                    730   0.0     
gb|AEK31216.1|  cellulose synthase A                                    729   0.0     
gb|AFR58755.1|  cellulose synthase 2                                    728   0.0     
gb|ABY25278.1|  cellulose synthase                                      728   0.0     Eucalyptus grandis [rose gum]
gb|AEX20380.1|  cellulose synthase 2-Dt                                 727   0.0     
ref|XP_007050192.1|  Cellulose synthase A4 isoform 2                    727   0.0     
gb|KHG10785.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    727   0.0     
gb|AEX20379.1|  cellulose synthase catalytic subunit 2-At               726   0.0     
gb|AAY60844.1|  cellulose synthase 2                                    726   0.0     Eucalyptus grandis [rose gum]
dbj|BAK18577.1|  cellulose synthase catalytic subunit                   726   0.0     
dbj|BAK18576.1|  cellulose synthase catalytic subunit                   726   0.0     
gb|ACS68193.1|  cellulose synthase 4.1 catalytic subunit                725   0.0     
emb|CDX94752.1|  BnaC07g17610D                                          724   0.0     
ref|NP_199216.2|  cellulose synthase A catalytic subunit 4 [UDP-f...    723   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865387.1|  hypothetical protein ARALYDRAFT_494593             723   0.0     
ref|XP_006403149.1|  hypothetical protein EUTSA_v10003137mg             723   0.0     
ref|XP_009101741.1|  PREDICTED: cellulose synthase A catalytic su...    721   0.0     
ref|XP_006857480.1|  hypothetical protein AMTR_s00067p00196920          719   0.0     
ref|XP_009101742.1|  PREDICTED: cellulose synthase A catalytic su...    719   0.0     
ref|XP_006281455.1|  hypothetical protein CARUB_v10027534mg             720   0.0     
ref|XP_010494402.1|  PREDICTED: cellulose synthase A catalytic su...    718   0.0     
ref|NP_001064811.1|  Os10g0467800                                       719   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|NP_001105672.1|  cellulose synthase10                               718   0.0     Zea mays [maize]
gb|EEC67136.1|  hypothetical protein OsI_33963                          717   0.0     Oryza sativa Indica Group [Indian rice]
gb|AAO15532.1|AF458083_1  cellulose synthase                            717   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010481785.1|  PREDICTED: cellulose synthase A catalytic su...    716   0.0     
ref|XP_010696484.1|  PREDICTED: cellulose synthase A catalytic su...    715   0.0     
gb|EEE51108.1|  hypothetical protein OsJ_31839                          715   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_010441941.1|  PREDICTED: cellulose synthase A catalytic su...    714   0.0     
dbj|BAB09063.1|  cellulose synthase catalytic subunit-like protein      712   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|ACS68194.1|  cellulose synthase 4.2 catalytic subunit                711   0.0     
ref|XP_009400930.1|  PREDICTED: cellulose synthase A catalytic su...    709   0.0     
ref|XP_009400929.1|  PREDICTED: cellulose synthase A catalytic su...    708   0.0     
gb|AGJ71353.1|  cellulose synthase 2                                    706   0.0     
tpg|DAA49708.1|  TPA: eukaryotic translation initiation factor 4E-2     717   0.0     
ref|XP_002467109.1|  hypothetical protein SORBIDRAFT_01g019720          707   0.0     Sorghum bicolor [broomcorn]
ref|XP_004982919.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    717   0.0     
ref|XP_006662427.1|  PREDICTED: cellulose synthase A catalytic su...    707   0.0     
gb|ADI99492.1|  cellulose synthase                                      699   0.0     
ref|XP_003574029.1|  PREDICTED: cellulose synthase A catalytic su...    688   0.0     
gb|EMT11949.1|  Cellulose synthase A catalytic subunit 7 (UDP-for...    680   0.0     
gb|AAX18648.1|  cellulose synthase catalytic subunit                    660   0.0     Pinus taeda
ref|XP_008387657.1|  PREDICTED: cellulose synthase A catalytic su...    629   0.0     
gb|AHL45023.1|  cellulose synthase 1A                                   633   0.0     
gb|AHL45026.1|  cellulose synthase 3B                                   630   0.0     
ref|XP_004291468.1|  PREDICTED: cellulose synthase A catalytic su...    630   0.0     
gb|AHL45024.1|  cellulose synthase 1B                                   631   0.0     
gb|AHL45025.1|  cellulose synthase 3A                                   630   0.0     
dbj|BAG06269.1|  cellulose synthase Z811                                619   0.0     Zinnia violacea [garden zinnia]
emb|CAN73700.1|  hypothetical protein VITISV_013112                     625   0.0     Vitis vinifera
ref|XP_008394069.1|  PREDICTED: cellulose synthase A catalytic su...    627   0.0     
ref|XP_008450511.1|  PREDICTED: cellulose synthase A catalytic su...    626   0.0     
ref|XP_008366693.1|  PREDICTED: cellulose synthase A catalytic su...    626   0.0     
ref|XP_007013842.1|  Cellulose synthase 1                               626   0.0     
ref|XP_004242614.1|  PREDICTED: cellulose synthase A catalytic su...    625   0.0     
ref|XP_004152851.1|  PREDICTED: cellulose synthase A catalytic su...    624   0.0     
ref|XP_006474027.1|  PREDICTED: cellulose synthase A catalytic su...    624   0.0     
ref|XP_006474028.1|  PREDICTED: cellulose synthase A catalytic su...    624   0.0     
ref|XP_004149389.1|  PREDICTED: cellulose synthase A catalytic su...    625   0.0     
ref|XP_010110357.1|  Protein radially swollen 1                         625   0.0     
ref|XP_006453581.1|  hypothetical protein CICLE_v10007321mg             624   0.0     
ref|XP_003522926.1|  PREDICTED: cellulose synthase A catalytic su...    624   0.0     
gb|KDO62270.1|  hypothetical protein CISIN_1g039060mg                   624   0.0     
gb|AGT16647.1|  cellulose synthase                                      625   0.0     
ref|XP_004162186.1|  PREDICTED: cellulose synthase A catalytic su...    625   0.0     
tpg|DAA59988.1|  TPA: putative cellulose synthase family protein        615   0.0     
ref|XP_010250039.1|  PREDICTED: probable cellulose synthase A cat...    625   0.0     
ref|XP_009355721.1|  PREDICTED: cellulose synthase A catalytic su...    625   0.0     
ref|XP_006343620.1|  PREDICTED: cellulose synthase A catalytic su...    623   0.0     
ref|XP_009407580.1|  PREDICTED: probable cellulose synthase A cat...    624   0.0     
gb|ACR38558.1|  unknown                                                 607   0.0     Zea mays [maize]
ref|XP_001767133.1|  cellulose synthase 4, glycosyltransferase fa...    625   0.0     
ref|XP_009386450.1|  PREDICTED: probable cellulose synthase A cat...    624   0.0     
ref|XP_008460760.1|  PREDICTED: cellulose synthase A catalytic su...    623   0.0     
ref|XP_009785781.1|  PREDICTED: cellulose synthase A catalytic su...    624   0.0     
ref|XP_011079380.1|  PREDICTED: cellulose synthase A catalytic su...    622   0.0     
ref|XP_009407595.1|  PREDICTED: probable cellulose synthase A cat...    623   0.0     
ref|XP_002983910.1|  family 2 glycosyltransferase                       623   0.0     
ref|XP_002960761.1|  cellulose synthase 4-1                             623   0.0     
ref|XP_009777624.1|  PREDICTED: cellulose synthase A catalytic su...    622   0.0     
gb|AAT66941.1|  CesA2                                                   623   0.0     Acacia mangium
emb|CBI21020.3|  unnamed protein product                                618   0.0     
ref|XP_009597841.1|  PREDICTED: cellulose synthase A catalytic su...    623   0.0     
ref|XP_008673642.1|  PREDICTED: probable cellulose synthase A cat...    622   0.0     
ref|XP_008375180.1|  PREDICTED: cellulose synthase A catalytic su...    622   0.0     
ref|XP_007221583.1|  hypothetical protein PRUPE_ppa000611mg             622   0.0     
ref|XP_006842872.1|  hypothetical protein AMTR_s00081p00171100          622   0.0     
ref|XP_002276890.2|  PREDICTED: cellulose synthase A catalytic su...    621   0.0     Vitis vinifera
ref|XP_008219478.1|  PREDICTED: cellulose synthase A catalytic su...    622   0.0     
gb|EYU46413.1|  hypothetical protein MIMGU_mgv1a000605mg                616   0.0     
gb|ACZ82297.1|  cellulose synthase                                      622   0.0     Phyllostachys edulis [kikko-chiku]
ref|XP_009354747.1|  PREDICTED: cellulose synthase A catalytic su...    622   0.0     
ref|XP_011079381.1|  PREDICTED: cellulose synthase A catalytic su...    620   0.0     
ref|XP_004968377.1|  PREDICTED: probable cellulose synthase A cat...    621   0.0     
gb|AFZ78556.1|  cellulose synthase                                      621   0.0     
ref|XP_011079382.1|  PREDICTED: cellulose synthase A catalytic su...    620   0.0     
ref|XP_010254360.1|  PREDICTED: probable cellulose synthase A cat...    622   0.0     
ref|XP_010241248.1|  PREDICTED: cellulose synthase A catalytic su...    621   0.0     
ref|XP_004300066.1|  PREDICTED: probable cellulose synthase A cat...    621   0.0     
gb|AAY43219.2|  cellulose synthase BoCesA3                              620   0.0     Bambusa oldhamii
gb|KEH32616.1|  cellulose synthase-like protein                         609   0.0     
ref|XP_006660635.1|  PREDICTED: cellulose synthase A catalytic su...    619   0.0     
tpg|DAA53225.1|  TPA: cellulose synthase3                               620   0.0     
gb|AAY43225.1|  cellulose synthase BoCesA3                              620   0.0     Bambusa oldhamii
emb|CDX85455.1|  BnaA02g03580D                                          617   0.0     
gb|AFS95066.1|  cellulose synthase                                      620   0.0     
ref|XP_002308657.1|  cellulose synthase family protein                  620   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_007137035.1|  hypothetical protein PHAVU_009G094200g             620   0.0     
ref|XP_010048223.1|  PREDICTED: cellulose synthase A catalytic su...    620   0.0     
ref|XP_002529615.1|  Cellulose synthase A catalytic subunit 6 [UD...    613   0.0     Ricinus communis
ref|XP_011083940.1|  PREDICTED: cellulose synthase A catalytic su...    618   0.0     
ref|XP_011018058.1|  PREDICTED: cellulose synthase A catalytic su...    618   0.0     
emb|CDP13491.1|  unnamed protein product                                619   0.0     
gb|AFG25776.1|  cellulose synthase 2                                    619   0.0     
gb|ACJ38667.1|  cellulose synthase                                      620   0.0     Betula luminifera [liang ye hua]
ref|XP_011081578.1|  PREDICTED: cellulose synthase A catalytic su...    619   0.0     
gb|KDP33612.1|  hypothetical protein JCGZ_07183                         619   0.0     
ref|XP_002324291.1|  TGACG-motif binding family protein                 619   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010257191.1|  PREDICTED: cellulose synthase A catalytic su...    619   0.0     
ref|XP_003578137.1|  PREDICTED: cellulose synthase A catalytic su...    618   0.0     
gb|AAY43218.1|  cellulose synthase BoCesA2                              619   0.0     Bambusa oldhamii
ref|XP_011093547.1|  PREDICTED: cellulose synthase A catalytic su...    618   0.0     
ref|XP_001757887.1|  cellulose synthase 5, glycosyltransferase fa...    619   0.0     
ref|XP_002325122.1|  cellulose synthase family protein                  617   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010088232.1|  OsCesA3 protein                                    619   0.0     
ref|XP_003518592.1|  PREDICTED: cellulose synthase A catalytic su...    618   0.0     
ref|XP_002463687.1|  hypothetical protein SORBIDRAFT_01g004210          617   0.0     Sorghum bicolor [broomcorn]
gb|ACT16001.1|  cellulose synthase                                      618   0.0     
ref|XP_010689561.1|  PREDICTED: cellulose synthase A catalytic su...    618   0.0     
gb|KHN28928.1|  Cellulose synthase A catalytic subunit 4 [UDP-for...    618   0.0     
gb|AFZ78551.1|  cellulose synthase                                      616   0.0     
gb|KCW81422.1|  hypothetical protein EUGRSUZ_C02801                     615   0.0     
gb|KHN08123.1|  Cellulose synthase A catalytic subunit 1 [UDP-for...    618   0.0     
ref|XP_007028786.1|  Cellulose synthase family protein                  617   0.0     
ref|XP_003522623.1|  PREDICTED: cellulose synthase A catalytic su...    618   0.0     
ref|XP_008466397.1|  PREDICTED: cellulose synthase A catalytic su...    618   0.0     
ref|XP_010670651.1|  PREDICTED: cellulose synthase A catalytic su...    618   0.0     
gb|AFZ78558.1|  cellulose synthase                                      617   0.0     
ref|XP_010648652.1|  PREDICTED: cellulose synthase A catalytic su...    617   0.0     
gb|ACU87559.2|  cellulose synthase                                      617   0.0     
ref|XP_011071168.1|  PREDICTED: cellulose synthase A catalytic su...    617   0.0     
gb|EYU32338.1|  hypothetical protein MIMGU_mgv1a000544mg                617   0.0     
ref|NP_001105532.1|  cellulose synthase catalytic subunit 12            616   0.0     Zea mays [maize]
gb|KDO61693.1|  hypothetical protein CISIN_1g001399mg                   617   0.0     
gb|AGX27214.1|  cellulose synthase 7                                    615   0.0     
gb|EYU29030.1|  hypothetical protein MIMGU_mgv1a000570mg                617   0.0     
ref|XP_006450469.1|  hypothetical protein CICLE_v10007296mg             617   0.0     
gb|AAQ63935.1|  cellulose synthase                                      617   0.0     Pinus radiata
ref|XP_010265522.1|  PREDICTED: cellulose synthase A catalytic su...    615   0.0     
ref|XP_011026459.1|  PREDICTED: cellulose synthase A catalytic su...    616   0.0     
ref|XP_010545449.1|  PREDICTED: cellulose synthase A catalytic su...    614   0.0     
ref|XP_004229630.1|  PREDICTED: cellulose synthase A catalytic su...    616   0.0     
gb|ACS68197.1|  cellulose synthase 7.1 catalytic subunit                614   0.0     
gb|EYU35355.1|  hypothetical protein MIMGU_mgv1a000638mg                614   0.0     
ref|NP_001275292.1|  cellulose synthase                                 616   0.0     
gb|KHN00756.1|  Cellulose synthase A catalytic subunit 6 [UDP-for...    615   0.0     
gb|KGN60109.1|  hypothetical protein Csa_3G878780                       615   0.0     
ref|XP_010547260.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    615   0.0     
ref|NP_001104954.1|  cellulose synthase-1                               615   0.0     Zea mays [maize]
gb|AFW81389.1|  cellulose synthase1                                     615   0.0     
ref|XP_010695250.1|  PREDICTED: cellulose synthase A catalytic su...    614   0.0     
ref|XP_004501313.1|  PREDICTED: cellulose synthase A catalytic su...    615   0.0     
ref|XP_003526416.1|  PREDICTED: cellulose synthase A catalytic su...    615   0.0     
gb|ABI78958.1|  cellulose synthase 5                                    615   0.0     Physcomitrella patens
ref|XP_006826669.1|  hypothetical protein AMTR_s00137p00043990          614   0.0     
gb|KCW81421.1|  hypothetical protein EUGRSUZ_C02801                     615   0.0     
ref|XP_006400279.1|  hypothetical protein EUTSA_v10012538mg             613   0.0     
gb|KHN07088.1|  Cellulose synthase A catalytic subunit 1 [UDP-for...    615   0.0     
ref|XP_007220288.1|  hypothetical protein PRUPE_ppa000593mg             615   0.0     
ref|XP_006483337.1|  PREDICTED: cellulose synthase A catalytic su...    615   0.0     
ref|XP_011039709.1|  PREDICTED: cellulose synthase A catalytic su...    615   0.0     
ref|XP_009389939.1|  PREDICTED: probable cellulose synthase A cat...    614   0.0     
ref|XP_010932185.1|  PREDICTED: probable cellulose synthase A cat...    614   0.0     
ref|XP_004136343.1|  PREDICTED: cellulose synthase A catalytic su...    614   0.0     
ref|XP_008670082.1|  PREDICTED: probable cellulose synthase A cat...    605   0.0     
ref|XP_002308412.1|  cellulose synthase family protein                  612   0.0     Populus trichocarpa [western balsam poplar]
gb|KEH32617.1|  cellulose synthase-like protein                         607   0.0     
gb|AEK31219.1|  cellulose synthase A                                    614   0.0     
gb|AFW81388.1|  cellulose synthase1                                     614   0.0     
gb|KDP36709.1|  hypothetical protein JCGZ_08000                         614   0.0     
ref|XP_008670083.1|  PREDICTED: probable cellulose synthase A cat...    604   0.0     
ref|XP_002867245.1|  hypothetical protein ARALYDRAFT_491486             613   0.0     
gb|KFK25952.1|  hypothetical protein AALP_AA8G184200                    612   0.0     
gb|AEP33538.1|  cellulose synthase catalytic subunit                    613   0.0     
ref|XP_010091161.1|  OsCesA7 protein                                    612   0.0     
gb|KFK25953.1|  hypothetical protein AALP_AA8G184200                    612   0.0     
ref|XP_009399755.1|  PREDICTED: probable cellulose synthase A cat...    613   0.0     
gb|AFB18636.1|  CESA7                                                   612   0.0     
gb|AEP33537.1|  cellulose synthase catalytic subunit                    613   0.0     
gb|AEP33557.1|  cellulose synthase catalytic subunit                    612   0.0     
gb|AEP33552.1|  cellulose synthase catalytic subunit                    612   0.0     
ref|XP_010687624.1|  PREDICTED: cellulose synthase A catalytic su...    612   0.0     
gb|AEP33540.1|  cellulose synthase catalytic subunit                    612   0.0     
ref|XP_006289427.1|  hypothetical protein CARUB_v10002932mg             612   0.0     
ref|NP_001105621.1|  cellulose synthase-4                               613   0.0     Zea mays [maize]
ref|NP_194967.1|  cellulose synthase A catalytic subunit 1 [UDP-f...    613   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|AIS85990.1|  cellulose synthase 3                                    613   0.0     
gb|AIS85978.1|  cellulose synthase 3                                    613   0.0     
dbj|BAJ85783.1|  predicted protein                                      612   0.0     
gb|AIS85987.1|  cellulose synthase 3                                    612   0.0     
tpg|DAA59989.1|  TPA: putative cellulose synthase family protein        612   0.0     
ref|XP_009131595.1|  PREDICTED: cellulose synthase A catalytic su...    611   0.0     
gb|AIS85996.1|  cellulose synthase 3                                    612   0.0     
gb|AAT57672.1|  cellulose synthase catalytic subunit                    612   0.0     Pinus radiata
ref|XP_006412477.1|  hypothetical protein EUTSA_v10024278mg             612   0.0     
ref|XP_008796554.1|  PREDICTED: probable cellulose synthase A cat...    612   0.0     
ref|XP_010270659.1|  PREDICTED: probable cellulose synthase A cat...    612   0.0     
ref|XP_006286973.1|  hypothetical protein CARUB_v10000119mg             610   0.0     
emb|CDY41973.1|  BnaA01g05450D                                          612   0.0     
emb|CDY04942.1|  BnaAnng01240D                                          611   0.0     
gb|AIS86011.1|  cellulose synthase 3                                    612   0.0     
gb|AIS85991.1|  cellulose synthase 3                                    612   0.0     
ref|XP_006361724.1|  PREDICTED: cellulose synthase A catalytic su...    612   0.0     
ref|XP_009408434.1|  PREDICTED: probable cellulose synthase A cat...    612   0.0     
gb|KHG04072.1|  putative cellulose synthase A catalytic subunit 8...    611   0.0     
gb|ADZ16120.1|  cellulose synthase A3                                   611   0.0     
ref|XP_009130870.1|  PREDICTED: cellulose synthase A catalytic su...    611   0.0     
gb|AEP33536.1|  cellulose synthase catalytic subunit                    611   0.0     
ref|XP_009417280.1|  PREDICTED: probable cellulose synthase A cat...    612   0.0     
emb|CDY52141.1|  BnaA03g55200D                                          611   0.0     
gb|AFB18638.1|  CESA10                                                  611   0.0     
ref|XP_009125590.1|  PREDICTED: cellulose synthase A catalytic su...    611   0.0     
dbj|BAJ33658.1|  unnamed protein product                                611   0.0     
emb|CDX80951.1|  BnaC03g02050D                                          611   0.0     
emb|CDY14127.1|  BnaC02g02440D                                          610   0.0     
gb|AFZ78559.1|  cellulose synthase                                      610   0.0     
ref|XP_010906116.1|  PREDICTED: probable cellulose synthase A cat...    611   0.0     
gb|AGX27223.1|  cellulose synthase 7                                    610   0.0     
ref|XP_009623502.1|  PREDICTED: cellulose synthase A catalytic su...    611   0.0     
ref|XP_011033387.1|  PREDICTED: cellulose synthase A catalytic su...    610   0.0     
ref|XP_010927484.1|  PREDICTED: probable cellulose synthase A cat...    611   0.0     
ref|XP_002873198.1|  hypothetical protein ARALYDRAFT_487306             610   0.0     
ref|XP_006285557.1|  hypothetical protein CARUB_v10006999mg             611   0.0     
gb|EAZ03185.1|  hypothetical protein OsI_25338                          610   0.0     
gb|ABR16179.1|  unknown                                                 592   0.0     
gb|AGX27238.1|  cellulose synthase 7                                    609   0.0     
ref|XP_010432725.1|  PREDICTED: cellulose synthase A catalytic su...    611   0.0     
ref|XP_009768318.1|  PREDICTED: cellulose synthase A catalytic su...    611   0.0     
gb|AII73574.1|  cellulose synthase 7-A                                  609   0.0     
ref|XP_002864919.1|  hypothetical protein ARALYDRAFT_496689             611   0.0     
gb|AEP33559.1|  cellulose synthase catalytic subunit                    610   0.0     
ref|XP_010032436.1|  PREDICTED: cellulose synthase A catalytic su...    610   0.0     
gb|AEP33553.1|  cellulose synthase catalytic subunit                    610   0.0     
ref|XP_009115076.1|  PREDICTED: cellulose synthase A catalytic su...    610   0.0     
gb|AGX27199.1|  cellulose synthase 7                                    609   0.0     
gb|EMT30130.1|  Cellulose synthase A catalytic subunit 9 (UDP-for...    610   0.0     
gb|AGX27229.1|  cellulose synthase 7                                    609   0.0     
gb|AAM26299.1|  cellulose synthase                                      609   0.0     
gb|AGX27202.1|  cellulose synthase 7                                    609   0.0     
gb|AAT66940.1|  CesA1                                                   610   0.0     
ref|XP_010420462.1|  PREDICTED: cellulose synthase A catalytic su...    608   0.0     
ref|XP_010453934.1|  PREDICTED: cellulose synthase A catalytic su...    608   0.0     
gb|AGX27216.1|  cellulose synthase 7                                    609   0.0     
gb|AGX27231.1|  cellulose synthase 7                                    609   0.0     
gb|EPS68064.1|  hypothetical protein M569_06709                         610   0.0     
gb|AGX27222.1|  cellulose synthase 7                                    609   0.0     
ref|XP_010453933.1|  PREDICTED: cellulose synthase A catalytic su...    608   0.0     
ref|XP_010420461.1|  PREDICTED: cellulose synthase A catalytic su...    608   0.0     
gb|AFZ78563.1|  cellulose synthase                                      610   0.0     
gb|AGX27233.1|  cellulose synthase 7                                    608   0.0     
ref|XP_008790520.1|  PREDICTED: probable cellulose synthase A cat...    610   0.0     
gb|AGX27203.1|  cellulose synthase 7                                    608   0.0     
gb|AGX27219.1|  cellulose synthase 7                                    608   0.0     
gb|AGX27211.1|  cellulose synthase 7                                    608   0.0     
gb|AGX27205.1|  cellulose synthase 7                                    608   0.0     
gb|AGX27220.1|  cellulose synthase 7                                    608   0.0     
ref|XP_010278977.1|  PREDICTED: cellulose synthase A catalytic su...    609   0.0     
emb|CDX68844.1|  BnaC01g06090D                                          610   0.0     
gb|KHG16921.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    609   0.0     
ref|XP_006381880.1|  hypothetical protein POPTR_0006s19580g             608   0.0     
ref|XP_006405185.1|  hypothetical protein EUTSA_v10000022mg             610   0.0     
gb|AGX27206.1|  cellulose synthase 7                                    608   0.0     
ref|XP_006398979.1|  hypothetical protein EUTSA_v10012528mg             609   0.0     
gb|AGX27207.1|  cellulose synthase 7                                    608   0.0     
ref|XP_003603419.1|  Cellulose synthase                                 610   0.0     
gb|AEP33556.1|  cellulose synthase catalytic subunit                    609   0.0     
dbj|BAJ96780.1|  predicted protein                                      609   0.0     
gb|AGC65585.1|  CESA3ixr1-2                                             609   0.0     
ref|NP_196136.1|  cellulose synthase A catalytic subunit 3 [UDP-f...    608   0.0     
gb|AGX27236.1|  cellulose synthase 7                                    608   0.0     
ref|XP_010270654.1|  PREDICTED: probable cellulose synthase A cat...    609   0.0     
ref|XP_006600535.1|  PREDICTED: cellulose synthase A catalytic su...    607   0.0     
gb|AGX27215.1|  cellulose synthase 7                                    607   0.0     
gb|AFB18635.1|  CESA6                                                   609   0.0     
ref|XP_009126053.1|  PREDICTED: cellulose synthase A catalytic su...    609   0.0     
ref|XP_008784835.1|  PREDICTED: probable cellulose synthase A cat...    608   0.0     
ref|NP_001289657.1|  cellulose synthase A catalytic subunit 1           609   0.0     
gb|KHG11461.1|  Cellulose synthase A catalytic subunit 1 [UDP-for...    609   0.0     
ref|XP_003610282.1|  Cellulose synthase catalytic subunit               607   0.0     
gb|AAC29067.1|  cellulose synthase                                      608   0.0     
ref|XP_011087713.1|  PREDICTED: cellulose synthase A catalytic su...    608   0.0     
gb|AAR29963.1|  putative cellulose synthase catalytic subunit           608   0.0     
ref|XP_010525969.1|  PREDICTED: cellulose synthase A catalytic su...    608   0.0     
ref|XP_010228016.1|  PREDICTED: probable cellulose synthase A cat...    608   0.0     
gb|AGX27235.1|  cellulose synthase 7                                    607   0.0     
ref|XP_004245031.1|  PREDICTED: cellulose synthase A catalytic su...    608   0.0     
ref|XP_010492694.1|  PREDICTED: cellulose synthase A catalytic su...    607   0.0     
ref|XP_008796456.1|  PREDICTED: probable cellulose synthase A cat...    608   0.0     
ref|XP_008670200.1|  PREDICTED: cellulose synthase A catalytic su...    607   0.0     
gb|AGX27212.1|  cellulose synthase 7                                    607   0.0     
ref|XP_010645442.1|  PREDICTED: probable cellulose synthase A cat...    608   0.0     
ref|XP_010452418.1|  PREDICTED: cellulose synthase A catalytic su...    607   0.0     
ref|XP_006279743.1|  hypothetical protein CARUB_v10027598mg             608   0.0     
ref|XP_001757832.1|  predicted protein                                  608   0.0     
gb|AGX27201.1|  cellulose synthase 7                                    606   0.0     
gb|AGV22109.1|  cellulose synthase 7                                    607   0.0     
gb|AFI71895.1|  cellulose synthase 6                                    607   0.0     
ref|XP_010228012.1|  PREDICTED: probable cellulose synthase A cat...    607   0.0     
emb|CDY42621.1|  BnaC01g00330D                                          607   0.0     
emb|CDX75242.1|  BnaA01g04600D                                          607   0.0     
ref|XP_002308955.1|  cellulose synthase family protein                  606   0.0     
ref|XP_004956061.1|  PREDICTED: probable cellulose synthase A cat...    607   0.0     
ref|XP_004956060.1|  PREDICTED: probable cellulose synthase A cat...    607   0.0     
gb|AIS86005.1|  cellulose synthase 3                                    607   0.0     
gb|KHN39939.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    607   0.0     
ref|XP_010447394.1|  PREDICTED: cellulose synthase A catalytic su...    607   0.0     
emb|CDY14504.1|  BnaC03g49550D                                          607   0.0     
emb|CDY08854.1|  BnaA06g23700D                                          607   0.0     
gb|AEP33539.1|  cellulose synthase catalytic subunit                    606   0.0     
ref|XP_004956059.1|  PREDICTED: probable cellulose synthase A cat...    607   0.0     
ref|XP_009150553.1|  PREDICTED: cellulose synthase A catalytic su...    606   0.0     
gb|KFK29850.1|  hypothetical protein AALP_AA7G186800                    606   0.0     
ref|XP_010437052.1|  PREDICTED: cellulose synthase A catalytic su...    606   0.0     
gb|ACS68191.1|  cellulose synthase 2.1 catalytic subunit                606   0.0     
ref|XP_004956058.1|  PREDICTED: probable cellulose synthase A cat...    607   0.0     
ref|XP_010491044.1|  PREDICTED: cellulose synthase A catalytic su...    605   0.0     
gb|AFP93559.1|  cellulose synthase A1                                   604   0.0     
ref|XP_003546888.1|  PREDICTED: cellulose synthase A catalytic su...    605   0.0     
ref|XP_002873827.1|  hypothetical protein ARALYDRAFT_909737             604   0.0     
emb|CDX72357.1|  BnaC07g43790D                                          605   0.0     
ref|XP_010445007.1|  PREDICTED: cellulose synthase A catalytic su...    611   0.0     
ref|NP_001104956.1|  cellulose synthase6                                604   0.0     
ref|XP_010526207.1|  PREDICTED: cellulose synthase A catalytic su...    605   0.0     
gb|AAC39333.1|  RSW1-like cellulose synthase catalytic subunit          588   0.0     
ref|XP_006399471.1|  hypothetical protein EUTSA_v10012521mg             605   0.0     
ref|XP_010431901.1|  PREDICTED: cellulose synthase A catalytic su...    605   0.0     
gb|AIA10372.1|  cellulose synthase                                      604   0.0     
ref|XP_004981133.1|  PREDICTED: probable cellulose synthase A cat...    605   0.0     
ref|XP_008648127.1|  PREDICTED: cellulose synthase6 isoform X1          605   0.0     
gb|ADZ16119.1|  cellulose synthase A3                                   604   0.0     
gb|AAC39336.1|  cellulose synthase catalytic subunit                    604   0.0     
ref|XP_004981132.1|  PREDICTED: probable cellulose synthase A cat...    605   0.0     
gb|ACS68190.1|  cellulose synthase 1.2 catalytic subunit                604   0.0     
ref|XP_002322712.1|  cellulose synthase family protein                  604   0.0     
ref|XP_010667061.1|  PREDICTED: cellulose synthase A catalytic su...    603   0.0     
gb|AEE60896.1|  cellulose synthase                                      602   0.0     
ref|XP_002314037.1|  cellulose synthase family protein                  603   0.0     
gb|AEP33543.1|  cellulose synthase catalytic subunit                    603   0.0     
ref|XP_002533228.1|  Cellulose synthase A catalytic subunit 3 [UD...    600   0.0     
gb|AEP33541.1|  cellulose synthase catalytic subunit                    603   0.0     
ref|XP_009372681.1|  PREDICTED: LOW QUALITY PROTEIN: probable cel...    604   0.0     
ref|XP_007148880.1|  hypothetical protein PHAVU_005G022100g             603   0.0     
gb|AEP33551.1|  cellulose synthase catalytic subunit                    603   0.0     
gb|AEP33545.1|  cellulose synthase catalytic subunit                    603   0.0     
gb|AEP33554.1|  cellulose synthase catalytic subunit                    602   0.0     
ref|NP_197244.1|  cellulose synthase A catalytic subunit 7 [UDP-f...    601   0.0     
emb|CDY13484.1|  BnaA03g52020D                                          603   0.0     
ref|XP_007052528.1|  Cellulose synthase family protein isoform 4        597   0.0     
gb|AEP33547.1|  cellulose synthase catalytic subunit                    602   0.0     
gb|AAD32031.1|AF088917_1  cellulose synthase catalytic subunit          601   0.0     
ref|XP_009138081.1|  PREDICTED: cellulose synthase A catalytic su...    603   0.0     
gb|AEE60898.1|  cellulose synthase                                      602   0.0     
ref|XP_009126184.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    600   0.0     
gb|AGC65584.1|  GFP-CESA3ixr1-2                                         610   0.0     
ref|XP_004956855.1|  PREDICTED: cellulose synthase A catalytic su...    601   0.0     
gb|ADZ16123.1|  cellulose synthase A3                                   601   0.0     
ref|XP_010520165.1|  PREDICTED: cellulose synthase A catalytic su...    601   0.0     
ref|XP_001769255.1|  cellulose synthase 8, glycosyltransferase fa...    601   0.0     
gb|AIS86004.1|  cellulose synthase 3                                    600   0.0     
gb|AFZ78554.1|  cellulose synthase                                      600   0.0     
gb|AFZ78557.1|  cellulose synthase                                      600   0.0     
gb|AIS85977.1|  cellulose synthase 3                                    600   0.0     
gb|AAY60846.1|  cellulose synthase 4                                    600   0.0     
ref|XP_002466137.1|  hypothetical protein SORBIDRAFT_01g002050          601   0.0     
gb|AIS85989.1|  cellulose synthase 3                                    600   0.0     
ref|XP_006411737.1|  hypothetical protein EUTSA_v10024277mg             600   0.0     
ref|XP_009601834.1|  PREDICTED: cellulose synthase A catalytic su...    600   0.0     
gb|AGC97433.2|  cellulose synthase                                      600   0.0     
ref|XP_002866842.1|  hypothetical protein ARALYDRAFT_490712             600   0.0     
gb|EMT00418.1|  Putative cellulose synthase A catalytic subunit 2...    602   0.0     
gb|AAO25536.1|  cellulose synthase                                      599   0.0     
gb|AIS86009.1|  cellulose synthase 3                                    599   0.0     
ref|XP_009146799.1|  PREDICTED: cellulose synthase A catalytic su...    598   0.0     
gb|AAD39534.2|  cellulose synthase catalytic subunit                    598   0.0     
tpg|DAA61529.1|  TPA: putative cellulose synthase family protein        598   0.0     
gb|AHH81946.1|  cellulose synthase                                      597   0.0     
ref|XP_007133819.1|  hypothetical protein PHAVU_011G211500g             598   0.0     
gb|EYU17480.1|  hypothetical protein MIMGU_mgv1a000527mg                594   0.0     
ref|NP_001104957.1|  cellulose synthase7                                598   0.0     
ref|XP_009799381.1|  PREDICTED: cellulose synthase A catalytic su...    598   0.0     
ref|XP_008784981.1|  PREDICTED: probable cellulose synthase A cat...    598   0.0     
ref|XP_004965873.1|  PREDICTED: probable cellulose synthase A cat...    598   0.0     
gb|AAR29964.1|  putative cellulose synthase catalytic subunit           598   0.0     
ref|XP_002532166.1|  Cellulose synthase A catalytic subunit 6 [UD...    598   0.0     
dbj|BAJ97774.1|  predicted protein                                      598   0.0     
ref|XP_006654097.1|  PREDICTED: probable cellulose synthase A cat...    598   0.0     
ref|XP_001753310.1|  putative cellulose synthase 3, glycosyltrans...    598   0.0     
gb|KCW89002.1|  hypothetical protein EUGRSUZ_A01324                     592   0.0     
gb|ACS68189.1|  cellulose synthase 1.1 catalytic subunit                597   0.0     
ref|XP_004960821.1|  PREDICTED: probable cellulose synthase A cat...    597   0.0     
ref|XP_010526630.1|  PREDICTED: cellulose synthase A catalytic su...    596   0.0     
ref|NP_195645.1|  cellulose synthase A catalytic subunit 2 [UDP-f...    596   0.0     
ref|XP_006283042.1|  hypothetical protein CARUB_v10004034mg             596   0.0     
ref|XP_010914890.1|  PREDICTED: probable cellulose synthase A cat...    596   0.0     
ref|XP_011047398.1|  PREDICTED: cellulose synthase A catalytic su...    596   0.0     
ref|XP_003557327.1|  PREDICTED: probable cellulose synthase A cat...    596   0.0     
gb|ADZ16121.1|  cellulose synthase A3                                   595   0.0     
ref|XP_006658446.1|  PREDICTED: probable cellulose synthase A cat...    595   0.0     
gb|ADD71499.1|  cellulose synthase catalytic subunit                    593   0.0     
ref|XP_006482874.1|  PREDICTED: cellulose synthase A catalytic su...    594   0.0     
ref|XP_006439113.1|  hypothetical protein CICLE_v10030723mg             594   0.0     
gb|EYU17481.1|  hypothetical protein MIMGU_mgv1a000527mg                595   0.0     
ref|XP_010446473.1|  PREDICTED: cellulose synthase A catalytic su...    593   0.0     
gb|KDP43475.1|  hypothetical protein JCGZ_16762                         593   0.0     
gb|AAY43217.1|  cellulose synthase BoCesA1                              593   0.0     
ref|XP_010546378.1|  PREDICTED: cellulose synthase A catalytic su...    593   0.0     
gb|ACZ82296.1|  cellulose synthase                                      593   0.0     
gb|AAY43216.1|  cellulose synthase BoCesA8                              593   0.0     
gb|ACQ99194.1|  cellulose synthase                                      592   0.0     
ref|XP_008792060.1|  PREDICTED: probable cellulose synthase A cat...    592   0.0     
ref|XP_007052525.1|  Cellulose synthase family protein isoform 1        596   0.0     
ref|NP_001105574.1|  cellulose synthase2                                591   0.0     
ref|XP_002515536.1|  Cellulose synthase A catalytic subunit 6 [UD...    592   0.0     
ref|XP_009617930.1|  PREDICTED: probable cellulose synthase A cat...    591   0.0     
ref|XP_006474030.1|  PREDICTED: cellulose synthase A catalytic su...    588   0.0     



>ref|XP_009588096.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
isoform X1 [Nicotiana tomentosiformis]
Length=1051

 Score =   796 bits (2056),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/513 (79%), Positives = 447/513 (87%), Gaps = 18/513 (4%)
 Frame = +2

Query  50    LHAADHDER------REVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYE  211
              H  D  +R      R+     +K+C+IC DEIGV ENGEVFVAC ECGFPVC+PCY+YE
Sbjct  13    FHTGDDQQRPQPAETRDQSAALKKICKICGDEIGVKENGEVFVACSECGFPVCRPCYEYE  72

Query  212   RSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHP-----PLSENGDY  376
             RSEGNQ CPHC++RYKRHKGCPRV GDDED F+ +DF+QEF+ KNH      P SENGDY
Sbjct  73    RSEGNQSCPHCHSRYKRHKGCPRVAGDDEDDFDHDDFDQEFQIKNHHTSPNHPHSENGDY  132

Query  377   HNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLV  556
               NQ  HH   N AA+  +   GSV GKDLEDEQKE + +AEWK+RVEKWK RQEKRGLV
Sbjct  133   --NQQHHH--ANGAAYNQSVT-GSVVGKDLEDEQKETYGDAEWKERVEKWKNRQEKRGLV  187

Query  557   TRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRIL  736
             ++  D      +EDDD+L+A+ARQPLWRK+P+ SSLISPYRIVIV RL++L FFFHFRIL
Sbjct  188   SKLGDGGNDQADEDDDYLLAEARQPLWRKVPLPSSLISPYRIVIVLRLVVLGFFFHFRIL  247

Query  737   TPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLA  916
             TPAYDA+PLW+ISVICEIWFGLSWILDQFPKWSPINRETYLDRL+LRFER  EGE N LA
Sbjct  248   TPAYDAYPLWIISVICEIWFGLSWILDQFPKWSPINRETYLDRLTLRFER--EGEPNRLA  305

Query  917   PVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFA  1096
             PVDV+VSTVDPLKEPPIITANTVLSILA DYPV+KVSCYVSDDGASMLLFD LAETAEFA
Sbjct  306   PVDVFVSTVDPLKEPPIITANTVLSILAADYPVEKVSCYVSDDGASMLLFDALAETAEFA  365

Query  1097  RRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAK  1276
             RRWVPFCKKY +EPRAP+FYF+EKIDYLKDKVQPTFVK+RRAMKREYEE+KVR+NALVAK
Sbjct  366   RRWVPFCKKYNVEPRAPDFYFNEKIDYLKDKVQPTFVKDRRAMKREYEEFKVRINALVAK  425

Query  1277  AQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGY  1456
             AQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELP+LVYVSREKRPGY
Sbjct  426   AQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPRLVYVSREKRPGY  485

Query  1457  QHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             QH+KKAGAMNALVRVSAVLTNAPFMLNLDCDHY
Sbjct  486   QHNKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  518



>ref|XP_009588107.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
isoform X2 [Nicotiana tomentosiformis]
Length=1050

 Score =   796 bits (2056),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/500 (81%), Positives = 444/500 (89%), Gaps = 12/500 (2%)
 Frame = +2

Query  71    ERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNT  250
             E R+     +K+C+IC DEIGV ENGEVFVAC ECGFPVC+PCY+YERSEGNQ CPHC++
Sbjct  25    ETRDQSAALKKICKICGDEIGVKENGEVFVACSECGFPVCRPCYEYERSEGNQSCPHCHS  84

Query  251   RYKRHKGCPRVVGddedhfegedfeqefeTKNHP-----PLSENGDYHNNQLPHHNTTNS  415
             RYKRHKGCPRV GDDED F+ +DF+QEF+ KNH      P SENGDY  NQ  HH   N 
Sbjct  85    RYKRHKGCPRVAGDDEDDFDHDDFDQEFQIKNHHTSPNHPHSENGDY--NQQHHH--ANG  140

Query  416   AAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadne  595
             AA+  +   GSV GKDLEDEQKE + +AEWK+RVEKWK RQEKRGLV++  D      +E
Sbjct  141   AAYNQSVT-GSVVGKDLEDEQKETYGDAEWKERVEKWKNRQEKRGLVSKLGDGGNDQADE  199

Query  596   dddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLIS  775
             DDD+L+A+ARQPLWRK+P+ SSLISPYRIVIV RL++L FFFHFRILTPAYDA+PLW+IS
Sbjct  200   DDDYLLAEARQPLWRKVPLPSSLISPYRIVIVLRLVVLGFFFHFRILTPAYDAYPLWIIS  259

Query  776   VICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLK  955
             VICEIWFGLSWILDQFPKWSPINRETYLDRL+LRFER  EGE N LAPVDV+VSTVDPLK
Sbjct  260   VICEIWFGLSWILDQFPKWSPINRETYLDRLTLRFER--EGEPNRLAPVDVFVSTVDPLK  317

Query  956   EPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIE  1135
             EPPIITANTVLSILA DYPV+KVSCYVSDDGASMLLFD LAETAEFARRWVPFCKKY +E
Sbjct  318   EPPIITANTVLSILAADYPVEKVSCYVSDDGASMLLFDALAETAEFARRWVPFCKKYNVE  377

Query  1136  PRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQD  1315
             PRAP+FYF+EKIDYLKDKVQPTFVK+RRAMKREYEE+KVR+NALVAKAQKKPEEGWVMQD
Sbjct  378   PRAPDFYFNEKIDYLKDKVQPTFVKDRRAMKREYEEFKVRINALVAKAQKKPEEGWVMQD  437

Query  1316  GTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALV  1495
             GTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELP+LVYVSREKRPGYQH+KKAGAMNALV
Sbjct  438   GTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPRLVYVSREKRPGYQHNKKAGAMNALV  497

Query  1496  RVSAVLTNAPFMLNLDCDHY  1555
             RVSAVLTNAPFMLNLDCDHY
Sbjct  498   RVSAVLTNAPFMLNLDCDHY  517



>ref|XP_009588113.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
isoform X3 [Nicotiana tomentosiformis]
Length=1049

 Score =   796 bits (2055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/500 (81%), Positives = 444/500 (89%), Gaps = 12/500 (2%)
 Frame = +2

Query  71    ERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNT  250
             E R+     +K+C+IC DEIGV ENGEVFVAC ECGFPVC+PCY+YERSEGNQ CPHC++
Sbjct  24    ETRDQSAALKKICKICGDEIGVKENGEVFVACSECGFPVCRPCYEYERSEGNQSCPHCHS  83

Query  251   RYKRHKGCPRVVGddedhfegedfeqefeTKNHP-----PLSENGDYHNNQLPHHNTTNS  415
             RYKRHKGCPRV GDDED F+ +DF+QEF+ KNH      P SENGDY  NQ  HH   N 
Sbjct  84    RYKRHKGCPRVAGDDEDDFDHDDFDQEFQIKNHHTSPNHPHSENGDY--NQQHHH--ANG  139

Query  416   AAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadne  595
             AA+  +   GSV GKDLEDEQKE + +AEWK+RVEKWK RQEKRGLV++  D      +E
Sbjct  140   AAYNQSVT-GSVVGKDLEDEQKETYGDAEWKERVEKWKNRQEKRGLVSKLGDGGNDQADE  198

Query  596   dddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLIS  775
             DDD+L+A+ARQPLWRK+P+ SSLISPYRIVIV RL++L FFFHFRILTPAYDA+PLW+IS
Sbjct  199   DDDYLLAEARQPLWRKVPLPSSLISPYRIVIVLRLVVLGFFFHFRILTPAYDAYPLWIIS  258

Query  776   VICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLK  955
             VICEIWFGLSWILDQFPKWSPINRETYLDRL+LRFER  EGE N LAPVDV+VSTVDPLK
Sbjct  259   VICEIWFGLSWILDQFPKWSPINRETYLDRLTLRFER--EGEPNRLAPVDVFVSTVDPLK  316

Query  956   EPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIE  1135
             EPPIITANTVLSILA DYPV+KVSCYVSDDGASMLLFD LAETAEFARRWVPFCKKY +E
Sbjct  317   EPPIITANTVLSILAADYPVEKVSCYVSDDGASMLLFDALAETAEFARRWVPFCKKYNVE  376

Query  1136  PRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQD  1315
             PRAP+FYF+EKIDYLKDKVQPTFVK+RRAMKREYEE+KVR+NALVAKAQKKPEEGWVMQD
Sbjct  377   PRAPDFYFNEKIDYLKDKVQPTFVKDRRAMKREYEEFKVRINALVAKAQKKPEEGWVMQD  436

Query  1316  GTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALV  1495
             GTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELP+LVYVSREKRPGYQH+KKAGAMNALV
Sbjct  437   GTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPRLVYVSREKRPGYQHNKKAGAMNALV  496

Query  1496  RVSAVLTNAPFMLNLDCDHY  1555
             RVSAVLTNAPFMLNLDCDHY
Sbjct  497   RVSAVLTNAPFMLNLDCDHY  516



>ref|XP_009781300.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
isoform X2 [Nicotiana sylvestris]
Length=1053

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/513 (79%), Positives = 447/513 (87%), Gaps = 13/513 (3%)
 Frame = +2

Query  35    TGGSHLHAADHDERREVERES-QKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYE  211
             TG      A+  ++ E    S +K+C+IC DEIGV ENG+ FVAC ECGFPVC+PCY+YE
Sbjct  15    TGDDRPQPAETRDQSEARMSSLKKICKICGDEIGVKENGDAFVACSECGFPVCRPCYEYE  74

Query  212   RSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPL-----SENGDY  376
             RSEGNQ CPHC++RYKRHKGCPRV GDDED F+ +DF+QEF+ KNH        SENGDY
Sbjct  75    RSEGNQSCPHCHSRYKRHKGCPRVAGDDEDDFDHDDFDQEFQIKNHHTSPNHHHSENGDY  134

Query  377   HNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLV  556
             +     HHN  N AA+  +   GSV GKDLEDEQKE + +AEWK+RVEKWK RQEKRGLV
Sbjct  135   NQQ---HHNA-NGAAYNQSVT-GSVAGKDLEDEQKETYGDAEWKERVEKWKNRQEKRGLV  189

Query  557   TRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRIL  736
             ++  D      +EDDD+L+A+ARQPLWRK+P+ SSLISPYRIVIV RL+IL FFFHFRIL
Sbjct  190   SKLGDGGNDQADEDDDYLLAEARQPLWRKVPLPSSLISPYRIVIVLRLVILGFFFHFRIL  249

Query  737   TPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLA  916
             TPA DA+PLW+ISVICEIWFGLSWILDQFPKWSPINRETYLDRL+LRFER  EGE N LA
Sbjct  250   TPANDAYPLWIISVICEIWFGLSWILDQFPKWSPINRETYLDRLALRFER--EGEPNRLA  307

Query  917   PVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFA  1096
             PVDV+VSTVDPLKEPPIITANTVLSILAVDYPV+KVSCYVSDDGASMLLFD LA+TAEFA
Sbjct  308   PVDVFVSTVDPLKEPPIITANTVLSILAVDYPVEKVSCYVSDDGASMLLFDALAKTAEFA  367

Query  1097  RRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAK  1276
             RRWVPFCKKY +EPRAP+FYF+EKIDYLKDKVQPTFVK+RRAMKREYEE+KVR+NALVAK
Sbjct  368   RRWVPFCKKYNVEPRAPDFYFNEKIDYLKDKVQPTFVKDRRAMKREYEEFKVRINALVAK  427

Query  1277  AQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGY  1456
             AQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELP+LVYVSREKRPGY
Sbjct  428   AQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPRLVYVSREKRPGY  487

Query  1457  QHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             QH+KKAGAMNALVRVSAVLTNAPFMLNLDCDHY
Sbjct  488   QHNKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  520



>ref|XP_009781299.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
isoform X1 [Nicotiana sylvestris]
Length=1054

 Score =   788 bits (2034),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/505 (79%), Positives = 442/505 (88%), Gaps = 12/505 (2%)
 Frame = +2

Query  56    AADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCC  235
             A   D+        +K+C+IC DEIGV ENG+ FVAC ECGFPVC+PCY+YERSEGNQ C
Sbjct  24    AETRDQSEARMSSLKKICKICGDEIGVKENGDAFVACSECGFPVCRPCYEYERSEGNQSC  83

Query  236   PHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPL-----SENGDYHNNQLPHH  400
             PHC++RYKRHKGCPRV GDDED F+ +DF+QEF+ KNH        SENGDY+     HH
Sbjct  84    PHCHSRYKRHKGCPRVAGDDEDDFDHDDFDQEFQIKNHHTSPNHHHSENGDYNQQ---HH  140

Query  401   NTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkg  580
             N  N AA+  +   GSV GKDLEDEQKE + +AEWK+RVEKWK RQEKRGLV++  D   
Sbjct  141   NA-NGAAYNQSVT-GSVAGKDLEDEQKETYGDAEWKERVEKWKNRQEKRGLVSKLGDGGN  198

Query  581   gadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFP  760
                +EDDD+L+A+ARQPLWRK+P+ SSLISPYRIVIV RL+IL FFFHFRILTPA DA+P
Sbjct  199   DQADEDDDYLLAEARQPLWRKVPLPSSLISPYRIVIVLRLVILGFFFHFRILTPANDAYP  258

Query  761   LWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVST  940
             LW+ISVICEIWFGLSWILDQFPKWSPINRETYLDRL+LRFER  EGE N LAPVDV+VST
Sbjct  259   LWIISVICEIWFGLSWILDQFPKWSPINRETYLDRLALRFER--EGEPNRLAPVDVFVST  316

Query  941   VDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCK  1120
             VDPLKEPPIITANTVLSILAVDYPV+KVSCYVSDDGASMLLFD LA+TAEFARRWVPFCK
Sbjct  317   VDPLKEPPIITANTVLSILAVDYPVEKVSCYVSDDGASMLLFDALAKTAEFARRWVPFCK  376

Query  1121  KYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEG  1300
             KY +EPRAP+FYF+EKIDYLKDKVQPTFVK+RRAMKREYEE+KVR+NALVAKAQKKPEEG
Sbjct  377   KYNVEPRAPDFYFNEKIDYLKDKVQPTFVKDRRAMKREYEEFKVRINALVAKAQKKPEEG  436

Query  1301  WVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGA  1480
             WVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELP+LVYVSREKRPGYQH+KKAGA
Sbjct  437   WVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPRLVYVSREKRPGYQHNKKAGA  496

Query  1481  MNALVRVSAVLTNAPFMLNLDCDHY  1555
             MNALVRVSAVLTNAPFMLNLDCDHY
Sbjct  497   MNALVRVSAVLTNAPFMLNLDCDHY  521



>ref|XP_004247500.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
[Solanum lycopersicum]
Length=1048

 Score =   785 bits (2026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/513 (77%), Positives = 438/513 (85%), Gaps = 22/513 (4%)
 Frame = +2

Query  47    HLHAADHDER------REVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQY  208
             H+     D+R      +E     +K+C+ICRDEI V ENGEVFVAC ECGFPVC+PCY+Y
Sbjct  13    HVFHTGDDQRPPTETSKEFVVSLKKICKICRDEIEVKENGEVFVACGECGFPVCRPCYEY  72

Query  209   ERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLS----ENGDY  376
             ERSEGNQ CPHC+TRYKRHKGCPRVVGDDED    +  ++     +H   +    ENG+Y
Sbjct  73    ERSEGNQACPHCHTRYKRHKGCPRVVGDDEDDIHDDFEQEFQIKNHHTSPNHHQLENGEY  132

Query  377   HNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLV  556
             +      HNT  +AAF  +   GSV GK+LEDEQKE + +AEWK+RVEKWK RQEKRGLV
Sbjct  133   N------HNTNGAAAFNQSVI-GSVAGKELEDEQKESYGDAEWKERVEKWKNRQEKRGLV  185

Query  557   TRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRIL  736
                        +EDDD+L+A+ARQPLWRK+P+ SSLISPYRIVI+ RL+IL FFFHFRIL
Sbjct  186   NN---GGNDQPDEDDDYLLAEARQPLWRKIPLPSSLISPYRIVIILRLVILGFFFHFRIL  242

Query  737   TPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLA  916
             TPAYDA+PLW+ISVICEIWF LSWILDQFPKWSPINRETYLDRL+LRFERDGE  R  LA
Sbjct  243   TPAYDAYPLWIISVICEIWFALSWILDQFPKWSPINRETYLDRLTLRFERDGEPNR--LA  300

Query  917   PVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFA  1096
             PVDV+VSTVDPLKEPPIITANTVLSILAVDYPV+KVSCYVSDDGASMLLFD+LAETAEFA
Sbjct  301   PVDVFVSTVDPLKEPPIITANTVLSILAVDYPVEKVSCYVSDDGASMLLFDSLAETAEFA  360

Query  1097  RRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAK  1276
             RRWVPFCKKY +EPRAP+FYF+EKIDYLKDKVQPTFVK+RRAMKREYEE+KVR+NALVAK
Sbjct  361   RRWVPFCKKYSVEPRAPDFYFNEKIDYLKDKVQPTFVKDRRAMKREYEEFKVRINALVAK  420

Query  1277  AQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGY  1456
             AQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALD+EGKELP+LVYVSREKRPGY
Sbjct  421   AQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDIEGKELPRLVYVSREKRPGY  480

Query  1457  QHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             QHHKKAGAMNALVRV+AVLTNAPFMLNLDCDHY
Sbjct  481   QHHKKAGAMNALVRVAAVLTNAPFMLNLDCDHY  513



>ref|XP_006358416.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming]-like 
[Solanum tuberosum]
Length=1048

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/513 (77%), Positives = 434/513 (85%), Gaps = 22/513 (4%)
 Frame = +2

Query  47    HLHAADHDERREVERESQ------KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQY  208
             H+     D+R   E   +      K+C+ICRDEI V ENGEVFVAC ECGFPVC PCY+Y
Sbjct  13    HVFHTGDDQRPPTETSKEFVVSLKKICKICRDEIEVKENGEVFVACGECGFPVCMPCYEY  72

Query  209   ERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPP----LSENGDY  376
             ERSEGNQ CP C+TRYKRHKGCPRVVGDDED    +  ++     +H       SENG+ 
Sbjct  73    ERSEGNQACPQCHTRYKRHKGCPRVVGDDEDDIHDDFEQEFQIKNHHTSPNHHQSENGE-  131

Query  377   HNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLV  556
             HN     HNT  +AAF  +   GSV GK+LEDEQKE + +AEWK+RVEKWK RQEKRGLV
Sbjct  132   HN-----HNTNGAAAFNQSIV-GSVAGKELEDEQKESYGDAEWKERVEKWKNRQEKRGLV  185

Query  557   TRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRIL  736
                        +EDDDFL+A+ARQPLWRK+P+ SSLISPYRIVI+ RL+IL FFFHFRIL
Sbjct  186   NN---GGNDQPDEDDDFLLAEARQPLWRKVPLPSSLISPYRIVIILRLVILGFFFHFRIL  242

Query  737   TPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLA  916
             TPAYDA+PLW+ISVICEIWF LSWILDQFPKWSPINRETYLDRL+LRFER  EGE N LA
Sbjct  243   TPAYDAYPLWIISVICEIWFALSWILDQFPKWSPINRETYLDRLTLRFER--EGEPNRLA  300

Query  917   PVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFA  1096
             PVDV+VSTVDPLKEPPIITANTVLSILAVDYPV+KVSCYVSDDGASMLLFD+LAETAEFA
Sbjct  301   PVDVFVSTVDPLKEPPIITANTVLSILAVDYPVEKVSCYVSDDGASMLLFDSLAETAEFA  360

Query  1097  RRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAK  1276
             RRWVPFCKKY +EPRAP+ YF+EKIDYLKDKVQPTFVK+RRAMKREYEE+KVR+NALVAK
Sbjct  361   RRWVPFCKKYSVEPRAPDIYFNEKIDYLKDKVQPTFVKDRRAMKREYEEFKVRINALVAK  420

Query  1277  AQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGY  1456
             AQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALD+EGKELP+LVYVSREKRPGY
Sbjct  421   AQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDIEGKELPRLVYVSREKRPGY  480

Query  1457  QHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             QHHKKAGAMNALVRV+AVLTNAPFMLNLDCDHY
Sbjct  481   QHHKKAGAMNALVRVAAVLTNAPFMLNLDCDHY  513



>ref|XP_009370338.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
[Pyrus x bretschneideri]
Length=1054

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/531 (74%), Positives = 435/531 (82%), Gaps = 31/531 (6%)
 Frame = +2

Query  17    SMAALFTGGSHLHAADH-----DERREVERESQ---KMCRICRDEIGVVENGEVFVACRE  172
             +MA LFTG SH H   H     +E R   R+S    K+CR+C DEIG  E+GE+FVAC  
Sbjct  5     TMAGLFTG-SHAHDEHHVVHATEENRPSTRQSVSSIKVCRVCGDEIGYKEDGELFVACHV  63

Query  173   CGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNH-  349
             CGFPVC+PCY YERSEGNQCCP CNTRYKRHKGCPRV GD++D    +  ++     +H 
Sbjct  64    CGFPVCRPCYDYERSEGNQCCPQCNTRYKRHKGCPRVAGDEDDFDADDFDDEFQIKIDHY  123

Query  350   ---------PPLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAE  502
                         SENGD  N Q  H N       QP +  GSV GKD E E+ E+ SNAE
Sbjct  124   DDPAEQNHVVARSENGD-QNQQQWHRND------QPFSVGGSVVGKDFEGEKDEL-SNAE  175

Query  503   WKDRVEKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRI  682
             W+DRVEKWK RQ K+GLV++  D +      +DDFL+A+ARQPLWRK+PISSS ISPYRI
Sbjct  176   WEDRVEKWKVRQAKKGLVSK--DGENDDQGLEDDFLLAEARQPLWRKVPISSSKISPYRI  233

Query  683   VIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLD  862
             VIVFRL+IL FFFHFRILTPAYDAFPLW+ISVICEIWF  SWILDQFPKW+PINRETYLD
Sbjct  234   VIVFRLVILAFFFHFRILTPAYDAFPLWIISVICEIWFAFSWILDQFPKWNPINRETYLD  293

Query  863   RLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSD  1042
             RLS+RFER  EGE NTL+PVDVYVSTVDPLKEPPIITANTVLSILA+DYPVDK+ CYVSD
Sbjct  294   RLSIRFER--EGEPNTLSPVDVYVSTVDPLKEPPIITANTVLSILAIDYPVDKICCYVSD  351

Query  1043  DGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRA  1222
             DGASMLLFD L+ETAEFARRWVPFCKK+ IEPRAPEFYFS+KIDYLKDKV P FVKERRA
Sbjct  352   DGASMLLFDALSETAEFARRWVPFCKKHTIEPRAPEFYFSQKIDYLKDKVHPNFVKERRA  411

Query  1223  MKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVE  1402
             MKREYEE+KVR+NALV+KAQKKPEEGWVM DGTPWPGNNTRDHPGMIQVYLGSEGALDV+
Sbjct  412   MKREYEEFKVRINALVSKAQKKPEEGWVMPDGTPWPGNNTRDHPGMIQVYLGSEGALDVD  471

Query  1403  GKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             GKELP+LVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY
Sbjct  472   GKELPRLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  522



>emb|CDP03783.1| unnamed protein product [Coffea canephora]
Length=1057

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/531 (75%), Positives = 446/531 (84%), Gaps = 28/531 (5%)
 Frame = +2

Query  20    MAALFTGGSHL-HAADH-----DERREVERES---QKMCRICRDEIGVVENGEVFVACRE  172
             MAA    GSH  +  DH     ++ R   RES    K+CR+C DEIG+ ENGEVF AC E
Sbjct  1     MAAGLVTGSHARNEHDHVIHGMEDERPPTRESGNKTKICRVCGDEIGLKENGEVFAACHE  60

Query  173   CGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHP  352
             CGFPVC+PCY+YERS+G+QCCP C+ RYKRHKGCPRV GDDED+F+ +  ++    +NH 
Sbjct  61    CGFPVCRPCYEYERSDGDQCCPQCHARYKRHKGCPRVEGDDEDNFDDDFEDEFQ-LRNHH  119

Query  353   PLS--------ENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDL--EDEQKEVFSNAE  502
               S        ENG+Y++     H  TN AA    A    VGGK+   ED+QKE +S +E
Sbjct  120   DTSPDRRQRYWENGEYNH----QHLHTNGAAHHSVAG-SVVGGKEEGEEDDQKETYSTSE  174

Query  503   WKDRVEKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRI  682
             WK+RVEKWKTRQEKRGLVT+ DD      +EDD FL+A+ARQPLWRK+P+ SSL++PYRI
Sbjct  175   WKERVEKWKTRQEKRGLVTKLDDGGNDPGDEDD-FLIAEARQPLWRKVPVPSSLVNPYRI  233

Query  683   VIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLD  862
             VIV RL+ILCFFFHFRIL PAYDAFPLW+ISVICEIWFGLSWILDQFPKW PINRETYLD
Sbjct  234   VIVLRLVILCFFFHFRILAPAYDAFPLWIISVICEIWFGLSWILDQFPKWLPINRETYLD  293

Query  863   RLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSD  1042
             RLSLR+ER  EGE N L+PVDV+VSTVDPLKEPPIITANTVLSILAVDYPV+KVSCYVSD
Sbjct  294   RLSLRYER--EGEPNRLSPVDVFVSTVDPLKEPPIITANTVLSILAVDYPVEKVSCYVSD  351

Query  1043  DGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRA  1222
             DGA+MLLFDTL+ETAEFARRWVPFCKKY +EPRAPEFYFSEKIDYLKDKVQ TFVK+RRA
Sbjct  352   DGAAMLLFDTLSETAEFARRWVPFCKKYSVEPRAPEFYFSEKIDYLKDKVQHTFVKDRRA  411

Query  1223  MKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVE  1402
             MKREYEE+KV++NALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVE
Sbjct  412   MKREYEEFKVKINALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVE  471

Query  1403  GKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             GKELP+LVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY
Sbjct  472   GKELPRLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  522



>ref|XP_003533679.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming]-like 
[Glycine max]
 gb|KHN26614.1| Cellulose synthase A catalytic subunit 4 [UDP-forming] [Glycine 
soja]
Length=1050

 Score =   768 bits (1983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/525 (76%), Positives = 439/525 (84%), Gaps = 24/525 (5%)
 Frame = +2

Query  17    SMAALFTGGSHLHAADHDERRE---VERESQKMCRICRDEIGVVENGEVFVACRECGFPV  187
             SMA L TG +   + D DE +     +  S+  CR+C DEIG  ENGE+FVAC  CGFPV
Sbjct  5     SMAGLITGSNSHFSRDSDEHQTPPTRQASSKTTCRVCGDEIGYKENGELFVACHVCGFPV  64

Query  188   CKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPP----  355
             C+PCY+YERSEGNQ CP CNTRYKRHKGCPRV GD+ED+F+ +DF+ EF  KNH      
Sbjct  65    CRPCYEYERSEGNQSCPQCNTRYKRHKGCPRVAGDEEDNFDADDFDDEFPVKNHREDLDR  124

Query  356   -----LSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVE  520
                    ENGDY+  +L H N       Q  ++ GSV GKD E + KE +SNAEW++RVE
Sbjct  125   NHDVNHVENGDYNPEKL-HPNG------QAFSSAGSVAGKDFEGD-KEFYSNAEWQERVE  176

Query  521   KWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRL  700
             KWK RQEKRGL+ +  +D      E+DD+L+A+ARQPLWRK+PISSSLI+PYRIVIV RL
Sbjct  177   KWKVRQEKRGLLNK--EDGKEDQGEEDDYLLAEARQPLWRKVPISSSLINPYRIVIVMRL  234

Query  701   IILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRF  880
             +ILCFFF FRILTPA DA+PLWLISVICEIWF LSWILDQFPKW PI RETYLDRLSLRF
Sbjct  235   VILCFFFRFRILTPANDAYPLWLISVICEIWFALSWILDQFPKWFPITRETYLDRLSLRF  294

Query  881   ERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASML  1060
             ER  EGE N LAPVD +VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASML
Sbjct  295   ER--EGETNELAPVDFFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASML  352

Query  1061  LFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYE  1240
             LFD+LAETAEFARRWVPFCKKY IEPRAPEFYFS+KIDYLKDKVQPTFVKERRAMKREYE
Sbjct  353   LFDSLAETAEFARRWVPFCKKYNIEPRAPEFYFSQKIDYLKDKVQPTFVKERRAMKREYE  412

Query  1241  EYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPK  1420
             E+KV++N+LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS GALDVEGKELPK
Sbjct  413   EFKVKINSLVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSAGALDVEGKELPK  472

Query  1421  LVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             LVY+SREKRPGY HHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY
Sbjct  473   LVYISREKRPGYPHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  517



>emb|CBI37171.3| unnamed protein product [Vitis vinifera]
Length=1000

 Score =   765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/522 (75%), Positives = 437/522 (84%), Gaps = 24/522 (5%)
 Frame = +2

Query  20    MAALFTGG---SHLHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVC  190
             MA L  G    + +H    ++R    +   K+CR+C DEIGV  +GE+FVAC ECGFPVC
Sbjct  1     MAGLVAGSHTRNEMHVLHGEQRPPTRQSVPKLCRVCGDEIGVKADGELFVACHECGFPVC  60

Query  191   KPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKN-------H  349
             KPCY+YERSEGNQCCP CNTRYKRHKGC RV GDDE   +G+DF  EF+ KN        
Sbjct  61    KPCYEYERSEGNQCCPQCNTRYKRHKGCARVAGDDEGSLDGDDFNDEFQIKNTRDQQNVF  120

Query  350   PPLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWK  529
              P SENGDY+    P     N  AF   +A GSV GKD E E K++++N EWKDRVEKWK
Sbjct  121   AP-SENGDYN----PQQWHANGQAF---SAAGSVAGKDFEGE-KDIYNNDEWKDRVEKWK  171

Query  530   TRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIIL  709
             TRQEK+GL+++   D G    +DDDFL+A+ARQPLWRK+PI+SS ISPYRIVIV RL+IL
Sbjct  172   TRQEKKGLISK---DGGNDPGDDDDFLLAEARQPLWRKVPIASSKISPYRIVIVLRLVIL  228

Query  710   CFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERD  889
              FFF FRILTPAYDAFPLWLISVICEIWF  SWILDQFPKW PINRETYL+RLS+RFER 
Sbjct  229   AFFFRFRILTPAYDAFPLWLISVICEIWFAFSWILDQFPKWQPINRETYLERLSMRFER-  287

Query  890   GEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFD  1069
              EGE N L+PVDV+VSTVDPLKEPPIITANTVLSIL++DYPV+KVSCYVSDDGASMLLFD
Sbjct  288   -EGEPNRLSPVDVFVSTVDPLKEPPIITANTVLSILSLDYPVEKVSCYVSDDGASMLLFD  346

Query  1070  TLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYK  1249
             +LAETAEFARRWVPFCKK+ IEPRAPEFYFS+KIDYLKDKV P+FVKERRAMKREYEE+K
Sbjct  347   SLAETAEFARRWVPFCKKHSIEPRAPEFYFSQKIDYLKDKVDPSFVKERRAMKREYEEFK  406

Query  1250  VRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVY  1429
             VR+NALVAKAQKKPEEGW MQDGTPWPGN TRDHPGMIQVYLGSEGALDVEGKELP+LVY
Sbjct  407   VRINALVAKAQKKPEEGWTMQDGTPWPGNITRDHPGMIQVYLGSEGALDVEGKELPRLVY  466

Query  1430  VSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             VSREKRPGYQHHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  467   VSREKRPGYQHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  508



>ref|XP_002273521.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
[Vitis vinifera]
Length=1044

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/523 (75%), Positives = 438/523 (84%), Gaps = 24/523 (5%)
 Frame = +2

Query  17    SMAALFTGG---SHLHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPV  187
             +MA L  G    + +H    ++R    +   K+CR+C DEIGV  +GE+FVAC ECGFPV
Sbjct  5     TMAGLVAGSHTRNEMHVLHGEQRPPTRQSVPKLCRVCGDEIGVKADGELFVACHECGFPV  64

Query  188   CKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKN-------  346
             CKPCY+YERSEGNQCCP CNTRYKRHKGC RV GDDE   +G+DF  EF+ KN       
Sbjct  65    CKPCYEYERSEGNQCCPQCNTRYKRHKGCARVAGDDEGSLDGDDFNDEFQIKNTRDQQNV  124

Query  347   HPPLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKW  526
               P SENGDY+    P     N  AF   +A GSV GKD E E K++++N EWKDRVEKW
Sbjct  125   FAP-SENGDYN----PQQWHANGQAF---SAAGSVAGKDFEGE-KDIYNNDEWKDRVEKW  175

Query  527   KTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLII  706
             KTRQEK+GL+++   D G    +DDDFL+A+ARQPLWRK+PI+SS ISPYRIVIV RL+I
Sbjct  176   KTRQEKKGLISK---DGGNDPGDDDDFLLAEARQPLWRKVPIASSKISPYRIVIVLRLVI  232

Query  707   LCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFER  886
             L FFF FRILTPAYDAFPLWLISVICEIWF  SWILDQFPKW PINRETYL+RLS+RFER
Sbjct  233   LAFFFRFRILTPAYDAFPLWLISVICEIWFAFSWILDQFPKWQPINRETYLERLSMRFER  292

Query  887   DGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLF  1066
               EGE N L+PVDV+VSTVDPLKEPPIITANTVLSIL++DYPV+KVSCYVSDDGASMLLF
Sbjct  293   --EGEPNRLSPVDVFVSTVDPLKEPPIITANTVLSILSLDYPVEKVSCYVSDDGASMLLF  350

Query  1067  DTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEY  1246
             D+LAETAEFARRWVPFCKK+ IEPRAPEFYFS+KIDYLKDKV P+FVKERRAMKREYEE+
Sbjct  351   DSLAETAEFARRWVPFCKKHSIEPRAPEFYFSQKIDYLKDKVDPSFVKERRAMKREYEEF  410

Query  1247  KVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLV  1426
             KVR+NALVAKAQKKPEEGW MQDGTPWPGN TRDHPGMIQVYLGSEGALDVEGKELP+LV
Sbjct  411   KVRINALVAKAQKKPEEGWTMQDGTPWPGNITRDHPGMIQVYLGSEGALDVEGKELPRLV  470

Query  1427  YVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             YVSREKRPGYQHHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  471   YVSREKRPGYQHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  513



>ref|XP_008339052.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
isoform X1 [Malus domestica]
Length=1054

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/531 (74%), Positives = 433/531 (82%), Gaps = 31/531 (6%)
 Frame = +2

Query  17    SMAALFTGGSHLHAADHD-----ERREVERESQ---KMCRICRDEIGVVENGEVFVACRE  172
             +M  LFTG SH     HD     E     R+S    K+CR+C DEIG  E GE+FVAC  
Sbjct  5     TMGGLFTG-SHARDELHDVHDTEENXPSTRQSMSSIKVCRVCGDEIGYKEGGELFVACHV  63

Query  173   CGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNH-  349
             CGFPVC+PCY YERSEGNQCCP CNTRYKRHKGCPRV GD++D    +  ++     +H 
Sbjct  64    CGFPVCRPCYDYERSEGNQCCPQCNTRYKRHKGCPRVAGDEDDFDADDFDDEFQIKIDHH  123

Query  350   ---------PPLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAE  502
                         SENGD  N Q  H N       QP +  GSV GKD E E+ E+ SNAE
Sbjct  124   DDPAEQNHVVARSENGD-QNQQQWHRND------QPFSVGGSVVGKDFEGEKDEL-SNAE  175

Query  503   WKDRVEKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRI  682
             WKDRVEKWK RQ K+GLV++  DD+      +DDFL+A+ARQPLWRK+PISSS ISPYRI
Sbjct  176   WKDRVEKWKVRQAKKGLVSK--DDENDDQGLEDDFLLAEARQPLWRKVPISSSKISPYRI  233

Query  683   VIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLD  862
             VIV RL+IL FFFHFRILTPAYDAFPLW+ISVICEIWFG SWILDQFPKW+PINRETYLD
Sbjct  234   VIVCRLVILAFFFHFRILTPAYDAFPLWIISVICEIWFGFSWILDQFPKWNPINRETYLD  293

Query  863   RLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSD  1042
             RLS+RFER  EGE NTL+PVDVYVSTVDPLKEPPIITANTVLSILA+DYPVDK+ CYVSD
Sbjct  294   RLSIRFER--EGEPNTLSPVDVYVSTVDPLKEPPIITANTVLSILAIDYPVDKICCYVSD  351

Query  1043  DGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRA  1222
             DGASMLLFD L+ETAEFARRWVPFCKK+ IEPRAPEFYFS+KIDYLKDKV P FVKERRA
Sbjct  352   DGASMLLFDALSETAEFARRWVPFCKKHTIEPRAPEFYFSQKIDYLKDKVHPNFVKERRA  411

Query  1223  MKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVE  1402
             MKREYEE+KVR+NALV+KAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDV+
Sbjct  412   MKREYEEFKVRINALVSKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVD  471

Query  1403  GKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             GKELP+LVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY
Sbjct  472   GKELPRLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  522



>ref|XP_004487957.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming]-like 
[Cicer arietinum]
Length=1018

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/515 (77%), Positives = 434/515 (84%), Gaps = 19/515 (4%)
 Frame = +2

Query  17    SMAALFTGGSHLHAADHDERR--EVERESQKMCRICRDEIGVVENGEVFVACRECGFPVC  190
             +MA L TG +   + D DE +     + S K CR+C DEIG  ENGE+FVAC  CGFPVC
Sbjct  5     TMAGLITGSNSHFSHDSDEHKAPTGRQSSLKTCRVCGDEIGYKENGELFVACHVCGFPVC  64

Query  191   KPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSENG  370
             KPCY+YERSEGNQCCP CNTRYKRHKGCPRVVGD+E++ +G+DFE EF  KNH       
Sbjct  65    KPCYEYERSEGNQCCPQCNTRYKRHKGCPRVVGDEEENLDGDDFEDEFPIKNH-------  117

Query  371   DYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRG  550
                 ++L  H   N          GSVGGKDLE E KE +SNAEWK+RVEKWK RQEKRG
Sbjct  118   ---YDELDQHRDVNHLE---NGESGSVGGKDLEGE-KEFYSNAEWKERVEKWKVRQEKRG  170

Query  551   LVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFR  730
             L+ + +D K     E+D++LMA+ARQPLWRK+PI SSLI+PYRIVIV RL+IL FFF FR
Sbjct  171   LLNK-EDGKEDQGEEEDEYLMAEARQPLWRKVPIPSSLINPYRIVIVMRLVILAFFFRFR  229

Query  731   ILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNT  910
             ILTPAYDA+PLWLISVICEIWF LSWILDQFPKW PI RETYLDRLS+RFER  EGE N 
Sbjct  230   ILTPAYDAYPLWLISVICEIWFALSWILDQFPKWFPITRETYLDRLSIRFER--EGEPNQ  287

Query  911   LAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAE  1090
             LA VDV+VSTVDPLKEPPIITANTVLSIL+VDYPV+KVSCYVSDDGASMLLFD+LAET+E
Sbjct  288   LANVDVFVSTVDPLKEPPIITANTVLSILSVDYPVEKVSCYVSDDGASMLLFDSLAETSE  347

Query  1091  FARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALV  1270
             FARRWVPFCKKY IEPRAPE+YFSEKIDYLKDKVQPTFVKERRAMKREYEE+KV++NALV
Sbjct  348   FARRWVPFCKKYSIEPRAPEYYFSEKIDYLKDKVQPTFVKERRAMKREYEEFKVKINALV  407

Query  1271  AKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRP  1450
             AKA KKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS GALDVEGKELPKLVY+SREKRP
Sbjct  408   AKALKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSAGALDVEGKELPKLVYISREKRP  467

Query  1451  GYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             GY HHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY
Sbjct  468   GYPHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  502



>ref|XP_008348984.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming]-like 
[Malus domestica]
Length=1054

 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/531 (74%), Positives = 431/531 (81%), Gaps = 31/531 (6%)
 Frame = +2

Query  17    SMAALFTGGSH-------LHAADHDER-REVERESQKMCRICRDEIGVVENGEVFVACRE  172
             +MA  FTG SH       +HA++ D         S K+CR+C DEIG  E+GE+FVAC  
Sbjct  5     TMAGFFTG-SHARDELNVVHASEEDRPPTRQSASSTKVCRVCGDEIGYKEDGELFVACHV  63

Query  173   CGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNH-  349
             CGFPVC+PCY YERSEGNQCCP CNTRYKRHKGCPRV GD++D    +  ++     +H 
Sbjct  64    CGFPVCRPCYDYERSEGNQCCPQCNTRYKRHKGCPRVAGDEDDFDADDFDDEFQIKIDHH  123

Query  350   ---------PPLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAE  502
                         SENGD HN Q  H N       QP +  GSV GKD E E K+V S AE
Sbjct  124   DDPAEQNHVIARSENGD-HNQQQWHRND------QPFSVGGSVAGKDFEGE-KDVLSTAE  175

Query  503   WKDRVEKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRI  682
             WKDRVEKWK RQEK+GLV++  D        +DDFL+A+ARQPLWRK+PISSS ISPYRI
Sbjct  176   WKDRVEKWKVRQEKKGLVSK--DGGNDEQGLEDDFLLAEARQPLWRKVPISSSKISPYRI  233

Query  683   VIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLD  862
             VIV RL+IL FFF FRILTPAYDA+PLWLISVICEIWF  SWILDQFPKW+PINRETYLD
Sbjct  234   VIVLRLVILAFFFRFRILTPAYDAYPLWLISVICEIWFAFSWILDQFPKWNPINRETYLD  293

Query  863   RLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSD  1042
             RLS+RFER  EGE NTL+PVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDK+ CYVSD
Sbjct  294   RLSIRFER--EGEPNTLSPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKICCYVSD  351

Query  1043  DGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRA  1222
             DGASMLLFD L+ETAEFARRWVPFCKK+ IEPRAPEFYFS+KIDYLKDKV P FVKERRA
Sbjct  352   DGASMLLFDALSETAEFARRWVPFCKKHTIEPRAPEFYFSQKIDYLKDKVHPNFVKERRA  411

Query  1223  MKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVE  1402
             MKREYEE+KVR+NALV+KA KKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDV+
Sbjct  412   MKREYEEFKVRINALVSKALKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVD  471

Query  1403  GKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             GKELP+LVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY
Sbjct  472   GKELPRLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  522



>ref|XP_010262430.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
[Nelumbo nucifera]
Length=1045

 Score =   764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/526 (75%), Positives = 437/526 (83%), Gaps = 26/526 (5%)
 Frame = +2

Query  20    MAALFTGGS-----HLHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFP  184
             M  L  G       H+     + R  + +   K+CR+C DEIG+ ENGE+FVAC ECGFP
Sbjct  1     MTGLIAGSHQRNELHVMHGVEEPRPAIRQSVSKICRVCGDEIGLKENGELFVACHECGFP  60

Query  185   VCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPL--  358
             VC+PCY+YERSEG+QCCP CNTRYKRHKGCPRVVGDDE + + +DFE EF+ KN+     
Sbjct  61    VCRPCYEYERSEGSQCCPQCNTRYKRHKGCPRVVGDDESNGDADDFEDEFQIKNNRDTPD  120

Query  359   -------SENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRV  517
                    SENGDY+    P     N   F   A  GSV GKD E E+   F+NAEWK+RV
Sbjct  121   RHHVVNPSENGDYN----PQQWQPNGQGFSSIA--GSVVGKDFEGEKD--FNNAEWKERV  172

Query  518   EKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFR  697
             +KWK +QEKRGLV++  DD G   +++DD LMA+ARQPLWRK+PI SS ISPYRIVIV R
Sbjct  173   DKWKAKQEKRGLVSK--DDGGNDKDDEDDILMAEARQPLWRKVPIPSSKISPYRIVIVLR  230

Query  698   LIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLR  877
             LI+LCFF  FRILTPA DA+PLWLISVICEIWF LSWILDQFPKW PI RETYLDRLSLR
Sbjct  231   LIVLCFFLRFRILTPANDAYPLWLISVICEIWFALSWILDQFPKWFPITRETYLDRLSLR  290

Query  878   FERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASM  1057
             FER  EGE N LAPVDV+VSTVDPLKEPPIITANTVLSIL+VDYPV+KVSCYVSDDGASM
Sbjct  291   FER--EGEPNRLAPVDVFVSTVDPLKEPPIITANTVLSILSVDYPVEKVSCYVSDDGASM  348

Query  1058  LLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREY  1237
             LLFDTL+ETAEFARRWVPFCKKY IEPRAPEFYFS+KIDYLKDKVQPTFVKERRAMKREY
Sbjct  349   LLFDTLSETAEFARRWVPFCKKYNIEPRAPEFYFSQKIDYLKDKVQPTFVKERRAMKREY  408

Query  1238  EEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELP  1417
             EE+KVR+NALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS+GALDVEGKELP
Sbjct  409   EEFKVRINALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSQGALDVEGKELP  468

Query  1418  KLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             +LVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY
Sbjct  469   RLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  514



>gb|AGW52058.1| cellulose synthase 4 [Populus tomentosa]
Length=1042

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/517 (75%), Positives = 433/517 (84%), Gaps = 10/517 (2%)
 Frame = +2

Query  20    MAALFTGGSH-LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             MA L TG S  LHA D       +  + K CR+C DEIGV E+GEVFVAC  CGFPVC+P
Sbjct  1     MAGLVTGSSQTLHAKDELRPPTRQSATSKKCRVCGDEIGVKEDGEVFVACHVCGFPVCRP  60

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedf---eqefeTKNHPPLSEN  367
             CY+YERSEGNQ CP CNTRYKRHKGCPRV GD++D     D    E + +  +H   ++ 
Sbjct  61    CYEYERSEGNQSCPQCNTRYKRHKGCPRVPGDNDDEDANFDDFDDEFQIKNHDHDESNQK  120

Query  368   GDYHNNQLPHHNTTNSAAFQPT-AAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEK  544
               + + ++ H+N       +P  ++ GSV GKDLE E KE +SNAEW++RVEKWK RQEK
Sbjct  121   NVFSHTEIEHYNEQEMHPIRPAFSSAGSVAGKDLEGE-KEGYSNAEWQERVEKWKVRQEK  179

Query  545   RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFH  724
             RGLV++  DD G    E+D++LMA+ARQPLWRK+PI SS I+PYRIVIV RLIILCFFF 
Sbjct  180   RGLVSK--DDGGNDQGEEDEYLMAEARQPLWRKIPIPSSRINPYRIVIVLRLIILCFFFR  237

Query  725   FRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGER  904
             FRILTPAYDA+ LWLISVICE+WFGLSWILDQFPKW+PI RETYLDRLS+RFER  EGE 
Sbjct  238   FRILTPAYDAYALWLISVICEVWFGLSWILDQFPKWNPIERETYLDRLSMRFER--EGEP  295

Query  905   NTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAET  1084
             N L PVDV+VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASMLLFD+LAET
Sbjct  296   NRLGPVDVFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASMLLFDSLAET  355

Query  1085  AEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNA  1264
             AEFARRWVPFCKK+ IEPRAPEFYF++KIDYLKDKV P FVKERRAMKREYEE+KVR+NA
Sbjct  356   AEFARRWVPFCKKHNIEPRAPEFYFTQKIDYLKDKVHPNFVKERRAMKREYEEFKVRINA  415

Query  1265  LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREK  1444
             LV+KAQKKPEEGWVMQDGTPWPGN TRDHPGMIQVYLGSEGALDVEGKELP+LVYVSREK
Sbjct  416   LVSKAQKKPEEGWVMQDGTPWPGNITRDHPGMIQVYLGSEGALDVEGKELPRLVYVSREK  475

Query  1445  RPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             RPGY HHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  476   RPGYNHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  512



>gb|AGW52077.1| cellulose synthase 4 [Populus tomentosa]
Length=1042

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/517 (75%), Positives = 433/517 (84%), Gaps = 10/517 (2%)
 Frame = +2

Query  20    MAALFTGGSH-LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             MA L TG S  LHA D       +  + K CR+C DEIGV E+GEVFVAC  CGFPVC+P
Sbjct  1     MAGLVTGSSQTLHAKDELRPPTRQSATSKKCRVCGDEIGVKEDGEVFVACHVCGFPVCRP  60

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedf---eqefeTKNHPPLSEN  367
             CY+YERSEGNQ CP CNTRYKRHKGCPRV GD++D     D    E + +  +H   ++ 
Sbjct  61    CYEYERSEGNQSCPQCNTRYKRHKGCPRVPGDNDDEDANFDDFDDEFQIKNHDHDESNQK  120

Query  368   GDYHNNQLPHHNTTNSAAFQPT-AAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEK  544
               + + ++ H+N       +P  ++ GSV GKDLE E KE +SNAEW++RVEKWK RQEK
Sbjct  121   NVFSHTEIEHYNEQEMHPIRPAFSSAGSVAGKDLEGE-KEGYSNAEWQERVEKWKVRQEK  179

Query  545   RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFH  724
             RGLV++  DD G    E+D++LMA+ARQPLWRK+PI SS I+PYRIVIV RLIILCFFF 
Sbjct  180   RGLVSK--DDGGNDQGEEDEYLMAEARQPLWRKIPIPSSRINPYRIVIVLRLIILCFFFR  237

Query  725   FRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGER  904
             FRILTPAYDA+ LWLISVICE+WFGLSWILDQFPKW+PI RETYLDRLS+RFER  EGE 
Sbjct  238   FRILTPAYDAYALWLISVICEVWFGLSWILDQFPKWNPIERETYLDRLSMRFER--EGEP  295

Query  905   NTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAET  1084
             N L PVDV+VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASMLLFD+LAET
Sbjct  296   NRLGPVDVFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASMLLFDSLAET  355

Query  1085  AEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNA  1264
             AEFARRWVPFCKK+ IEPRAPEFYF++KIDYLKDKV P FVKERRAMKREYEE+KVR+NA
Sbjct  356   AEFARRWVPFCKKHNIEPRAPEFYFTQKIDYLKDKVHPNFVKERRAMKREYEEFKVRINA  415

Query  1265  LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREK  1444
             LV+KAQKKPEEGWVMQDGTPWPGN TRDHPGMIQVYLGSEGALDVEGKELP+LVYVSREK
Sbjct  416   LVSKAQKKPEEGWVMQDGTPWPGNITRDHPGMIQVYLGSEGALDVEGKELPRLVYVSREK  475

Query  1445  RPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             RPGY HHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  476   RPGYNHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  512



>ref|XP_004289981.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming]-like 
[Fragaria vesca subsp. vesca]
Length=1058

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/533 (74%), Positives = 428/533 (80%), Gaps = 33/533 (6%)
 Frame = +2

Query  17    SMAALFTGGSH-----LHA--ADHDERREVERESQKMCRICRDEIGVVENGEVFVACREC  175
             SMA L+TG  +     LHA  A  +      +   K+CR+C D+IG  E GE+FVAC  C
Sbjct  5     SMAGLYTGSHNQGEDELHALRATEENLPPTRQSVSKVCRVCGDDIGFKEGGELFVACHVC  64

Query  176   GFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPP  355
             GFPVC+PCY YERSEGNQCCP CNTRYKRHKGCPRV GDDED    +  E+    KNH  
Sbjct  65    GFPVCRPCYDYERSEGNQCCPQCNTRYKRHKGCPRVAGDDEDFDADDFDEEFQIVKNHND  124

Query  356   L-------------SENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSN  496
                           SENGD HN Q    N       QP +  GSV  KD E + KE   +
Sbjct  125   HDSSEEKNHAIDVPSENGD-HNQQKWQTNN------QPFSVQGSV--KDFEGD-KEALGS  174

Query  497   AEWKDRVEKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPY  676
             AEWKDRVEKWK RQEKRGLV ++D +      EDD FLMA+ARQPLWRK+PI+SS ISPY
Sbjct  175   AEWKDRVEKWKVRQEKRGLVNKYDGNDDDQGLEDD-FLMAEARQPLWRKVPIASSKISPY  233

Query  677   RIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETY  856
             RIVIV RL+IL FFFHFRILTPAYDAFPLWLISVICEIWF LSWILDQFPKW PINRETY
Sbjct  234   RIVIVMRLVILAFFFHFRILTPAYDAFPLWLISVICEIWFALSWILDQFPKWQPINRETY  293

Query  857   LDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYV  1036
             LDRLSLRFER  EGE NTLAPVDVYVS+VDPLKEPPIITANTVLSILAVDYPVDKV CYV
Sbjct  294   LDRLSLRFER--EGEPNTLAPVDVYVSSVDPLKEPPIITANTVLSILAVDYPVDKVCCYV  351

Query  1037  SDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKER  1216
             SDDGASMLLFD L+ETAEFARRWVPFCKK+ IEPRAPEFYFS+KIDYLKDKV P FVKER
Sbjct  352   SDDGASMLLFDALSETAEFARRWVPFCKKHTIEPRAPEFYFSQKIDYLKDKVHPNFVKER  411

Query  1217  RAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALD  1396
             RAMKREYEE+KVR+NALVA A KKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALD
Sbjct  412   RAMKREYEEFKVRINALVANALKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALD  471

Query  1397  VEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             V+GKELP+LVYVSREKRPGYQHHKKAGAMNA+VRVSAVL+NAPFMLNLDCDHY
Sbjct  472   VDGKELPRLVYVSREKRPGYQHHKKAGAMNAMVRVSAVLSNAPFMLNLDCDHY  524



>ref|XP_002301856.1| hypothetical protein POPTR_0002s25970g [Populus trichocarpa]
 gb|EEE81129.1| hypothetical protein POPTR_0002s25970g [Populus trichocarpa]
Length=1042

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/517 (75%), Positives = 431/517 (83%), Gaps = 10/517 (2%)
 Frame = +2

Query  20    MAALFTGGSH-LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             MA L TG S  LHA D       +  + K CR+C DEIGV E+GEVFVAC  CGFPVC+P
Sbjct  1     MAGLVTGSSQTLHAKDELRPPTRQSATSKKCRVCGDEIGVKEDGEVFVACHVCGFPVCRP  60

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSENGD-  373
             CY+YERSEGNQ CP CNTRYKRHKGCPRV GD++D     D  ++     H    E+   
Sbjct  61    CYEYERSEGNQSCPQCNTRYKRHKGCPRVPGDNDDEDANFDDFEDEFQIKHHDHDESNQK  120

Query  374   --YHNNQLPHHNTTNSAAFQPT-AAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEK  544
               + + ++ H+N       +P  ++ GSV GKDLE E KE +SNAEW++RVEKWK RQEK
Sbjct  121   NVFSHTEIEHYNEQEMQPIRPAFSSAGSVAGKDLEGE-KEGYSNAEWQERVEKWKVRQEK  179

Query  545   RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFH  724
             RGLV++  DD G    E+D++LMA+ARQPLWRK+PI SS I+PYRIVIV RLIILCFFF 
Sbjct  180   RGLVSK--DDGGNDQGEEDEYLMAEARQPLWRKIPIPSSRINPYRIVIVLRLIILCFFFR  237

Query  725   FRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGER  904
             FRILTPAYDA+ LWLISVICE+WFGLSWILDQFPKW+PI RETYLDRLS+RFER  EGE 
Sbjct  238   FRILTPAYDAYALWLISVICEVWFGLSWILDQFPKWNPIERETYLDRLSMRFER--EGEP  295

Query  905   NTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAET  1084
             N L PVDV+VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASMLLFD+LAET
Sbjct  296   NRLGPVDVFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASMLLFDSLAET  355

Query  1085  AEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNA  1264
             AEFARRWVPFCKK+ IEPRAPEFYF++KIDYLKDKV P FVKERRAMKREYEE+KVR+NA
Sbjct  356   AEFARRWVPFCKKHNIEPRAPEFYFTQKIDYLKDKVHPNFVKERRAMKREYEEFKVRINA  415

Query  1265  LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREK  1444
             LV+KAQKKPEEGWVMQDGTPWPGN TRDHPGMIQVYLGSEGALDVEGKELP+LVYVSREK
Sbjct  416   LVSKAQKKPEEGWVMQDGTPWPGNITRDHPGMIQVYLGSEGALDVEGKELPRLVYVSREK  475

Query  1445  RPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             RPGY HHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  476   RPGYNHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  512



>gb|AGW52051.1| cellulose synthase 4 [Populus tomentosa]
 gb|AGW52054.1| cellulose synthase 4 [Populus tomentosa]
 gb|AGW52079.1| cellulose synthase 4 [Populus tomentosa]
Length=1042

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/517 (75%), Positives = 430/517 (83%), Gaps = 10/517 (2%)
 Frame = +2

Query  20    MAALFTGGSH-LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             MA L TG S  LHA D       +  + K CR+C DEIGV E+GEVFVAC  CGFPVC+P
Sbjct  1     MAGLVTGSSQTLHAKDELRPPTRQSATSKKCRVCGDEIGVKEDGEVFVACHVCGFPVCRP  60

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSENGD-  373
             CY+YERSEGNQ CP CNTRYKRHKGCPRV GD++D     D   +     H    E+   
Sbjct  61    CYEYERSEGNQSCPQCNTRYKRHKGCPRVPGDNDDEDANFDDFDDEFQIKHHDHDESNQK  120

Query  374   --YHNNQLPHHNTTNSAAFQPT-AAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEK  544
               + + ++ H+N       +P  ++ GSV GKDLE E KE +SNAEW++RVEKWK RQEK
Sbjct  121   NVFSHTEIEHYNEQEMHPIRPAFSSAGSVAGKDLEGE-KEGYSNAEWQERVEKWKVRQEK  179

Query  545   RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFH  724
             RGLV++  DD G    E+D++LMA+ARQPLWRK+PI SS I+PYRIVIV RLIILCFFF 
Sbjct  180   RGLVSK--DDGGNDQGEEDEYLMAEARQPLWRKIPIPSSRINPYRIVIVLRLIILCFFFR  237

Query  725   FRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGER  904
             FRILTPAYDA+ LWLISVICE+WFGLSWILDQFPKW+PI RETYLDRLS+RFER  EGE 
Sbjct  238   FRILTPAYDAYALWLISVICEVWFGLSWILDQFPKWNPIERETYLDRLSMRFER--EGEP  295

Query  905   NTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAET  1084
             N L PVDV+VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASMLLFD+LAET
Sbjct  296   NRLGPVDVFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASMLLFDSLAET  355

Query  1085  AEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNA  1264
             AEFARRWVPFCKK+ IEPRAPEFYF++KIDYLKDKV P FVKERRAMKREYEE+KVR+NA
Sbjct  356   AEFARRWVPFCKKHNIEPRAPEFYFTQKIDYLKDKVHPNFVKERRAMKREYEEFKVRINA  415

Query  1265  LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREK  1444
             LV+KAQKKPEEGWVMQDGTPWPGN TRDHPGMIQVYLGSEGALDVEGKELP+LVYVSREK
Sbjct  416   LVSKAQKKPEEGWVMQDGTPWPGNITRDHPGMIQVYLGSEGALDVEGKELPRLVYVSREK  475

Query  1445  RPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             RPGY HHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  476   RPGYNHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  512



>gb|AGW52040.1| cellulose synthase 4 [Populus tomentosa]
 gb|AGW52055.1| cellulose synthase 4 [Populus tomentosa]
 gb|AGW52056.1| cellulose synthase 4 [Populus tomentosa]
 gb|AGW52069.1| cellulose synthase 4 [Populus tomentosa]
 gb|AGW52075.1| cellulose synthase 4 [Populus tomentosa]
 gb|AGW52076.1| cellulose synthase 4 [Populus tomentosa]
Length=1042

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/517 (75%), Positives = 430/517 (83%), Gaps = 10/517 (2%)
 Frame = +2

Query  20    MAALFTGGSH-LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             MA L TG S  LHA D       +  + K CR+C DEIGV E+GEVFVAC  CGFPVC+P
Sbjct  1     MAGLVTGSSQTLHAKDELRPPTRQSATSKKCRVCGDEIGVKEDGEVFVACHVCGFPVCRP  60

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSENGD-  373
             CY+YERSEGNQ CP CNTRYKRHKGCPRV GD++D     D   +     H    E+   
Sbjct  61    CYEYERSEGNQSCPQCNTRYKRHKGCPRVPGDNDDEDANFDDFDDEFQIKHHDHDESNQK  120

Query  374   --YHNNQLPHHNTTNSAAFQPT-AAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEK  544
               + + ++ H+N       +P  ++ GSV GKDLE E KE +SNAEW++RVEKWK RQEK
Sbjct  121   NVFSHTEIEHYNEQEMHPIRPAFSSAGSVAGKDLEGE-KEGYSNAEWQERVEKWKVRQEK  179

Query  545   RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFH  724
             RGLV++  DD G    E+D++LMA+ARQPLWRK+PI SS I+PYRIVIV RLIILCFFF 
Sbjct  180   RGLVSK--DDGGNDQGEEDEYLMAEARQPLWRKIPIPSSRINPYRIVIVLRLIILCFFFR  237

Query  725   FRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGER  904
             FRILTPAYDA+ LWLISVICE+WFGLSWILDQFPKW+PI RETYLDRLS+RFER  EGE 
Sbjct  238   FRILTPAYDAYALWLISVICEVWFGLSWILDQFPKWNPIERETYLDRLSMRFER--EGEP  295

Query  905   NTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAET  1084
             N L PVDV+VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASMLLFD+LAET
Sbjct  296   NRLGPVDVFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASMLLFDSLAET  355

Query  1085  AEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNA  1264
             AEFARRWVPFCKK+ IEPRAPEFYF++KIDYLKDKV P FVKERRAMKREYEE+KVR+NA
Sbjct  356   AEFARRWVPFCKKHNIEPRAPEFYFTQKIDYLKDKVHPNFVKERRAMKREYEEFKVRINA  415

Query  1265  LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREK  1444
             LV+KAQKKPEEGWVMQDGTPWPGN TRDHPGMIQVYLGSEGALDVEGKELP+LVYVSREK
Sbjct  416   LVSKAQKKPEEGWVMQDGTPWPGNITRDHPGMIQVYLGSEGALDVEGKELPRLVYVSREK  475

Query  1445  RPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             RPGY HHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  476   RPGYNHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  512



>gb|AGW52078.1| cellulose synthase 4 [Populus tomentosa]
Length=1042

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/517 (75%), Positives = 430/517 (83%), Gaps = 10/517 (2%)
 Frame = +2

Query  20    MAALFTGGSH-LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             MA L TG S  LHA D       +  + K CR+C DEIGV E+GEVFVAC  CGFPVC+P
Sbjct  1     MAGLVTGSSQTLHAKDELRPPTRQSATSKKCRVCGDEIGVKEDGEVFVACHVCGFPVCRP  60

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSENGD-  373
             CY+YERSEGNQ CP CNTRYKRHKGCPRV GD++D     D   +     H    E+   
Sbjct  61    CYEYERSEGNQSCPQCNTRYKRHKGCPRVPGDNDDEDANFDDFDDEFQIKHHDHDESNQK  120

Query  374   --YHNNQLPHHNTTNSAAFQPT-AAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEK  544
               + + ++ H+N       +P  ++ GSV GKDLE E KE +SNAEW++RVEKWK RQEK
Sbjct  121   NVFSHTEIEHYNEQEMHPIRPAFSSAGSVAGKDLEGE-KEGYSNAEWQERVEKWKVRQEK  179

Query  545   RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFH  724
             RGLV++  DD G    E+D++LMA+ARQPLWRK+PI SS I+PYRIVIV RLIILCFFF 
Sbjct  180   RGLVSK--DDGGNDQGEEDEYLMAEARQPLWRKIPIPSSRINPYRIVIVLRLIILCFFFR  237

Query  725   FRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGER  904
             FRILTPAYDA+ LWLISVICE+WFGLSWILDQFPKW+PI RETYLDRLS+RFER  EGE 
Sbjct  238   FRILTPAYDAYALWLISVICEVWFGLSWILDQFPKWNPIERETYLDRLSMRFER--EGEP  295

Query  905   NTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAET  1084
             N L PVDV+VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASMLLFD+LAET
Sbjct  296   NRLGPVDVFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASMLLFDSLAET  355

Query  1085  AEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNA  1264
             AEFARRWVPFCKK+ IEPRAPEFYF++KIDYLKDKV P FVKERRAMKREYEE+KVR+NA
Sbjct  356   AEFARRWVPFCKKHNIEPRAPEFYFTQKIDYLKDKVHPNFVKERRAMKREYEEFKVRINA  415

Query  1265  LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREK  1444
             LV+KAQKKPEEGWVMQDGTPWPGN TRDHPGMIQVYLGSEGALDVEGKELP+LVYVSREK
Sbjct  416   LVSKAQKKPEEGWVMQDGTPWPGNITRDHPGMIQVYLGSEGALDVEGKELPRLVYVSREK  475

Query  1445  RPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             RPGY HHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  476   RPGYNHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  512



>gb|ACJ38666.1| cellulose synthase [Betula luminifera]
Length=1049

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/529 (74%), Positives = 437/529 (83%), Gaps = 31/529 (6%)
 Frame = +2

Query  17    SMAALFTGGSHLHAADH-----DERREVERES-QKMCRICRDEIGVVENGEVFVACRECG  178
             +M      GSH     H     DE+R   R+S  K CR+C DEIG  E+GE+FVAC  CG
Sbjct  5     AMTGGLVAGSHTRNELHVLHGDDEQRPPTRQSVSKTCRVCGDEIGYKEDGELFVACHVCG  64

Query  179   FPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNH---  349
             FPVC+PCY YERSEGNQ CP CNTRYKR KGCPRV GDD+++F+ +DF+ EF+TKNH   
Sbjct  65    FPVCRPCYDYERSEGNQSCPQCNTRYKRQKGCPRVAGDDDENFDADDFDDEFQTKNHHDD  124

Query  350   ------PPLSENGDYHNNQLPHHNTTNSAAFQPTAA-PGSVGGKDLEDEQKEVFSNAEWK  508
                      SENGDY++ Q           ++PT +  GSV GKD E E +E +SNAEWK
Sbjct  125   SDRQHVTIHSENGDYNHPQ-----------WKPTGSFAGSVAGKDFEGE-REAYSNAEWK  172

Query  509   DRVEKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVI  688
             +R+EKWK RQEKRGLV + DD      ++ DDFL+A+ARQPLWRK+PISSS ISPYRIVI
Sbjct  173   ERIEKWKVRQEKRGLVNK-DDGNNDQGDDQDDFLLAEARQPLWRKVPISSSKISPYRIVI  231

Query  689   VFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRL  868
             V RLIIL FF  FR+LTPAYDA+PLW+ISVICE WF  SWILDQFPKW PI RETYLDRL
Sbjct  232   VLRLIILAFFLRFRVLTPAYDAYPLWIISVICETWFAFSWILDQFPKWFPITRETYLDRL  291

Query  869   SLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDG  1048
             S+RFER  EGE N L+PVDV+VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDG
Sbjct  292   SMRFER--EGEPNRLSPVDVFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDG  349

Query  1049  ASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMK  1228
             ASMLLFDTL+ETAEFARRWVPFC+KY IEPRAPE+YFSEK+DYLKDKV P+FVKERRAMK
Sbjct  350   ASMLLFDTLSETAEFARRWVPFCRKYSIEPRAPEYYFSEKMDYLKDKVLPSFVKERRAMK  409

Query  1229  REYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGK  1408
             REYEE+KVR+NALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGK
Sbjct  410   REYEEFKVRINALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGK  469

Query  1409  ELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             ELP+LVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY
Sbjct  470   ELPRLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  518



>ref|XP_011024455.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
isoform X1 [Populus euphratica]
Length=1042

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/517 (74%), Positives = 430/517 (83%), Gaps = 10/517 (2%)
 Frame = +2

Query  20    MAALFTGGSH-LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             MA L TG S  LHA D       +  + K CR+C DEIGV E+GEVFVAC  CGFPVC+P
Sbjct  1     MAGLVTGSSQTLHAKDELRPPTRQSATSKKCRVCGDEIGVKEDGEVFVACHVCGFPVCRP  60

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSENGD-  373
             CY+YERSEGNQ CP CNTRYKRH+GCPRV GD++D     D   +     H    E+   
Sbjct  61    CYEYERSEGNQSCPQCNTRYKRHRGCPRVPGDNDDDDANFDDFDDEFQIKHHDHDESNQK  120

Query  374   --YHNNQLPHHNTTNSAAFQPT-AAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEK  544
               + + ++ H+N       +P  ++ GSV GKDLE E KE +SNAEW++RVEKWK RQEK
Sbjct  121   NVFSHTEIEHYNEQEMHPIRPAFSSAGSVAGKDLEGE-KEGYSNAEWQERVEKWKFRQEK  179

Query  545   RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFH  724
             RGLV++  DD G    E+D++LMA+ARQPLWRK+PI SS I+PYRIVIV RLIILCFFF 
Sbjct  180   RGLVSK--DDGGNDQGEEDEYLMAEARQPLWRKIPIPSSRINPYRIVIVLRLIILCFFFR  237

Query  725   FRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGER  904
             FRILTPAYDA+ LWLISVICE+WFGLSWILDQFPKW+PI RETYLDRLS+RFER  EGE 
Sbjct  238   FRILTPAYDAYALWLISVICEVWFGLSWILDQFPKWNPIERETYLDRLSMRFER--EGEP  295

Query  905   NTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAET  1084
             N L PVDV+VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASMLLFD+LAET
Sbjct  296   NRLGPVDVFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASMLLFDSLAET  355

Query  1085  AEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNA  1264
             AEFARRWVPFCKK+ IEPRAPEFYF++KIDYLKDKV P FVKERRAMKREYEE+KVR+NA
Sbjct  356   AEFARRWVPFCKKHNIEPRAPEFYFTQKIDYLKDKVHPNFVKERRAMKREYEEFKVRINA  415

Query  1265  LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREK  1444
             LV+KAQKKPEEGWVMQDGTPWPGN TRDHPGMIQVYLGSEGALDVEGKELP+LVYVSREK
Sbjct  416   LVSKAQKKPEEGWVMQDGTPWPGNITRDHPGMIQVYLGSEGALDVEGKELPRLVYVSREK  475

Query  1445  RPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             RPGY HHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  476   RPGYNHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  512



>gb|AGG91493.1| cellulose synthase A4 [Betula platyphylla]
Length=1049

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/529 (74%), Positives = 437/529 (83%), Gaps = 31/529 (6%)
 Frame = +2

Query  17    SMAALFTGGSHLHAADH-----DERREVERES-QKMCRICRDEIGVVENGEVFVACRECG  178
             +M      GSH     H     DE+R   R+S  K CR+C DEIG  E+GE+FVAC  CG
Sbjct  5     AMTGGLVAGSHTRNELHVLHGDDEQRPPTRQSVSKTCRVCGDEIGYKEDGELFVACNVCG  64

Query  179   FPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNH---  349
             FPVC+PCY YERSEGNQ CP CNTRYKR KGCPRV GDD+++F+ +DF+ EF+TKNH   
Sbjct  65    FPVCRPCYDYERSEGNQSCPQCNTRYKRQKGCPRVAGDDDENFDADDFDDEFQTKNHHDD  124

Query  350   ------PPLSENGDYHNNQLPHHNTTNSAAFQPTAA-PGSVGGKDLEDEQKEVFSNAEWK  508
                      SENGDY++ Q           ++PT +  GSV GKD E E +E +SNAEWK
Sbjct  125   SDRQHVTIHSENGDYNHPQ-----------WKPTGSFAGSVAGKDFEGE-RETYSNAEWK  172

Query  509   DRVEKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVI  688
             +R+EKWK RQEKRGLV + DD      ++ DDFL+A+ARQPLWRK+PI+SS ISPYRIVI
Sbjct  173   ERIEKWKVRQEKRGLVNK-DDGNNDQGDDQDDFLLAEARQPLWRKVPIASSKISPYRIVI  231

Query  689   VFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRL  868
             V RLIIL FF  FR+LTPAYDA+PLW+ISVICE WF  SWILDQFPKW PI RETYLDRL
Sbjct  232   VLRLIILAFFLRFRVLTPAYDAYPLWIISVICETWFAFSWILDQFPKWFPITRETYLDRL  291

Query  869   SLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDG  1048
             S+RFER  EGE N L+PVDV+VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDG
Sbjct  292   SMRFER--EGEPNRLSPVDVFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDG  349

Query  1049  ASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMK  1228
             ASMLLFDTL+ETAEFARRWVPFC+KY IEPRAPE+YFSEK+DYLKDKV P+FVKERRAMK
Sbjct  350   ASMLLFDTLSETAEFARRWVPFCRKYSIEPRAPEYYFSEKMDYLKDKVLPSFVKERRAMK  409

Query  1229  REYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGK  1408
             REYEE+KVR+NALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGK
Sbjct  410   REYEEFKVRINALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGK  469

Query  1409  ELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             ELP+LVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY
Sbjct  470   ELPRLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  518



>gb|AGW52057.1| cellulose synthase 4 [Populus tomentosa]
Length=1042

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/517 (74%), Positives = 429/517 (83%), Gaps = 10/517 (2%)
 Frame = +2

Query  20    MAALFTGGSH-LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             MA L TG S  LHA D       +  + K CR+C DEIGV E+GEVFVAC  CGFPVC+P
Sbjct  1     MAGLVTGSSQTLHAKDELRPPTRQSATSKKCRVCGDEIGVKEDGEVFVACHVCGFPVCRP  60

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSENGD-  373
             CY+YERSEGNQ CP CNTRYKRHKGCPRV GD++D     D   +     H    E+   
Sbjct  61    CYEYERSEGNQSCPQCNTRYKRHKGCPRVPGDNDDEDANFDDFDDEFQIKHHDHDESNQK  120

Query  374   --YHNNQLPHHNTTNSAAFQPT-AAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEK  544
               + + ++ H+N       +P  ++ GSV GKDLE E KE +SNAEW++RVEKWK RQEK
Sbjct  121   NVFSHTEIEHYNEQEMHPIRPAFSSAGSVAGKDLEGE-KEGYSNAEWQERVEKWKVRQEK  179

Query  545   RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFH  724
             RGLV++  DD G    E+D++LMA+ARQPLWRK+PI SS I+PYRIVIV RLIILCFFF 
Sbjct  180   RGLVSK--DDGGNDQGEEDEYLMAEARQPLWRKIPIPSSRINPYRIVIVLRLIILCFFFR  237

Query  725   FRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGER  904
             FRILTPAYDA+ LWLISVICE+WFGLSWILDQFPKW+PI RETYLDRLS+RFER  EGE 
Sbjct  238   FRILTPAYDAYALWLISVICEVWFGLSWILDQFPKWNPIERETYLDRLSMRFER--EGEP  295

Query  905   NTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAET  1084
             N L PVDV+VSTVDPLKEPPII ANTVLSIL+VDYPVDKVSCYVSDDGASMLLFD+LAET
Sbjct  296   NRLGPVDVFVSTVDPLKEPPIIAANTVLSILSVDYPVDKVSCYVSDDGASMLLFDSLAET  355

Query  1085  AEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNA  1264
             AEFARRWVPFCKK+ IEPRAPEFYF++KIDYLKDKV P FVKERRAMKREYEE+KVR+NA
Sbjct  356   AEFARRWVPFCKKHNIEPRAPEFYFTQKIDYLKDKVHPNFVKERRAMKREYEEFKVRINA  415

Query  1265  LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREK  1444
             LV+KAQKKPEEGWVMQDGTPWPGN TRDHPGMIQVYLGSEGALDVEGKELP+LVYVSREK
Sbjct  416   LVSKAQKKPEEGWVMQDGTPWPGNITRDHPGMIQVYLGSEGALDVEGKELPRLVYVSREK  475

Query  1445  RPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             RPGY HHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  476   RPGYNHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  512



>ref|XP_011024456.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
isoform X2 [Populus euphratica]
Length=1042

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/517 (74%), Positives = 430/517 (83%), Gaps = 10/517 (2%)
 Frame = +2

Query  20    MAALFTGGSH-LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             MA L TG S  LHA D       +  + K CR+C DEIGV E+GEVFVAC  CGFPVC+P
Sbjct  1     MAGLVTGSSQTLHAKDELRPPTRQSATSKKCRVCGDEIGVKEDGEVFVACHVCGFPVCRP  60

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSENGD-  373
             CY+YERSEGNQ CP CNTRYKRH+GCPRV GD++D     D   +     H    E+   
Sbjct  61    CYEYERSEGNQSCPQCNTRYKRHRGCPRVPGDNDDDDANFDDFDDEFQIKHHDHDESNQK  120

Query  374   --YHNNQLPHHNTTNSAAFQPT-AAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEK  544
               + + ++ H+N       +P  ++ GSV GKDLE E KE +SNAEW++RVEKWK RQEK
Sbjct  121   NVFSHTEIEHYNEQEMHPIRPAFSSAGSVAGKDLEGE-KEGYSNAEWQERVEKWKFRQEK  179

Query  545   RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFH  724
             RGLV++  DD G    E+D++LMA+ARQPLWRK+PI SS I+PYRIVIV RLIILCFFF 
Sbjct  180   RGLVSK--DDGGNDQGEEDEYLMAEARQPLWRKIPIPSSRINPYRIVIVLRLIILCFFFR  237

Query  725   FRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGER  904
             FRILTPAYDA+ LWLISVICE+WFGLSWILDQFPKW+PI RETYLDRLS+RFER  EGE 
Sbjct  238   FRILTPAYDAYALWLISVICEVWFGLSWILDQFPKWNPIERETYLDRLSMRFER--EGEP  295

Query  905   NTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAET  1084
             N L PVDV+VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASMLLFD+LAET
Sbjct  296   NRLGPVDVFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASMLLFDSLAET  355

Query  1085  AEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNA  1264
             AEFARRWVPFCKK+ IEPRAPEFYF++KIDYLKDKV P FVKERRAMKREYEE+KVR+NA
Sbjct  356   AEFARRWVPFCKKHNIEPRAPEFYFTQKIDYLKDKVHPNFVKERRAMKREYEEFKVRINA  415

Query  1265  LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREK  1444
             LV+KAQKKPEEGWVMQDGTPWPGN TRDHPGMIQVYLGSEGALDVEGKELP+LVYVSREK
Sbjct  416   LVSKAQKKPEEGWVMQDGTPWPGNITRDHPGMIQVYLGSEGALDVEGKELPRLVYVSREK  475

Query  1445  RPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             RPGY HHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  476   RPGYNHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  512



>gb|AGW52052.1| cellulose synthase 4 [Populus tomentosa]
 gb|AGW52053.1| cellulose synthase 4 [Populus tomentosa]
 gb|AGW52074.1| cellulose synthase 4 [Populus tomentosa]
Length=1042

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/517 (74%), Positives = 429/517 (83%), Gaps = 10/517 (2%)
 Frame = +2

Query  20    MAALFTGGSH-LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             MA L TG S  LHA D       +  + K CR+C DEIGV E+GEVFVAC  CGFPVC+P
Sbjct  1     MAGLVTGSSQTLHAKDELRPPTRQSATSKKCRVCGDEIGVKEDGEVFVACHVCGFPVCRP  60

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSENGD-  373
             CY+YERSEGNQ CP CNTRYKRHKGCPRV GD++D     D   +     H    E+   
Sbjct  61    CYEYERSEGNQSCPQCNTRYKRHKGCPRVPGDNDDEDANFDDFDDEFQIKHHDHDESNQK  120

Query  374   --YHNNQLPHHNTTNSAAFQPT-AAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEK  544
               + + ++ H+N       +P  ++ GSV GKDLE E KE +SNAEW++RVEKWK RQEK
Sbjct  121   NVFSHTEIEHYNEQEMHPIRPAFSSAGSVAGKDLEGE-KEGYSNAEWQERVEKWKVRQEK  179

Query  545   RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFH  724
             RGLV++  DD G    E+D++LMA+ARQPLWRK+PI SS I+PYRIVIV RLIILCFFF 
Sbjct  180   RGLVSK--DDGGNDQGEEDEYLMAEARQPLWRKIPIPSSRINPYRIVIVLRLIILCFFFR  237

Query  725   FRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGER  904
             FRILTPAYDA+ LWLISVICE+WFGLSWILDQFPKW+PI RETYLDRLS+RFER  EGE 
Sbjct  238   FRILTPAYDAYALWLISVICEVWFGLSWILDQFPKWNPIERETYLDRLSMRFER--EGEP  295

Query  905   NTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAET  1084
             N L PVDV+VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASMLLFD+LAET
Sbjct  296   NRLGPVDVFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASMLLFDSLAET  355

Query  1085  AEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNA  1264
             AEFARRWVPFCKK+ IEPRAPEFYF++KIDYLKDKV P FVKERRAMKREYEE+KVR+NA
Sbjct  356   AEFARRWVPFCKKHNIEPRAPEFYFTQKIDYLKDKVHPNFVKERRAMKREYEEFKVRINA  415

Query  1265  LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREK  1444
             LV+KAQKKPEEGWVMQDGTPWPGN TRDHPGMI VYLGSEGALDVEGKELP+LVYVSREK
Sbjct  416   LVSKAQKKPEEGWVMQDGTPWPGNITRDHPGMIHVYLGSEGALDVEGKELPRLVYVSREK  475

Query  1445  RPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             RPGY HHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  476   RPGYNHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  512



>gb|AES65133.2| cellulose synthase-like protein [Medicago truncatula]
Length=1044

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/516 (74%), Positives = 438/516 (85%), Gaps = 11/516 (2%)
 Frame = +2

Query  17    SMAALFTGGSHLHAADHDERRE--VERESQKMCRICRDEIGVVENGEVFVACRECGFPVC  190
             +MA L TG +   + D DE +     + S K+CR+C DEIG  ENGE+FVAC  C FPVC
Sbjct  5     TMAGLITGSNSHFSHDSDEHKPPPANKSSSKICRVCGDEIGYKENGELFVACHVCAFPVC  64

Query  191   KPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNH-PPLSEN  367
             KPCY+YERSEGNQCCP CN+RYKRHKGCPRVVGD++++ +G+DFE EF  KNH   L +N
Sbjct  65    KPCYEYERSEGNQCCPQCNSRYKRHKGCPRVVGDEDENLDGDDFEDEFPVKNHHDDLDQN  124

Query  368   GDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKR  547
              D ++ +   +N      F   ++ GSV GKDLE E KE +SN EW++RVEKWK RQEKR
Sbjct  125   RDVNHVESVDYNQQKLHTF---SSAGSVTGKDLEGE-KEFYSNEEWQERVEKWKVRQEKR  180

Query  548   GLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHF  727
             GL+ +  +D      E+D++LMA+ARQPLWRK+PI SSLI+PYRIVI+ RL+IL FFF F
Sbjct  181   GLLNK--EDGKEDQGEEDEYLMAEARQPLWRKVPIPSSLINPYRIVIIMRLVILAFFFRF  238

Query  728   RILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERN  907
             RILTPAYDA+PLWLISVICEIWF LSWILDQFPKW PI RETYLDRLS+RFER  EGE N
Sbjct  239   RILTPAYDAYPLWLISVICEIWFALSWILDQFPKWLPITRETYLDRLSIRFER--EGEPN  296

Query  908   TLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETA  1087
              L+PVDV+VS+VDPLKEPPIITANTVLSIL+VDYPV+KV+CYVSDDGASMLLFD LAET+
Sbjct  297   QLSPVDVFVSSVDPLKEPPIITANTVLSILSVDYPVEKVTCYVSDDGASMLLFDCLAETS  356

Query  1088  EFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNAL  1267
             EFARRWVPFCKKY IEPRAPE+YF+EKIDYLKDKV+PTFVKERR+MKREYEE+KV++NAL
Sbjct  357   EFARRWVPFCKKYSIEPRAPEYYFNEKIDYLKDKVEPTFVKERRSMKREYEEFKVKINAL  416

Query  1268  VAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKR  1447
             VAKA KKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS GALDVEGKELPKLVY+SREKR
Sbjct  417   VAKALKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSAGALDVEGKELPKLVYISREKR  476

Query  1448  PGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             PGY HHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY
Sbjct  477   PGYPHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  512



>gb|KHN47729.1| Cellulose synthase A catalytic subunit 4 [UDP-forming] [Glycine 
soja]
Length=1050

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/525 (74%), Positives = 435/525 (83%), Gaps = 24/525 (5%)
 Frame = +2

Query  17    SMAALFTGGSHLHAADHDERR---EVERESQKMCRICRDEIGVVENGEVFVACRECGFPV  187
             SMA L T  +   + D +E +     +  S+  CR+C DEIG +ENGE+FVAC  C FPV
Sbjct  5     SMAGLITSSNSHFSRDSNEHQAPPTRQASSKTTCRVCGDEIGYMENGELFVACHVCRFPV  64

Query  188   CKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPP----  355
             C+PCY+YERSEGNQ CP CNTRYKRHKGCPRV GD+ED+ + +DF+ +F  +NH      
Sbjct  65    CRPCYEYERSEGNQSCPQCNTRYKRHKGCPRVAGDEEDNIDADDFDDQFPVENHREDLDG  124

Query  356   -----LSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVE  520
                    ENGDY+  +L       S+A       GSV GKD E + K+ +SNAEW++RVE
Sbjct  125   QHDVNHVENGDYNQEKLHPSGQAFSSA-------GSVAGKDFEGD-KDFYSNAEWQERVE  176

Query  521   KWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRL  700
             KWK RQEKRGL+ +  +D      E+DD+L+A+ARQPLWRK+PISSSLI+PYRIVIV RL
Sbjct  177   KWKVRQEKRGLLNK--EDGKEDQAEEDDYLLAEARQPLWRKVPISSSLINPYRIVIVMRL  234

Query  701   IILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRF  880
             +ILCFFF FRILTPA DA+PLWLISVICEIWF LSWILDQFPKW PI RETYLDRL+LRF
Sbjct  235   VILCFFFRFRILTPANDAYPLWLISVICEIWFALSWILDQFPKWFPIARETYLDRLALRF  294

Query  881   ERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASML  1060
             ER  EGE N LAPVD +VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASML
Sbjct  295   ER--EGETNQLAPVDFFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASML  352

Query  1061  LFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYE  1240
             LFD+LAETAEFARRWVPFCKKY IEPRAPEFYFS+KIDYLKDKVQPTFVKERRAMKREYE
Sbjct  353   LFDSLAETAEFARRWVPFCKKYNIEPRAPEFYFSQKIDYLKDKVQPTFVKERRAMKREYE  412

Query  1241  EYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPK  1420
             E+KV++N+LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS GALDVEGKELPK
Sbjct  413   EFKVKINSLVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSAGALDVEGKELPK  472

Query  1421  LVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             LVY+SREKRPGY HHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY
Sbjct  473   LVYISREKRPGYPHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  517



>gb|AGW52043.1| cellulose synthase 4 [Populus tomentosa]
 gb|AGW52044.1| cellulose synthase 4 [Populus tomentosa]
 gb|AGW52063.1| cellulose synthase 4 [Populus tomentosa]
Length=1042

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/517 (74%), Positives = 432/517 (84%), Gaps = 10/517 (2%)
 Frame = +2

Query  20    MAALFTGGSH-LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             MA L TG S  LHA D       +  + K CR+C DEIGV E+GEVFVAC  CGFPVC+P
Sbjct  1     MAGLVTGSSQTLHAKDELRPPTRQSATSKKCRVCGDEIGVKEDGEVFVACHVCGFPVCRP  60

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedf---eqefeTKNHPPLSEN  367
             CY+YERSEGNQ CP CNTRYKRHKGCPRV GD++D     D    E + +  +H   ++ 
Sbjct  61    CYEYERSEGNQSCPQCNTRYKRHKGCPRVPGDNDDEDANFDDFDDEFQIKNHDHDESNQK  120

Query  368   GDYHNNQLPHHNTTNSAAFQPT-AAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEK  544
               + + ++ H+N       +P  ++ GSV GKDLE E KE +SNAEW++RVEKWK RQEK
Sbjct  121   NVFSHTEIEHYNEQEMHPIRPAFSSAGSVAGKDLEGE-KEGYSNAEWQERVEKWKVRQEK  179

Query  545   RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFH  724
             RGLV++  DD G    E+D++LMA+ARQPLWRK+PI SS I+PYRIVIV RLIILCFFF 
Sbjct  180   RGLVSK--DDGGNDQGEEDEYLMAEARQPLWRKIPIPSSRINPYRIVIVLRLIILCFFFR  237

Query  725   FRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGER  904
             FRILTPA DA+ LWLISVICE+WFGLSWILDQFPKW+PI RETYLDRLS+RFER  EGE 
Sbjct  238   FRILTPASDAYALWLISVICEVWFGLSWILDQFPKWNPIERETYLDRLSMRFER--EGEP  295

Query  905   NTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAET  1084
             N L PVDV+VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASMLLFD+LAET
Sbjct  296   NRLGPVDVFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASMLLFDSLAET  355

Query  1085  AEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNA  1264
             AEFARRWVPFCKK+ IEPRAPEFYF++KIDYLKDKV P FVKERRAMKREYEE+KVR+NA
Sbjct  356   AEFARRWVPFCKKHNIEPRAPEFYFTQKIDYLKDKVHPNFVKERRAMKREYEEFKVRINA  415

Query  1265  LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREK  1444
             LV+KAQKKPEEGWVMQDGTPWPGN TRDHPGMIQVYLGSEGALDVEGKELP+LVYVSREK
Sbjct  416   LVSKAQKKPEEGWVMQDGTPWPGNITRDHPGMIQVYLGSEGALDVEGKELPRLVYVSREK  475

Query  1445  RPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             RPGY HHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  476   RPGYNHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  512



>gb|ACT78709.1| cellulose synthase 4 [Populus tomentosa]
 gb|AGW52041.1| cellulose synthase 4 [Populus tomentosa]
 gb|AGW52046.1| cellulose synthase 4 [Populus tomentosa]
 gb|AGW52048.1| cellulose synthase 4 [Populus tomentosa]
 gb|AGW52049.1| cellulose synthase 4 [Populus tomentosa]
 gb|AGW52050.1| cellulose synthase 4 [Populus tomentosa]
 gb|AGW52064.1| cellulose synthase 4 [Populus tomentosa]
 gb|AGW52067.1| cellulose synthase 4 [Populus tomentosa]
 gb|AGW52080.1| cellulose synthase 4 [Populus tomentosa]
Length=1042

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/517 (74%), Positives = 432/517 (84%), Gaps = 10/517 (2%)
 Frame = +2

Query  20    MAALFTGGSH-LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             MA L TG S  LHA D       +  + K CR+C DEIGV E+GEVFVAC  CGFPVC+P
Sbjct  1     MAGLVTGSSQTLHAKDELRPPTRQSATSKKCRVCGDEIGVKEDGEVFVACHVCGFPVCRP  60

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedf---eqefeTKNHPPLSEN  367
             CY+YERSEGNQ CP CNTRYKRHKGCPRV GD++D     D    E + +  +H   ++ 
Sbjct  61    CYEYERSEGNQSCPQCNTRYKRHKGCPRVPGDNDDEDANFDDFDDEFQIKNHDHDESNQK  120

Query  368   GDYHNNQLPHHNTTNSAAFQPT-AAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEK  544
               + + ++ H+N       +P  ++ GSV GKDLE E KE +SNAEW++RVEKWK RQEK
Sbjct  121   NVFSHTEIEHYNEQEMHPIRPAFSSAGSVAGKDLEGE-KEGYSNAEWQERVEKWKVRQEK  179

Query  545   RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFH  724
             RGLV++  DD G    E+D++LMA+ARQPLWRK+PI SS I+PYRIVIV RLIILCFFF 
Sbjct  180   RGLVSK--DDGGNDQGEEDEYLMAEARQPLWRKIPIPSSRINPYRIVIVLRLIILCFFFR  237

Query  725   FRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGER  904
             FRILTPA DA+ LWLISVICE+WFGLSWILDQFPKW+PI RETYLDRLS+RFER  EGE 
Sbjct  238   FRILTPASDAYALWLISVICEVWFGLSWILDQFPKWNPIERETYLDRLSMRFER--EGEP  295

Query  905   NTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAET  1084
             N L PVDV+VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASMLLFD+LAET
Sbjct  296   NRLGPVDVFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASMLLFDSLAET  355

Query  1085  AEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNA  1264
             AEFARRWVPFCKK+ IEPRAPEFYF++KIDYLKDKV P FVKERRAMKREYEE+KVR+NA
Sbjct  356   AEFARRWVPFCKKHNIEPRAPEFYFTQKIDYLKDKVHPNFVKERRAMKREYEEFKVRINA  415

Query  1265  LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREK  1444
             LV+KAQKKPEEGWVMQDGTPWPGN TRDHPGMIQVYLGSEGALDVEGKELP+LVYVSREK
Sbjct  416   LVSKAQKKPEEGWVMQDGTPWPGNITRDHPGMIQVYLGSEGALDVEGKELPRLVYVSREK  475

Query  1445  RPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             RPGY HHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  476   RPGYNHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  512



>gb|AGW52037.1| cellulose synthase 4 [Populus tomentosa]
Length=1042

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/517 (74%), Positives = 430/517 (83%), Gaps = 10/517 (2%)
 Frame = +2

Query  20    MAALFTGGSH-LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             MA L TG S  LHA D       +  + K CR+C DEIGV E+GEVFVAC  CGFPVC+P
Sbjct  1     MAGLVTGSSQTLHAKDELRPPTRQSATSKKCRVCGDEIGVKEDGEVFVACHVCGFPVCRP  60

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSENGD-  373
             CY+YERSEGNQ CP CNTRYKRHKGCP+V GD++D     D   +     H    E+   
Sbjct  61    CYEYERSEGNQSCPQCNTRYKRHKGCPKVPGDNDDEDANFDDFDDQFQIKHHDHDESNQK  120

Query  374   --YHNNQLPHHNTTNSAAFQPT-AAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEK  544
               + + ++ H+N       +P  ++ GSV GKDLE E KE +SNAEW++RVEKWK RQEK
Sbjct  121   NVFSHTEIEHYNEQEMHPIRPAFSSAGSVAGKDLEGE-KEGYSNAEWQERVEKWKVRQEK  179

Query  545   RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFH  724
             RGLV++  DD G    E+D++LMA+ARQPLWRK+PI SS I+PYRIVIV RLIILCFFF 
Sbjct  180   RGLVSK--DDGGNDQGEEDEYLMAEARQPLWRKIPIPSSRINPYRIVIVLRLIILCFFFR  237

Query  725   FRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGER  904
             FRILTPAYDA+ LWLISVICE+WFGLSWILDQFPKW+PI RETYLDRLS+RFER  EGE 
Sbjct  238   FRILTPAYDAYALWLISVICEVWFGLSWILDQFPKWNPIERETYLDRLSMRFER--EGEP  295

Query  905   NTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAET  1084
             N L PVDV+VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASMLLFD+LAET
Sbjct  296   NRLGPVDVFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASMLLFDSLAET  355

Query  1085  AEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNA  1264
             AEFARRWVPFCKK+ IEPRAPEFYF++KIDYLKDKV P FVKERRAMKREYEE+KVR+NA
Sbjct  356   AEFARRWVPFCKKHNIEPRAPEFYFTQKIDYLKDKVHPNFVKERRAMKREYEEFKVRINA  415

Query  1265  LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREK  1444
             LV+KAQKKPEEGWVMQDGTPWPGN TRDHPGMIQVYLGSEGALDVEGKELP+LVYVSREK
Sbjct  416   LVSKAQKKPEEGWVMQDGTPWPGNITRDHPGMIQVYLGSEGALDVEGKELPRLVYVSREK  475

Query  1445  RPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             RPGY HHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  476   RPGYNHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  512



>gb|AGW52065.1| cellulose synthase 4 [Populus tomentosa]
 gb|AGW52066.1| cellulose synthase 4 [Populus tomentosa]
 gb|AGW52071.1| cellulose synthase 4 [Populus tomentosa]
Length=1042

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/517 (74%), Positives = 429/517 (83%), Gaps = 10/517 (2%)
 Frame = +2

Query  20    MAALFTGGSH-LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             MA L TG S  LHA D       +  + K CR+C DEIGV E+GEVFVAC  CGFPVC+P
Sbjct  1     MAGLVTGSSQTLHAKDELRPPTRQSATSKKCRVCGDEIGVKEDGEVFVACHVCGFPVCRP  60

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSENGD-  373
             CY+YERSEGNQ CP CNTRYKRHKGCPRV GD++D     D   +     H    E+   
Sbjct  61    CYEYERSEGNQSCPQCNTRYKRHKGCPRVPGDNDDEDANFDDFDDEFQIKHHDHDESNQK  120

Query  374   --YHNNQLPHHNTTNSAAFQPT-AAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEK  544
               + + ++ H+N       +P  ++ GSV GKDLE E KE +SNAEW++RVEKWK RQEK
Sbjct  121   NVFSHTEIEHYNEQEMHPIRPAFSSAGSVAGKDLEGE-KEGYSNAEWQERVEKWKVRQEK  179

Query  545   RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFH  724
             RGLV++  DD G    E+D++LMA+ARQPLWRK+PI SS I+PYRIVIV RLIILCFFF 
Sbjct  180   RGLVSK--DDGGNDQGEEDEYLMAEARQPLWRKIPIPSSRINPYRIVIVLRLIILCFFFR  237

Query  725   FRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGER  904
             FRILTPA DA+ LWLISVICE+WFGLSWILDQFPKW+PI RETYLDRLS+RFER  EGE 
Sbjct  238   FRILTPASDAYALWLISVICEVWFGLSWILDQFPKWNPIERETYLDRLSMRFER--EGEP  295

Query  905   NTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAET  1084
             N L PVDV+VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASMLLFD+LAET
Sbjct  296   NRLGPVDVFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASMLLFDSLAET  355

Query  1085  AEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNA  1264
             AEFARRWVPFCKK+ IEPRAPEFYF++KIDYLKDKV P FVKERRAMKREYEE+KVR+NA
Sbjct  356   AEFARRWVPFCKKHNIEPRAPEFYFTQKIDYLKDKVHPNFVKERRAMKREYEEFKVRINA  415

Query  1265  LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREK  1444
             LV+KAQKKPEEGWVMQDGTPWPGN TRDHPGMIQVYLGSEGALDVEGKELP+LVYVSREK
Sbjct  416   LVSKAQKKPEEGWVMQDGTPWPGNITRDHPGMIQVYLGSEGALDVEGKELPRLVYVSREK  475

Query  1445  RPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             RPGY HHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  476   RPGYNHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  512



>gb|AGW52042.1| cellulose synthase 4 [Populus tomentosa]
 gb|AGW52059.1| cellulose synthase 4 [Populus tomentosa]
 gb|AGW52060.1| cellulose synthase 4 [Populus tomentosa]
Length=1042

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/517 (74%), Positives = 429/517 (83%), Gaps = 10/517 (2%)
 Frame = +2

Query  20    MAALFTGGSH-LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             MA L TG S  LHA D       +  + K CR+C DEIGV E+GEVFVAC  CGFPVC+P
Sbjct  1     MAGLVTGSSQTLHAKDELRPPTRQSATSKKCRVCGDEIGVKEDGEVFVACHVCGFPVCRP  60

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSENGD-  373
             CY+YERSEGNQ CP CNTRYKRHKGCPRV GD++D     D   +     H    E+   
Sbjct  61    CYEYERSEGNQSCPQCNTRYKRHKGCPRVPGDNDDEDANFDDFDDEFQIKHHDHDESNQK  120

Query  374   --YHNNQLPHHNTTNSAAFQPT-AAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEK  544
               + + ++ H+N       +P  ++ GSV GKDLE E KE +SNAEW++RVEKWK RQEK
Sbjct  121   NVFSHTEIEHYNEQEMHPIRPAFSSAGSVAGKDLEGE-KEGYSNAEWQERVEKWKVRQEK  179

Query  545   RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFH  724
             RGLV++  DD G    E+D++LMA+ARQPLWRK+PI SS I+PYRIVIV RLIILCFFF 
Sbjct  180   RGLVSK--DDGGNDQGEEDEYLMAEARQPLWRKIPIPSSRINPYRIVIVLRLIILCFFFR  237

Query  725   FRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGER  904
             FRILTPA DA+ LWLISVICE+WFGLSWILDQFPKW+PI RETYLDRLS+RFER  EGE 
Sbjct  238   FRILTPASDAYALWLISVICEVWFGLSWILDQFPKWNPIERETYLDRLSMRFER--EGEP  295

Query  905   NTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAET  1084
             N L PVDV+VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASMLLFD+LAET
Sbjct  296   NRLGPVDVFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASMLLFDSLAET  355

Query  1085  AEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNA  1264
             AEFARRWVPFCKK+ IEPRAPEFYF++KIDYLKDKV P FVKERRAMKREYEE+KVR+NA
Sbjct  356   AEFARRWVPFCKKHNIEPRAPEFYFTQKIDYLKDKVHPNFVKERRAMKREYEEFKVRINA  415

Query  1265  LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREK  1444
             LV+KAQKKPEEGWVMQDGTPWPGN TRDHPGMIQVYLGSEGALDVEGKELP+LVYVSREK
Sbjct  416   LVSKAQKKPEEGWVMQDGTPWPGNITRDHPGMIQVYLGSEGALDVEGKELPRLVYVSREK  475

Query  1445  RPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             RPGY HHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  476   RPGYNHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  512



>gb|AII73573.1| cellulose synthase 4 [Medicago sativa]
Length=1039

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/515 (75%), Positives = 437/515 (85%), Gaps = 11/515 (2%)
 Frame = +2

Query  20    MAALFTGGSHLHAADHDERRE--VERESQKMCRICRDEIGVVENGEVFVACRECGFPVCK  193
             MA L TG +   + D DE +     + S K+CR+C DEIG  ENGE+FVAC  C FPVCK
Sbjct  1     MAGLITGSNSHFSHDSDEHKPPPANKSSSKICRVCGDEIGYKENGELFVACHVCSFPVCK  60

Query  194   PCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNH-PPLSENG  370
             PCY+YERSEGNQCCP CN+RYKRHKGCPRVVGD++++ +G+DFE EF  KNH   L +N 
Sbjct  61    PCYEYERSEGNQCCPQCNSRYKRHKGCPRVVGDEDENLDGDDFEDEFPVKNHHDDLDQNR  120

Query  371   DYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRG  550
             D ++ +   +N      F   ++ GSV GKDLE E KE +SN EW++RVEKWK RQEKRG
Sbjct  121   DVNHVESVDYNQQKLHTF---SSAGSVTGKDLEGE-KEFYSNEEWQERVEKWKVRQEKRG  176

Query  551   LVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFR  730
             L+ +  +D      E+D++LMA+ARQPLWRK+PI SSLI+PYRIVIV RL+IL FFF FR
Sbjct  177   LLNK--EDGKEDQGEEDEYLMAEARQPLWRKVPIPSSLINPYRIVIVMRLVILAFFFRFR  234

Query  731   ILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNT  910
             ILTPAYDA+PLWLISVICEIWF LSWILDQFPKW PI RETYLDRLS+RFER  EGE N 
Sbjct  235   ILTPAYDAYPLWLISVICEIWFALSWILDQFPKWLPITRETYLDRLSIRFER--EGEPNQ  292

Query  911   LAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAE  1090
             L+PVDV+VS+VDPLKEPPIITANTVLSIL+VDYPV+KV+CYVSDDGASMLLFD LAET+E
Sbjct  293   LSPVDVFVSSVDPLKEPPIITANTVLSILSVDYPVEKVTCYVSDDGASMLLFDCLAETSE  352

Query  1091  FARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALV  1270
             FARRWVPFCKKY IEPRAPE+YF+EKIDYLKDKV+PTFVKERR+MKREYEE+KV++NALV
Sbjct  353   FARRWVPFCKKYSIEPRAPEYYFNEKIDYLKDKVEPTFVKERRSMKREYEEFKVKINALV  412

Query  1271  AKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRP  1450
             AKA KKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS GALDVEGKELPKLVY+SREKRP
Sbjct  413   AKALKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSAGALDVEGKELPKLVYISREKRP  472

Query  1451  GYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             GY HHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY
Sbjct  473   GYPHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  507



>ref|XP_003594882.1| Cellulose synthase [Medicago truncatula]
Length=1039

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/515 (75%), Positives = 437/515 (85%), Gaps = 11/515 (2%)
 Frame = +2

Query  20    MAALFTGGSHLHAADHDERRE--VERESQKMCRICRDEIGVVENGEVFVACRECGFPVCK  193
             MA L TG +   + D DE +     + S K+CR+C DEIG  ENGE+FVAC  C FPVCK
Sbjct  1     MAGLITGSNSHFSHDSDEHKPPPANKSSSKICRVCGDEIGYKENGELFVACHVCAFPVCK  60

Query  194   PCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNH-PPLSENG  370
             PCY+YERSEGNQCCP CN+RYKRHKGCPRVVGD++++ +G+DFE EF  KNH   L +N 
Sbjct  61    PCYEYERSEGNQCCPQCNSRYKRHKGCPRVVGDEDENLDGDDFEDEFPVKNHHDDLDQNR  120

Query  371   DYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRG  550
             D ++ +   +N      F   ++ GSV GKDLE E KE +SN EW++RVEKWK RQEKRG
Sbjct  121   DVNHVESVDYNQQKLHTF---SSAGSVTGKDLEGE-KEFYSNEEWQERVEKWKVRQEKRG  176

Query  551   LVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFR  730
             L+ +  +D      E+D++LMA+ARQPLWRK+PI SSLI+PYRIVI+ RL+IL FFF FR
Sbjct  177   LLNK--EDGKEDQGEEDEYLMAEARQPLWRKVPIPSSLINPYRIVIIMRLVILAFFFRFR  234

Query  731   ILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNT  910
             ILTPAYDA+PLWLISVICEIWF LSWILDQFPKW PI RETYLDRLS+RFER  EGE N 
Sbjct  235   ILTPAYDAYPLWLISVICEIWFALSWILDQFPKWLPITRETYLDRLSIRFER--EGEPNQ  292

Query  911   LAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAE  1090
             L+PVDV+VS+VDPLKEPPIITANTVLSIL+VDYPV+KV+CYVSDDGASMLLFD LAET+E
Sbjct  293   LSPVDVFVSSVDPLKEPPIITANTVLSILSVDYPVEKVTCYVSDDGASMLLFDCLAETSE  352

Query  1091  FARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALV  1270
             FARRWVPFCKKY IEPRAPE+YF+EKIDYLKDKV+PTFVKERR+MKREYEE+KV++NALV
Sbjct  353   FARRWVPFCKKYSIEPRAPEYYFNEKIDYLKDKVEPTFVKERRSMKREYEEFKVKINALV  412

Query  1271  AKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRP  1450
             AKA KKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS GALDVEGKELPKLVY+SREKRP
Sbjct  413   AKALKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSAGALDVEGKELPKLVYISREKRP  472

Query  1451  GYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             GY HHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY
Sbjct  473   GYPHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  507



>ref|XP_007199679.1| hypothetical protein PRUPE_ppa000641mg [Prunus persica]
 gb|EMJ00878.1| hypothetical protein PRUPE_ppa000641mg [Prunus persica]
Length=1056

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/530 (74%), Positives = 433/530 (82%), Gaps = 29/530 (5%)
 Frame = +2

Query  17    SMAALFTGG---SHLHAADH-DERREVERES---QKMCRICRDEIGVVENGEVFVACREC  175
             +MA LFTG      LH  +  +E R   R+S    K+CR+C DEIG  E+GE+FVAC  C
Sbjct  5     TMAGLFTGSHARDELHVVNGTEENRPPTRQSVSSSKVCRVCGDEIGYKEDGELFVACHVC  64

Query  176   GFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPP  355
             GFPVC+PCY YERSEGNQ CP CNTRYKR KGCPRV GD+ED    +  ++     +H  
Sbjct  65    GFPVCRPCYDYERSEGNQSCPQCNTRYKRQKGCPRVAGDEEDFDADDFDDEFQIKIDHHD  124

Query  356   ----------LSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEW  505
                        SENG+ H  Q  HHN       QP +  GSV GKD E E KEV SNAEW
Sbjct  125   ESTEKNNFVNHSENGE-HTQQQWHHND------QPFSVGGSVAGKDFEGE-KEVLSNAEW  176

Query  506   KDRVEKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIV  685
             KDRVEKWK RQEK+GLV +  DD+      +DDFL+A+ARQPLWRK+P+SSS ISPYRIV
Sbjct  177   KDRVEKWKVRQEKKGLVNK--DDRNDDQGYEDDFLLAEARQPLWRKVPVSSSKISPYRIV  234

Query  686   IVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDR  865
             IV RL+IL FFF FRILTPAYDA+PLW+ISVICEIWF  SWILDQFPKW+PINRETYLDR
Sbjct  235   IVCRLVILAFFFRFRILTPAYDAYPLWIISVICEIWFAFSWILDQFPKWNPINRETYLDR  294

Query  866   LSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDD  1045
             L++RFER  EGE NTL+ VDVYVSTVDPLKEPPIITANTVLSIL+VDYPVDK+ CYVSDD
Sbjct  295   LTIRFER--EGEPNTLSSVDVYVSTVDPLKEPPIITANTVLSILSVDYPVDKICCYVSDD  352

Query  1046  GASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAM  1225
             GASMLLFD+L+ETAEFARRWVPFCKK+ IEPRAPEFYFS+KIDYLKDKV P FVKERRAM
Sbjct  353   GASMLLFDSLSETAEFARRWVPFCKKHNIEPRAPEFYFSQKIDYLKDKVHPNFVKERRAM  412

Query  1226  KREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEG  1405
             KREYEE+KVR+NALV+KAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDV+G
Sbjct  413   KREYEEFKVRINALVSKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVDG  472

Query  1406  KELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             KELP+LVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY
Sbjct  473   KELPRLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  522



>gb|AGW52045.1| cellulose synthase 4 [Populus tomentosa]
Length=1042

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/517 (74%), Positives = 429/517 (83%), Gaps = 10/517 (2%)
 Frame = +2

Query  20    MAALFTGGSH-LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             MA L TG S  LHA D       +  + K CR+C DE+GV E+GEVFVAC  CGFPVC+P
Sbjct  1     MAGLVTGSSQTLHAKDELRPPTRQSATSKKCRVCGDEVGVKEDGEVFVACHVCGFPVCRP  60

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSENGD-  373
             CY+YERSEGNQ CP CNTRYKRHKGCPRV GD++D     D   +     H    E+   
Sbjct  61    CYEYERSEGNQSCPQCNTRYKRHKGCPRVPGDNDDEDANFDDFDDEFQIKHHDHDESNQK  120

Query  374   --YHNNQLPHHNTTNSAAFQPT-AAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEK  544
               + + ++ H+N       +P  ++ GSV GKDLE E KE +SNAEW++RVEKWK RQEK
Sbjct  121   NVFSHTEIEHYNEQEMHPIRPAFSSAGSVAGKDLEGE-KEGYSNAEWQERVEKWKVRQEK  179

Query  545   RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFH  724
             RGLV++  DD G    E+D++LMA+ARQPLWRK+PI SS I+PYRIVIV RLIILCFFF 
Sbjct  180   RGLVSK--DDGGNDQGEEDEYLMAEARQPLWRKIPIPSSRINPYRIVIVLRLIILCFFFR  237

Query  725   FRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGER  904
             FRILTPA DA+ LWLISVICE+WFGLSWILDQFPKW+PI RETYLDRLS+RFER  EGE 
Sbjct  238   FRILTPASDAYALWLISVICEVWFGLSWILDQFPKWNPIERETYLDRLSMRFER--EGEP  295

Query  905   NTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAET  1084
             N L PVDV+VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASMLLFD+LAET
Sbjct  296   NRLGPVDVFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASMLLFDSLAET  355

Query  1085  AEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNA  1264
             AEFARRWVPFCKK+ IEPRAPEFYF++KIDYLKDKV P FVKERRAMKREYEE+KVR+NA
Sbjct  356   AEFARRWVPFCKKHNIEPRAPEFYFTQKIDYLKDKVHPNFVKERRAMKREYEEFKVRINA  415

Query  1265  LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREK  1444
             LV+KAQKKPEEGWVMQDGTPWPGN TRDHPGMIQVYLGSEGALDVEGKELP+LVYVSREK
Sbjct  416   LVSKAQKKPEEGWVMQDGTPWPGNITRDHPGMIQVYLGSEGALDVEGKELPRLVYVSREK  475

Query  1445  RPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             RPGY HHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  476   RPGYNHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  512



>ref|XP_006443764.1| hypothetical protein CICLE_v10018639mg [Citrus clementina]
 ref|XP_006479464.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming]-like 
isoform X2 [Citrus sinensis]
 gb|ESR57004.1| hypothetical protein CICLE_v10018639mg [Citrus clementina]
Length=1050

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/526 (74%), Positives = 432/526 (82%), Gaps = 34/526 (6%)
 Frame = +2

Query  32    FTGGSH----LHAADHDERREVERES-QKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             F  GSH    LH    +E R   R+S  K+CR+C DEIG+ ENGE+FVAC ECGFPVC+P
Sbjct  9     FVAGSHSRNELHVMHANEERPPTRQSGSKLCRVCGDEIGLKENGELFVACHECGFPVCRP  68

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNH---------  349
             CY+YERSEG+QCCP CNTRYKRHKGC RV GD+ED+F+ +  ++    KNH         
Sbjct  69    CYEYERSEGSQCCPGCNTRYKRHKGCARVAGDEEDNFDDDFEDE---FKNHFDNQDHDQH  125

Query  350   ----PPLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRV  517
                    SENGD + NQ  +          P +  GSV GKD E + KE +S+AEW++RV
Sbjct  126   HHVTTTRSENGDNNQNQFLN---------GPGSFAGSVAGKDFEGD-KEGYSSAEWQERV  175

Query  518   EKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFR  697
             EKWK RQEKRGLVT+ DD      + DDDFLMA+ARQPLWRK+PI SS I+PYRIVI+ R
Sbjct  176   EKWKIRQEKRGLVTK-DDGGNDQGDGDDDFLMAEARQPLWRKVPIPSSKINPYRIVIILR  234

Query  698   LIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLR  877
             L IL FF  FRILTPAYDAFPLW+ISVICE+WF  SWILDQFPKW PI RETYLDRLS+R
Sbjct  235   LFILAFFLRFRILTPAYDAFPLWIISVICEVWFAFSWILDQFPKWFPITRETYLDRLSIR  294

Query  878   FERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASM  1057
             FER  EGE N LAPVDV+VSTVDPLKEPPIITANTVLSIL++DYPVDKVSCYVSDDGASM
Sbjct  295   FER--EGEPNRLAPVDVFVSTVDPLKEPPIITANTVLSILSMDYPVDKVSCYVSDDGASM  352

Query  1058  LLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREY  1237
             LLFD L+ETAEFARRWVPFCKKY IEPRAPEFYFS+KIDYLKDKVQPTFVK+RRAMKREY
Sbjct  353   LLFDALSETAEFARRWVPFCKKYIIEPRAPEFYFSQKIDYLKDKVQPTFVKDRRAMKREY  412

Query  1238  EEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELP  1417
             EE+KVR+NALV+KAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELP
Sbjct  413   EEFKVRINALVSKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELP  472

Query  1418  KLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             +LVYVSREKRPGY HHKKAGAMNALVRVSAVLTNAPF+LNLDCDHY
Sbjct  473   RLVYVSREKRPGYNHHKKAGAMNALVRVSAVLTNAPFILNLDCDHY  518



>gb|KDO60380.1| hypothetical protein CISIN_1g001574mg [Citrus sinensis]
Length=1050

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/526 (74%), Positives = 432/526 (82%), Gaps = 34/526 (6%)
 Frame = +2

Query  32    FTGGSH----LHAADHDERREVERES-QKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             F  GSH    LH    +E R   R+S  K+CR+C DEIG+ ENGE+FVAC ECGFPVC+P
Sbjct  9     FVAGSHSRNELHVMHANEERPPTRQSGSKLCRVCGDEIGLKENGELFVACHECGFPVCRP  68

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNH---------  349
             CY+YERSEG+QCCP CNTRYKRHKGC RV GD+ED+F+ +  ++    KNH         
Sbjct  69    CYEYERSEGSQCCPGCNTRYKRHKGCARVAGDEEDNFDDDFEDE---FKNHYDNQDHDQH  125

Query  350   ----PPLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRV  517
                    SENGD + NQ  +          P +  GSV GKD E + KE +S+AEW++RV
Sbjct  126   HHVTTTRSENGDNNQNQFLN---------GPGSFAGSVAGKDFEGD-KEGYSSAEWQERV  175

Query  518   EKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFR  697
             EKWK RQEKRGLVT+ DD      + DDDFLMA+ARQPLWRK+PI SS I+PYRIVI+ R
Sbjct  176   EKWKIRQEKRGLVTK-DDGGNDQGDGDDDFLMAEARQPLWRKVPIPSSKINPYRIVIILR  234

Query  698   LIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLR  877
             L IL FF  FRILTPAYDAFPLW+ISVICE+WF  SWILDQFPKW PI RETYLDRLS+R
Sbjct  235   LFILAFFLRFRILTPAYDAFPLWIISVICEVWFAFSWILDQFPKWFPITRETYLDRLSIR  294

Query  878   FERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASM  1057
             FER  EGE N LAPVDV+VSTVDPLKEPPIITANTVLSIL++DYPVDKVSCYVSDDGASM
Sbjct  295   FER--EGEPNRLAPVDVFVSTVDPLKEPPIITANTVLSILSMDYPVDKVSCYVSDDGASM  352

Query  1058  LLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREY  1237
             LLFD L+ETAEFARRWVPFCKKY IEPRAPEFYFS+KIDYLKDKVQPTFVK+RRAMKREY
Sbjct  353   LLFDALSETAEFARRWVPFCKKYIIEPRAPEFYFSQKIDYLKDKVQPTFVKDRRAMKREY  412

Query  1238  EEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELP  1417
             EE+KVR+NALV+KAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELP
Sbjct  413   EEFKVRINALVSKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELP  472

Query  1418  KLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             +LVYVSREKRPGY HHKKAGAMNALVRVSAVLTNAPF+LNLDCDHY
Sbjct  473   RLVYVSREKRPGYNHHKKAGAMNALVRVSAVLTNAPFILNLDCDHY  518



>gb|AGW52072.1| cellulose synthase 4 [Populus tomentosa]
Length=1042

 Score =   756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/517 (74%), Positives = 428/517 (83%), Gaps = 10/517 (2%)
 Frame = +2

Query  20    MAALFTGGSH-LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             MA L TG S  LHA D       +  + K CR+C DEIGV E+GEVFVAC  CGFPVC+P
Sbjct  1     MAGLVTGSSQTLHAKDELRPPTRQSATSKKCRVCGDEIGVKEDGEVFVACHVCGFPVCRP  60

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSENGD-  373
             CY+YERSEGNQ CP CNTRYKRHKGCPRV GD++D     D   +     H    E+   
Sbjct  61    CYEYERSEGNQSCPQCNTRYKRHKGCPRVPGDNDDEDANFDDFDDEFQIKHHDHDESNQK  120

Query  374   --YHNNQLPHHNTTNSAAFQPT-AAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEK  544
               + + ++ H+N       +P  ++ GSV GKDLE E KE +SNAEW++RVEKWK RQEK
Sbjct  121   NVFSHTEIEHYNEQEMHPIRPAFSSAGSVAGKDLEGE-KEGYSNAEWQERVEKWKVRQEK  179

Query  545   RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFH  724
             RGLV++  DD G    E+D++LMA+ARQPLWRK+PI SS I+PYRIVIV RLIILCFFF 
Sbjct  180   RGLVSK--DDGGNDQGEEDEYLMAEARQPLWRKIPIPSSRINPYRIVIVLRLIILCFFFR  237

Query  725   FRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGER  904
             FRILTPA DA+ LWLISVICE+WFGLSWILDQFPKW+PI RETYLDRLS+RFER  EGE 
Sbjct  238   FRILTPASDAYALWLISVICEVWFGLSWILDQFPKWNPIERETYLDRLSMRFER--EGEP  295

Query  905   NTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAET  1084
             N L PVDV+VSTVDPLKEPPII ANTVLSIL+VDYPVDKVSCYVSDDGASMLLFD+LAET
Sbjct  296   NRLGPVDVFVSTVDPLKEPPIIAANTVLSILSVDYPVDKVSCYVSDDGASMLLFDSLAET  355

Query  1085  AEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNA  1264
             AEFARRWVPFCKK+ IEPRAPEFYF++KIDYLKDKV P FVKERRAMKREYEE+KVR+NA
Sbjct  356   AEFARRWVPFCKKHNIEPRAPEFYFTQKIDYLKDKVHPNFVKERRAMKREYEEFKVRINA  415

Query  1265  LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREK  1444
             LV+KAQKKPEEGWVMQDGTPWPGN TRDHPGMIQVYLGSEGALDVEGKELP+LVYVSREK
Sbjct  416   LVSKAQKKPEEGWVMQDGTPWPGNITRDHPGMIQVYLGSEGALDVEGKELPRLVYVSREK  475

Query  1445  RPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             RPGY HHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  476   RPGYNHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  512



>ref|XP_007138849.1| hypothetical protein PHAVU_009G242700g [Phaseolus vulgaris]
 gb|ESW10843.1| hypothetical protein PHAVU_009G242700g [Phaseolus vulgaris]
Length=1048

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/524 (75%), Positives = 437/524 (83%), Gaps = 24/524 (5%)
 Frame = +2

Query  17    SMAALFTGGSHLH-AADHDERREVERE-SQKMCRICRDEIGVVENGEVFVACRECGFPVC  190
             SMA   TG SH H + D DE +   R+ S K CR+C DEIG  ENGEVFVAC  CGFPVC
Sbjct  5     SMAGFITG-SHAHFSPDSDEHQAPTRQPSSKTCRVCGDEIGYKENGEVFVACHVCGFPVC  63

Query  191   KPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSE--  364
             +PCY+YERSEGNQ CP CNTRYKRHKGCPRV GD+E+  + +DF+ EF  KNH    +  
Sbjct  64    RPCYEYERSEGNQSCPQCNTRYKRHKGCPRVAGDEEETLDADDFDDEFSIKNHREDLDRQ  123

Query  365   -------NGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEK  523
                    NGDY+  +L H N       Q  ++ GSV GKD  D +K+ +SNAEW++RVEK
Sbjct  124   HDANHVGNGDYNQEKL-HPNG------QAFSSAGSVTGKDF-DGEKDFYSNAEWQERVEK  175

Query  524   WKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLI  703
             WK RQEKRGL+ +  +D      EDDD+++A+ARQPLWRK+PISSSLI+PYRIVI+ RL+
Sbjct  176   WKVRQEKRGLLNK--EDGKEEQGEDDDYILAEARQPLWRKVPISSSLINPYRIVIIMRLV  233

Query  704   ILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFE  883
             IL FFF FRILTPA DA+ LWLISVICEIWF LSWILDQFPKW PI RETYLDRLSLRFE
Sbjct  234   ILAFFFRFRILTPANDAYALWLISVICEIWFALSWILDQFPKWFPITRETYLDRLSLRFE  293

Query  884   RDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLL  1063
             R  EGE N LAPVD +VSTVDPLKEPPIITANTVLSIL+VDYPV+KVSCYVSDDGASMLL
Sbjct  294   R--EGEPNQLAPVDFFVSTVDPLKEPPIITANTVLSILSVDYPVEKVSCYVSDDGASMLL  351

Query  1064  FDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEE  1243
             FD+LAETAEFARRWVPFCKKY IEPRAPE+YFS+KIDYLKDKVQPTFVKERR+MKREYEE
Sbjct  352   FDSLAETAEFARRWVPFCKKYNIEPRAPEYYFSQKIDYLKDKVQPTFVKERRSMKREYEE  411

Query  1244  YKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKL  1423
             +KV++N+LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS GALDVEGKELP+L
Sbjct  412   FKVKINSLVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSAGALDVEGKELPRL  471

Query  1424  VYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             VY+SREKRPGY HHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY
Sbjct  472   VYISREKRPGYPHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  515



>gb|AGW52073.1| cellulose synthase 4 [Populus tomentosa]
Length=1042

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/517 (74%), Positives = 428/517 (83%), Gaps = 10/517 (2%)
 Frame = +2

Query  20    MAALFTGGSH-LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             MA L TG S  LHA D       +  + K CR+C DEIGV E+GEVFVAC  CGFPVC+P
Sbjct  1     MAGLVTGSSQTLHAKDELRPPTRQSATSKKCRVCGDEIGVKEDGEVFVACHVCGFPVCRP  60

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSENGD-  373
             CY+YERSEGNQ CP CNTRYKRHKGCPRV GD++D     D   +     H    E+   
Sbjct  61    CYEYERSEGNQSCPQCNTRYKRHKGCPRVPGDNDDEDANFDDFDDEFQIKHHDHDESNQK  120

Query  374   --YHNNQLPHHNTTNSAAFQPT-AAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEK  544
               + + ++ H+N       +P  ++ GSV GKDLE E KE +SNAEW++RVEKWK RQEK
Sbjct  121   NVFSHTEIEHYNEQEMHPIRPAFSSAGSVAGKDLEGE-KEGYSNAEWQERVEKWKVRQEK  179

Query  545   RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFH  724
             RGLV++  DD G    E+D++LMA+ARQPLWRK+PI SS I+PYRIVIV RLIILCFFF 
Sbjct  180   RGLVSK--DDGGNDQGEEDEYLMAEARQPLWRKIPIPSSRINPYRIVIVLRLIILCFFFR  237

Query  725   FRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGER  904
             FRILTPA DA+ LWLISVICE+WFGLSWILDQFPKW+PI RETYLDRLS+RFER  EGE 
Sbjct  238   FRILTPASDAYALWLISVICEVWFGLSWILDQFPKWNPIERETYLDRLSMRFER--EGEP  295

Query  905   NTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAET  1084
             N L PVDV+VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASMLLFD+LAET
Sbjct  296   NRLGPVDVFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASMLLFDSLAET  355

Query  1085  AEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNA  1264
             AEFARRWVPFCKK+ IEPRAPEFYF++KIDYLKDKV P FVKERRAMKREYEE+KVR+NA
Sbjct  356   AEFARRWVPFCKKHNIEPRAPEFYFTQKIDYLKDKVHPNFVKERRAMKREYEEFKVRINA  415

Query  1265  LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREK  1444
             LV+KAQKKPEEGWVMQDGTPWPGN TRDHPGMI VYLGSEGALDVEGKELP+LVYVSREK
Sbjct  416   LVSKAQKKPEEGWVMQDGTPWPGNITRDHPGMIHVYLGSEGALDVEGKELPRLVYVSREK  475

Query  1445  RPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             RPGY HHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  476   RPGYNHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  512



>gb|AGW52047.1| cellulose synthase 4 [Populus tomentosa]
 gb|AGW52068.1| cellulose synthase 4 [Populus tomentosa]
Length=1042

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/517 (74%), Positives = 428/517 (83%), Gaps = 10/517 (2%)
 Frame = +2

Query  20    MAALFTGGSH-LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             MA L TG S  LHA D       +  + K CR+C DEIGV E+GEVFVAC  CGFPVC+P
Sbjct  1     MAGLVTGSSQTLHAKDELRPPTRQSATSKKCRVCGDEIGVKEDGEVFVACHVCGFPVCRP  60

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSENGD-  373
             CY+YERSEGNQ CP CNTRYKRHKGCPRV GD++D     D   +     H    E+   
Sbjct  61    CYEYERSEGNQSCPQCNTRYKRHKGCPRVPGDNDDEDANFDDFDDEFQIKHHDHDESNQK  120

Query  374   --YHNNQLPHHNTTNSAAFQPT-AAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEK  544
               + + ++ H+N       +P  ++ GSV GKDLE E KE +SNAEW++RVEKWK RQEK
Sbjct  121   NVFSHTEIEHYNEQEMHPIRPAFSSAGSVAGKDLEGE-KEGYSNAEWQERVEKWKVRQEK  179

Query  545   RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFH  724
             RGLV++  DD G    E+D++LMA+ARQPLWRK+PI SS I+PYRIVIV RLIILCFFF 
Sbjct  180   RGLVSK--DDGGNDQGEEDEYLMAEARQPLWRKIPIPSSRINPYRIVIVLRLIILCFFFR  237

Query  725   FRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGER  904
             FRILTPA DA+ LWLISVICE+WFGLSWILDQFPKW+PI RETYLDRLS+RFER  EGE 
Sbjct  238   FRILTPASDAYALWLISVICEVWFGLSWILDQFPKWNPIERETYLDRLSMRFER--EGEP  295

Query  905   NTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAET  1084
             N L PVDV+VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASMLLFD+LAET
Sbjct  296   NRLGPVDVFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASMLLFDSLAET  355

Query  1085  AEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNA  1264
             AEFARRWVPFCKK+ IEPRAPEFYF++KIDYLKDKV P FVKERRAMKREYEE+KVR+NA
Sbjct  356   AEFARRWVPFCKKHNIEPRAPEFYFTQKIDYLKDKVHPNFVKERRAMKREYEEFKVRINA  415

Query  1265  LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREK  1444
             LV+KAQKKPEEGWVMQDGTPWPGN TRDHPGMI VYLGSEGALDVEGKELP+LVYVSREK
Sbjct  416   LVSKAQKKPEEGWVMQDGTPWPGNITRDHPGMIHVYLGSEGALDVEGKELPRLVYVSREK  475

Query  1445  RPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             RPGY HHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  476   RPGYNHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  512



>gb|AGW52061.1| cellulose synthase 4 [Populus tomentosa]
Length=1042

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/517 (74%), Positives = 431/517 (83%), Gaps = 10/517 (2%)
 Frame = +2

Query  20    MAALFTGGSH-LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             MA L TG S  LHA D       +  + K CR+C DE+GV E+GEVFVAC  CGFPVC+P
Sbjct  1     MAGLVTGSSQTLHAKDELRPPTRQSATSKKCRVCGDEVGVKEDGEVFVACHVCGFPVCRP  60

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedf---eqefeTKNHPPLSEN  367
             CY+YERSEGNQ CP CNTRYKRHKGCPRV GD++D     D    E + +  +H   ++ 
Sbjct  61    CYEYERSEGNQSCPQCNTRYKRHKGCPRVPGDNDDEDANFDDFDDEFQIKNHDHDESNQK  120

Query  368   GDYHNNQLPHHNTTNSAAFQPT-AAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEK  544
               + + ++ H+N       +P  ++ GSV GKDLE E KE +SNAEW++RVEKWK RQEK
Sbjct  121   NVFSHTEIEHYNEQEMHPIRPAFSSAGSVAGKDLEGE-KEGYSNAEWQERVEKWKVRQEK  179

Query  545   RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFH  724
             RGLV++  DD G    E+D++LMA+ARQPLWRK+PI SS I+PYRIVIV RLIILCFFF 
Sbjct  180   RGLVSK--DDGGNDQGEEDEYLMAEARQPLWRKIPIPSSRINPYRIVIVLRLIILCFFFR  237

Query  725   FRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGER  904
             FRILTPA DA+ LWLISVICE+WFGLSWILDQFPKW+PI RETYLDRLS+RFER  EGE 
Sbjct  238   FRILTPASDAYALWLISVICEVWFGLSWILDQFPKWNPIERETYLDRLSMRFER--EGEP  295

Query  905   NTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAET  1084
             N L PVDV+VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASMLLFD+LAET
Sbjct  296   NRLGPVDVFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASMLLFDSLAET  355

Query  1085  AEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNA  1264
             AEFARRWVPFCKK+ IEPRAPEFYF++KIDYLKDKV P FVKERRAMKREYEE+KVR+NA
Sbjct  356   AEFARRWVPFCKKHNIEPRAPEFYFTQKIDYLKDKVHPNFVKERRAMKREYEEFKVRINA  415

Query  1265  LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREK  1444
             LV+KAQKKPEEGWVMQDGTPWPGN TRDHPGMI VYLGSEGALDVEGKELP+LVYVSREK
Sbjct  416   LVSKAQKKPEEGWVMQDGTPWPGNITRDHPGMIHVYLGSEGALDVEGKELPRLVYVSREK  475

Query  1445  RPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             RPGY HHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  476   RPGYNHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  512



>ref|XP_004140572.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming]-like 
[Cucumis sativus]
 ref|XP_004157586.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming]-like 
[Cucumis sativus]
 gb|KGN46380.1| hypothetical protein Csa_6G088080 [Cucumis sativus]
Length=1041

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/522 (75%), Positives = 436/522 (84%), Gaps = 22/522 (4%)
 Frame = +2

Query  20    MAALFTGGSHL-HAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             MA L TG  H  H  D   R      S K+CR+C DEIG+ E+G+VF+AC  C FPVC+P
Sbjct  1     MAGLVTGSQHYPHVVDESHRGP--PLSSKICRVCGDEIGLKEDGKVFLACLACNFPVCRP  58

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNH---------  349
             CY+YERSEGN+CCP CNTRYKRHKG PRV+GDDE+  + +DFE EF  K++         
Sbjct  59    CYEYERSEGNKCCPQCNTRYKRHKGSPRVIGDDEEADDADDFEDEFPIKHNKNDEFQAKQ  118

Query  350   PPLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWK  529
             P  SEN D +N+Q  H N  +S      +  GSV GKD+E E++  + + EWK+R++KWK
Sbjct  119   PNHSEN-DGYNDQNWHKNVQSS-----FSVAGSVNGKDMEGEKEGGYGSVEWKERIDKWK  172

Query  530   TRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIIL  709
              RQEKRGL  +  +D    D E+DD+L+A+ARQPLWRKLPISSS ISPYRIVIV RL+IL
Sbjct  173   VRQEKRGLGNK--EDGSNNDQEEDDYLLAEARQPLWRKLPISSSKISPYRIVIVLRLVIL  230

Query  710   CFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERD  889
              FFF FRILTPAYDAFPLWLISVICEIWFG SWILDQFPKW+PINRETYLDRLS+RFER 
Sbjct  231   AFFFRFRILTPAYDAFPLWLISVICEIWFGFSWILDQFPKWAPINRETYLDRLSMRFER-  289

Query  890   GEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFD  1069
              EGE N L+PVD +VSTVDPLKEPPIITANTVLSILAVDYPV+KVSCYVSDDGASMLLFD
Sbjct  290   -EGEPNLLSPVDFFVSTVDPLKEPPIITANTVLSILAVDYPVEKVSCYVSDDGASMLLFD  348

Query  1070  TLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYK  1249
             TLAETAEFARRWVPFCKK+ IEPRAPEFYFS+K+DYLKDKV P+FVKERRAMKREYEE+K
Sbjct  349   TLAETAEFARRWVPFCKKFSIEPRAPEFYFSQKMDYLKDKVLPSFVKERRAMKREYEEFK  408

Query  1250  VRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVY  1429
             VR+NALVAKAQKKPEEGWVMQDGTPWPGN TRDHPGMIQVYLGSEGALDVEGKELP+LVY
Sbjct  409   VRINALVAKAQKKPEEGWVMQDGTPWPGNLTRDHPGMIQVYLGSEGALDVEGKELPRLVY  468

Query  1430  VSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             VSREKRPGYQHHKKAGAMNALVRVSAVLTNAPF+LNLDCDHY
Sbjct  469   VSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFILNLDCDHY  510



>ref|XP_006479463.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming]-like 
isoform X1 [Citrus sinensis]
Length=1051

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/527 (73%), Positives = 432/527 (82%), Gaps = 35/527 (7%)
 Frame = +2

Query  32    FTGGSH----LHA--ADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCK  193
             F  GSH    LH   A+ ++R    +   K+CR+C DEIG+ ENGE+FVAC ECGFPVC+
Sbjct  9     FVAGSHSRNELHVMHANEEQRPPTRQSGSKLCRVCGDEIGLKENGELFVACHECGFPVCR  68

Query  194   PCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNH--------  349
             PCY+YERSEG+QCCP CNTRYKRHKGC RV GD+ED+F+ +  ++    KNH        
Sbjct  69    PCYEYERSEGSQCCPGCNTRYKRHKGCARVAGDEEDNFDDDFEDE---FKNHFDNQDHDQ  125

Query  350   -----PPLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDR  514
                     SENGD + NQ  +          P +  GSV GKD E + KE +S+AEW++R
Sbjct  126   HHHVTTTRSENGDNNQNQFLN---------GPGSFAGSVAGKDFEGD-KEGYSSAEWQER  175

Query  515   VEKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVF  694
             VEKWK RQEKRGLVT+ DD      + DDDFLMA+ARQPLWRK+PI SS I+PYRIVI+ 
Sbjct  176   VEKWKIRQEKRGLVTK-DDGGNDQGDGDDDFLMAEARQPLWRKVPIPSSKINPYRIVIIL  234

Query  695   RLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSL  874
             RL IL FF  FRILTPAYDAFPLW+ISVICE+WF  SWILDQFPKW PI RETYLDRLS+
Sbjct  235   RLFILAFFLRFRILTPAYDAFPLWIISVICEVWFAFSWILDQFPKWFPITRETYLDRLSI  294

Query  875   RFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGAS  1054
             RFER  EGE N LAPVDV+VSTVDPLKEPPIITANTVLSIL++DYPVDKVSCYVSDDGAS
Sbjct  295   RFER--EGEPNRLAPVDVFVSTVDPLKEPPIITANTVLSILSMDYPVDKVSCYVSDDGAS  352

Query  1055  MLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKRE  1234
             MLLFD L+ETAEFARRWVPFCKKY IEPRAPEFYFS+KIDYLKDKVQPTFVK+RRAMKRE
Sbjct  353   MLLFDALSETAEFARRWVPFCKKYIIEPRAPEFYFSQKIDYLKDKVQPTFVKDRRAMKRE  412

Query  1235  YEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKEL  1414
             YEE+KVR+NALV+KAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKEL
Sbjct  413   YEEFKVRINALVSKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKEL  472

Query  1415  PKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             P+LVYVSREKRPGY HHKKAGAMNALVRVSAVLTNAPF+LNLDCDHY
Sbjct  473   PRLVYVSREKRPGYNHHKKAGAMNALVRVSAVLTNAPFILNLDCDHY  519



>gb|KDO60379.1| hypothetical protein CISIN_1g001574mg [Citrus sinensis]
Length=1051

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/527 (73%), Positives = 432/527 (82%), Gaps = 35/527 (7%)
 Frame = +2

Query  32    FTGGSH----LHA--ADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCK  193
             F  GSH    LH   A+ ++R    +   K+CR+C DEIG+ ENGE+FVAC ECGFPVC+
Sbjct  9     FVAGSHSRNELHVMHANEEQRPPTRQSGSKLCRVCGDEIGLKENGELFVACHECGFPVCR  68

Query  194   PCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNH--------  349
             PCY+YERSEG+QCCP CNTRYKRHKGC RV GD+ED+F+ +  ++    KNH        
Sbjct  69    PCYEYERSEGSQCCPGCNTRYKRHKGCARVAGDEEDNFDDDFEDE---FKNHYDNQDHDQ  125

Query  350   -----PPLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDR  514
                     SENGD + NQ  +          P +  GSV GKD E + KE +S+AEW++R
Sbjct  126   HHHVTTTRSENGDNNQNQFLN---------GPGSFAGSVAGKDFEGD-KEGYSSAEWQER  175

Query  515   VEKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVF  694
             VEKWK RQEKRGLVT+ DD      + DDDFLMA+ARQPLWRK+PI SS I+PYRIVI+ 
Sbjct  176   VEKWKIRQEKRGLVTK-DDGGNDQGDGDDDFLMAEARQPLWRKVPIPSSKINPYRIVIIL  234

Query  695   RLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSL  874
             RL IL FF  FRILTPAYDAFPLW+ISVICE+WF  SWILDQFPKW PI RETYLDRLS+
Sbjct  235   RLFILAFFLRFRILTPAYDAFPLWIISVICEVWFAFSWILDQFPKWFPITRETYLDRLSI  294

Query  875   RFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGAS  1054
             RFER  EGE N LAPVDV+VSTVDPLKEPPIITANTVLSIL++DYPVDKVSCYVSDDGAS
Sbjct  295   RFER--EGEPNRLAPVDVFVSTVDPLKEPPIITANTVLSILSMDYPVDKVSCYVSDDGAS  352

Query  1055  MLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKRE  1234
             MLLFD L+ETAEFARRWVPFCKKY IEPRAPEFYFS+KIDYLKDKVQPTFVK+RRAMKRE
Sbjct  353   MLLFDALSETAEFARRWVPFCKKYIIEPRAPEFYFSQKIDYLKDKVQPTFVKDRRAMKRE  412

Query  1235  YEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKEL  1414
             YEE+KVR+NALV+KAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKEL
Sbjct  413   YEEFKVRINALVSKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKEL  472

Query  1415  PKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             P+LVYVSREKRPGY HHKKAGAMNALVRVSAVLTNAPF+LNLDCDHY
Sbjct  473   PRLVYVSREKRPGYNHHKKAGAMNALVRVSAVLTNAPFILNLDCDHY  519



>gb|AGW52070.1| cellulose synthase 4 [Populus tomentosa]
Length=1042

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/517 (74%), Positives = 431/517 (83%), Gaps = 10/517 (2%)
 Frame = +2

Query  20    MAALFTGGSH-LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             MA L TG S  LHA D       +  + K CR+C DEIGV E+GEVFVAC  CGFPVC+P
Sbjct  1     MAGLVTGSSQTLHAKDELRPPTRQSATSKKCRVCGDEIGVKEDGEVFVACHVCGFPVCRP  60

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedf---eqefeTKNHPPLSEN  367
             C +YERSEGNQ CP CNTRYKRHKGCPRV GD++D     D    E + +  +H   ++ 
Sbjct  61    CCEYERSEGNQSCPQCNTRYKRHKGCPRVPGDNDDEDANFDDFDDEFQIKNHDHDESNQK  120

Query  368   GDYHNNQLPHHNTTNSAAFQPT-AAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEK  544
               + + ++ H+N       +P  ++ GSV GKDLE E KE +SNAEW++RVEKWK RQEK
Sbjct  121   NVFSHTEIEHYNEQEMHPIRPAFSSAGSVAGKDLEGE-KEGYSNAEWQERVEKWKVRQEK  179

Query  545   RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFH  724
             RGLV++  DD G    E+D++LMA+ARQPLWRK+PI SS I+PYRIVIV RLIILCFFF 
Sbjct  180   RGLVSK--DDGGNDQGEEDEYLMAEARQPLWRKIPIPSSRINPYRIVIVLRLIILCFFFR  237

Query  725   FRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGER  904
             FRILTPA DA+ LWLISVICE+WFGLSWILDQFPKW+PI RETYLDRLS+RFER  EGE 
Sbjct  238   FRILTPASDAYALWLISVICEVWFGLSWILDQFPKWNPIERETYLDRLSMRFER--EGEP  295

Query  905   NTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAET  1084
             N L PVDV+VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASMLLFD+LAET
Sbjct  296   NRLGPVDVFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASMLLFDSLAET  355

Query  1085  AEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNA  1264
             AEFARRWVPFCKK+ IEPRAPEFYF++KIDYLKDKV P FVKERRAMKREYEE+KVR+NA
Sbjct  356   AEFARRWVPFCKKHNIEPRAPEFYFTQKIDYLKDKVHPNFVKERRAMKREYEEFKVRINA  415

Query  1265  LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREK  1444
             LV+KAQKKPEEGWVMQDGTPWPGN TRDHPGMIQVYLGSEGALDVEGKELP+LVYVSREK
Sbjct  416   LVSKAQKKPEEGWVMQDGTPWPGNITRDHPGMIQVYLGSEGALDVEGKELPRLVYVSREK  475

Query  1445  RPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             RPGY HHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  476   RPGYNHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  512



>gb|AGW52062.1| cellulose synthase 4 [Populus tomentosa]
Length=1042

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/518 (75%), Positives = 432/518 (83%), Gaps = 12/518 (2%)
 Frame = +2

Query  20    MAALFTGGSHLHAADHDERREVERES--QKMCRICRDEIGVVENGEVFVACRECGFPVCK  193
             MA L TG S    A  DE R   R+S   K CR+C DEIGV E+GEVFVAC  CGFPVC+
Sbjct  1     MAGLVTGSSQTLQA-KDELRPPTRQSATSKKCRVCGDEIGVKEDGEVFVACHVCGFPVCR  59

Query  194   PCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedf---eqefeTKNHPPLSE  364
             PCY+YERSEGNQ CP CNTRYKRHKGCPRV GD++D     D    E + +  +H   ++
Sbjct  60    PCYEYERSEGNQSCPQCNTRYKRHKGCPRVPGDNDDEDANFDDFDDEFQIKNHDHDESNQ  119

Query  365   NGDYHNNQLPHHNTTNSAAFQPT-AAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQE  541
                + + ++ H+N       +P  ++ GSV GKDLE E KE +SNAEW++RVEKWK RQE
Sbjct  120   KNVFSHTEIEHYNEQEMHPIRPAFSSAGSVAGKDLEGE-KEGYSNAEWQERVEKWKVRQE  178

Query  542   KRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFF  721
             KRGLV++  DD G    E+D++LMA+ARQPLWRK+PI SS I+PYRIVIV RLIILCFFF
Sbjct  179   KRGLVSK--DDGGNDQGEEDEYLMAEARQPLWRKIPIPSSRINPYRIVIVLRLIILCFFF  236

Query  722   HFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGE  901
              FRILTPA DA+ LWLISVICE+WFGLSWILDQFPKW+PI RETYLDRLS+RFER  EGE
Sbjct  237   RFRILTPASDAYALWLISVICEVWFGLSWILDQFPKWNPIERETYLDRLSMRFER--EGE  294

Query  902   RNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAE  1081
              N L PVDV+VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASMLLFD+LAE
Sbjct  295   PNRLGPVDVFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASMLLFDSLAE  354

Query  1082  TAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVN  1261
             TAEFARRWVPFCKK+ IEPRAPEFYF++KIDYLKDKV P FVKERRAMKREYEE+KVR+N
Sbjct  355   TAEFARRWVPFCKKHNIEPRAPEFYFTQKIDYLKDKVHPNFVKERRAMKREYEEFKVRIN  414

Query  1262  ALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSRE  1441
             ALV+KAQKKPEEGWVMQDGTPWPGN TRDHPGMIQVYLGSE ALDVEGKELP+LVYVSRE
Sbjct  415   ALVSKAQKKPEEGWVMQDGTPWPGNITRDHPGMIQVYLGSESALDVEGKELPRLVYVSRE  474

Query  1442  KRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             KRPGY HHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  475   KRPGYNHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  512



>gb|AEE60895.1| cellulose synthase [Populus tomentosa]
Length=1042

 Score =   753 bits (1943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/517 (74%), Positives = 429/517 (83%), Gaps = 10/517 (2%)
 Frame = +2

Query  20    MAALFTGGSH-LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             MA L TG S  LHA D       +  + K CR+C DEIGV E+GEVFVAC  CGFPVC+P
Sbjct  1     MAGLVTGSSQTLHAKDELMPPTRQSATSKKCRVCGDEIGVKEDGEVFVACHVCGFPVCRP  60

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSENGD-  373
             CY+YERSEGNQ CP CNTRYKRHKGCPRV GD++D     D   +     H    E+   
Sbjct  61    CYEYERSEGNQSCPQCNTRYKRHKGCPRVPGDNDDEDANFDDFDDEFQIKHHDHDESNQK  120

Query  374   --YHNNQLPHHNTTNSAAFQPT-AAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEK  544
               + + ++ H+N       +P  ++ GSV GKDLE + KE +SNAEW++RVEKWK RQEK
Sbjct  121   NVFSHTEIEHYNEQEMHPIRPAFSSAGSVAGKDLEGD-KEGYSNAEWQERVEKWKVRQEK  179

Query  545   RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFH  724
             RGLV++  D+ G    E+D++LMA+ARQPLWRK+PI SS I+PYRIVIV RLIILCFFF 
Sbjct  180   RGLVSK--DEGGNDQGEEDEYLMAEARQPLWRKIPIPSSRINPYRIVIVLRLIILCFFFR  237

Query  725   FRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGER  904
             FRILTPA DA+ LWLISVICE+WFGLSWILDQFPKW+PI RETYLDRLS+RFER  EGE 
Sbjct  238   FRILTPASDAYALWLISVICEVWFGLSWILDQFPKWNPIERETYLDRLSMRFER--EGEP  295

Query  905   NTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAET  1084
             N L PVDV+VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASMLLFD+LAET
Sbjct  296   NRLGPVDVFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASMLLFDSLAET  355

Query  1085  AEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNA  1264
             AEFARRWVPFCKK+ IEPRAPEFYF++KIDYLKDKV P FVKERRAMKREYEE+KVR+NA
Sbjct  356   AEFARRWVPFCKKHNIEPRAPEFYFTQKIDYLKDKVHPNFVKERRAMKREYEEFKVRINA  415

Query  1265  LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREK  1444
             LV+KAQKKPEEGWVMQDGTPWPGN TRDHPGMIQVYLGSEGALDVEGKELP+LVYVSREK
Sbjct  416   LVSKAQKKPEEGWVMQDGTPWPGNITRDHPGMIQVYLGSEGALDVEGKELPRLVYVSREK  475

Query  1445  RPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             RPGY HHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  476   RPGYNHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  512



>gb|AGW52039.1| cellulose synthase 4 [Populus alba x Populus glandulosa]
Length=1042

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/517 (74%), Positives = 431/517 (83%), Gaps = 10/517 (2%)
 Frame = +2

Query  20    MAALFTGGSH-LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             MA L TG S  LHA D       +  + K CR+C DEIGV E+GEVFVAC  CGFPVC+P
Sbjct  1     MAGLVTGSSQTLHAKDELRPPTRQSATSKKCRVCGDEIGVKEDGEVFVACHVCGFPVCRP  60

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedf---eqefeTKNHPPLSEN  367
             CY+YERSEGNQ CP CNTRYKRHKGCPRV GD++D     D    E + +  +H   ++ 
Sbjct  61    CYEYERSEGNQSCPQCNTRYKRHKGCPRVPGDNDDEDANFDDFDDEFQIKNHDHDESNQK  120

Query  368   GDYHNNQLPHHNTTNSAAFQPT-AAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEK  544
               + + ++ H+N       +P  ++ GSV GKDLE + KE +SNAEW++RVEKWK RQEK
Sbjct  121   NVFSHTEIEHYNEQEMHPIRPAFSSAGSVAGKDLEGD-KEGYSNAEWQERVEKWKVRQEK  179

Query  545   RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFH  724
             RGLV++  D+ G    E+D++LMA+ARQPLWRK+PI SS I+PYRIVIV RLIILC FF 
Sbjct  180   RGLVSK--DEGGNDQGEEDEYLMAEARQPLWRKIPIPSSRINPYRIVIVLRLIILCLFFR  237

Query  725   FRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGER  904
             FRILTPA DA+ LWLISVICE+WFGLSWILDQFPKW+PI RETYLDRLS+RFER  EGE 
Sbjct  238   FRILTPASDAYALWLISVICEVWFGLSWILDQFPKWNPIERETYLDRLSMRFER--EGEP  295

Query  905   NTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAET  1084
             N L PVDV+VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASMLLFD+LAET
Sbjct  296   NRLGPVDVFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASMLLFDSLAET  355

Query  1085  AEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNA  1264
             AEFARRWVPFCKK+ IEPRAPEFYF++KIDYLKDKV P FVKERRAMKREYEE+KVR+NA
Sbjct  356   AEFARRWVPFCKKHNIEPRAPEFYFTQKIDYLKDKVHPNFVKERRAMKREYEEFKVRINA  415

Query  1265  LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREK  1444
             LV+KAQKKPEEGWVMQDGTPWPGN TRDHPGMIQVYLGSEGALDVEGKELP+LVYVSREK
Sbjct  416   LVSKAQKKPEEGWVMQDGTPWPGNITRDHPGMIQVYLGSEGALDVEGKELPRLVYVSREK  475

Query  1445  RPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             RPGY HHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  476   RPGYNHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  512



>ref|XP_008459950.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
[Cucumis melo]
Length=1040

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/522 (75%), Positives = 436/522 (84%), Gaps = 22/522 (4%)
 Frame = +2

Query  20    MAALFTGGSHL-HAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             MA L TG  H  H  D   R      S K+CR+C DEIG+ E+G+VFVAC  C FPVC+P
Sbjct  1     MAGLVTGSQHYPHVVDESHRGP--PLSSKICRVCSDEIGLKEDGKVFVACLACNFPVCRP  58

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNH---------  349
             CY+YERSEGN+CCP CNTRYKRHKG PRV+GDDE+  E +DF+ EF  K++         
Sbjct  59    CYEYERSEGNKCCPQCNTRYKRHKGSPRVIGDDEEGDEADDFDDEFPIKHNKNDEFQAKQ  118

Query  350   PPLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWK  529
             P  SEN D +N+Q  H N  +S      +  GSV GKD+E E++  + + EWK+R++KWK
Sbjct  119   PNHSEN-DRYNDQNWHKNVQSS-----FSVAGSVNGKDMEGEKEGGYGSVEWKERIDKWK  172

Query  530   TRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIIL  709
              RQEKRGL  +  +D    D E+DD+L+A+ARQPLWRKLPISSS ISPYRIVIV RL+IL
Sbjct  173   VRQEKRGLGNK--EDGSNNDQEEDDYLLAEARQPLWRKLPISSSKISPYRIVIVLRLVIL  230

Query  710   CFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERD  889
              FFF FRILTPAYDAFPLWLISVICEIWFG SWILDQFPKW+PINRETYLDRLS+RFER 
Sbjct  231   AFFFRFRILTPAYDAFPLWLISVICEIWFGFSWILDQFPKWAPINRETYLDRLSMRFER-  289

Query  890   GEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFD  1069
              EGE N L+P+D +VSTVDPLKEPPIITANTVLSIL+VDYPV+KVSCYVSDDGASMLLFD
Sbjct  290   -EGEPNRLSPIDFFVSTVDPLKEPPIITANTVLSILSVDYPVEKVSCYVSDDGASMLLFD  348

Query  1070  TLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYK  1249
             TLAETAEFARRWVPFCKK+ IEPRAPEFYFS+K+DYLKDKV P+FVKERRAMKREYEE+K
Sbjct  349   TLAETAEFARRWVPFCKKFSIEPRAPEFYFSQKMDYLKDKVLPSFVKERRAMKREYEEFK  408

Query  1250  VRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVY  1429
             VRVNALVAKAQKKPEEGWVMQDGTPWPGN TRDHPGMIQVYLGSEGALDVEGKELP+LVY
Sbjct  409   VRVNALVAKAQKKPEEGWVMQDGTPWPGNLTRDHPGMIQVYLGSEGALDVEGKELPRLVY  468

Query  1430  VSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             VSREKRPGYQHHKKAGAMNALVRVSAVLTNAPF+LNLDCDHY
Sbjct  469   VSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFILNLDCDHY  510



>gb|AGW52038.1| cellulose synthase 4 [Populus alba x Populus glandulosa]
Length=1042

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/517 (74%), Positives = 431/517 (83%), Gaps = 10/517 (2%)
 Frame = +2

Query  20    MAALFTGGSH-LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             MA L TG S  LHA D       +  + K CR+C DEIGV E+GEVFVAC  CGFPVC+P
Sbjct  1     MAGLVTGSSQALHAKDELRPPTRQSATSKKCRVCGDEIGVKEDGEVFVACHVCGFPVCRP  60

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedf---eqefeTKNHPPLSEN  367
             CY+YERSEGNQ CP CNTRYKRHKGCPRV GD++D     D    E + +  +H   ++ 
Sbjct  61    CYEYERSEGNQSCPQCNTRYKRHKGCPRVPGDNDDEDANFDDFDDEFQIKNHDHDESNQK  120

Query  368   GDYHNNQLPHHNTTNSAAFQPT-AAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEK  544
               + + ++ H+N       +P  ++ GSV GKDLE + KE +SNAEW++RVEKWK RQEK
Sbjct  121   NVFSHTEIEHYNEQEMHPIRPAFSSAGSVAGKDLEGD-KEGYSNAEWQERVEKWKVRQEK  179

Query  545   RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFH  724
             RGLV++  D+ G    E+D++LMA+ARQPLWRK+PI SS I+PYRIVIV RLIILC FF 
Sbjct  180   RGLVSK--DEGGNDQGEEDEYLMAEARQPLWRKIPIPSSRINPYRIVIVLRLIILCLFFR  237

Query  725   FRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGER  904
             FRILTPA DA+ LWLISVICE+WFGLSWILDQFPKW+PI RETYLDRLS+RFER  EGE 
Sbjct  238   FRILTPASDAYALWLISVICEVWFGLSWILDQFPKWNPIERETYLDRLSMRFER--EGEP  295

Query  905   NTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAET  1084
             N L PVDV+VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASMLLFD+LAET
Sbjct  296   NRLGPVDVFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASMLLFDSLAET  355

Query  1085  AEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNA  1264
             AEFARRWVPFCKK+ IEPRAPEFYF++KIDYLKDKV P FVKERRAMKREYEE+KVR+NA
Sbjct  356   AEFARRWVPFCKKHNIEPRAPEFYFTQKIDYLKDKVHPNFVKERRAMKREYEEFKVRINA  415

Query  1265  LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREK  1444
             LV+KAQKKPEEGWVMQDGTPWPGN TRDHPGMIQVYLGSEGALDVEGKELP+LVYVSREK
Sbjct  416   LVSKAQKKPEEGWVMQDGTPWPGNITRDHPGMIQVYLGSEGALDVEGKELPRLVYVSREK  475

Query  1445  RPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             RPGY HHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  476   RPGYNHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  512



>ref|XP_008235611.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
[Prunus mume]
Length=1056

 Score =   751 bits (1940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/530 (73%), Positives = 432/530 (82%), Gaps = 29/530 (5%)
 Frame = +2

Query  17    SMAALFTGG---SHLHAADH-DERREVERES---QKMCRICRDEIGVVENGEVFVACREC  175
             +MA LFTG      LH  +  +E R   R+S    K+CR+C D+IG  E+GE+FVAC  C
Sbjct  5     TMAGLFTGSHARDELHVVNGTEENRPPTRQSVSSSKVCRVCGDDIGYKEDGELFVACHVC  64

Query  176   GFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPP  355
             GFPVC+PCY YERSEGNQ CP CNTRYKR K CPRV GD+ED    +  ++     +H  
Sbjct  65    GFPVCRPCYDYERSEGNQSCPQCNTRYKRQKCCPRVAGDEEDFDADDYDDEFQIKIDHHD  124

Query  356   ----------LSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEW  505
                        SENG+ H  Q  HHN       QP +  GSV GKD E E KEV SNAEW
Sbjct  125   ESTEKNNFVNHSENGE-HTQQQWHHND------QPFSVGGSVAGKDFEGE-KEVLSNAEW  176

Query  506   KDRVEKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIV  685
             KDRVEKWK RQEK+GLV +  DD+      +DDFL+A+ARQPLWRK+P+SSS ISPYRIV
Sbjct  177   KDRVEKWKVRQEKKGLVNK--DDRNDDQGYEDDFLLAEARQPLWRKVPVSSSKISPYRIV  234

Query  686   IVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDR  865
             IV RL+IL FFF FRILTPAYDA+PLW+ISVICEIWF  SWILDQFPKW+PINRETYLDR
Sbjct  235   IVCRLVILAFFFRFRILTPAYDAYPLWIISVICEIWFAFSWILDQFPKWNPINRETYLDR  294

Query  866   LSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDD  1045
             L++RFER  EGE NTL+ VDVYVSTVDPLKEPPIITANTVLSIL+VDYPVDK+ CYVSDD
Sbjct  295   LTIRFER--EGEPNTLSSVDVYVSTVDPLKEPPIITANTVLSILSVDYPVDKICCYVSDD  352

Query  1046  GASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAM  1225
             GASMLLFD+L+ETAEFARRWVPFCKK+ +EPRAPEFYFS+KIDYLKDKV P FVKERRAM
Sbjct  353   GASMLLFDSLSETAEFARRWVPFCKKHNVEPRAPEFYFSQKIDYLKDKVHPNFVKERRAM  412

Query  1226  KREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEG  1405
             KREYEE+KVR+NALV+KAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDV+G
Sbjct  413   KREYEEFKVRINALVSKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVDG  472

Query  1406  KELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             KELP+LVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY
Sbjct  473   KELPRLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  522



>gb|EYU46412.1| hypothetical protein MIMGU_mgv1a000605mg [Erythranthe guttata]
Length=1047

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/515 (74%), Positives = 433/515 (84%), Gaps = 7/515 (1%)
 Frame = +2

Query  20    MAALFTGGSHLH-AADHDERREVERESQKMCRICRDEIGVV-ENGEVFVACRECGFPVCK  193
             MAALFTG   LH ++D  +   +   + K+CRIC DEIG++ E+GE FVAC ECGFPVC+
Sbjct  1     MAALFTGSRVLHTSSDEHDGHPMPESTAKICRICGDEIGILQESGEAFVACHECGFPVCR  60

Query  194   PCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSENGD  373
             PCY YERS+G+Q CP C+TRYKRHKGCP+  GD+E+ +  +  +Q    KNH   + +  
Sbjct  61    PCYDYERSDGHQTCPQCHTRYKRHKGCPKADGDEEEAYYDDFEDQIE-LKNHHDYTPDPA  119

Query  374   YHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGL  553
             +H+      N  +       +  GSV GKD E E KE   N EWK+R+EKWK+RQEKRGL
Sbjct  120   HHSEVKFSQNQIHINGDTIPSVAGSVTGKDFEGE-KESPDNEEWKERMEKWKSRQEKRGL  178

Query  554   VTR-FdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFR  730
             VT+  D      D++DDDFL+A+ARQPLWRK+PI S LISPYRIVIV R +ILCFFFHFR
Sbjct  179   VTKTGDGGNDKNDDDDDDFLIAEARQPLWRKVPIPSRLISPYRIVIVVRFVILCFFFHFR  238

Query  731   ILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNT  910
             ILTPA DA+PLW+ISVICEIWFGLSWILDQFPKW+PINRETYLDRLSLRFER+GE +R  
Sbjct  239   ILTPAQDAYPLWIISVICEIWFGLSWILDQFPKWAPINRETYLDRLSLRFEREGEPDR--  296

Query  911   LAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAE  1090
             LAPVD +VS+VDPLKEPPIITANT+LSILAVDYPVDKVSCY+SDDGASMLLFD L+ETAE
Sbjct  297   LAPVDFFVSSVDPLKEPPIITANTILSILAVDYPVDKVSCYLSDDGASMLLFDALSETAE  356

Query  1091  FARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALV  1270
             FARRWVPFCKKY +EPRAPEFYFSEK+DYLKDKVQPTFVK+RRAMKREYEE+KVR+NALV
Sbjct  357   FARRWVPFCKKYSVEPRAPEFYFSEKMDYLKDKVQPTFVKDRRAMKREYEEFKVRINALV  416

Query  1271  AKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRP  1450
             AKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALD+EGKELP+LVYVSREKRP
Sbjct  417   AKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDIEGKELPRLVYVSREKRP  476

Query  1451  GYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             GYQHHKKAGA NALVRVSAVLTNAPF+LNLDCDHY
Sbjct  477   GYQHHKKAGAENALVRVSAVLTNAPFILNLDCDHY  511



>ref|XP_010556863.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010556864.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
isoform X2 [Tarenaya hassleriana]
Length=1038

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/511 (74%), Positives = 422/511 (83%), Gaps = 23/511 (5%)
 Frame = +2

Query  59    ADHDERREVERES--QKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQC  232
             A  DE R   R S   K+CR+C DE+G  ENGE FVAC  C FPVC+PCY+YERS+GNQC
Sbjct  7     ATFDEHRPATRHSLSSKICRVCGDELGTRENGEAFVACHVCSFPVCRPCYEYERSDGNQC  66

Query  233   CPHCNTRYKRHKGCPRVVG----------ddedhfegedfeqefeTKNHPPLSENGDYHN  382
             CP CNTRYKRH+G PR+ G           ++++ + ++       +N    SEN DY N
Sbjct  67    CPQCNTRYKRHRGSPRIPGDEDEINGGDDSEDEYHQIKNRRDASVHQNFAYGSENADYSN  126

Query  383   NQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTR  562
             NQ    N       Q  ++ GSV GK+  D +K+ +++AEWK+RVEKWK RQEKRGLVT+
Sbjct  127   NQQWQPNG------QAFSSAGSVAGKEF-DAEKDGYTSAEWKERVEKWKQRQEKRGLVTK  179

Query  563   FdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTP  742
               +DK     E+DD+L A+ARQPLWRK+PISSS ISPYRIVIV RL+IL FFF FRILTP
Sbjct  180   --EDKSNDQAEEDDYLDAEARQPLWRKVPISSSKISPYRIVIVARLVILAFFFRFRILTP  237

Query  743   AYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPV  922
             AYDA+PLWLISVICEIWF LSWILDQFPKW PINRETYLDRLS+RFERDGE   N L PV
Sbjct  238   AYDAYPLWLISVICEIWFALSWILDQFPKWFPINRETYLDRLSMRFERDGEA--NKLLPV  295

Query  923   DVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARR  1102
             DV+VSTVDPLKEPPIITANTVLSILAVDYPV+KVSCYVSDDGASMLLFDTL+ETAEFARR
Sbjct  296   DVFVSTVDPLKEPPIITANTVLSILAVDYPVEKVSCYVSDDGASMLLFDTLSETAEFARR  355

Query  1103  WVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQ  1282
             WVPFCKKY +EPRAPEFYFSEKIDYLKDKVQPTFVK+RRAMKREYEE+KVR+NALVAKAQ
Sbjct  356   WVPFCKKYNVEPRAPEFYFSEKIDYLKDKVQPTFVKDRRAMKREYEEFKVRINALVAKAQ  415

Query  1283  KKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQH  1462
             KKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLG EGA DV+GKELP+LVYVSREKRPGY H
Sbjct  416   KKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGKEGAFDVDGKELPRLVYVSREKRPGYGH  475

Query  1463  HKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             HKKAGAMNA+VRVSAVLTNAPFMLNLDCDHY
Sbjct  476   HKKAGAMNAMVRVSAVLTNAPFMLNLDCDHY  506



>gb|AAC78476.1| cellulose synthase [Populus tremula x Populus alba]
Length=1042

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/517 (74%), Positives = 428/517 (83%), Gaps = 10/517 (2%)
 Frame = +2

Query  20    MAALFTGGSH-LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             MA L TG S  LHA D       +  + K CR+C DEIGV E+GEVFVAC  CGFPVC+P
Sbjct  1     MAGLVTGSSQTLHAKDELMPPTRQSATSKKCRVCGDEIGVKEDGEVFVACHVCGFPVCRP  60

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSENGD-  373
             CY+YERSEGNQ CP CNTRYKRHKGCPRV GD++D     D   +     H    E+   
Sbjct  61    CYEYERSEGNQSCPQCNTRYKRHKGCPRVPGDNDDEDANFDDFDDEFQIKHHDHDESNQK  120

Query  374   --YHNNQLPHHNTTNSAAFQPT-AAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEK  544
               + + ++ H+N       +P  ++ GSV GKDLE + KE +SNAEW++RVEKWK RQEK
Sbjct  121   NVFSHTEIEHYNEQEMHPIRPAFSSAGSVAGKDLEGD-KEGYSNAEWQERVEKWKVRQEK  179

Query  545   RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFH  724
             RGLV++  D+ G    E+D++LMA+ARQPLWRK+PI SS I+PYRIVIV RLIILCFFF 
Sbjct  180   RGLVSK--DEGGNDQGEEDEYLMAEARQPLWRKIPIPSSRINPYRIVIVLRLIILCFFFR  237

Query  725   FRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGER  904
             FRILTPA DA+ LWLISVICE+WFGLSWILDQFPKW+PI RETYLDRLS+RFER  EGE 
Sbjct  238   FRILTPASDAYALWLISVICEVWFGLSWILDQFPKWNPIERETYLDRLSMRFER--EGEP  295

Query  905   NTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAET  1084
             N L PVDV+VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASMLLFD+LAET
Sbjct  296   NRLGPVDVFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASMLLFDSLAET  355

Query  1085  AEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNA  1264
             AEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDKV P FVKERRAMKREYEE+KVR+NA
Sbjct  356   AEFARKWVPFCKKHNIEPRAPEFYFTQKIDYLKDKVHPNFVKERRAMKREYEEFKVRINA  415

Query  1265  LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREK  1444
             LV+KAQKKPEEGWVMQDGTPWPGN TRDHPGMIQVYLGSEGALDVEGKELP+LVYVSREK
Sbjct  416   LVSKAQKKPEEGWVMQDGTPWPGNITRDHPGMIQVYLGSEGALDVEGKELPRLVYVSREK  475

Query  1445  RPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             RPGY HHKKAGAMNAL+ VSAVLTNAPFMLNLDCDHY
Sbjct  476   RPGYNHHKKAGAMNALILVSAVLTNAPFMLNLDCDHY  512



>ref|XP_008339053.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
isoform X2 [Malus domestica]
Length=1032

 Score =   748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/525 (74%), Positives = 427/525 (81%), Gaps = 31/525 (6%)
 Frame = +2

Query  17    SMAALFTGGSHLHAADHD-----ERREVERESQ---KMCRICRDEIGVVENGEVFVACRE  172
             +M  LFTG SH     HD     E     R+S    K+CR+C DEIG  E GE+FVAC  
Sbjct  5     TMGGLFTG-SHARDELHDVHDTEENXPSTRQSMSSIKVCRVCGDEIGYKEGGELFVACHV  63

Query  173   CGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNH-  349
             CGFPVC+PCY YERSEGNQCCP CNTRYKRHKGCPRV GD++D    +  ++     +H 
Sbjct  64    CGFPVCRPCYDYERSEGNQCCPQCNTRYKRHKGCPRVAGDEDDFDADDFDDEFQIKIDHH  123

Query  350   ---------PPLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAE  502
                         SENGD  N Q  H N       QP +  GSV GKD E E+ E+ SNAE
Sbjct  124   DDPAEQNHVVARSENGD-QNQQQWHRND------QPFSVGGSVVGKDFEGEKDEL-SNAE  175

Query  503   WKDRVEKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRI  682
             WKDRVEKWK RQ K+GLV++  DD+      +DDFL+A+ARQPLWRK+PISSS ISPYRI
Sbjct  176   WKDRVEKWKVRQAKKGLVSK--DDENDDQGLEDDFLLAEARQPLWRKVPISSSKISPYRI  233

Query  683   VIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLD  862
             VIV RL+IL FFFHFRILTPAYDAFPLW+ISVICEIWFG SWILDQFPKW+PINRETYLD
Sbjct  234   VIVCRLVILAFFFHFRILTPAYDAFPLWIISVICEIWFGFSWILDQFPKWNPINRETYLD  293

Query  863   RLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSD  1042
             RLS+RFER  EGE NTL+PVDVYVSTVDPLKEPPIITANTVLSILA+DYPVDK+ CYVSD
Sbjct  294   RLSIRFER--EGEPNTLSPVDVYVSTVDPLKEPPIITANTVLSILAIDYPVDKICCYVSD  351

Query  1043  DGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRA  1222
             DGASMLLFD L+ETAEFARRWVPFCKK+ IEPRAPEFYFS+KIDYLKDKV P FVKERRA
Sbjct  352   DGASMLLFDALSETAEFARRWVPFCKKHTIEPRAPEFYFSQKIDYLKDKVHPNFVKERRA  411

Query  1223  MKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVE  1402
             MKREYEE+KVR+NALV+KAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDV+
Sbjct  412   MKREYEEFKVRINALVSKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVD  471

Query  1403  GKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLN  1537
             GKELP+LVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPF+++
Sbjct  472   GKELPRLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFLMD  516



>gb|AAT09894.1| cellulose synthase [Populus tremula x Populus tremuloides]
Length=1042

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/517 (74%), Positives = 427/517 (83%), Gaps = 10/517 (2%)
 Frame = +2

Query  20    MAALFTGGSH-LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             MA L TG S  LHA D       +  + K CR+C DEIGV E+GEVFVAC  CGFPVC+P
Sbjct  1     MAGLVTGSSQTLHAKDELMPPTRQSATSKKCRVCGDEIGVKEDGEVFVACHVCGFPVCRP  60

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSENGD-  373
             CY+YERSEGNQ CP CNTRYKRHKGCPRV GD++D     D   +     H    E+   
Sbjct  61    CYEYERSEGNQSCPQCNTRYKRHKGCPRVPGDNDDEDANFDDFDDEFQIKHHDHDESNQK  120

Query  374   --YHNNQLPHHNTTNSAAFQPT-AAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEK  544
               + + ++ H+N       +P  ++ GSV GKDLE +  E +SNAEW++RVEKWK RQEK
Sbjct  121   NVFSHTEIEHYNEQEMHPIRPAFSSAGSVAGKDLEGDN-EGYSNAEWQERVEKWKVRQEK  179

Query  545   RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFH  724
             RGLV++  D+ G    E+D++LMA+ARQPLWRK+PI SS I+PYR VIV RLIILCFFF 
Sbjct  180   RGLVSK--DEGGNDQGEEDEYLMAEARQPLWRKIPIPSSRINPYRFVIVLRLIILCFFFR  237

Query  725   FRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGER  904
             FRILTPA DA+ LWLISVICE+WFGLSWILD+FPKW+PI RETYLDRLS+RFER  EGE 
Sbjct  238   FRILTPASDAYALWLISVICEVWFGLSWILDRFPKWNPIERETYLDRLSMRFER--EGEP  295

Query  905   NTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAET  1084
             N L PVDV+VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASMLLFD+LAET
Sbjct  296   NRLGPVDVFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASMLLFDSLAET  355

Query  1085  AEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNA  1264
             AEFARRWVPFCKK+ IEPRAPEFYF++KIDYLKDKV P FVKERRAMKREYEE+KVR+NA
Sbjct  356   AEFARRWVPFCKKHNIEPRAPEFYFTQKIDYLKDKVHPNFVKERRAMKREYEEFKVRINA  415

Query  1265  LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREK  1444
             LV+KAQKKPEEGWVMQDGTPWPGN TRDHPGMIQVYLGSEGALDVEGKELP+LVYVSREK
Sbjct  416   LVSKAQKKPEEGWVMQDGTPWPGNITRDHPGMIQVYLGSEGALDVEGKELPRLVYVSREK  475

Query  1445  RPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             RPGY HHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  476   RPGYNHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  512



>gb|AAQ08987.1| xylem-specific cellulose synthase [Populus tremuloides]
Length=1042

 Score =   746 bits (1926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/517 (74%), Positives = 426/517 (82%), Gaps = 10/517 (2%)
 Frame = +2

Query  20    MAALFTGGSH-LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             MA L TG S  LHA D       +  + K CR+C DEIGV E+GEVFVAC  CGFPVC+P
Sbjct  1     MAGLVTGSSQTLHAKDELRPPTRQSATSKKCRVCGDEIGVKEDGEVFVACHVCGFPVCRP  60

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSENGD-  373
             CY+YERSEGNQ CP CNTRYKRHKGCPRV GD++D     D   +     H    E+   
Sbjct  61    CYEYERSEGNQSCPQCNTRYKRHKGCPRVPGDNDDEDANFDDFDDEFQIKHHDHDESNQK  120

Query  374   --YHNNQLPHHNTTNSAAFQPT-AAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEK  544
               +   ++ H+N       +P  ++ GSV GKDLE E KE +SNAEW++RVEKWK RQEK
Sbjct  121   NVFSRTEIEHYNEQEMHPIRPAFSSAGSVAGKDLEGE-KEGYSNAEWQERVEKWKVRQEK  179

Query  545   RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFH  724
             RGLV++  DD G    E+D++LMA+ARQPLWRK+PI SS I+PYRIVIV RLIILCFFF 
Sbjct  180   RGLVSK--DDGGNDQGEEDEYLMAEARQPLWRKIPIPSSRINPYRIVIVLRLIILCFFFR  237

Query  725   FRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGER  904
             F ILTPA DA+ L LISVICE+WFGLSWILDQFPKW+PI RETYLDRLS+RFER  EGE 
Sbjct  238   FWILTPASDAYALGLISVICEVWFGLSWILDQFPKWNPIERETYLDRLSMRFER--EGEP  295

Query  905   NTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAET  1084
             N L PVDV+VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASMLLFD+LAET
Sbjct  296   NRLGPVDVFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASMLLFDSLAET  355

Query  1085  AEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNA  1264
             AEFARRWVPFCKK+ IEPRAPEFYF++KIDYLKDKV P FVKERRAMKREYEE+KVR+NA
Sbjct  356   AEFARRWVPFCKKHNIEPRAPEFYFTQKIDYLKDKVHPNFVKERRAMKREYEEFKVRINA  415

Query  1265  LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREK  1444
             LV+KAQKKPEEGWVMQDGTPWPGN TRDHPGMIQVYLGSEGALDVEGKELP+LVYVSREK
Sbjct  416   LVSKAQKKPEEGWVMQDGTPWPGNITRDHPGMIQVYLGSEGALDVEGKELPRLVYVSREK  475

Query  1445  RPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             RPGY HHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  476   RPGYNHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  512



>gb|ACC59197.1| cellulose synthase [Betula platyphylla]
Length=1048

 Score =   746 bits (1926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/529 (74%), Positives = 434/529 (82%), Gaps = 32/529 (6%)
 Frame = +2

Query  17    SMAALFTGGSHLHAADH-----DERREVERES-QKMCRICRDEIGVVENGEVFVACRECG  178
             +M      GSH     H     DE+R   R+S  K CR+C DEIG  E+GE+FVAC  CG
Sbjct  5     AMTGGLVAGSHTRNELHVLHGDDEQRPPTRQSVSKTCRVCGDEIGYKEDGELFVACNVCG  64

Query  179   FPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNH---  349
             FPVC+PCY YERSEGNQ CP CNTRYKR KGCPRV GDD+++F+ +DF+ EF+TKNH   
Sbjct  65    FPVCRPCYDYERSEGNQSCPQCNTRYKRQKGCPRVAGDDDENFDADDFDDEFQTKNHHDD  124

Query  350   ------PPLSENGDYHNNQLPHHNTTNSAAFQPTAA-PGSVGGKDLEDEQKEVFSNAEWK  508
                      SENGDY++ Q           ++PT +  GSV GKD E E +E +SNAEWK
Sbjct  125   SDRQHVTIHSENGDYNHPQ-----------WKPTGSFAGSVAGKDFEGE-RETYSNAEWK  172

Query  509   DRVEKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVI  688
             +R+EKWK RQEKRGLV + DD      ++ DDFL+A+ARQPLWRK+PI+SS ISPYRIVI
Sbjct  173   ERIEKWKVRQEKRGLVNK-DDGNNDQGDDQDDFLLAEARQPLWRKVPIASSKISPYRIVI  231

Query  689   VFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRL  868
             V RLIIL FF  FR+LTPAYDA+PLW+ISVICE WF  SWILDQFPKW PI RETYLDRL
Sbjct  232   VLRLIILAFFLRFRVLTPAYDAYPLWIISVICETWFAFSWILDQFPKWFPITRETYLDRL  291

Query  869   SLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDG  1048
             S+RFER  EGE N L+PVDV+VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDG
Sbjct  292   SMRFER--EGEPNRLSPVDVFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDG  349

Query  1049  ASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMK  1228
             ASMLLFDTL+ETAEFARRWVPFC+KY IEPRAPE+YFSEK+DYLKDKV P+FVKERRAMK
Sbjct  350   ASMLLFDTLSETAEFARRWVPFCRKYSIEPRAPEYYFSEKMDYLKDKVLPSFVKERRAMK  409

Query  1229  REYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGK  1408
             REYEE+KVR+NALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQV L SEGALDVEGK
Sbjct  410   REYEEFKVRINALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVIL-SEGALDVEGK  468

Query  1409  ELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             ELP+LVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPF LNLDCDHY
Sbjct  469   ELPRLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFTLNLDCDHY  517



>gb|KDP26483.1| hypothetical protein JCGZ_17641 [Jatropha curcas]
Length=1165

 Score =   747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/522 (74%), Positives = 434/522 (83%), Gaps = 27/522 (5%)
 Frame = +2

Query  2     TSRHVSMAALFTGGSHLHAADHDERREVERES--QKMCRICRDEIGVVENGEVFVACREC  175
             T    +MA L TGGSH    D++E R   R+S   K+CR+C DEIGV E+G+VF+AC  C
Sbjct  135   TESSFTMAGLATGGSH-PLQDYEEHRPATRQSATSKVCRVCGDEIGVKEDGQVFLACHVC  193

Query  176   GFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNH--  349
              FPVC+PCY+YERSEGNQCCP CNTRYKRHKGCPRV GDD+D  E +DF+ EF+ K H  
Sbjct  194   EFPVCRPCYEYERSEGNQCCPQCNTRYKRHKGCPRVAGDDDDDIEADDFDDEFQIKQHHD  253

Query  350   PPLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWK  529
              P S+N  +  +QL  H + + A            GKD+E E +E++SNAEWK+RVEKWK
Sbjct  254   DPDSKN-VFAQSQL--HTSFSYAG----------SGKDIEAE-REMYSNAEWKERVEKWK  299

Query  530   TRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIIL  709
              RQEKRGLV +          E+D++LMA+ARQPLWRK+PISSS I+PYRIVIV RL++L
Sbjct  300   VRQEKRGLVNK------DDGGEEDEYLMAEARQPLWRKIPISSSKINPYRIVIVIRLVVL  353

Query  710   CFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERD  889
              FF  FR+LTPA DA+PLWL+SVICEIWF  SWILDQFPKW PI RETYLDRLS+RFER 
Sbjct  354   AFFLRFRVLTPALDAYPLWLVSVICEIWFAFSWILDQFPKWFPIERETYLDRLSMRFER-  412

Query  890   GEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFD  1069
              EGE N LAPVD +VSTVDPLKEPPIITANTVLSILAVDYPV+KVSCYVSDDGASMLLFD
Sbjct  413   -EGEPNRLAPVDFFVSTVDPLKEPPIITANTVLSILAVDYPVNKVSCYVSDDGASMLLFD  471

Query  1070  TLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYK  1249
             TLAETAEFARRWVPFCKK+ IEPRAPEFYFS+KIDYLKDKV P FVKERRAMKREYEE+K
Sbjct  472   TLAETAEFARRWVPFCKKHNIEPRAPEFYFSQKIDYLKDKVHPNFVKERRAMKREYEEFK  531

Query  1250  VRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVY  1429
             V++N+LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELP+LVY
Sbjct  532   VKINSLVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPRLVY  591

Query  1430  VSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             VSREKRPGY HHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  592   VSREKRPGYDHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  633


 Score =   136 bits (343),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 73/93 (78%), Gaps = 3/93 (3%)
 Frame = +2

Query  17   SMAALFTGGSHLHAADHDERREVERES--QKMCRICRDEIGVVENGEVFVACRECGFPVC  190
            +MA L TGGSH    D++E R   R+S   K+CR+C DEIGV E+G+VF+AC  C FPVC
Sbjct  9    TMAGLATGGSH-PLQDYEEHRPATRQSATSKVCRVCGDEIGVKEDGQVFLACHVCEFPVC  67

Query  191  KPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVG  289
            +PCY+YERSEGNQCCP CNTRYKRHKGCPRV G
Sbjct  68   RPCYEYERSEGNQCCPQCNTRYKRHKGCPRVAG  100



>ref|XP_011080097.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
[Sesamum indicum]
Length=1045

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/525 (77%), Positives = 441/525 (84%), Gaps = 26/525 (5%)
 Frame = +2

Query  20    MAALFTGGSH-------LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECG  178
             MA LFTG SH       LHAAD + R      + K CR+C DEIG+ E+G VFVAC ECG
Sbjct  1     MAGLFTG-SHGRNDLHVLHAAD-EHRPPTRGSTTKTCRVCGDEIGLNEDGRVFVACHECG  58

Query  179   FPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNH---  349
             FPVC+PCY YERSEG+Q CP CNTRYKRHKGC RV GDDED+ + +DFE EF+ KN    
Sbjct  59    FPVCRPCYDYERSEGHQTCPQCNTRYKRHKGCARVEGDDEDNHDDDDFEDEFQLKNRHHH  118

Query  350   ---PPLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVE  520
                P   E GD+  +Q+      N A  +  A  GSV GKD E E KE ++  EWK+RVE
Sbjct  119   TLDPHHVELGDHSQHQV----HMNGATVRSVA--GSVAGKDFEAE-KEAYNTEEWKERVE  171

Query  521   KWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRL  700
             KWKTRQEKRGL+T+   D GG D +DDDFL+A+ARQPLWRK+PI S LISPYRIVIV R 
Sbjct  172   KWKTRQEKRGLITK--ADDGGHDEDDDDFLIAEARQPLWRKVPIPSRLISPYRIVIVIRF  229

Query  701   IILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRF  880
             IILCFFFHFRILTPA DA+PLW+ISVICEIWFGLSWILDQFPKW PINRETYLDRLSLRF
Sbjct  230   IILCFFFHFRILTPAKDAYPLWIISVICEIWFGLSWILDQFPKWLPINRETYLDRLSLRF  289

Query  881   ERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASML  1060
             ER  EGE N L+ VD +VSTVDPLKEPPIITANTVLSIL+VDYPV+KVSCYVSDDGASML
Sbjct  290   ER--EGEPNQLSAVDFFVSTVDPLKEPPIITANTVLSILSVDYPVEKVSCYVSDDGASML  347

Query  1061  LFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYE  1240
             LFDTL+ETAEFARRWVPFCKKY +EPRAPEFYFSEKIDYLKDKVQPTFVK+RRAMKREYE
Sbjct  348   LFDTLSETAEFARRWVPFCKKYNVEPRAPEFYFSEKIDYLKDKVQPTFVKDRRAMKREYE  407

Query  1241  EYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPK  1420
             E+KVR+NALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALD+EGKELP+
Sbjct  408   EFKVRINALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDIEGKELPR  467

Query  1421  LVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             LVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPF+LNLDCDHY
Sbjct  468   LVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFILNLDCDHY  512



>ref|XP_003532664.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming]-like 
[Glycine max]
Length=1034

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/508 (75%), Positives = 424/508 (83%), Gaps = 15/508 (3%)
 Frame = +2

Query  38    GGSHLH-AADHDERREVERES-QKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYE  211
              GSH H   D +E R   R+S  K+CR+C DEIG  E+G++FVAC  C FPVC+PCY+YE
Sbjct  7     AGSHFHFPRDSEEHRPPTRQSASKVCRVCSDEIGYGEDGKLFVACHVCRFPVCRPCYEYE  66

Query  212   RSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSENGDYHNNQL  391
             RSEGN CCP CNTRYKRHKGCPRV GDDE+H + +DF    + K+     EN DY   Q 
Sbjct  67    RSEGNHCCPQCNTRYKRHKGCPRVAGDDEEHSDADDFHDNPDEKHDVNHLENKDYKEQQW  126

Query  392   PHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdd  571
              H N       Q  ++ GSV GK+ E E KE FSN EW++R++KWK RQEKR L  +   
Sbjct  127   -HPNG------QAFSSAGSVVGKEFEGE-KEFFSNGEWEERLDKWKARQEKRDLQNK---  175

Query  572   dkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYD  751
             ++G  D  +DD+L+A+ARQPLWRK+PISSSLI+PYRIVI+ RL+IL FF  FRILTPAYD
Sbjct  176   EEGKDDQGEDDYLLAEARQPLWRKVPISSSLINPYRIVIIMRLVILVFFLRFRILTPAYD  235

Query  752   AFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVY  931
             A+PLWL SVICEIWF LSWILDQFPKW PI RETYLDRLS+RFER  EGE N LAPVDVY
Sbjct  236   AYPLWLASVICEIWFALSWILDQFPKWFPITRETYLDRLSIRFER--EGEPNLLAPVDVY  293

Query  932   VSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVP  1111
             VSTVDPLKEPPIITANTVLSILAVDYPV+KV CYVSDDGASMLLFDTL+ET+EFARRWVP
Sbjct  294   VSTVDPLKEPPIITANTVLSILAVDYPVEKVCCYVSDDGASMLLFDTLSETSEFARRWVP  353

Query  1112  FCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKP  1291
             FCKKY IEPRAPEFYFS+KIDYLKDKV PTFVKERRAMKREYEE+KV++NALVAKAQKKP
Sbjct  354   FCKKYSIEPRAPEFYFSQKIDYLKDKVHPTFVKERRAMKREYEEFKVKINALVAKAQKKP  413

Query  1292  EEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKK  1471
             EEGWVMQDGTPWPGNNTRDHPGMIQVYLGS GALDVEGKELP++VYVSREKRPGY HHKK
Sbjct  414   EEGWVMQDGTPWPGNNTRDHPGMIQVYLGSGGALDVEGKELPRIVYVSREKRPGYNHHKK  473

Query  1472  AGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             AGAMNALVRVSAVL+NAPFMLNLDCDHY
Sbjct  474   AGAMNALVRVSAVLSNAPFMLNLDCDHY  501



>ref|XP_010091789.1| OsCesA4 protein [Morus notabilis]
 gb|EXB45997.1| OsCesA4 protein [Morus notabilis]
Length=1529

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/523 (73%), Positives = 431/523 (82%), Gaps = 19/523 (4%)
 Frame = +2

Query  26    ALFTGGSH------LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPV  187
             A F  GSH      +  A+ + R    + + ++CR+C DEIG  ENG++FVAC  CGFPV
Sbjct  511   AGFVTGSHTRNDLQVSDAEQNSRPLTRQAASRICRVCGDEIGYKENGDLFVACHVCGFPV  570

Query  188   CKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSEN  367
             C+PCY YERS+GNQ CP CNTRY+RHKGCPRV GDD+D  +G+DF+ EF  KNH   S+N
Sbjct  571   CRPCYDYERSDGNQSCPQCNTRYRRHKGCPRVAGDDDDSDDGDDFDDEFRMKNHH--SDN  628

Query  368   GDYHN-NQLPHHNTT---NSAAFQPTAAPGSVGG---KDLEDEQKEVFSNAEWKDRVEKW  526
              D H  N L +++     N   +QP     SV G   K+ E E KEV+ N EWKDRVEKW
Sbjct  629   SDDHRINPLTNNSDNGEHNQQQWQPNGHAFSVAGSAAKEFEGE-KEVYGNDEWKDRVEKW  687

Query  527   KTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLII  706
             K RQE+RG +    DD      +D+D+L+A+ARQPLWRK+PI SSLISPYRIVIV RL+I
Sbjct  688   KVRQERRGNLLN-KDDGNNDQGDDEDYLLAEARQPLWRKIPIPSSLISPYRIVIVLRLLI  746

Query  707   LCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFER  886
             LCFFF FRILTPAYDAFPLWLISVICEIWF  SWILDQFPKW P+ R+TYLDRLS+RFER
Sbjct  747   LCFFFRFRILTPAYDAFPLWLISVICEIWFAFSWILDQFPKWCPVTRQTYLDRLSIRFER  806

Query  887   DGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLF  1066
             DGE  R  L+PVDVYVSTVDPLKEPPIITANTVLSIL+VDYPVDKV CYVSDDGASMLLF
Sbjct  807   DGEPNR--LSPVDVYVSTVDPLKEPPIITANTVLSILSVDYPVDKVCCYVSDDGASMLLF  864

Query  1067  DTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEY  1246
             D+LAETAEFARRWVPFCKK+ IEPR PEFYFSEKIDYLKDKV P+FVKERRAMKREYEE+
Sbjct  865   DSLAETAEFARRWVPFCKKHNIEPRTPEFYFSEKIDYLKDKVHPSFVKERRAMKREYEEF  924

Query  1247  KVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLV  1426
             KVR+NALVAKAQKKPE+GWVMQDGTPWPGNNTRDHPGMIQVYLGS GALDVEGKELP+LV
Sbjct  925   KVRINALVAKAQKKPEDGWVMQDGTPWPGNNTRDHPGMIQVYLGSGGALDVEGKELPRLV  984

Query  1427  YVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             Y+SREKRPGYQHHKKAGAMNALVRVSAVL+NAPFMLNLDCDHY
Sbjct  985   YISREKRPGYQHHKKAGAMNALVRVSAVLSNAPFMLNLDCDHY  1027



>ref|XP_007158869.1| hypothetical protein PHAVU_002G188600g [Phaseolus vulgaris]
 gb|ESW30863.1| hypothetical protein PHAVU_002G188600g [Phaseolus vulgaris]
Length=1034

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/514 (72%), Positives = 421/514 (82%), Gaps = 13/514 (3%)
 Frame = +2

Query  14    VSMAALFTGGSHLHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCK  193
             +++ ++    SH      + R      + K+CR+C D+IG  E+G++FVAC  C FPVC+
Sbjct  1     MALNSMAASHSHFPCGSGEHRPPTRHSASKVCRVCSDQIGHGEDGKLFVACHVCSFPVCQ  60

Query  194   PCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSENGD  373
             PCY+YERSEGNQCCP CNTRYKRHKGCPRVVGDDE H + +DF  + E K      EN D
Sbjct  61    PCYEYERSEGNQCCPQCNTRYKRHKGCPRVVGDDEKHSDADDFHDDPEEKYDANHLENKD  120

Query  374   YHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGL  553
             Y   Q        S A       GSV GK+ E E KE FSN EW++R+E+WK RQEKRGL
Sbjct  121   YKEQQWHQKGQAFSTA-------GSVAGKEFEGE-KEFFSNGEWEERLEQWKARQEKRGL  172

Query  554   VTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRI  733
             + +   ++G  +  +DD+++A+ARQPLWRK+PISSSLI+PYRIVI+ RL IL FF  FR+
Sbjct  173   LNK---EEGKDEQVEDDYVLAEARQPLWRKVPISSSLINPYRIVIIMRLFILVFFLRFRV  229

Query  734   LTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTL  913
             LTPAYDA+PLWL SVICE+WF LSWILDQFPKW PI RETYLDRLS+RFER  EGE N L
Sbjct  230   LTPAYDAYPLWLASVICEVWFALSWILDQFPKWFPITRETYLDRLSMRFER--EGEPNLL  287

Query  914   APVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEF  1093
             APVDVYVSTVDPLKEPPIITANTVLSILAVDYPV+KV CYVSDDGASMLLFD L+ET+EF
Sbjct  288   APVDVYVSTVDPLKEPPIITANTVLSILAVDYPVEKVCCYVSDDGASMLLFDALSETSEF  347

Query  1094  ARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVA  1273
             ARRWVPFCKKY IEPRAPEFYFS+KIDYLKDKV PTFVKERRAMKREYEE+KV++N+LVA
Sbjct  348   ARRWVPFCKKYSIEPRAPEFYFSQKIDYLKDKVLPTFVKERRAMKREYEEFKVKINSLVA  407

Query  1274  KAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPG  1453
             KAQKKPEEGWVMQDGTPWPGN+TRDHPGMIQVYLGS GALDVEGKELP+LVY+SREKRPG
Sbjct  408   KAQKKPEEGWVMQDGTPWPGNSTRDHPGMIQVYLGSGGALDVEGKELPRLVYISREKRPG  467

Query  1454  YQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             Y HHKKAGAMNALVRVSAVL+NAPFMLNLDCDHY
Sbjct  468   YNHHKKAGAMNALVRVSAVLSNAPFMLNLDCDHY  501



>ref|XP_002526560.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative 
[Ricinus communis]
 gb|EEF35838.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative 
[Ricinus communis]
Length=1044

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/527 (72%), Positives = 425/527 (81%), Gaps = 29/527 (6%)
 Frame = +2

Query  20    MAALFTGGSHLHAADHDERREVERESQKM-CRICRDEIGVVENGEVFVACRECGFPVCKP  196
             MA L    SH    D+DE R   R+S K+ CR+C D+IGV E+G +FVAC  C FPVCKP
Sbjct  1     MAGLPATTSH-PLQDYDEHRPPTRQSGKVSCRVCGDDIGVKEDGTLFVACHVCRFPVCKP  59

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGd--------------dedhfegedfeqef  334
             CY+YERSEGNQCCP CNTRYKRH+GC RVVGD                   + +  + + 
Sbjct  60    CYEYERSEGNQCCPQCNTRYKRHRGCARVVGDDEDDIDADDFDDEFQIKQQQQQHHDHDP  119

Query  335   eTKNHPPLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDR  514
             + KN    SE+GDY   Q P H  T    F    +     GK++E E +E++SN EWKDR
Sbjct  120   DHKNVFARSESGDYIPRQ-PLH--TGGPVFSSAGS-----GKEIEAE-RELYSNEEWKDR  170

Query  515   VEKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVF  694
             VEKWK RQEKRGLV +  DD G    E+D++LMA+ARQPLWRK+PISSS I+PYRIVI+ 
Sbjct  171   VEKWKVRQEKRGLVGK--DDVGNDQGEEDEYLMAEARQPLWRKIPISSSKINPYRIVIII  228

Query  695   RLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSL  874
             RL +L FF  FR+LTPAYDA+PLWLISVICEIWF  SWILDQFPKW PI RETYLDRLS+
Sbjct  229   RLFVLIFFLRFRVLTPAYDAYPLWLISVICEIWFAFSWILDQFPKWFPIERETYLDRLSM  288

Query  875   RFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGAS  1054
             RFER  EGE N LAP+D +VSTVDPLKEPPIITANTVLSILAVDYPV+K+SCYVSDDGAS
Sbjct  289   RFER--EGEANRLAPIDFFVSTVDPLKEPPIITANTVLSILAVDYPVNKISCYVSDDGAS  346

Query  1055  MLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKRE  1234
             MLLFD+LAETAEFARRWVPFCKK+ IEPRAPEFYFS+KIDYLKDKV P FVKERRAMKRE
Sbjct  347   MLLFDSLAETAEFARRWVPFCKKHNIEPRAPEFYFSQKIDYLKDKVHPNFVKERRAMKRE  406

Query  1235  YEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKEL  1414
             YEE+KV++N+LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKEL
Sbjct  407   YEEFKVKINSLVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKEL  466

Query  1415  PKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             P+LVYVSREKRPGYQHHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  467   PRLVYVSREKRPGYQHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  513



>ref|XP_010934249.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Elaeis guineensis]
Length=1053

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/517 (73%), Positives = 425/517 (82%), Gaps = 15/517 (3%)
 Frame = +2

Query  32    FTGGSH----LHAADHDERREVERE--SQKMCRICRDEIGVVENGEVFVACRECGFPVCK  193
                GSH    LH     E  +V+    + K+CR+C DE+G+ ENGE+FVAC EC FPVC+
Sbjct  9     LVAGSHRRNELHVMHGHEEPKVQNHQVNGKICRVCGDEVGLKENGELFVACHECAFPVCQ  68

Query  194   PCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSENGD  373
              CY+YERSEGN+ CP CNTRYKRHKGCPR+ GD++D  + +DFE EF+ K+     EN  
Sbjct  69    ACYEYERSEGNKTCPQCNTRYKRHKGCPRIEGDEDDGADMDDFEDEFQLKSPKKSQEN--  126

Query  374   YHNNQLPHHNTTNSAAFQP---TAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEK  544
              H   L   N      ++P   ++  GSV GKDLE E +E+  N EWKDRVEKWK +QEK
Sbjct  127   -HRFDLNSENGDRMQQWRPNGLSSFAGSVVGKDLEAE-REMEGNLEWKDRVEKWKVKQEK  184

Query  545   RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFH  724
             RG++ + +++    DN +D+ LMA+ARQPLWRK+PI SS ISPYRIVIV RL+ILCFF  
Sbjct  185   RGMINKDEEEDNEQDNYEDEILMAEARQPLWRKVPIPSSRISPYRIVIVLRLVILCFFLR  244

Query  725   FRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGER  904
             FR+ TPA DA+ LWL SVICEIWF LSWILDQFPKW PI RETYLDRLS+RFER  EGE 
Sbjct  245   FRLTTPAKDAYALWLTSVICEIWFALSWILDQFPKWFPITRETYLDRLSMRFER--EGEP  302

Query  905   NTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAET  1084
             N L+ VDV+VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASMLLFD L+ET
Sbjct  303   NRLSAVDVFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASMLLFDALSET  362

Query  1085  AEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNA  1264
             AEFARRWVPFCKK+ IEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEE+KVR+NA
Sbjct  363   AEFARRWVPFCKKHTIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEFKVRINA  422

Query  1265  LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREK  1444
             LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS GALDVEGKELP+LVYVSREK
Sbjct  423   LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSAGALDVEGKELPRLVYVSREK  482

Query  1445  RPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             RPGYQHHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  483   RPGYQHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  519



>gb|KFK31669.1| hypothetical protein AALP_AA6G143600 [Arabis alpina]
Length=1051

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/511 (73%), Positives = 420/511 (82%), Gaps = 21/511 (4%)
 Frame = +2

Query  59    ADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCP  238
             A  D+       S K+CRIC DEI   +NG+ FVAC  C FPVCKPCY+YERS GN+CCP
Sbjct  7     ASFDDEHRHSSFSAKICRICSDEIKEGDNGQTFVACHVCAFPVCKPCYEYERSNGNKCCP  66

Query  239   HCNTRYKRHKGCPRVVGddedhfegedfeqefeTK----------NHPPLSENGDYHNNQ  388
              CNT YKRHKG PR+ GD+E++   +D + E   K          N    SENGDY++ Q
Sbjct  67    QCNTHYKRHKGSPRIAGDEEENNGPDDSDDELNIKTRQDASSIHQNFAYGSENGDYNSKQ  126

Query  389   LPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFd  568
                 +  N  AF  T   GSV GKD E E ++ +++AEWK+RV+KWK RQEKRGLVT+ +
Sbjct  127   ---QSRPNGRAFSST---GSVLGKDFEAE-RDAYTDAEWKERVDKWKVRQEKRGLVTKGE  179

Query  569   ddkggadneddd--FLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTP  742
               K     +D++  +L ADARQPLWRK+PISSS ISPYRIVIV RL+IL FFF FRILTP
Sbjct  180   QTKDQDSEDDEEEGYLDADARQPLWRKVPISSSKISPYRIVIVLRLVILAFFFRFRILTP  239

Query  743   AYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPV  922
             A DA+PLWLISVICEIWF LSWILDQFPKW PINRETYLDRLS+R+ER  EG++N LAPV
Sbjct  240   ANDAYPLWLISVICEIWFALSWILDQFPKWFPINRETYLDRLSMRYER--EGDKNKLAPV  297

Query  923   DVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARR  1102
             DV+VSTVDPLKEPPIITANT+LSILAVDYPV+KVSCYVSDDGASMLLFDTL+ET+EFARR
Sbjct  298   DVFVSTVDPLKEPPIITANTILSILAVDYPVNKVSCYVSDDGASMLLFDTLSETSEFARR  357

Query  1103  WVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQ  1282
             WVPFCKKY +EPRAPEFYFSEKIDYLKDKVQPTFVK+RRAMKREYEE+KVR+NALVAKAQ
Sbjct  358   WVPFCKKYNVEPRAPEFYFSEKIDYLKDKVQPTFVKDRRAMKREYEEFKVRINALVAKAQ  417

Query  1283  KKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQH  1462
             KKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLG EGA D++G ELP+LVYVSREKRPGY H
Sbjct  418   KKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGKEGAYDIDGNELPRLVYVSREKRPGYAH  477

Query  1463  HKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             HKKAGAMNA+VRVSAVLTNAPFMLNLDCDHY
Sbjct  478   HKKAGAMNAMVRVSAVLTNAPFMLNLDCDHY  508



>gb|KHG02090.1| Cellulose synthase A catalytic subunit 4 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=1033

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/494 (76%), Positives = 417/494 (84%), Gaps = 15/494 (3%)
 Frame = +2

Query  89    RESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHK  268
             + S K+C++C D+IG  E+GE+FVAC  C FPVC PCY+YERSEG QCCP CNTRYKR K
Sbjct  18    QSSGKVCKVCGDKIGRNEDGELFVACHVCAFPVCPPCYEYERSEGTQCCPQCNTRYKRQK  77

Query  269   GCPRVVGddedhfegedfeqefeTKNHPP---LSENGDYHNNQLPHHNTTNSAAFQPTAA  439
             G  RV GDDED+++ +DF+ EF+TKN        ENGDY NNQ  H N       Q  + 
Sbjct  78    GSARVAGDDEDNYDQDDFDDEFQTKNRKDDLDQHENGDY-NNQQWHPNG------QAFSV  130

Query  440   PGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddk--ggadnedddFLM  613
              GS  GKD E + KE++ +AEWK+RVEKWK RQEKRGLV  + D         E++D+LM
Sbjct  131   GGSTAGKDFEGD-KEIYGSAEWKERVEKWKVRQEKRGLVGNYGDAGHDQAEQEEEEDYLM  189

Query  614   ADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIW  793
             A+ARQPLWRK+PISSSLI+PYRIVIV RL +L FF  FRILTPAYDAFPLWLISVICE+W
Sbjct  190   AEARQPLWRKVPISSSLINPYRIVIVLRLFVLIFFLRFRILTPAYDAFPLWLISVICEVW  249

Query  794   FGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIIT  973
             F  SWILDQFPKW PI RETYLDRLSLRFER  EGE N L  VDV+VSTVDPLKEPPIIT
Sbjct  250   FAFSWILDQFPKWLPITRETYLDRLSLRFER--EGEPNQLGSVDVFVSTVDPLKEPPIIT  307

Query  974   ANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEF  1153
             ANTVLSIL+VDYPV+KVSCYVSDDGASMLLFDTL+ETAEFARRWVPFCKK+ +EPRAPEF
Sbjct  308   ANTVLSILSVDYPVEKVSCYVSDDGASMLLFDTLSETAEFARRWVPFCKKHNVEPRAPEF  367

Query  1154  YFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPG  1333
             YFSEKIDYLKDKV P+FVKERRAMKREYEE+KVR+NALVAKAQKKPEEGWVMQDGTPWPG
Sbjct  368   YFSEKIDYLKDKVHPSFVKERRAMKREYEEFKVRINALVAKAQKKPEEGWVMQDGTPWPG  427

Query  1334  NNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVL  1513
             NNTRDHPGMIQVYLGS GALDV+GKELP+LVYVSREKRPGYQHHKKAGAMNALVRVSAVL
Sbjct  428   NNTRDHPGMIQVYLGSAGALDVDGKELPRLVYVSREKRPGYQHHKKAGAMNALVRVSAVL  487

Query  1514  TNAPFMLNLDCDHY  1555
             TNAPF+LNLDCDHY
Sbjct  488   TNAPFILNLDCDHY  501



>ref|XP_008785168.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Phoenix dactylifera]
Length=1054

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/517 (73%), Positives = 424/517 (82%), Gaps = 15/517 (3%)
 Frame = +2

Query  32    FTGGSH----LHAADHDERREVERE--SQKMCRICRDEIGVVENGEVFVACRECGFPVCK  193
                GSH    LH     E  +++    + K+CR+C DEIG+ ENGE+F+AC ECGFPVC+
Sbjct  9     LVAGSHRRNELHVMHGHEEPKIQNHHLNAKVCRVCGDEIGLKENGEMFMACHECGFPVCQ  68

Query  194   PCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSENGD  373
             PCY+YERSEGNQ CP CNTRYKRHKGCPRV GD +D  + +DFE EF  K+     EN  
Sbjct  69    PCYEYERSEGNQTCPQCNTRYKRHKGCPRVEGDGDDGADMDDFEDEFPLKSPKKSQEN--  126

Query  374   YHNNQLPHHNTTNSAAFQP---TAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEK  544
              H   +   N      ++P   ++  GSV  K+LE E +E+  N EWKDRVEKWK +QEK
Sbjct  127   -HRLDINSENGDRMQQWRPNGLSSFTGSVTAKELEAE-REMEGNMEWKDRVEKWKVKQEK  184

Query  545   RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFH  724
             RG++ + D++    D  +D+ LMA+ARQPLWRK+PI SS I+PYRIVIV RL+ILCFFF 
Sbjct  185   RGMINKDDEEDNDQDAYEDEMLMAEARQPLWRKVPIPSSKINPYRIVIVLRLVILCFFFR  244

Query  725   FRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGER  904
             FR+ TPA DA+ LWL SVICEIWF LSWILDQFPKW PI RETYLDRLS+RF+R+GE  R
Sbjct  245   FRLTTPAKDAYALWLTSVICEIWFALSWILDQFPKWFPITRETYLDRLSMRFDREGEPSR  304

Query  905   NTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAET  1084
               LA VDV+VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASMLLFD L+ET
Sbjct  305   --LAAVDVFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASMLLFDALSET  362

Query  1085  AEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNA  1264
             AEFARRWVPFCKKY IEPRAPEFYFSEKIDYLKDKVQP+FVKERRAMKREYEE+KVR+NA
Sbjct  363   AEFARRWVPFCKKYTIEPRAPEFYFSEKIDYLKDKVQPSFVKERRAMKREYEEFKVRINA  422

Query  1265  LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREK  1444
             LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS GALDVEGKELP+LVYVSREK
Sbjct  423   LVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSAGALDVEGKELPRLVYVSREK  482

Query  1445  RPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             RPGYQHHKKAGAMNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  483   RPGYQHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHY  519



>ref|NP_001289665.1| cellulose synthase A catalytic subunit 4 [Eucalyptus grandis]
 gb|ABY25275.1| cellulose synthase [Eucalyptus grandis]
Length=1045

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/526 (73%), Positives = 422/526 (80%), Gaps = 34/526 (6%)
 Frame = +2

Query  32    FTGGSH----LHAADH---DERREVERE-SQKMCRICRDEIGVVENGEVFVACRECGFPV  187
             F  GSH    LH  +    DE R   R+ + + CR+C DEIG+ ++G  FVAC ECGFPV
Sbjct  4     FAVGSHSRNELHVTNGGAADEHRSPPRQNAARTCRVCGDEIGLKDDGAPFVACHECGFPV  63

Query  188   CKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVG-------ddedhfegedfeqefeTKN  346
             C+PCY YERS+G QCCP CN RYKRHKGCPRV G       + ED  +        E + 
Sbjct  64    CRPCYVYERSDGTQCCPQCNARYKRHKGCPRVAGDDEDDHFEGEDFEDEFQIRNRGENEV  123

Query  347   HPP---LSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRV  517
              P     SENGD H  Q+  +    S+A       GSV G +LE E      NAEWK+R+
Sbjct  124   RPTGFDRSENGDSHAPQVHQNGQVFSSA-------GSVVGAELEGE-----GNAEWKERI  171

Query  518   EKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFR  697
             EKWK RQEKRGLV +  DD G  D E+DD+LMA+ARQPL RK+PISSS ISPYRIVIV R
Sbjct  172   EKWKIRQEKRGLVGK--DDGGNGDGEEDDYLMAEARQPLSRKVPISSSKISPYRIVIVLR  229

Query  698   LIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLR  877
             LI+L FF HFRILTPA DAFPLWLISVICE WF LSWILDQFPKW+PINRETYLDRLS+R
Sbjct  230   LIVLGFFLHFRILTPATDAFPLWLISVICETWFALSWILDQFPKWNPINRETYLDRLSIR  289

Query  878   FERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASM  1057
             FER+GE  R  LAPVDV+VSTVDPLKEPPIITANTVLSILAVDYPVDKV CYVSDDGASM
Sbjct  290   FEREGEPSR--LAPVDVFVSTVDPLKEPPIITANTVLSILAVDYPVDKVCCYVSDDGASM  347

Query  1058  LLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREY  1237
             LLFDTL+ETAEFARRWVPFCKKY IEPR PEFYFS+KIDYLKDKV+P+FVKERRAMKREY
Sbjct  348   LLFDTLSETAEFARRWVPFCKKYSIEPRTPEFYFSQKIDYLKDKVEPSFVKERRAMKREY  407

Query  1238  EEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELP  1417
             EE+KVR+NALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS GALDVEGKELP
Sbjct  408   EEFKVRINALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSAGALDVEGKELP  467

Query  1418  KLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             +LVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPF+LNLDCDHY
Sbjct  468   RLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFLLNLDCDHY  513



>ref|XP_007050191.1| Cellulose synthase A4 isoform 1 [Theobroma cacao]
 gb|EOX94348.1| Cellulose synthase A4 isoform 1 [Theobroma cacao]
Length=1041

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/507 (75%), Positives = 422/507 (83%), Gaps = 23/507 (5%)
 Frame = +2

Query  68    DERREVERESQ-KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHC  244
             DE R   R+S  K+C++C DEIG  E+G +FVAC  CGFPVC+PCY+YERSEG QCCP C
Sbjct  15    DENRPPTRQSSGKICKVCGDEIGHKEDGALFVACHVCGFPVCRPCYEYERSEGTQCCPQC  74

Query  245   NTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPP----------LSENGDYHNNQLP  394
             NTRYKR KG PRV GD+ED+ + +DF+ EF+TKN             L ENGDY NNQ  
Sbjct  75    NTRYKRLKGSPRVAGDEEDNSDQDDFDDEFQTKNRKDDSDRQHDGQILQENGDY-NNQQW  133

Query  395   HHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFddd  574
             H N       Q  +  GS  GKD E + KE++ +AEWK+RVEKWK RQEKRGL++   DD
Sbjct  134   HPNG------QAFSVAGSTAGKDFEGD-KEIYGSAEWKERVEKWKVRQEKRGLMSN--DD  184

Query  575   kggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDA  754
              G    E+DD+LMA+ARQPLWRK+PI SSLI+PYRIVIV R I+L FF  FRILTPAYDA
Sbjct  185   GGNDQAEEDDYLMAEARQPLWRKVPIPSSLINPYRIVIVLRFIVLVFFLRFRILTPAYDA  244

Query  755   FPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYV  934
             +PLWLISVICE+WF  SWILDQFPKW PI RETYLDRLSLRFER  EGE N L  VDV+V
Sbjct  245   YPLWLISVICEVWFAFSWILDQFPKWLPITRETYLDRLSLRFER--EGEPNQLGSVDVFV  302

Query  935   STVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPF  1114
             STVDPLKEPPIITANTVLSILAVDYPV+KV+CYVSDDGASMLLFDTL+ETAEFARRWVPF
Sbjct  303   STVDPLKEPPIITANTVLSILAVDYPVEKVTCYVSDDGASMLLFDTLSETAEFARRWVPF  362

Query  1115  CKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPE  1294
             CKK+ +EPRAPEFYFSEKIDYLKDKV P+FVKERRAMKREYEE+KVR+NALVAKAQKKPE
Sbjct  363   CKKHNVEPRAPEFYFSEKIDYLKDKVHPSFVKERRAMKREYEEFKVRINALVAKAQKKPE  422

Query  1295  EGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKA  1474
             EGWVMQDGTPWPGN TRDHPGMIQVYLGS GALDV+GKELP+LVYVSREKRPGYQHHKKA
Sbjct  423   EGWVMQDGTPWPGNITRDHPGMIQVYLGSAGALDVDGKELPRLVYVSREKRPGYQHHKKA  482

Query  1475  GAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             GA NALVRVSAVL+NAPF+LNLDCDHY
Sbjct  483   GAENALVRVSAVLSNAPFILNLDCDHY  509



>gb|AEK31216.1| cellulose synthase A [Eucalyptus camaldulensis]
Length=1045

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/526 (73%), Positives = 421/526 (80%), Gaps = 34/526 (6%)
 Frame = +2

Query  32    FTGGSH----LHAADH---DERREVERE-SQKMCRICRDEIGVVENGEVFVACRECGFPV  187
             F  GSH    LH  +    DE R   R+ + + CR+C DEIG+ ++G  FVAC ECGFPV
Sbjct  4     FAVGSHSRNELHVTNGGAADEHRSPPRQNAARTCRVCGDEIGLKDDGAPFVACHECGFPV  63

Query  188   CKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVG-------ddedhfegedfeqefeTKN  346
             C+PCY YERS+G QCCP CN RYKRHKGCPRV G       + ED  +        E + 
Sbjct  64    CRPCYVYERSDGTQCCPQCNARYKRHKGCPRVAGDDEDDHFEGEDFEDEFQIRNRGENEV  123

Query  347   HPP---LSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRV  517
              P     SENGD H  Q+  +    S+A       GSV G +LE E      NAEWK+R+
Sbjct  124   RPTGFDRSENGDSHAPQVHQNGQVFSSA-------GSVVGAELEGE-----GNAEWKERI  171

Query  518   EKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFR  697
             EKWK RQEKRGLV +  DD G  D E+DD+LMA+ARQPL RK+PISSS ISPYRIVIV R
Sbjct  172   EKWKIRQEKRGLVGK--DDGGNGDGEEDDYLMAEARQPLSRKVPISSSKISPYRIVIVLR  229

Query  698   LIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLR  877
             LI+L FF HFRILTPA DAFPLWLISVICE WF LSWILDQFPKW+P NRETYLDRLS+R
Sbjct  230   LIVLGFFLHFRILTPATDAFPLWLISVICETWFALSWILDQFPKWNPTNRETYLDRLSIR  289

Query  878   FERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASM  1057
             FER+GE  R  LAPVDV+VSTVDPLKEPPIITANTVLSILAVDYPVDKV CYVSDDGASM
Sbjct  290   FEREGEPSR--LAPVDVFVSTVDPLKEPPIITANTVLSILAVDYPVDKVCCYVSDDGASM  347

Query  1058  LLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREY  1237
             LLFDTL+ETAEFARRWVPFCKKY IEPR PEFYFS+KIDYLKDKV+P+FVKERRAMKREY
Sbjct  348   LLFDTLSETAEFARRWVPFCKKYSIEPRTPEFYFSQKIDYLKDKVEPSFVKERRAMKREY  407

Query  1238  EEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELP  1417
             EE+KVR+NALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS GALDVEGKELP
Sbjct  408   EEFKVRINALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSAGALDVEGKELP  467

Query  1418  KLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             +LVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPF+LNLDCDHY
Sbjct  468   RLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFLLNLDCDHY  513



>gb|AFR58755.1| cellulose synthase 2 [Eucalyptus tereticornis]
Length=1037

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/527 (73%), Positives = 420/527 (80%), Gaps = 35/527 (7%)
 Frame = +2

Query  32    FTGGSH----LH-----AADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFP  184
             F  GSH    LH     AAD   R    + + + CR+C DEIG+ ++G  FVAC ECGFP
Sbjct  4     FAVGSHSRNELHVTNGGAADEIHRSPPRQNAARTCRVCGDEIGLKDDGAPFVACHECGFP  63

Query  185   VCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVG-------ddedhfegedfeqefeTK  343
             VC+PCY YERS+G QCCP CN RYKRHKGCPRV G       + ED  +        E +
Sbjct  64    VCRPCYVYERSDGTQCCPQCNARYKRHKGCPRVAGDDEDDHFEGEDFEDEFQIRNRGENE  123

Query  344   NHPP---LSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDR  514
               P     SENGD H  Q+  +    S+A       GSV G +LE E      NAEWK+R
Sbjct  124   VRPTGFDRSENGDSHAPQVHPNGQVFSSA-------GSVVGAELEGE-----GNAEWKER  171

Query  515   VEKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVF  694
             +EKWK RQEKRGLV +  DD G  D E+DD+LMA+ARQPL RK+PISSS ISPYRIVIV 
Sbjct  172   IEKWKIRQEKRGLVGK--DDGGNGDGEEDDYLMAEARQPLSRKVPISSSKISPYRIVIVL  229

Query  695   RLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSL  874
             RLI+L FF HFRILTPA DAFPLWLISVICE WF LSWILDQFPKW+PINRETYLDRLS+
Sbjct  230   RLIVLGFFLHFRILTPATDAFPLWLISVICETWFALSWILDQFPKWNPINRETYLDRLSI  289

Query  875   RFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGAS  1054
             RF+R+GE  R  LAPVDV+VSTVDPLKEPPIITANTVLSILAVDYPVDKV CYVSDDGAS
Sbjct  290   RFDREGEPSR--LAPVDVFVSTVDPLKEPPIITANTVLSILAVDYPVDKVCCYVSDDGAS  347

Query  1055  MLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKRE  1234
             MLL DTL+ETAEFARRWVPFCKKY IEPR PEFYFS+KIDYLKDKV+P+FVKERRAMKRE
Sbjct  348   MLLLDTLSETAEFARRWVPFCKKYSIEPRTPEFYFSQKIDYLKDKVEPSFVKERRAMKRE  407

Query  1235  YEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKEL  1414
             YEE+KVR+NALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS GALDVEGKEL
Sbjct  408   YEEFKVRINALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSAGALDVEGKEL  467

Query  1415  PKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             P+LVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPF+LNLDCDHY
Sbjct  468   PRLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFLLNLDCDHY  514



>gb|ABY25278.1| cellulose synthase [Eucalyptus grandis]
Length=1045

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/526 (73%), Positives = 422/526 (80%), Gaps = 34/526 (6%)
 Frame = +2

Query  32    FTGGSH----LHAADH---DERREVERE-SQKMCRICRDEIGVVENGEVFVACRECGFPV  187
             F  GSH    LH  +    DE R   R+ + + CR+C DEIG+ ++G  FVAC ECGFPV
Sbjct  4     FAVGSHSRNELHVTNGGAADEHRSPPRQNAARTCRVCGDEIGLKDDGAPFVACHECGFPV  63

Query  188   CKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVG-------ddedhfegedfeqefeTKN  346
             C+PCY YERS+G QCCP CN RYKRHKGCPRV G       + ED  +        E + 
Sbjct  64    CRPCYVYERSDGTQCCPQCNARYKRHKGCPRVAGDDEDDHFEGEDFEDEFQIRNRGENEV  123

Query  347   HPP---LSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRV  517
              P     SENGD H  Q+  +    S+A       GSV G +LE E      NAEWK+R+
Sbjct  124   RPTGFDRSENGDSHAPQVHPNGQVFSSA-------GSVVGAELEGE-----GNAEWKERI  171

Query  518   EKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFR  697
             EKWK RQEKRGLV +  DD G  D E+DD+LMA+ARQPL RK+PISSS ISPYRIVIV R
Sbjct  172   EKWKIRQEKRGLVGK--DDGGNGDGEEDDYLMAEARQPLSRKVPISSSKISPYRIVIVLR  229

Query  698   LIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLR  877
             L++L FF HFRILTPA DAFPLWLISVICE WF LSWILDQFPKW+PINRETYLDRLS+R
Sbjct  230   LVVLGFFLHFRILTPATDAFPLWLISVICETWFALSWILDQFPKWNPINRETYLDRLSIR  289

Query  878   FERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASM  1057
             FER+GE  R  LAPVDV+VS+VDPLKEPPIITANTVLSILAVDYPVDKV CYVSDDGASM
Sbjct  290   FEREGEPSR--LAPVDVFVSSVDPLKEPPIITANTVLSILAVDYPVDKVCCYVSDDGASM  347

Query  1058  LLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREY  1237
             LLFDTL+ETAEFARRWVPFCKKY IEPR PEFYFS+KIDYLKDKV+P+FVKERRAMKREY
Sbjct  348   LLFDTLSETAEFARRWVPFCKKYSIEPRTPEFYFSQKIDYLKDKVEPSFVKERRAMKREY  407

Query  1238  EEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELP  1417
             EE+KVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS GALDVEGKELP
Sbjct  408   EEFKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSAGALDVEGKELP  467

Query  1418  KLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             +LVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPF+LNLDCDHY
Sbjct  468   RLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFLLNLDCDHY  513



>gb|AEX20380.1| cellulose synthase 2-Dt [Gossypium hirsutum]
 gb|AEX20382.1| cellulose synthase catalytic subunit 2-Dt [Gossypium hirsutum]
Length=1040

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/519 (73%), Positives = 425/519 (82%), Gaps = 20/519 (4%)
 Frame = +2

Query  14    VSMAALFTGGSHLHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCK  193
              +MAA F  GS   A D +      + S K+CR+C D+IG  ENG+ FVAC  C FPVC+
Sbjct  4     TTMAAGF--GSL--AVDENRGSSTHQSSTKICRVCGDKIGQKENGQPFVACHVCAFPVCR  59

Query  194   PCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKN-----HPPL  358
             PCY+YERSEGNQCCP CNTRYKRHKG PR+ GD+ED  + +DF+ EF+ KN     HP  
Sbjct  60    PCYEYERSEGNQCCPQCNTRYKRHKGSPRISGDEEDDSDQDDFDDEFQIKNRKDDSHP--  117

Query  359   SENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQ  538
              ++ +   N   H    N  AF   +  GS  GKDLE + KE++ + EWK+RVEKWK RQ
Sbjct  118   -QHENEEYNNNNHQWHPNGQAF---SVAGSTAGKDLEGD-KEIYGSEEWKERVEKWKVRQ  172

Query  539   EKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFF  718
             EKRGLV+   D+ G    E+DD+L+A+ARQPLWRK+PISSSLISPYRIVIV R  IL FF
Sbjct  173   EKRGLVSN--DNGGNDPPEEDDYLLAEARQPLWRKVPISSSLISPYRIVIVLRFFILAFF  230

Query  719   FHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEG  898
               FRILTPAYDA+PLWLISVICE+WF  SWILDQFPKW PI RETYLDRLSLRFER  EG
Sbjct  231   LRFRILTPAYDAYPLWLISVICEVWFAFSWILDQFPKWFPITRETYLDRLSLRFER--EG  288

Query  899   ERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLA  1078
             E N L  VDV+VSTVDPLKEPPIITANTVLSILAVDYPV+KV CYVSDDGASMLLFD+L+
Sbjct  289   EPNQLGAVDVFVSTVDPLKEPPIITANTVLSILAVDYPVEKVCCYVSDDGASMLLFDSLS  348

Query  1079  ETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRV  1258
             ETAEFARRWVPFCKK+ +EPRAPEFYF+EKIDYLKDKV P+FVKERRAMKREYEE+KVR+
Sbjct  349   ETAEFARRWVPFCKKHNVEPRAPEFYFNEKIDYLKDKVHPSFVKERRAMKREYEEFKVRI  408

Query  1259  NALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSR  1438
             NALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS GALDV+GKELP+LVYVSR
Sbjct  409   NALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSAGALDVDGKELPRLVYVSR  468

Query  1439  EKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             EKRPGYQHHKKAGA NALVRVSAVLTNAPF+LNLDCDHY
Sbjct  469   EKRPGYQHHKKAGAENALVRVSAVLTNAPFILNLDCDHY  507



>ref|XP_007050192.1| Cellulose synthase A4 isoform 2 [Theobroma cacao]
 gb|EOX94349.1| Cellulose synthase A4 isoform 2 [Theobroma cacao]
Length=1036

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/502 (75%), Positives = 422/502 (84%), Gaps = 18/502 (4%)
 Frame = +2

Query  68    DERREVERESQ-KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHC  244
             DE R   R+S  K+C++C DEIG  E+G +FVAC  CGFPVC+PCY+YERSEG QCCP C
Sbjct  15    DENRPPTRQSSGKICKVCGDEIGHKEDGALFVACHVCGFPVCRPCYEYERSEGTQCCPQC  74

Query  245   NTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLS----ENGDYHNNQLPHHNTTN  412
             NTRYKR KG PRV GD+ED+ + +DF+ EF+TKN    S    ENGDY NNQ  H N   
Sbjct  75    NTRYKRLKGSPRVAGDEEDNSDQDDFDDEFQTKNRKDDSDRQHENGDY-NNQQWHPNG--  131

Query  413   SAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadn  592
                 Q  +  GS  GKD E + KE++ +AEWK+RVEKWK RQEKRGL++   DD G    
Sbjct  132   ----QAFSVAGSTAGKDFEGD-KEIYGSAEWKERVEKWKVRQEKRGLMSN--DDGGNDQA  184

Query  593   edddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLI  772
             E+DD+LMA+ARQPLWRK+PI SSLI+PYRIVIV R I+L FF  FRILTPAYDA+PLWLI
Sbjct  185   EEDDYLMAEARQPLWRKVPIPSSLINPYRIVIVLRFIVLVFFLRFRILTPAYDAYPLWLI  244

Query  773   SVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPL  952
             SVICE+WF  SWILDQFPKW PI RETYLDRLSLRFER  EGE N L  VDV+VSTVDPL
Sbjct  245   SVICEVWFAFSWILDQFPKWLPITRETYLDRLSLRFER--EGEPNQLGSVDVFVSTVDPL  302

Query  953   KEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCI  1132
             KEPPIITANTVLSILAVDYPV+KV+CYVSDDGASMLLFDTL+ETAEFARRWVPFCKK+ +
Sbjct  303   KEPPIITANTVLSILAVDYPVEKVTCYVSDDGASMLLFDTLSETAEFARRWVPFCKKHNV  362

Query  1133  EPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQ  1312
             EPRAPEFYFSEKIDYLKDKV P+FVKERRAMKREYEE+KVR+NALVAKAQKKPEEGWVMQ
Sbjct  363   EPRAPEFYFSEKIDYLKDKVHPSFVKERRAMKREYEEFKVRINALVAKAQKKPEEGWVMQ  422

Query  1313  DGTPWPGNNTRDHPGMI-QVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNA  1489
             DGTPWPGN TRDHPGMI QVYLGS GALDV+GKELP+LVYVSREKRPGYQHHKKAGA NA
Sbjct  423   DGTPWPGNITRDHPGMIQQVYLGSAGALDVDGKELPRLVYVSREKRPGYQHHKKAGAENA  482

Query  1490  LVRVSAVLTNAPFMLNLDCDHY  1555
             LVRVSAVL+NAPF+LNLDCDHY
Sbjct  483   LVRVSAVLSNAPFILNLDCDHY  504



>gb|KHG10785.1| Cellulose synthase A catalytic subunit 3 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=1040

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/518 (73%), Positives = 425/518 (82%), Gaps = 20/518 (4%)
 Frame = +2

Query  17    SMAALFTGGSHLHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             +MAA F  GS   A D +      + S K+CR+C D+IG  ENG+ FVAC  C FPVC+P
Sbjct  5     TMAAGF--GSL--AVDENRGSSTHQSSTKICRVCGDKIGQKENGQPFVACHVCAFPVCRP  60

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKN-----HPPLS  361
             CY+YERSEGNQCCP CNTRYKRHKG PR+ GD+ED  + +DF+ EF+ KN     HP   
Sbjct  61    CYEYERSEGNQCCPQCNTRYKRHKGSPRISGDEEDDSDQDDFDDEFQIKNRKDDSHP---  117

Query  362   ENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQE  541
             ++ +   N   H    N  AF   +  GS  GKDLE + KE++ + EWK+RVEKWK RQE
Sbjct  118   QHENEEYNNNNHQWHPNGQAF---SVAGSTAGKDLEGD-KEIYGSEEWKERVEKWKVRQE  173

Query  542   KRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFF  721
             KRGLV+   D+ G    E+DD+L+A+ARQPLWRK+PISSSLISPYRIVIV R  IL FF 
Sbjct  174   KRGLVSN--DNGGNDPPEEDDYLLAEARQPLWRKVPISSSLISPYRIVIVLRFFILAFFL  231

Query  722   HFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGE  901
              FRILTPAYDA+PLWLISVICE+WF  SWILDQFPKW PI RETYLDRLSLRFER  EGE
Sbjct  232   RFRILTPAYDAYPLWLISVICEVWFAFSWILDQFPKWFPITRETYLDRLSLRFER--EGE  289

Query  902   RNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAE  1081
              N L  VDV+VSTVDPLKEPPIITANTVLSILAVDYPV+KV CYVSDDGASMLLFD+L+E
Sbjct  290   PNQLGAVDVFVSTVDPLKEPPIITANTVLSILAVDYPVEKVCCYVSDDGASMLLFDSLSE  349

Query  1082  TAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVN  1261
             TAEFARRWVPFCKK+ +EPRAPEFYF+EKIDYLKDKV P+FVKERRAMKREYEE+KVR+N
Sbjct  350   TAEFARRWVPFCKKHNVEPRAPEFYFNEKIDYLKDKVHPSFVKERRAMKREYEEFKVRIN  409

Query  1262  ALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSRE  1441
             ALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS GALDV+GKELP+LVYVSRE
Sbjct  410   ALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSAGALDVDGKELPRLVYVSRE  469

Query  1442  KRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             KRPGYQHHKKAGA NALVRVSAVLTNAPF+LNLDCDHY
Sbjct  470   KRPGYQHHKKAGAENALVRVSAVLTNAPFILNLDCDHY  507



>gb|AEX20379.1| cellulose synthase catalytic subunit 2-At [Gossypium hirsutum]
 gb|AEX20381.1| cellulose synthase catalytic subunit 2-At [Gossypium hirsutum]
Length=1039

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/518 (73%), Positives = 425/518 (82%), Gaps = 20/518 (4%)
 Frame = +2

Query  17    SMAALFTGGSHLHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             +MAA F  GS   A D +      + S K+CR+C D+IG  ENG+ FVAC  C FPVC+P
Sbjct  5     TMAAGF--GSL--AVDENRGSSTHQSSTKICRVCGDKIGQKENGQPFVACHVCAFPVCRP  60

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKN-----HPPLS  361
             CY+YERSEGNQCCP CNTRYKRHKG PR+ GD+ED  + +DF+ EF+ KN     HP   
Sbjct  61    CYEYERSEGNQCCPQCNTRYKRHKGSPRISGDEEDDSDQDDFDDEFQIKNRKDDSHP---  117

Query  362   ENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQE  541
             ++ +   N   H    N  AF   +  GS  GKDLE + KE++ + EWK+RVEKWK RQE
Sbjct  118   QHENEEYNNNNHQWHPNGQAF---SVAGSTAGKDLEGD-KEIYGSEEWKERVEKWKVRQE  173

Query  542   KRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFF  721
             KRGLV+   D+ G    E+DD+L+A+ARQPLWRK+PISSSLISPYRIVIV R  IL FF 
Sbjct  174   KRGLVSN--DNGGNDPPEEDDYLLAEARQPLWRKVPISSSLISPYRIVIVLRFFILAFFL  231

Query  722   HFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGE  901
              FRILTPAYDA+PLWLISVICE+WF  SWILDQFPKW PI RETYLDRLSLRFER  EGE
Sbjct  232   RFRILTPAYDAYPLWLISVICEVWFAFSWILDQFPKWFPITRETYLDRLSLRFER--EGE  289

Query  902   RNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAE  1081
              N L  VDV+VSTVDPLKEPPIITANTVLSILAVDYPV+KV CYVSDDGASMLLFD+L+E
Sbjct  290   PNQLGAVDVFVSTVDPLKEPPIITANTVLSILAVDYPVEKVCCYVSDDGASMLLFDSLSE  349

Query  1082  TAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVN  1261
             TAEFARRWVPFCKK+ +EPRAPEFYF+EKIDYLKDKV P+FVKERRAMKREYEE+KVR+N
Sbjct  350   TAEFARRWVPFCKKHNVEPRAPEFYFNEKIDYLKDKVHPSFVKERRAMKREYEEFKVRIN  409

Query  1262  ALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSRE  1441
             ALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS GALDV+GKELP+LVYVSRE
Sbjct  410   ALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSAGALDVDGKELPRLVYVSRE  469

Query  1442  KRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             KRPGYQHHKKAGA NALVRVSAVLTNAPF+LNLDCDHY
Sbjct  470   KRPGYQHHKKAGAENALVRVSAVLTNAPFILNLDCDHY  507



>gb|AAY60844.1| cellulose synthase 2 [Eucalyptus grandis]
Length=1045

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/526 (73%), Positives = 422/526 (80%), Gaps = 34/526 (6%)
 Frame = +2

Query  32    FTGGSH----LHAADH---DERREVERE-SQKMCRICRDEIGVVENGEVFVACRECGFPV  187
             F  GSH    LH  +    DE R   R+ + + CR+C DEIG+ ++G  FVAC ECGFPV
Sbjct  4     FAVGSHSRNELHVTNGGAADEHRSPPRQNAARTCRVCGDEIGLKDDGAPFVACHECGFPV  63

Query  188   CKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVG-------ddedhfegedfeqefeTKN  346
             C+PCY YERS+G QCCP CN RYKRHKGCPRV G       + ED  +        E + 
Sbjct  64    CRPCYVYERSDGTQCCPQCNARYKRHKGCPRVAGDDEDDHFEGEDFEDEFQIRNRGENEV  123

Query  347   HPP---LSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRV  517
              P     SENGD H  Q+  +    S+A       GSV G +LE E      NAEWK+R+
Sbjct  124   RPTGFDRSENGDSHAPQVHPNGQVFSSA-------GSVVGAELEGE-----GNAEWKERI  171

Query  518   EKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFR  697
             EKWK RQEKRGLV +  DD G  D E+DD+LMA+ARQPL RK+PISSS ISPYRIVIV R
Sbjct  172   EKWKIRQEKRGLVGK--DDGGNGDGEEDDYLMAEARQPLSRKVPISSSKISPYRIVIVLR  229

Query  698   LIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLR  877
             L++L FF HFRILTPA DAFPLWLISVICE WF LSWILDQFPKW+PI+RETYLDRLS+R
Sbjct  230   LVVLGFFLHFRILTPATDAFPLWLISVICETWFALSWILDQFPKWNPIDRETYLDRLSIR  289

Query  878   FERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASM  1057
             FER+GE  R  LAPVDV+VS+VDPLKEPPIITANTVLSILAVDYPVDKV CYVSDDGASM
Sbjct  290   FEREGEPSR--LAPVDVFVSSVDPLKEPPIITANTVLSILAVDYPVDKVCCYVSDDGASM  347

Query  1058  LLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREY  1237
             LLFDTL+ETAEFARRWVPFCKKY IEPR PEFYFS+KIDYLKDKV+P+FVKERRAMKREY
Sbjct  348   LLFDTLSETAEFARRWVPFCKKYSIEPRTPEFYFSQKIDYLKDKVEPSFVKERRAMKREY  407

Query  1238  EEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELP  1417
             EE+KVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS GALDVEGKELP
Sbjct  408   EEFKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSAGALDVEGKELP  467

Query  1418  KLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             +LVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPF+LNLDCDHY
Sbjct  468   RLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFLLNLDCDHY  513



>dbj|BAK18577.1| cellulose synthase catalytic subunit [Eucalyptus globulus]
Length=1047

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/527 (74%), Positives = 425/527 (81%), Gaps = 37/527 (7%)
 Frame = +2

Query  32    FTGGSH----LH-----AADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFP  184
             F  GSH    LH     AAD   R    + + + CR C DEIG+ ++G  FVAC ECGFP
Sbjct  4     FAVGSHSRNELHVTNGGAADEVHRSPPRQNAARTCRACGDEIGLKDDGAPFVACHECGFP  63

Query  185   VCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedh-fegedfeqefeTKNHPP--  355
             VC+PCY YERS+G QCCP CN RYKRHKGCPR+ GDDED  FEGEDFE EF+ +N     
Sbjct  64    VCRPCYVYERSDGTQCCPQCNARYKRHKGCPRIPGDDEDDHFEGEDFEDEFQIRNRGENA  123

Query  356   -------LSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDR  514
                     SENGD H  Q+  +    S+A       GSV G +LE E      NAEWK+R
Sbjct  124   VRPTGFDRSENGDSHAPQVHQNGQVFSSA-------GSVVGAELEGE-----GNAEWKER  171

Query  515   VEKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVF  694
             +EKWK RQEKRGLV++ D   G  + +D    MA+ARQPL RK+PISSS ISPYRIVIV 
Sbjct  172   IEKWKIRQEKRGLVSKDDGGNGDGEEDD----MAEARQPLSRKVPISSSKISPYRIVIVL  227

Query  695   RLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSL  874
             RL++L FF HFRILTPA DAFPLWLISVICE WF LSWILDQFPKW+PINRETYLDRLS+
Sbjct  228   RLVVLGFFLHFRILTPATDAFPLWLISVICETWFALSWILDQFPKWNPINRETYLDRLSI  287

Query  875   RFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGAS  1054
             RFER+GE  R  LAPVDV+VS+VDPLKEPPIITANTVLSILAVDYPVDKV CYVSDDGAS
Sbjct  288   RFEREGEPSR--LAPVDVFVSSVDPLKEPPIITANTVLSILAVDYPVDKVCCYVSDDGAS  345

Query  1055  MLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKRE  1234
             MLLFDTL+ETAEFARRWVPFCKKY IEPR PEFYFS+KIDYLKDKV+P+FVKERRAMKRE
Sbjct  346   MLLFDTLSETAEFARRWVPFCKKYSIEPRTPEFYFSQKIDYLKDKVEPSFVKERRAMKRE  405

Query  1235  YEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKEL  1414
             YEE+KVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS GALDVEGKEL
Sbjct  406   YEEFKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSAGALDVEGKEL  465

Query  1415  PKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             P+LVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPF+LNLDCDHY
Sbjct  466   PRLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFLLNLDCDHY  512



>dbj|BAK18576.1| cellulose synthase catalytic subunit [Eucalyptus globulus]
Length=1047

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/527 (73%), Positives = 425/527 (81%), Gaps = 37/527 (7%)
 Frame = +2

Query  32    FTGGSH----LH-----AADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFP  184
             F  GSH    LH     AAD   R    + + + CR C DEIG+ ++G  FVAC ECGFP
Sbjct  4     FAVGSHSRNELHVTNGGAADEVHRSPPRQNAARTCRACGDEIGLKDDGAPFVACHECGFP  63

Query  185   VCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedh-fegedfeqefeTKNHPP--  355
             VC+PCY YERS+G QCCP CN RYKRHKGCPR+ GDDED  FEGEDFE EF+ +N     
Sbjct  64    VCRPCYVYERSDGTQCCPQCNARYKRHKGCPRIPGDDEDDHFEGEDFEDEFQIRNRGENA  123

Query  356   -------LSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDR  514
                     SENGD H  Q+  +    S+A       GSV G +LE E      NAEWK+R
Sbjct  124   VRPTGFDRSENGDSHAPQVHQNGQVFSSA-------GSVVGAELEGE-----GNAEWKER  171

Query  515   VEKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVF  694
             +EKWK RQEKRGLV++ D   G  + ++    MA+ARQPL RK+PISSS ISPYRIVIV 
Sbjct  172   IEKWKIRQEKRGLVSKDDGGNGDGEEDE----MAEARQPLSRKVPISSSKISPYRIVIVL  227

Query  695   RLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSL  874
             RL++L FF HFRILTPA DAFPLWLISVICE WF LSWILDQFPKW+PINRETYLDRLS+
Sbjct  228   RLVVLGFFLHFRILTPATDAFPLWLISVICETWFALSWILDQFPKWNPINRETYLDRLSI  287

Query  875   RFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGAS  1054
             RFER+GE  R  LAPVDV+VS+VDPLKEPPIITANTVLSILAVDYPVDKV CYVSDDGAS
Sbjct  288   RFEREGEPSR--LAPVDVFVSSVDPLKEPPIITANTVLSILAVDYPVDKVCCYVSDDGAS  345

Query  1055  MLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKRE  1234
             MLLFDTL+ETAEFARRWVPFCKKY IEPR PEFYFS+KIDYLKDKV+P+FVKERRAMKRE
Sbjct  346   MLLFDTLSETAEFARRWVPFCKKYSIEPRTPEFYFSQKIDYLKDKVEPSFVKERRAMKRE  405

Query  1235  YEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKEL  1414
             YEE+KVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS GALDVEGKEL
Sbjct  406   YEEFKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSAGALDVEGKEL  465

Query  1415  PKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             P+LVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPF+LNLDCDHY
Sbjct  466   PRLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFLLNLDCDHY  512



>gb|ACS68193.1| cellulose synthase 4.1 catalytic subunit [Brassica napus]
Length=1038

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/513 (71%), Positives = 410/513 (80%), Gaps = 23/513 (4%)
 Frame = +2

Query  56    AADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCC  235
             A+  DE R     S K+CRICRDE+   +NG+ FVAC  C FPVCKPCY+YERS GN+CC
Sbjct  7     ASFGDEHRH-SSFSAKICRICRDEVKDGDNGQTFVACHVCAFPVCKPCYEYERSNGNKCC  65

Query  236   PHCNTRYKRHKGCPRVVG------------ddedhfegedfeqefeTKNHPPLSENGDYH  379
             P CNT YKRHKG P + G             D++       +     +N    SENGDY+
Sbjct  66    PQCNTPYKRHKGSPTIAGDDEEEENNGHVDSDDELNIKNRKDTSSIHQNFAYGSENGDYN  125

Query  380   NNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVT  559
             + Q       N  AF  T   GSV G++ E E+    ++AEWK+RV+KWK RQEKRGL+ 
Sbjct  126   SKQ---QWRPNGRAFSST---GSVLGREFEGERDGA-TDAEWKERVDKWKARQEKRGLLV  178

Query  560   RFdddkggadne-dddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRIL  736
             + +  K       +++FL ADARQPLWRK+PISSS ISPYRIVIV RLIIL FFF FRIL
Sbjct  179   KGEQTKDQDSQTDEEEFLDADARQPLWRKVPISSSKISPYRIVIVLRLIILVFFFRFRIL  238

Query  737   TPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLA  916
             TPA DA+PLWLISVICEIWF LSWILDQFPKW PINRETYLDRLS+RFERDGE  +N LA
Sbjct  239   TPAKDAYPLWLISVICEIWFALSWILDQFPKWFPINRETYLDRLSMRFERDGE--KNKLA  296

Query  917   PVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFA  1096
             PVDV+VSTVDPLKEPPIITANT+LSILAVDYPV KVSCYVSDDGASMLLFDTL+ET+EFA
Sbjct  297   PVDVFVSTVDPLKEPPIITANTILSILAVDYPVSKVSCYVSDDGASMLLFDTLSETSEFA  356

Query  1097  RRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAK  1276
             RRWVPFCKKY +EPRAPEFYFSEKIDYLKDKVQ TFVK+RRAMKREYEE+KVR+N+LVAK
Sbjct  357   RRWVPFCKKYNVEPRAPEFYFSEKIDYLKDKVQTTFVKDRRAMKREYEEFKVRINSLVAK  416

Query  1277  AQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGY  1456
             AQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLG EGA D++G ELP+LVYVSREKRPGY
Sbjct  417   AQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGKEGAYDIDGNELPRLVYVSREKRPGY  476

Query  1457  QHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
              HHKKAGAMNA+VRVSAVLTNAPFMLNLDCDHY
Sbjct  477   AHHKKAGAMNAMVRVSAVLTNAPFMLNLDCDHY  509



>emb|CDX94752.1| BnaC07g17610D [Brassica napus]
Length=1051

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/513 (71%), Positives = 410/513 (80%), Gaps = 23/513 (4%)
 Frame = +2

Query  56    AADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCC  235
             A+  DE R     S K+CRICRDE+   +NG+ FVAC  C FPVCKPCY+YERS GN+CC
Sbjct  7     ASFGDEHRH-SSFSAKICRICRDEVKDGDNGQTFVACHVCAFPVCKPCYEYERSNGNKCC  65

Query  236   PHCNTRYKRHKGCPRVVG------------ddedhfegedfeqefeTKNHPPLSENGDYH  379
             P CNT YKRHKG P + G             D++       +     +N    SENGDY+
Sbjct  66    PQCNTPYKRHKGSPTIAGDDEEEENNGHVDSDDELNIKNRKDTSSIHQNFAYGSENGDYN  125

Query  380   NNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVT  559
             + Q       N  AF  T   GSV G++ E E+    ++AEWK+RV+KWK RQEKRGL+ 
Sbjct  126   SKQ---QWRPNGRAFSST---GSVLGREFEGERDGA-TDAEWKERVDKWKARQEKRGLLV  178

Query  560   RFdddkggadne-dddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRIL  736
             + +  K       +++FL ADARQPLWRK+PISSS ISPYRIVIV RLIIL FFF FRIL
Sbjct  179   KGEQTKDQDSQTDEEEFLDADARQPLWRKVPISSSKISPYRIVIVLRLIILVFFFRFRIL  238

Query  737   TPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLA  916
             TPA DA+PLWLISVICEIWF LSWILDQFPKW PINRETYLDRLS+RFERDGE  +N LA
Sbjct  239   TPAKDAYPLWLISVICEIWFALSWILDQFPKWFPINRETYLDRLSMRFERDGE--KNKLA  296

Query  917   PVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFA  1096
             PVDV+VSTVDPLKEPPIITANT+LSILAVDYPV KVSCYVSDDGASMLLFDTL+ET+EFA
Sbjct  297   PVDVFVSTVDPLKEPPIITANTILSILAVDYPVSKVSCYVSDDGASMLLFDTLSETSEFA  356

Query  1097  RRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAK  1276
             RRWVPFCKKY +EPRAPEFYFSEKIDYLKDKVQ TFVK+RRAMKREYEE+KVR+N+LVAK
Sbjct  357   RRWVPFCKKYNVEPRAPEFYFSEKIDYLKDKVQTTFVKDRRAMKREYEEFKVRINSLVAK  416

Query  1277  AQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGY  1456
             AQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLG EGA D++G ELP+LVYVSREKRPGY
Sbjct  417   AQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGKEGAYDIDGNELPRLVYVSREKRPGY  476

Query  1457  QHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
              HHKKAGAMNA+VRVSAVLTNAPFMLNLDCDHY
Sbjct  477   AHHKKAGAMNAMVRVSAVLTNAPFMLNLDCDHY  509



>ref|NP_199216.2| cellulose synthase A catalytic subunit 4 [UDP-forming] [Arabidopsis 
thaliana]
 sp|Q84JA6.1|CESA4_ARATH RecName: Full=Cellulose synthase A catalytic subunit 4 [UDP-forming]; 
Short=AtCesA4; AltName: Full=Protein IRREGULAR XYLEM 
5; Short=AtIRX5 [Arabidopsis thaliana]
 gb|AAO64130.1| putative cellulose synthase catalytic subunit [Arabidopsis thaliana]
 gb|AAP04096.1| putative cellulose synthase catalytic subunit [Arabidopsis thaliana]
 dbj|BAF00480.1| cellulose synthase catalytic subunit like protein [Arabidopsis 
thaliana]
 gb|AED95050.1| cellulose synthase A catalytic subunit 4 [UDP-forming] [Arabidopsis 
thaliana]
 gb|AID66006.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=1049

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/508 (71%), Positives = 414/508 (81%), Gaps = 18/508 (4%)
 Frame = +2

Query  59    ADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCP  238
             A  D+       S K+C++C DE+   +NG+ FVAC  C +PVCKPCY+YERS GN+CCP
Sbjct  7     ASFDDEHRHSSFSAKICKVCGDEVKDDDNGQTFVACHVCVYPVCKPCYEYERSNGNKCCP  66

Query  239   HCNTRYKRHKGCPRVVG---------ddedhfegedfeqefeTKNHPPLSENGDYHNNQL  391
              CNT YKRHKG P++ G          D++       +     +N    SENGDY++ Q 
Sbjct  67    QCNTLYKRHKGSPKIAGDEENNGPDDSDDELNIKYRQDGSSIHQNFAYGSENGDYNSKQ-  125

Query  392   PHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdd  571
                   N  AF  T   GSV GKD E E ++ +++AEWK+RV+KWK RQEKRGLVT+ + 
Sbjct  126   --QWRPNGRAFSST---GSVLGKDFEAE-RDGYTDAEWKERVDKWKARQEKRGLVTKGEQ  179

Query  572   dkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYD  751
                  +++++++L A+ARQPLWRK+PISSS ISPYRIVIV RL+IL FFF FRILTPA D
Sbjct  180   TNEDKEDDEEEYLDAEARQPLWRKVPISSSKISPYRIVIVLRLVILVFFFRFRILTPAKD  239

Query  752   AFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVY  931
             A+PLWLISVICEIWF LSWILDQFPKW PINRETYLDRLS+RFERDGE  +N LAPVDV+
Sbjct  240   AYPLWLISVICEIWFALSWILDQFPKWFPINRETYLDRLSMRFERDGE--KNKLAPVDVF  297

Query  932   VSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVP  1111
             VSTVDPLKEPPIITANT+LSILAVDYPV+KVSCYVSDDGASMLLFDTL+ET+EFARRWVP
Sbjct  298   VSTVDPLKEPPIITANTILSILAVDYPVNKVSCYVSDDGASMLLFDTLSETSEFARRWVP  357

Query  1112  FCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKP  1291
             FCKKY +EPRAPEFYFSEKIDYLKDKVQ TFVK+RRAMKREYEE+KVR+NALVAKAQKKP
Sbjct  358   FCKKYNVEPRAPEFYFSEKIDYLKDKVQTTFVKDRRAMKREYEEFKVRINALVAKAQKKP  417

Query  1292  EEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKK  1471
             EEGWVMQDGTPWPGNNTRDHPGMIQVYLG EGA D++G ELP+LVYVSREKRPGY HHKK
Sbjct  418   EEGWVMQDGTPWPGNNTRDHPGMIQVYLGKEGAFDIDGNELPRLVYVSREKRPGYAHHKK  477

Query  1472  AGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             AGAMNA+VRVSAVLTNAPFMLNLDCDHY
Sbjct  478   AGAMNAMVRVSAVLTNAPFMLNLDCDHY  505



>ref|XP_002865387.1| hypothetical protein ARALYDRAFT_494593 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41646.1| hypothetical protein ARALYDRAFT_494593 [Arabidopsis lyrata subsp. 
lyrata]
Length=1047

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/507 (71%), Positives = 414/507 (82%), Gaps = 21/507 (4%)
 Frame = +2

Query  62    DHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPH  241
             DH+ R        K+CR+C DE+   +NG+ FVAC  C +PVCKPCY+YERS GN+CCP 
Sbjct  5     DHEHRHS---SPAKICRVCGDEVKDNDNGQTFVACHVCAYPVCKPCYEYERSNGNKCCPQ  61

Query  242   CNTRYKRHKGCPRVVG---------ddedhfegedfeqefeTKNHPPLSENGDYHNNQLP  394
             CNT YKRHKG P++VG          D++       +     +N    SENGDY++ Q  
Sbjct  62    CNTIYKRHKGSPKIVGDEENNGPDDSDDELNIKNRQDASSIHQNFAYGSENGDYNSKQ--  119

Query  395   HHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFddd  574
                  N  AF  T   GSV GKD E E ++ +++AEWK+RV+KWK RQEKRGLVT+ +  
Sbjct  120   -QWRPNGRAFSST---GSVLGKDFEAE-RDGYTDAEWKERVDKWKARQEKRGLVTKGEQT  174

Query  575   kggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDA  754
                 +++++++L A+ARQPLWRK+PISSS ISPYRIVIV RL+IL FFF FRILTPA DA
Sbjct  175   NEDKEDDEEEYLDAEARQPLWRKVPISSSKISPYRIVIVLRLVILVFFFRFRILTPAKDA  234

Query  755   FPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYV  934
             +PLWLISVICEIWF LSWILDQFPKW PINRETYLDRLS+RFERDGE  +N L PVDV+V
Sbjct  235   YPLWLISVICEIWFALSWILDQFPKWFPINRETYLDRLSMRFERDGE--KNKLEPVDVFV  292

Query  935   STVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPF  1114
             STVDPLKEPPIITANT+LSIL+VDYPV+KVSCYVSDDGASMLLFDTL+ET+EFARRWVPF
Sbjct  293   STVDPLKEPPIITANTILSILSVDYPVNKVSCYVSDDGASMLLFDTLSETSEFARRWVPF  352

Query  1115  CKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPE  1294
             CKKY +EPRAPEFYFSEKIDYLKDKVQ TFVK+RRAMKREYEE+KVR+NALVAKAQKKPE
Sbjct  353   CKKYNVEPRAPEFYFSEKIDYLKDKVQTTFVKDRRAMKREYEEFKVRINALVAKAQKKPE  412

Query  1295  EGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKA  1474
             EGWVMQDGTPWPGNNTRDHPGMIQVYLG EGA D++G ELP+LVYVSREKRPGY HHKKA
Sbjct  413   EGWVMQDGTPWPGNNTRDHPGMIQVYLGKEGAFDIDGNELPRLVYVSREKRPGYAHHKKA  472

Query  1475  GAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             GAMNA+VRVSAVLTNAPFMLNLDCDHY
Sbjct  473   GAMNAMVRVSAVLTNAPFMLNLDCDHY  499



>ref|XP_006403149.1| hypothetical protein EUTSA_v10003137mg [Eutrema salsugineum]
 gb|ESQ44602.1| hypothetical protein EUTSA_v10003137mg [Eutrema salsugineum]
Length=1045

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/506 (73%), Positives = 416/506 (82%), Gaps = 16/506 (3%)
 Frame = +2

Query  59    ADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCP  238
             A  D+       S K+CRIC DEI   +NG  FVAC  C FPVC+PCY+YERS GN+CCP
Sbjct  7     ASFDDEHRHSSFSAKICRICSDEIRDGDNGHTFVACHVCAFPVCRPCYEYERSNGNKCCP  66

Query  239   HCNTRYKRHKGCPRVVGddedhfegedfeqefeTKN---HPPL---SENGDYHNNQLPHH  400
              CNT YKRHKG PR+ GD+E++   +D + +   KN   H      SENGDY++ Q    
Sbjct  67    QCNTPYKRHKGSPRIEGDEEENNGPDDSDDDLNIKNRSIHQNFAYGSENGDYNSKQ---Q  123

Query  401   NTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdd-dk  577
                N  AF  T   GSV GK+ E E+    ++AEWK+RV+KWK RQEKRGLV + +  + 
Sbjct  124   WRPNGRAFSST---GSVLGKEFEAERDGA-TDAEWKERVDKWKARQEKRGLVMKGEQPNN  179

Query  578   ggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAF  757
                D E++++L A+ARQPLWRK+PISSS ISPYRIVIV RL+IL FFF FRILTPA DA+
Sbjct  180   EDDDEEEEEYLDAEARQPLWRKVPISSSKISPYRIVIVLRLVILAFFFRFRILTPANDAY  239

Query  758   PLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVS  937
             PLWLISVICEIWF LSWILDQFPKW PINRETYLDRL++RFERDGE  +N LAPVDV+VS
Sbjct  240   PLWLISVICEIWFALSWILDQFPKWFPINRETYLDRLAMRFERDGE--KNKLAPVDVFVS  297

Query  938   TVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFC  1117
             TVDPLKEPPIITANT+LSILAVDYPV+KVSCYVSDDGASMLLFDTL+ET+EFARRWVPFC
Sbjct  298   TVDPLKEPPIITANTILSILAVDYPVNKVSCYVSDDGASMLLFDTLSETSEFARRWVPFC  357

Query  1118  KKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEE  1297
             KKY +EPRAPEFYFSEKIDYLKDKVQ TFVK+RRAMKREYEE+KVR+N+LVAKAQKKPEE
Sbjct  358   KKYNVEPRAPEFYFSEKIDYLKDKVQTTFVKDRRAMKREYEEFKVRINSLVAKAQKKPEE  417

Query  1298  GWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAG  1477
             GWVMQDGTPWPGNNTRDHPGMIQVYLG EGA D++G ELP+LVYVSREKRPGY HHKKAG
Sbjct  418   GWVMQDGTPWPGNNTRDHPGMIQVYLGKEGAFDIDGNELPRLVYVSREKRPGYAHHKKAG  477

Query  1478  AMNALVRVSAVLTNAPFMLNLDCDHY  1555
             AMNA+VRVSAVLTNAPFMLNLDCDHY
Sbjct  478   AMNAMVRVSAVLTNAPFMLNLDCDHY  503



>ref|XP_009101741.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
isoform X1 [Brassica rapa]
Length=1052

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/513 (71%), Positives = 409/513 (80%), Gaps = 22/513 (4%)
 Frame = +2

Query  56    AADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCC  235
             A+  DE+      S K+CRICRDE+   +NG+ FVAC  C FPVCKPCY+YERS GN+CC
Sbjct  7     ASFGDEQHRHSSFSAKICRICRDEVKDGDNGQTFVACHVCAFPVCKPCYEYERSNGNKCC  66

Query  236   PHCNTRYKRHKGCPRVVG------------ddedhfegedfeqefeTKNHPPLSENGDYH  379
             P CNT YK HKG P + G             D++       +     +N    SENGDY+
Sbjct  67    PQCNTPYKHHKGSPTIAGDDEEEENNGHVDSDDELNIKNRKDTSSIHQNFAYGSENGDYN  126

Query  380   NNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVT  559
             + Q       +  AF  T   GSV G++ E E+    ++AEWK+RV+KWK RQEKRGL+ 
Sbjct  127   SKQ---QWRPSGRAFSST---GSVLGREFEGERDGA-TDAEWKERVDKWKARQEKRGLLV  179

Query  560   RFdddkggadne-dddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRIL  736
             + +  K       +++FL ADARQPLWRK+PISSS ISPYRIVIV RLIIL FFF FRIL
Sbjct  180   KGEQTKDQDSQSDEEEFLDADARQPLWRKVPISSSKISPYRIVIVLRLIILVFFFRFRIL  239

Query  737   TPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLA  916
             TPA DA+PLWLISVICEIWF LSWILDQFPKW PINRETYLDRLS+RFERDGE  +N LA
Sbjct  240   TPAKDAYPLWLISVICEIWFALSWILDQFPKWFPINRETYLDRLSMRFERDGE--KNKLA  297

Query  917   PVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFA  1096
             PVDV+VSTVDPLKEPPIITANT+LSILAVDYPV KVSCYVSDDGASMLLFDTL+ET+EFA
Sbjct  298   PVDVFVSTVDPLKEPPIITANTILSILAVDYPVSKVSCYVSDDGASMLLFDTLSETSEFA  357

Query  1097  RRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAK  1276
             RRWVPFCKKY +EPRAPEFYFSEKIDYLKDKVQ TFVK+RRAMKREYEE+KVR+N+LVAK
Sbjct  358   RRWVPFCKKYNVEPRAPEFYFSEKIDYLKDKVQTTFVKDRRAMKREYEEFKVRINSLVAK  417

Query  1277  AQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGY  1456
             AQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLG EGA D++G +LP+LVYVSREKRPGY
Sbjct  418   AQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGKEGAYDIDGNDLPRLVYVSREKRPGY  477

Query  1457  QHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
              HHKKAGAMNA+VRVSAVLTNAPFMLNLDCDHY
Sbjct  478   AHHKKAGAMNAMVRVSAVLTNAPFMLNLDCDHY  510



>ref|XP_006857480.1| hypothetical protein AMTR_s00067p00196920 [Amborella trichopoda]
 gb|ERN18947.1| hypothetical protein AMTR_s00067p00196920 [Amborella trichopoda]
Length=1022

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/495 (74%), Positives = 414/495 (84%), Gaps = 14/495 (3%)
 Frame = +2

Query  86    ERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRH  265
             +R   K+C +C DEIG  E+GE+FVAC  CGFPVC+PCY+YER EG QCCP CNTRY+R+
Sbjct  10    QRSRSKLCCVCGDEIGRREDGELFVACNVCGFPVCRPCYEYERKEGTQCCPQCNTRYRRY  69

Query  266   KGCPRVVGddedhfegedfeqefeTKNHPPLSENGDYHNNQLPHHNTTNSAAFQP-----  430
             KGCPRV GD+ED  +  DFE++ + K+H  L   G + +  +P  N   +  +QP     
Sbjct  70    KGCPRVAGDEEDDDDDNDFEEKLDVKSHRDL---GVHRSAIVPSENGDPNPLWQPGGPAY  126

Query  431   TAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadnedddFL  610
             ++  GSV GK++E E KEV+S+AEWK+RVEKWK RQEK+GL  +       A +E DD L
Sbjct  127   SSFTGSVAGKEMEGE-KEVYSSAEWKERVEKWKERQEKKGLAPK---QDAPAQDEPDDML  182

Query  611   MADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEI  790
             MA+ARQPLWRK+PI SS I+PYRIVI+ RL++L FFF FRI  PA DAF LWL SVICEI
Sbjct  183   MAEARQPLWRKVPIPSSKINPYRIVIILRLVVLGFFFRFRITNPASDAFGLWLTSVICEI  242

Query  791   WFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPII  970
             WF  SWILDQFPKW PI RETYLDRLS RFE +GE +R  L+PVDV+VSTVDPLKEPPII
Sbjct  243   WFAFSWILDQFPKWFPITRETYLDRLSARFEPEGEPDR--LSPVDVFVSTVDPLKEPPII  300

Query  971   TANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPE  1150
             TANTVLSIL+VDYPV+KVSCYVSDDGASMLLFDTL+ETAEFARRWVPFCKKY IEPR PE
Sbjct  301   TANTVLSILSVDYPVEKVSCYVSDDGASMLLFDTLSETAEFARRWVPFCKKYSIEPRTPE  360

Query  1151  FYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWP  1330
             FYFS+KIDYLKDKVQP+FVKERRAMKREYEE+KVR+NALVAKAQK PEEGWVMQDGTPWP
Sbjct  361   FYFSQKIDYLKDKVQPSFVKERRAMKREYEEFKVRINALVAKAQKAPEEGWVMQDGTPWP  420

Query  1331  GNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAV  1510
             GNNTRDHPGMIQVYLG+EGA DVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAV
Sbjct  421   GNNTRDHPGMIQVYLGAEGAHDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAV  480

Query  1511  LTNAPFMLNLDCDHY  1555
             LTNAPFMLNLDCDHY
Sbjct  481   LTNAPFMLNLDCDHY  495



>ref|XP_009101742.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
isoform X2 [Brassica rapa]
Length=1051

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/513 (71%), Positives = 409/513 (80%), Gaps = 23/513 (4%)
 Frame = +2

Query  56    AADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCC  235
             A+  DE R     S K+CRICRDE+   +NG+ FVAC  C FPVCKPCY+YERS GN+CC
Sbjct  7     ASFGDEHRH-SSFSAKICRICRDEVKDGDNGQTFVACHVCAFPVCKPCYEYERSNGNKCC  65

Query  236   PHCNTRYKRHKGCPRVVG------------ddedhfegedfeqefeTKNHPPLSENGDYH  379
             P CNT YK HKG P + G             D++       +     +N    SENGDY+
Sbjct  66    PQCNTPYKHHKGSPTIAGDDEEEENNGHVDSDDELNIKNRKDTSSIHQNFAYGSENGDYN  125

Query  380   NNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVT  559
             + Q       +  AF  T   GSV G++ E E+    ++AEWK+RV+KWK RQEKRGL+ 
Sbjct  126   SKQ---QWRPSGRAFSST---GSVLGREFEGERDGA-TDAEWKERVDKWKARQEKRGLLV  178

Query  560   RFdddkggadne-dddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRIL  736
             + +  K       +++FL ADARQPLWRK+PISSS ISPYRIVIV RLIIL FFF FRIL
Sbjct  179   KGEQTKDQDSQSDEEEFLDADARQPLWRKVPISSSKISPYRIVIVLRLIILVFFFRFRIL  238

Query  737   TPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLA  916
             TPA DA+PLWLISVICEIWF LSWILDQFPKW PINRETYLDRLS+RFERDGE  +N LA
Sbjct  239   TPAKDAYPLWLISVICEIWFALSWILDQFPKWFPINRETYLDRLSMRFERDGE--KNKLA  296

Query  917   PVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFA  1096
             PVDV+VSTVDPLKEPPIITANT+LSILAVDYPV KVSCYVSDDGASMLLFDTL+ET+EFA
Sbjct  297   PVDVFVSTVDPLKEPPIITANTILSILAVDYPVSKVSCYVSDDGASMLLFDTLSETSEFA  356

Query  1097  RRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAK  1276
             RRWVPFCKKY +EPRAPEFYFSEKIDYLKDKVQ TFVK+RRAMKREYEE+KVR+N+LVAK
Sbjct  357   RRWVPFCKKYNVEPRAPEFYFSEKIDYLKDKVQTTFVKDRRAMKREYEEFKVRINSLVAK  416

Query  1277  AQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGY  1456
             AQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLG EGA D++G +LP+LVYVSREKRPGY
Sbjct  417   AQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGKEGAYDIDGNDLPRLVYVSREKRPGY  476

Query  1457  QHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
              HHKKAGAMNA+VRVSAVLTNAPFMLNLDCDHY
Sbjct  477   AHHKKAGAMNAMVRVSAVLTNAPFMLNLDCDHY  509



>ref|XP_006281455.1| hypothetical protein CARUB_v10027534mg [Capsella rubella]
 gb|EOA14353.1| hypothetical protein CARUB_v10027534mg [Capsella rubella]
Length=1058

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/511 (71%), Positives = 411/511 (80%), Gaps = 21/511 (4%)
 Frame = +2

Query  59    ADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCP  238
             A  D+       S K+CR+C DE+   +NG++FVAC  C +PVCKPCY+YERS GN+CCP
Sbjct  7     ASFDDEHRHSSFSAKICRVCSDEVKDDDNGQIFVACHVCAYPVCKPCYEYERSNGNKCCP  66

Query  239   HCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLS----------ENGDYHNNQ  388
              CNT YKRHKG P++ GD+E++    + E E   KN    S          ENGDY + Q
Sbjct  67    QCNTLYKRHKGSPKIAGDEEENNGLGESENELNIKNRHDASSIHQNFAYGSENGDYTSKQ  126

Query  389   LPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFd  568
                    N  AF  T   GSV G D E E ++ +++AEWK+RV+KWK RQEKRGLV + +
Sbjct  127   ---QWRPNGRAFSST---GSVLGNDFEGE-RDGYTDAEWKERVDKWKARQEKRGLVVKGE  179

Query  569   ddkggadnedddFLMAD--ARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTP  742
                     +D++    D  ARQPLWRK+PISSS ISPYRIVIV RL+IL FFF FRILTP
Sbjct  180   QTNDQDKEDDEEEEYLDAEARQPLWRKVPISSSKISPYRIVIVLRLVILVFFFRFRILTP  239

Query  743   AYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPV  922
             A DA+PLWLISVICEIWF LSWILDQFPKW PINRETYLDRLS+RFERDGE  +N LAPV
Sbjct  240   AKDAYPLWLISVICEIWFALSWILDQFPKWFPINRETYLDRLSMRFERDGE--KNKLAPV  297

Query  923   DVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARR  1102
             DV+VSTVDPLKEPPIITANT+LSILAVDYPV+KVSCYVSDDGASMLLFDTL+ET+EFARR
Sbjct  298   DVFVSTVDPLKEPPIITANTILSILAVDYPVNKVSCYVSDDGASMLLFDTLSETSEFARR  357

Query  1103  WVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQ  1282
             WVPFCKKY +EPRAPEFYFSEKIDYLKDKVQ TFVK+RRAMKREYEE+KVR+NALVAKAQ
Sbjct  358   WVPFCKKYNVEPRAPEFYFSEKIDYLKDKVQTTFVKDRRAMKREYEEFKVRINALVAKAQ  417

Query  1283  KKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQH  1462
             KKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLG EGA D++G ELP+LVYVSREKRPGY H
Sbjct  418   KKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGKEGAYDIDGNELPRLVYVSREKRPGYAH  477

Query  1463  HKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             HKKAGAMNA+VRVSAVLTNAPFMLNLDCDHY
Sbjct  478   HKKAGAMNAMVRVSAVLTNAPFMLNLDCDHY  508



>ref|XP_010494402.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming]-like 
[Camelina sativa]
Length=1054

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/510 (71%), Positives = 411/510 (81%), Gaps = 20/510 (4%)
 Frame = +2

Query  59    ADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCP  238
             A  D+       S K+CR+C DE+   +NG+ FVAC  C +PVCKPCY+YERS GN+CCP
Sbjct  7     ASFDDEHRHSTFSAKICRVCGDEVKDDDNGQTFVACHVCAYPVCKPCYEYERSNGNKCCP  66

Query  239   HCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLS---------ENGDYHNNQL  391
              CNT YKRHKG P++ GD+E +   +  + E   KN    S         ENGDY++ Q 
Sbjct  67    QCNTLYKRHKGSPKIDGDEEGNNGVDGSDDELNIKNRQDSSIHQNFAYGSENGDYNSKQQ  126

Query  392   PHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdd  571
                N       +  ++ GSV GKD E E ++ +++AEWK+RV+KWK RQEKRGLV + D 
Sbjct  127   WRQNG------RTFSSTGSVLGKDFEAE-RDGYTDAEWKERVDKWKARQEKRGLVVKGDQ  179

Query  572   dkggadnedddFLMAD--ARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPA  745
                    +D++    D  ARQPLWRK+PISSS ISPYRIVIV RL+IL FFF FRILTPA
Sbjct  180   TNDQDKEDDEEDEYLDAEARQPLWRKVPISSSKISPYRIVIVLRLVILVFFFRFRILTPA  239

Query  746   YDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVD  925
              DA+PLWLISVICEIWF LSWILDQFPKW PINRETYLDRLS+RFERDGE  +N LAPVD
Sbjct  240   KDAYPLWLISVICEIWFALSWILDQFPKWFPINRETYLDRLSMRFERDGE--KNKLAPVD  297

Query  926   VYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRW  1105
             V+VSTVDPLKEPPIITANT+LSILAVDYPV+KVSCYVSDDGASMLLFDTL+ET+EFARRW
Sbjct  298   VFVSTVDPLKEPPIITANTILSILAVDYPVNKVSCYVSDDGASMLLFDTLSETSEFARRW  357

Query  1106  VPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQK  1285
             VPFCKKY +EPRAPEFYFSEKIDYLKDKVQ TFVK+RRAMKREYEE+KVR+NALVAKAQK
Sbjct  358   VPFCKKYNVEPRAPEFYFSEKIDYLKDKVQTTFVKDRRAMKREYEEFKVRINALVAKAQK  417

Query  1286  KPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHH  1465
             KPEEGWVMQDGTPWPGNNTRDHPGMIQVYLG EGA D++G ELP+LVYVSREKRPGY HH
Sbjct  418   KPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGKEGAFDIDGNELPRLVYVSREKRPGYDHH  477

Query  1466  KKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             KKAGAMNA+VRVSAVLTNAPFMLNLDCDHY
Sbjct  478   KKAGAMNAMVRVSAVLTNAPFMLNLDCDHY  507



>ref|NP_001064811.1| Os10g0467800 [Oryza sativa Japonica Group]
 sp|Q9AV71.1|CESA7_ORYSJ RecName: Full=Cellulose synthase A catalytic subunit 7 [UDP-forming]; 
AltName: Full=OsCesA7 [Oryza sativa Japonica Group]
 gb|AAK27814.1|AC022457_17 putative cellulose synthase [Oryza sativa Japonica Group]
 gb|AAP54202.1| Cellulose synthase A catalytic subunit 4, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF26725.1| Os10g0467800 [Oryza sativa Japonica Group]
 dbj|BAG92896.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1063

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/518 (71%), Positives = 418/518 (81%), Gaps = 24/518 (5%)
 Frame = +2

Query  23    AALFTGGSHLHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCY  202
              A  TGG H             +  +K CR+C +E+   E+G+ FVAC ECGFPVCKPCY
Sbjct  3     TASVTGGEH-------------KGKEKTCRVCGEEVAAREDGKPFVACAECGFPVCKPCY  49

Query  203   QYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKN-------HPPLS  361
             +YERSEG QCCP CNTRYKRHKGCPRV GD++D  + +DFE+EF+ K+       H P++
Sbjct  50    EYERSEGTQCCPQCNTRYKRHKGCPRVEGDEDDGGDMDDFEEEFQIKSPTKQKPPHEPVN  109

Query  362   ENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQE  541
              +    N + P            ++  GSV GKDLE E +E+    EWKDR++KWKT+QE
Sbjct  110   FDVYSENGEQPAQKWRPGGP-ALSSFTGSVAGKDLEQE-REMEGGMEWKDRIDKWKTKQE  167

Query  542   KRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFF  721
             KRG + R D D     N+D+  L+A+ARQPLWRK+PI SS I+PYRIVIV RL++LCFF 
Sbjct  168   KRGKLNRDDSDDDDDKNDDEYMLLAEARQPLWRKVPIPSSKINPYRIVIVLRLVVLCFFL  227

Query  722   HFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGE  901
              FRI TPA DA PLWL SVICE+WF LSWILDQ PKWSP+ RETYLDRL+LR+ERDGE  
Sbjct  228   KFRITTPAMDAVPLWLASVICELWFALSWILDQLPKWSPVTRETYLDRLALRYERDGEPC  287

Query  902   RNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAE  1081
             R  LAP+D +VSTVDPLKEPPIITANTVLSILAVDYPVD+VSCYVSDDGASMLLFDTL+E
Sbjct  288   R--LAPIDFFVSTVDPLKEPPIITANTVLSILAVDYPVDRVSCYVSDDGASMLLFDTLSE  345

Query  1082  TAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVN  1261
             TAEFARRWVPFCKK+ IEPRAPEFYFS+KIDYLKDKVQPTFVKERRAMKREYEE+KVR+N
Sbjct  346   TAEFARRWVPFCKKFTIEPRAPEFYFSQKIDYLKDKVQPTFVKERRAMKREYEEFKVRIN  405

Query  1262  ALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSRE  1441
             ALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS+GALDVEG ELP+LVYVSRE
Sbjct  406   ALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSQGALDVEGSELPRLVYVSRE  465

Query  1442  KRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             KRPGY HHKKAGAMN+LVRVSAVLTNAPF+LNLDCDHY
Sbjct  466   KRPGYNHHKKAGAMNSLVRVSAVLTNAPFILNLDCDHY  503



>ref|NP_001105672.1| cellulose synthase10 [Zea mays]
 gb|AAR23310.1| cellulose synthase catalytic subunit 10 [Zea mays]
Length=1078

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/528 (70%), Positives = 422/528 (80%), Gaps = 24/528 (5%)
 Frame = +2

Query  17    SMAALFTGGSHLHAADHDERREVERESQ------KMCRICRDEIGVVENGEVFVACRECG  178
             S+      GSH+    H  R   E  ++      K CR+C DE+G  E+G+ FVAC ECG
Sbjct  5     SVTGGLAAGSHMRDELHVMRAREEPNAKVRSADVKTCRVCADEVGTREDGQPFVACAECG  64

Query  179   FPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKN----  346
             FPVC+PCY+YERSEG QCCP CNTRYKR KGCPRV GD+E+  E +DFE EF  K+    
Sbjct  65    FPVCRPCYEYERSEGTQCCPQCNTRYKRQKGCPRVEGDEEEGPEMDDFEDEFPAKSPKKP  124

Query  347   HPPL-----SENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKD  511
             H P+     SENG++   +      T S+        GSV GKDLE E +E+  + EWKD
Sbjct  125   HEPVAFDVYSENGEHPAQKWRTGGQTLSSF------TGSVAGKDLEAE-REMEGSMEWKD  177

Query  512   RVEKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIV  691
             R++KWKT+QEKRG +   D D     NED+  L+A+ARQPLWRK+PI SS+I+PYRIVIV
Sbjct  178   RIDKWKTKQEKRGKLNHDDSDDDDDKNEDEYMLLAEARQPLWRKVPIPSSMINPYRIVIV  237

Query  692   FRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLS  871
              RL++LCFF  FRI TPA DA PLWL SVICE+WF  SWILDQ PKW+P+ RETYLDRL+
Sbjct  238   LRLVVLCFFLKFRITTPATDAVPLWLASVICELWFAFSWILDQLPKWAPVTRETYLDRLA  297

Query  872   LRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGA  1051
             LR++R+GE  R  L+P+D +VSTVDPLKEPPIITANTVLSILAVDYPVD+VSCYVSDDGA
Sbjct  298   LRYDREGEACR--LSPIDFFVSTVDPLKEPPIITANTVLSILAVDYPVDRVSCYVSDDGA  355

Query  1052  SMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKR  1231
             SMLLFD L+ETAEFARRWVPFCKK+ +EPRAPEFYFS+KIDYLKDKVQPTFVKERRAMKR
Sbjct  356   SMLLFDALSETAEFARRWVPFCKKFAVEPRAPEFYFSQKIDYLKDKVQPTFVKERRAMKR  415

Query  1232  EYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKE  1411
             EYEE+KVR+NALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLG++GALDVEG E
Sbjct  416   EYEEFKVRINALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGNQGALDVEGHE  475

Query  1412  LPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             LP+LVYVSREKRPGY HHKKAGAMNALVRVSAVLTNAPF+LNLDCDHY
Sbjct  476   LPRLVYVSREKRPGYNHHKKAGAMNALVRVSAVLTNAPFILNLDCDHY  523



>gb|EEC67136.1| hypothetical protein OsI_33963 [Oryza sativa Indica Group]
Length=1063

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/518 (71%), Positives = 418/518 (81%), Gaps = 24/518 (5%)
 Frame = +2

Query  23    AALFTGGSHLHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCY  202
              A  TGG H             +  +K CR+C +E+   E+G+ FVAC ECGFPVC+PCY
Sbjct  3     TASVTGGEH-------------KGKEKTCRVCGEEVAAREDGKPFVACAECGFPVCRPCY  49

Query  203   QYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKN-------HPPLS  361
             +YERSEG QCCP CNTRYKRHKGCPRV GD++D  + +DFE+EF+ K+       H P++
Sbjct  50    EYERSEGTQCCPQCNTRYKRHKGCPRVEGDEDDGGDMDDFEEEFQIKSPTKQKPPHEPVN  109

Query  362   ENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQE  541
              +    N + P            ++  GSV GKDLE E +E+    EWKDR++KWKT+QE
Sbjct  110   FDVYSENGEQPAQKWRPGGP-ALSSFTGSVAGKDLEQE-REMEGGMEWKDRIDKWKTKQE  167

Query  542   KRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFF  721
             KRG + R D D     N+D+  L+A+ARQPLWRK+PI SS I+PYRIVIV RL++LCFF 
Sbjct  168   KRGKLNRDDSDDDDDKNDDEYMLLAEARQPLWRKVPIPSSKINPYRIVIVLRLVVLCFFL  227

Query  722   HFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGE  901
              FRI TPA DA PLWL SVICE+WF LSWILDQ PKWSP+ RETYLDRL+LR+ERDGE  
Sbjct  228   KFRITTPAMDAVPLWLASVICELWFALSWILDQLPKWSPVTRETYLDRLALRYERDGEPC  287

Query  902   RNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAE  1081
             R  LAP+D +VSTVDPLKEPPIITANTVLSILAVDYPVD+VSCYVSDDGASMLLFDTL+E
Sbjct  288   R--LAPIDFFVSTVDPLKEPPIITANTVLSILAVDYPVDRVSCYVSDDGASMLLFDTLSE  345

Query  1082  TAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVN  1261
             TAEFARRWVPFCKK+ IEPRAPEFYFS+KIDYLKDKVQPTFVKERRAMKREYEE+KVR+N
Sbjct  346   TAEFARRWVPFCKKFTIEPRAPEFYFSQKIDYLKDKVQPTFVKERRAMKREYEEFKVRIN  405

Query  1262  ALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSRE  1441
             ALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS+GALDVEG ELP+LVYVSRE
Sbjct  406   ALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSQGALDVEGSELPRLVYVSRE  465

Query  1442  KRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             KRPGY HHKKAGAMN+LVRVSAVLTNAPF+LNLDCDHY
Sbjct  466   KRPGYNHHKKAGAMNSLVRVSAVLTNAPFILNLDCDHY  503



>gb|AAO15532.1|AF458083_1 cellulose synthase [Arabidopsis thaliana]
Length=1055

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/509 (71%), Positives = 414/509 (81%), Gaps = 19/509 (4%)
 Frame = +2

Query  59    ADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCP  238
             A  D+       S K+C++C DE+   +NG+ FVAC  C +PVCKPCY+YERS GN+CCP
Sbjct  7     ASFDDEHRHSSFSAKICKVCGDEVKDDDNGQTFVACHVCVYPVCKPCYEYERSNGNKCCP  66

Query  239   HCNTRYKRHKGCPRVVG---------ddedhfegedfeqefeTKNHPPLSENGDYHNNQL  391
              CNT YKRHKG P++ G          D++       +     +N    SENGDY++ Q 
Sbjct  67    QCNTLYKRHKGSPKIAGDEENNGPDDSDDELNIKYRQDGSSIHQNFAYGSENGDYNSKQ-  125

Query  392   PHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRF-d  568
                   N  AF  T   GSV GKD E E ++ +++AEWK+RV+KWK RQEKRGLVT+   
Sbjct  126   --QCRPNGRAFSST---GSVLGKDFEAE-RDGYTDAEWKERVDKWKARQEKRGLVTKGEQ  179

Query  569   ddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAY  748
              ++   D+E+++ L A+ARQPLWRK+PISSS ISPYRIVIV RL+IL FFF FRILTPA 
Sbjct  180   TNEDKEDDEEEELLDAEARQPLWRKVPISSSKISPYRIVIVLRLVILVFFFRFRILTPAK  239

Query  749   DAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDV  928
             DA+PLWLISVICEIWF LSWILDQFPKW PINRETYLDRLS+RFERDGE  +N LAPVDV
Sbjct  240   DAYPLWLISVICEIWFALSWILDQFPKWFPINRETYLDRLSMRFERDGE--KNKLAPVDV  297

Query  929   YVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWV  1108
             +VSTVDPLKEPPIITANT+LSILAVDYPV+KVSCYVSDDGASMLLFDTL+ET+EFARRWV
Sbjct  298   FVSTVDPLKEPPIITANTILSILAVDYPVNKVSCYVSDDGASMLLFDTLSETSEFARRWV  357

Query  1109  PFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKK  1288
             PFCKKY +EPRAPEFYFSEKIDYLKDKVQ TFVK+RRAMKREYEE+KVR+NALVAKAQKK
Sbjct  358   PFCKKYNVEPRAPEFYFSEKIDYLKDKVQTTFVKDRRAMKREYEEFKVRINALVAKAQKK  417

Query  1289  PEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHK  1468
             PEEGWVMQDGTPWPGNNTRDHPGMIQVYLG EGA D++G ELP+LVYVSREKRPGY HHK
Sbjct  418   PEEGWVMQDGTPWPGNNTRDHPGMIQVYLGKEGAFDIDGNELPRLVYVSREKRPGYAHHK  477

Query  1469  KAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             KAGAMNA+VRVSAVLTNAPFMLNLDCDHY
Sbjct  478   KAGAMNAMVRVSAVLTNAPFMLNLDCDHY  506



>ref|XP_010481785.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
[Camelina sativa]
Length=1055

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/511 (71%), Positives = 411/511 (80%), Gaps = 21/511 (4%)
 Frame = +2

Query  59    ADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCP  238
             A  D+       S K+CR+C DE+   +NG+ FVAC  C +PVCKPC++YERS GN+CCP
Sbjct  7     ASFDDEHRHSSFSAKICRVCGDEVKDDDNGQTFVACHVCAYPVCKPCFEYERSNGNKCCP  66

Query  239   HCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLS----------ENGDYHNNQ  388
              CNT YKRHKG P++ GD+E++   +    E   KN    S          ENG+Y++ Q
Sbjct  67    QCNTLYKRHKGSPKIDGDEEENNGLDGSHDELNIKNRQDASSIHQNFAYGSENGEYNSTQ  126

Query  389   LPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFd  568
                    N  AF  T   GSV GKD E E ++ +++AEWK+RV+KWK RQEKRGLV + D
Sbjct  127   ---QWRPNGRAFSST---GSVLGKDFEAE-RDGYTDAEWKERVDKWKARQEKRGLVVKGD  179

Query  569   ddkggadnedddFLMAD--ARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTP  742
                     +D++    D  ARQPLWRK+PISSS ISPYRIVIV RL+IL FFF FRILTP
Sbjct  180   QTNDQDKEDDEEDEYLDAEARQPLWRKVPISSSKISPYRIVIVLRLVILVFFFRFRILTP  239

Query  743   AYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPV  922
             A DA+PLWLISVICEIWF LSWILDQFPKW PINRETYLDRLS+RFERDGE  +N LAPV
Sbjct  240   AKDAYPLWLISVICEIWFALSWILDQFPKWFPINRETYLDRLSMRFERDGE--KNKLAPV  297

Query  923   DVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARR  1102
             DV+VSTVDPLKEPPIITANT+LSILAVDYPV+KVSCYVSDDGASMLLFDTL+ET+EFARR
Sbjct  298   DVFVSTVDPLKEPPIITANTILSILAVDYPVNKVSCYVSDDGASMLLFDTLSETSEFARR  357

Query  1103  WVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQ  1282
             WVPFCKKY +EPRAPEFYFSEKIDYLKDKVQ TFVK+RRAMKREYEE+KVR+NALVAKAQ
Sbjct  358   WVPFCKKYNVEPRAPEFYFSEKIDYLKDKVQTTFVKDRRAMKREYEEFKVRINALVAKAQ  417

Query  1283  KKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQH  1462
             KKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLG EGA D++G ELP+LVYVSREKRPGY H
Sbjct  418   KKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGKEGAFDIDGNELPRLVYVSREKRPGYAH  477

Query  1463  HKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             HKKAGAMNA+VRVSAVLTNAPFMLNLDCDHY
Sbjct  478   HKKAGAMNAMVRVSAVLTNAPFMLNLDCDHY  508



>ref|XP_010696484.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
[Beta vulgaris subsp. vulgaris]
Length=1040

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/504 (74%), Positives = 422/504 (84%), Gaps = 17/504 (3%)
 Frame = +2

Query  68    DERREVERESQ-KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHC  244
             DE R   R+S+  +CR+C D I V E+GE F+AC+EC FPVC+PCY+YER EG QCCP C
Sbjct  13    DENRPPTRQSRANICRVCGDGIEVREDGEAFIACQECKFPVCRPCYEYERCEGTQCCPQC  72

Query  245   NTRYKRHKGCPRVVGddedhfegedfeqefeTKNHP----PLSENGDYHNNQLPHHNTTN  412
             NTRYKR +G PRV GD+E+H +  D ++EFE K +P      SENG+Y N Q  H N   
Sbjct  73    NTRYKRLRGSPRVEGDEEEHLDANDLDEEFENKINPQHLTSHSENGEY-NQQQWHVNGHP  131

Query  413   SAAFQPTAAPGSVGGKDLEDEQK---EVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkgg  583
              ++F      GSV GK+L+ E+    +   + +WK+RVEKWKTRQEK+GLV+ ++ D+  
Sbjct  132   FSSFA-----GSVTGKELDGEKDMNGKDLDSDQWKERVEKWKTRQEKKGLVSTYEGDQND  186

Query  584   adnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPL  763
                EDD FL A+ARQPLWRK+PISSS I+PYRIVIV RL+IL FF  FRILTPA DA+PL
Sbjct  187   QAEEDD-FLTAEARQPLWRKVPISSSRINPYRIVIVMRLVILAFFLRFRILTPATDAYPL  245

Query  764   WLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTV  943
             WLISVICE WF  SWILDQFPKW PINRETYL+RL+LRFER  EGE N+LAPVD +VSTV
Sbjct  246   WLISVICETWFAFSWILDQFPKWFPINRETYLERLTLRFER--EGEPNSLAPVDFFVSTV  303

Query  944   DPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKK  1123
             DPLKEPPIITANTVLSIL+VDYPV+KVSCYVSDDGASMLLFDTL+ETAEFARRWVPFCKK
Sbjct  304   DPLKEPPIITANTVLSILSVDYPVEKVSCYVSDDGASMLLFDTLSETAEFARRWVPFCKK  363

Query  1124  YCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGW  1303
             Y IEPRAPEFYFS+K+DYLKDKVQ TFVK+RRAMKREYEE+KV +NALVA+AQKKPEEGW
Sbjct  364   YNIEPRAPEFYFSQKMDYLKDKVQATFVKDRRAMKREYEEFKVSINALVAQAQKKPEEGW  423

Query  1304  VMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAM  1483
             VMQDG+PWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGY HHKKAGAM
Sbjct  424   VMQDGSPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYNHHKKAGAM  483

Query  1484  NALVRVSAVLTNAPFMLNLDCDHY  1555
             NALVRVSAVLTNAPF+LNLDCDHY
Sbjct  484   NALVRVSAVLTNAPFILNLDCDHY  507



>gb|EEE51108.1| hypothetical protein OsJ_31839 [Oryza sativa Japonica Group]
Length=1063

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/518 (71%), Positives = 417/518 (81%), Gaps = 24/518 (5%)
 Frame = +2

Query  23    AALFTGGSHLHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCY  202
              A  TGG H             +  +K CR+C +E+   E+G+ FVAC ECGFPVCKPCY
Sbjct  3     TASVTGGEH-------------KGKEKTCRVCGEEVAAREDGKPFVACAECGFPVCKPCY  49

Query  203   QYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKN-------HPPLS  361
             +YERSEG QCCP CNTRYKRHKGCPRV GD++D  + +DFE+EF+ K+       H P++
Sbjct  50    EYERSEGTQCCPQCNTRYKRHKGCPRVEGDEDDGGDMDDFEEEFQIKSPTKQKPPHEPVN  109

Query  362   ENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQE  541
              +    N + P            ++  GSV GKDLE E +E+    EWKDR++KWKT+QE
Sbjct  110   FDVYSENGEQPAQKWRPGGP-ALSSFTGSVAGKDLEQE-REMEGGMEWKDRIDKWKTKQE  167

Query  542   KRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFF  721
             K G + R D D     N+D+  L+A+ARQPLWRK+PI SS I+PYRIVIV RL++LCFF 
Sbjct  168   KPGKLNRDDSDDDDDKNDDEYMLLAEARQPLWRKVPIPSSKINPYRIVIVLRLVVLCFFL  227

Query  722   HFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGE  901
              FRI TPA DA PLWL SVICE+WF LSWILDQ PKWSP+ RETYLDRL+LR+ERDGE  
Sbjct  228   KFRITTPAMDAVPLWLASVICELWFALSWILDQLPKWSPVTRETYLDRLALRYERDGEPC  287

Query  902   RNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAE  1081
             R  LAP+D +VSTVDPLKEPPIITANTVLSILAVDYPVD+VSCYVSDDGASMLLFDTL+E
Sbjct  288   R--LAPIDFFVSTVDPLKEPPIITANTVLSILAVDYPVDRVSCYVSDDGASMLLFDTLSE  345

Query  1082  TAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVN  1261
             TAEFARRWVPFCKK+ IEPRAPEFYFS+KIDYLKDKVQPTFVKERRAMKREYEE+KVR+N
Sbjct  346   TAEFARRWVPFCKKFTIEPRAPEFYFSQKIDYLKDKVQPTFVKERRAMKREYEEFKVRIN  405

Query  1262  ALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSRE  1441
             ALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS+GALDVEG ELP+LVYVSRE
Sbjct  406   ALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSQGALDVEGSELPRLVYVSRE  465

Query  1442  KRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             KRPGY HHKKAGAMN+LVRVSAVLTNAPF+LNLDCDHY
Sbjct  466   KRPGYNHHKKAGAMNSLVRVSAVLTNAPFILNLDCDHY  503



>ref|XP_010441941.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming]-like 
[Camelina sativa]
Length=1057

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/511 (71%), Positives = 410/511 (80%), Gaps = 21/511 (4%)
 Frame = +2

Query  59    ADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCP  238
             A  D+       S K+CR+C DE+   +NG+ FVAC  C +PVCKPCY+YERS GN+CCP
Sbjct  7     ASFDDEHRHSSFSAKICRVCGDEVKDDDNGQNFVACHVCAYPVCKPCYEYERSNGNKCCP  66

Query  239   HCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLS----------ENGDYHNNQ  388
              CNT  KRHKG P++ GD+E +   +  + E   KN    S          ENGDY++ Q
Sbjct  67    QCNTLCKRHKGSPKIDGDEEGNNGLDGSDDELNIKNRQDASSIHQNFAYGSENGDYNSKQ  126

Query  389   LPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFd  568
                    N  AF  T   GSV GKD E E ++ +++AEWK+RV+KWK RQEKRGLV + D
Sbjct  127   ---QWRPNGRAFSST---GSVLGKDFEAE-RDGYTDAEWKERVDKWKARQEKRGLVVKGD  179

Query  569   ddkggadnedddFLMAD--ARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTP  742
                     +D++    D  ARQPLWRK+PISSS ISPYRIVIV RL+IL FFF FRILTP
Sbjct  180   QTNDQDKEDDEEDEYLDAEARQPLWRKVPISSSKISPYRIVIVLRLVILVFFFRFRILTP  239

Query  743   AYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPV  922
             A DA+PLWLISVICEIWF LSWILDQFPKW PINRETYLDRLS+RFERDGE  +N LAPV
Sbjct  240   AKDAYPLWLISVICEIWFALSWILDQFPKWFPINRETYLDRLSMRFERDGE--KNKLAPV  297

Query  923   DVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARR  1102
             DV+VSTVDPLKEPPIITANT+LSILAVDYPV+KVSCYVSDDGASMLLFDTL+ET+EFARR
Sbjct  298   DVFVSTVDPLKEPPIITANTILSILAVDYPVNKVSCYVSDDGASMLLFDTLSETSEFARR  357

Query  1103  WVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQ  1282
             WVPFCKKY +EPRAPEFYFSEKIDYLKDKVQ TFVK+RRAMKREYEE+KVR+NALVAKAQ
Sbjct  358   WVPFCKKYNVEPRAPEFYFSEKIDYLKDKVQTTFVKDRRAMKREYEEFKVRINALVAKAQ  417

Query  1283  KKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQH  1462
             KKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLG EGA D++G ELP+LVYVSREKRPGY H
Sbjct  418   KKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGKEGAFDIDGNELPRLVYVSREKRPGYAH  477

Query  1463  HKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             HKKAGAMNA+VRVSAVLTNAPFMLNLDCDHY
Sbjct  478   HKKAGAMNAMVRVSAVLTNAPFMLNLDCDHY  508



>dbj|BAB09063.1| cellulose synthase catalytic subunit-like protein [Arabidopsis 
thaliana]
Length=1043

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/492 (72%), Positives = 411/492 (84%), Gaps = 11/492 (2%)
 Frame = +2

Query  95    SQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGC  274
             S K+C++C DE+   +NG+ FVAC  C +PVCKPCY+YERS GN+CCP CNT YKRHKG 
Sbjct  14    SAKICKVCGDEVKDDDNGQTFVACHVCVYPVCKPCYEYERSNGNKCCPQCNTLYKRHKGS  73

Query  275   PRVVGddedhf--egedfeqefeTKNHPPLSENGDYHNNQLPHHNTT---NSAAFQPTAA  439
             P++ GD+E++   + +D       ++   + +N  Y +            N  AF  T  
Sbjct  74    PKIAGDEENNGPDDSDDELNIKYRQDGSSIHQNFAYGSVLFDFDKQQWRPNGRAFSST--  131

Query  440   PGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadnedddFLMAD  619
              GSV GKD E E ++ +++AEWK+RV+KWK RQEKRGLVT+ +      +++++++L A+
Sbjct  132   -GSVLGKDFEAE-RDGYTDAEWKERVDKWKARQEKRGLVTKGEQTNEDKEDDEEEYLDAE  189

Query  620   ARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFG  799
             ARQPLWRK+PISSS ISPYRIVIV RL+IL FFF FRILTPA DA+PLWLISVICEIWF 
Sbjct  190   ARQPLWRKVPISSSKISPYRIVIVLRLVILVFFFRFRILTPAKDAYPLWLISVICEIWFA  249

Query  800   LSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITAN  979
             LSWILDQFPKW PINRETYLDRLS+RFERDGE  +N LAPVDV+VSTVDPLKEPPIITAN
Sbjct  250   LSWILDQFPKWFPINRETYLDRLSMRFERDGE--KNKLAPVDVFVSTVDPLKEPPIITAN  307

Query  980   TVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYF  1159
             T+LSILAVDYPV+KVSCYVSDDGASMLLFDTL+ET+EFARRWVPFCKKY +EPRAPEFYF
Sbjct  308   TILSILAVDYPVNKVSCYVSDDGASMLLFDTLSETSEFARRWVPFCKKYNVEPRAPEFYF  367

Query  1160  SEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNN  1339
             SEKIDYLKDKVQ TFVK+RRAMKREYEE+KVR+NALVAKAQKKPEEGWVMQDGTPWPGNN
Sbjct  368   SEKIDYLKDKVQTTFVKDRRAMKREYEEFKVRINALVAKAQKKPEEGWVMQDGTPWPGNN  427

Query  1340  TRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTN  1519
             TRDHPGMIQVYLG EGA D++G ELP+LVYVSREKRPGY HHKKAGAMNA+VRVSAVLTN
Sbjct  428   TRDHPGMIQVYLGKEGAFDIDGNELPRLVYVSREKRPGYAHHKKAGAMNAMVRVSAVLTN  487

Query  1520  APFMLNLDCDHY  1555
             APFMLNLDCDHY
Sbjct  488   APFMLNLDCDHY  499



>gb|ACS68194.1| cellulose synthase 4.2 catalytic subunit [Brassica napus]
Length=1052

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/513 (70%), Positives = 408/513 (80%), Gaps = 22/513 (4%)
 Frame = +2

Query  56    AADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCC  235
             A+  DE+      S K+CRICRDE+   +NG+ FVAC  C FPVCKPCY+YERS GN+CC
Sbjct  7     ASFGDEQHRHSSFSAKICRICRDEVKDGDNGQTFVACHVCAFPVCKPCYEYERSNGNKCC  66

Query  236   PHCNTRYKRHKGCPRVVG------------ddedhfegedfeqefeTKNHPPLSENGDYH  379
             P CNT YK HKG P + G             D++       +     +N    SENGDY+
Sbjct  67    PQCNTPYKHHKGSPTIAGDDEEEENNGHVDSDDELNIKNRKDTSSIYQNFAYGSENGDYN  126

Query  380   NNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVT  559
             + Q       +  AF  T   GSV G++ E E+    ++AEWK RV+KWK RQEKRGL+ 
Sbjct  127   SKQ---QWRPSGRAFSST---GSVLGREFEGERDGA-TDAEWKVRVDKWKARQEKRGLLV  179

Query  560   RFdddk-ggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRIL  736
             + +  K   + +++++FL ADARQPLWRK+PISSS ISPYRIVIV RLIIL  FF FRIL
Sbjct  180   KGEQTKDQDSQSDEEEFLDADARQPLWRKVPISSSKISPYRIVIVLRLIILVSFFRFRIL  239

Query  737   TPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLA  916
             TPA DA+PLWLISVICEIWF LSWILDQFPKW PINRETYLDRLS+RFERD  GE+N LA
Sbjct  240   TPAKDAYPLWLISVICEIWFALSWILDQFPKWFPINRETYLDRLSMRFERD--GEKNKLA  297

Query  917   PVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFA  1096
             PVDV+VSTVDPLKEPPIITANT+LSILAVDYPV KVSCYVSDDGASMLLFDTL+ET+EFA
Sbjct  298   PVDVFVSTVDPLKEPPIITANTILSILAVDYPVSKVSCYVSDDGASMLLFDTLSETSEFA  357

Query  1097  RRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAK  1276
             RRWVPFCKKY +EPRAPEFYFSEKIDYLKDKVQ TFVK+RRAMKREYE +KVR+N+LVAK
Sbjct  358   RRWVPFCKKYNVEPRAPEFYFSEKIDYLKDKVQTTFVKDRRAMKREYEGFKVRINSLVAK  417

Query  1277  AQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGY  1456
             AQKKPEEGW+MQDGTPWPGNNTRDHPGMIQVYLG EGA D++G ELP+LVYVSREKRPGY
Sbjct  418   AQKKPEEGWMMQDGTPWPGNNTRDHPGMIQVYLGKEGAYDIDGNELPRLVYVSREKRPGY  477

Query  1457  QHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
               HKKAGAMNA+VRVSAVLTNAPFMLNLDCDHY
Sbjct  478   ARHKKAGAMNAMVRVSAVLTNAPFMLNLDCDHY  510



>ref|XP_009400930.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=1043

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/518 (72%), Positives = 418/518 (81%), Gaps = 16/518 (3%)
 Frame = +2

Query  23    AALFTGGSHLHAADH--DERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
             A     GSH     H     +E  R + ++CR+C DEIG+ +NG+ F AC ECGFPVC+P
Sbjct  6     ATRLVAGSHWRNELHVMHNHQEKSRANTRLCRVCGDEIGLRDNGDPFAACLECGFPVCQP  65

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSENGDY  376
             CY+YER EGNQ CP CNTRYKRHKGCPRV GDD+D  E +DFE+EF+ K+  P     D+
Sbjct  66    CYEYERREGNQACPQCNTRYKRHKGCPRVEGDDDDGVEMDDFEEEFQIKS--PKKSPDDH  123

Query  377   HNNQLPHHNTTNSAAFQPTAA-----PGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQE  541
                     N      ++P+A       GS+ GK+LE E +++  N EWKDRVEKWK   E
Sbjct  124   QRFDANSENGERVQPWRPSAHTLSSFAGSIVGKELEME-RDMEGNIEWKDRVEKWK---E  179

Query  542   KRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFF  721
             ++G + + DD     DN +DD LMA+ARQPLWRK+PI SS ISPYRIVIV RL IL FFF
Sbjct  180   RKGQINK-DDGGNDEDNYEDDMLMAEARQPLWRKVPIPSSRISPYRIVIVLRLAILVFFF  238

Query  722   HFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGE  901
              FRI TPA DA+ LWL SVICEIWF LSWILDQFPKW PI RETYLDRL++RFER  EGE
Sbjct  239   RFRITTPATDAYALWLTSVICEIWFALSWILDQFPKWFPITRETYLDRLAMRFER--EGE  296

Query  902   RNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAE  1081
              N LAPVD +VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASML FDT++E
Sbjct  297   PNRLAPVDFFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASMLTFDTMSE  356

Query  1082  TAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVN  1261
             TAEFARRWVPFCKK+ IEPRAPEFYFS+KIDYLKDKVQPTFVKERRAMKREYEE+KVR+N
Sbjct  357   TAEFARRWVPFCKKHSIEPRAPEFYFSQKIDYLKDKVQPTFVKERRAMKREYEEFKVRIN  416

Query  1262  ALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSRE  1441
             ALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS GALDVEGKELP+LVYVSRE
Sbjct  417   ALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSAGALDVEGKELPRLVYVSRE  476

Query  1442  KRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             KRPGYQHHKKAGAMNALVRVSAVLTNAPF+LNLDCDHY
Sbjct  477   KRPGYQHHKKAGAMNALVRVSAVLTNAPFILNLDCDHY  514



>ref|XP_009400929.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=1047

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/522 (72%), Positives = 422/522 (81%), Gaps = 20/522 (4%)
 Frame = +2

Query  23    AALFTGGSH----LHAADHDERREVE--RESQKMCRICRDEIGVVENGEVFVACRECGFP  184
             A     GSH    LH   + +  +V+  R + ++CR+C DEIG+ +NG+ F AC ECGFP
Sbjct  6     ATRLVAGSHWRNELHVMHNHQEPKVQKSRANTRLCRVCGDEIGLRDNGDPFAACLECGFP  65

Query  185   VCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSE  364
             VC+PCY+YER EGNQ CP CNTRYKRHKGCPRV GDD+D  E +DFE+EF+ K+  P   
Sbjct  66    VCQPCYEYERREGNQACPQCNTRYKRHKGCPRVEGDDDDGVEMDDFEEEFQIKS--PKKS  123

Query  365   NGDYHNNQLPHHNTTNSAAFQPTAA-----PGSVGGKDLEDEQKEVFSNAEWKDRVEKWK  529
               D+        N      ++P+A       GS+ GK+LE E +++  N EWKDRVEKWK
Sbjct  124   PDDHQRFDANSENGERVQPWRPSAHTLSSFAGSIVGKELEME-RDMEGNIEWKDRVEKWK  182

Query  530   TRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIIL  709
                E++G + + DD     DN +DD LMA+ARQPLWRK+PI SS ISPYRIVIV RL IL
Sbjct  183   ---ERKGQINK-DDGGNDEDNYEDDMLMAEARQPLWRKVPIPSSRISPYRIVIVLRLAIL  238

Query  710   CFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERD  889
              FFF FRI TPA DA+ LWL SVICEIWF LSWILDQFPKW PI RETYLDRL++RFER 
Sbjct  239   VFFFRFRITTPATDAYALWLTSVICEIWFALSWILDQFPKWFPITRETYLDRLAMRFER-  297

Query  890   GEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFD  1069
              EGE N LAPVD +VSTVDPLKEPPIITANTVLSIL+VDYPVDKVSCYVSDDGASML FD
Sbjct  298   -EGEPNRLAPVDFFVSTVDPLKEPPIITANTVLSILSVDYPVDKVSCYVSDDGASMLTFD  356

Query  1070  TLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYK  1249
             T++ETAEFARRWVPFCKK+ IEPRAPEFYFS+KIDYLKDKVQPTFVKERRAMKREYEE+K
Sbjct  357   TMSETAEFARRWVPFCKKHSIEPRAPEFYFSQKIDYLKDKVQPTFVKERRAMKREYEEFK  416

Query  1250  VRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVY  1429
             VR+NALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS GALDVEGKELP+LVY
Sbjct  417   VRINALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSAGALDVEGKELPRLVY  476

Query  1430  VSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             VSREKRPGYQHHKKAGAMNALVRVSAVLTNAPF+LNLDCDHY
Sbjct  477   VSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFILNLDCDHY  518



>gb|AGJ71353.1| cellulose synthase 2, partial [Eucalyptus urophylla]
Length=998

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/482 (76%), Positives = 400/482 (83%), Gaps = 26/482 (5%)
 Frame = +2

Query  140   ENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVG-------dde  298
             ++G  FVAC ECGFPVC+PCY YERS+G QCCP CN RYKRHKGCPR+ G       D E
Sbjct  1     DDGAPFVACHECGFPVCRPCYVYERSDGTQCCPQCNARYKRHKGCPRIPGDDEDDHFDGE  60

Query  299   dhfegedfeqefeTKNHPP---LSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLE  469
             D  +        E +  P     SENGD H  Q+  +    S+A       GSV G +LE
Sbjct  61    DFEDEFQIRNRGENEVRPTGFDRSENGDGHAPQVHPNGQVFSSA-------GSVVGAELE  113

Query  470   DEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLP  649
              E      NAEWK+R+EKWK RQEKRGLV++  DD G  D E+DD+LMA+ARQPL RK+P
Sbjct  114   GE-----GNAEWKERIEKWKIRQEKRGLVSK--DDGGNGDGEEDDYLMAEARQPLSRKVP  166

Query  650   ISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPK  829
             ISSS ISPYRIVIV RLI+L FF HFRILTPA DAFPLWLISVICE WF LSWILDQFPK
Sbjct  167   ISSSKISPYRIVIVLRLIVLGFFLHFRILTPATDAFPLWLISVICETWFALSWILDQFPK  226

Query  830   WSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDY  1009
             W+PINRETYLDRLS+RF+R+GE  R  LAPVDV+VSTVDPLKEPPIITANTVLSILAVDY
Sbjct  227   WNPINRETYLDRLSIRFDREGEPSR--LAPVDVFVSTVDPLKEPPIITANTVLSILAVDY  284

Query  1010  PVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDK  1189
             PVDKV CYVSDDGASMLLFDTL+ETAEFARRWVPFCKKY IEPR PEFYFS+KIDYLKDK
Sbjct  285   PVDKVCCYVSDDGASMLLFDTLSETAEFARRWVPFCKKYSIEPRTPEFYFSQKIDYLKDK  344

Query  1190  VQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQV  1369
             V+P+FVKERRAMKREYEE+KVR+NALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQV
Sbjct  345   VEPSFVKERRAMKREYEEFKVRINALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQV  404

Query  1370  YLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCD  1549
             YLGS GALDVEGKELP+LVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPF+LNLDCD
Sbjct  405   YLGSAGALDVEGKELPRLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFLLNLDCD  464

Query  1550  HY  1555
             HY
Sbjct  465   HY  466



>tpg|DAA49708.1| TPA: eukaryotic translation initiation factor 4E-2 [Zea mays]
Length=1395

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/528 (70%), Positives = 422/528 (80%), Gaps = 24/528 (5%)
 Frame = +2

Query  17    SMAALFTGGSHLHAADHDERREVERESQ------KMCRICRDEIGVVENGEVFVACRECG  178
             S+      GSH+    H  R   E  ++      K CR+C DE+G  E+G+ FVAC ECG
Sbjct  322   SVTGGLAAGSHMRDELHVMRAREEPNAKVRSADVKTCRVCADEVGTREDGQPFVACAECG  381

Query  179   FPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKN----  346
             FPVC+PCY+YERSEG QCCP CNTRYKR KGCPRV GD+E+  E +DFE EF  K+    
Sbjct  382   FPVCRPCYEYERSEGTQCCPQCNTRYKRQKGCPRVEGDEEEGPEMDDFEDEFPAKSPKKP  441

Query  347   HPPL-----SENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKD  511
             H P+     SENG++   +      T S+        GSV GKDLE E +E+  + EWKD
Sbjct  442   HEPVAFDVYSENGEHPAQKWRTGGQTLSSF------TGSVAGKDLEAE-REMEGSMEWKD  494

Query  512   RVEKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIV  691
             R++KWKT+QEKRG +   D D     NED+  L+A+ARQPLWRK+PI SS+I+PYRIVIV
Sbjct  495   RIDKWKTKQEKRGKLNHDDSDDDDDKNEDEYMLLAEARQPLWRKVPIPSSMINPYRIVIV  554

Query  692   FRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLS  871
              RL++LCFF  FRI TPA DA PLWL SVICE+WF  SWILDQ PKW+P+ RETYLDRL+
Sbjct  555   LRLVVLCFFLKFRITTPATDAVPLWLASVICELWFAFSWILDQLPKWAPVTRETYLDRLA  614

Query  872   LRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGA  1051
             LR++R+GE  R  L+P+D +VSTVDPLKEPPIITANTVLSILAVDYPVD+VSCYVSDDGA
Sbjct  615   LRYDREGEACR--LSPIDFFVSTVDPLKEPPIITANTVLSILAVDYPVDRVSCYVSDDGA  672

Query  1052  SMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKR  1231
             SMLLFD L+ETAEFARRWVPFCKK+ +EPRAPEFYFS+KIDYLKDKVQPTFVKERRAMKR
Sbjct  673   SMLLFDALSETAEFARRWVPFCKKFAVEPRAPEFYFSQKIDYLKDKVQPTFVKERRAMKR  732

Query  1232  EYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKE  1411
             EYEE+KVR+NALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLG++GALDVEG E
Sbjct  733   EYEEFKVRINALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGNQGALDVEGHE  792

Query  1412  LPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             LP+LVYVSREKRPGY HHKKAGAMNALVRVSAVLTNAPF+LNLDCDHY
Sbjct  793   LPRLVYVSREKRPGYNHHKKAGAMNALVRVSAVLTNAPFILNLDCDHY  840



>ref|XP_002467109.1| hypothetical protein SORBIDRAFT_01g019720 [Sorghum bicolor]
 gb|EER94107.1| hypothetical protein SORBIDRAFT_01g019720 [Sorghum bicolor]
Length=1058

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/504 (71%), Positives = 414/504 (82%), Gaps = 12/504 (2%)
 Frame = +2

Query  62    DHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPH  241
             D+D++  V     K CR+C DE+G  E+G+ FVAC ECGFPVC+PCY+YERSEG QCCP 
Sbjct  2     DNDDK--VRSADVKTCRVCADEVGTREDGQPFVACTECGFPVCRPCYEYERSEGTQCCPQ  59

Query  242   CNTRYKRHKGCPRVVGddedhfegedfeqefeTKN----HPPLSENGDYHNNQLPHHNTT  409
             CNTRYKR KG PRV GD+++  E +DFE+EF  K+    H P+  +    N + P     
Sbjct  60    CNTRYKRQKGSPRVEGDEDEGPEMDDFEEEFPVKSPNKPHEPVPFDVYSENGEQPAQKW-  118

Query  410   NSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggad  589
              +     ++  GSV GKDLE E +E+  + EWKDR++KWKT+QEKRG +   D D    D
Sbjct  119   RTGGHTLSSFTGSVAGKDLEAE-REMEGSMEWKDRIDKWKTKQEKRGKLNHDDSDDDDDD  177

Query  590   nedd--dFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPL  763
             ++++    L+A+ARQPLWRK+PI SS I+PYRIVIV RL++LCFF  FRI TPA DA PL
Sbjct  178   DKNEDEYMLLAEARQPLWRKVPIPSSKINPYRIVIVLRLVVLCFFLKFRITTPAMDAVPL  237

Query  764   WLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTV  943
             WL SVICE+WF  SWILDQ PKW+P+ RETYLDRL+LR++RDGE  R  L+P+D +VSTV
Sbjct  238   WLASVICELWFAFSWILDQLPKWAPVTRETYLDRLALRYDRDGEACR--LSPIDFFVSTV  295

Query  944   DPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKK  1123
             DPLKEPPIITANTVLSILAVDYPVD+VSCYVSDDGASMLLFDTL+ETAEFARRWVPFCKK
Sbjct  296   DPLKEPPIITANTVLSILAVDYPVDRVSCYVSDDGASMLLFDTLSETAEFARRWVPFCKK  355

Query  1124  YCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGW  1303
             + +EPRAPEFYFS KIDYLKDKVQPTFVKERRAMKREYEE+KVR+NALVAKAQKKPEEGW
Sbjct  356   FAVEPRAPEFYFSHKIDYLKDKVQPTFVKERRAMKREYEEFKVRINALVAKAQKKPEEGW  415

Query  1304  VMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAM  1483
             VMQDGTPWPGNNTRDHPGMIQVYLG++GALDVEG ELP+LVYVSREKRPGY HHKKAGAM
Sbjct  416   VMQDGTPWPGNNTRDHPGMIQVYLGTQGALDVEGHELPRLVYVSREKRPGYNHHKKAGAM  475

Query  1484  NALVRVSAVLTNAPFMLNLDCDHY  1555
             NALVRVSAVLTNAPF+LNLDCDHY
Sbjct  476   NALVRVSAVLTNAPFILNLDCDHY  499



>ref|XP_004982919.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase A catalytic 
subunit 7 [UDP-forming]-like [Setaria italica]
Length=1398

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/524 (69%), Positives = 412/524 (79%), Gaps = 25/524 (5%)
 Frame = +2

Query  32    FTGGSHLH-----AADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKP  196
                GSHL         H+E         K CR+C DE+G  E+G+ FVAC ECGFPVC+P
Sbjct  329   LAAGSHLRDELHVMRGHEEAPAGRSADVKTCRVCGDEVGAREDGQPFVACSECGFPVCRP  388

Query  197   CYQYERSEGNQCCPHCNTRYKRHKGCPRVVG------ddedhfegedfeqefeTKNHPPL  358
             CY+YER+EG QCCP CNTRYKRHKGCPRV G      + +D  E      +   K H P+
Sbjct  389   CYEYERAEGTQCCPQCNTRYKRHKGCPRVEGDEDDGPEMDDFEEEFPAAVKSPKKPHEPV  448

Query  359   -----SENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEK  523
                  SENG+    Q P    T       ++  GSV GKDLE E +E+  + EWKDR++K
Sbjct  449   AFDVYSENGE----QPPQKWRTGGQTL--SSFTGSVAGKDLEAE-REMEGSMEWKDRIDK  501

Query  524   WKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLI  703
             WKT+QEKRG +   D D     N+D+  L+A+ARQPLWRK+PI SS I+PYRIVIV RL+
Sbjct  502   WKTKQEKRGKLNHDDSDDDDDKNDDEYMLLAEARQPLWRKVPIPSSQINPYRIVIVLRLV  561

Query  704   ILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFE  883
             +LCFF  FRI TPA DA PLWL SVICE+WF LSWILDQ PKW+P+ RETYLDRL+LR++
Sbjct  562   VLCFFLKFRITTPATDAVPLWLASVICELWFALSWILDQLPKWAPVTRETYLDRLALRYD  621

Query  884   RDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLL  1063
             R+G+  R  L+P+D +VSTVDPLKEPPIITANTVLSILAVDYPVD+ SCYVSDDGASMLL
Sbjct  622   REGDACR--LSPIDFFVSTVDPLKEPPIITANTVLSILAVDYPVDRTSCYVSDDGASMLL  679

Query  1064  FDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEE  1243
             FDTL+ETAEFARRWVPFCKK+ +EPRAPEFYFS+KIDYLKDKVQPTFVKERRAMKREYEE
Sbjct  680   FDTLSETAEFARRWVPFCKKFAVEPRAPEFYFSQKIDYLKDKVQPTFVKERRAMKREYEE  739

Query  1244  YKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKL  1423
             +KVR+NALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS+GALDVEG ELP+L
Sbjct  740   FKVRINALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSQGALDVEGHELPRL  799

Query  1424  VYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             VYVSREKRPGY HHKKAGAMNALVRVSAVLTNAPF+LNLDCDHY
Sbjct  800   VYVSREKRPGYNHHKKAGAMNALVRVSAVLTNAPFILNLDCDHY  843



>ref|XP_006662427.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Oryza brachyantha]
Length=1299

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/522 (70%), Positives = 420/522 (80%), Gaps = 18/522 (3%)
 Frame = +2

Query  32    FTGGSH----LHAA-DHDERREVERESQ-KMCRICRDEIGVVENGEVFVACRECGFPVCK  193
                GSH    LH    H+E  +V   +  K CR+C +E+   E+G+ FVAC ECGFPVC+
Sbjct  224   LVAGSHQRDELHVMRSHEETGKVRSAADVKTCRVCGEEVAAREDGQPFVACAECGFPVCR  283

Query  194   PCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKN-------HP  352
             PCY+YERSEG QCCP CNTRYKR KGCPRV GD++D  + +DFE+EF+ K+       H 
Sbjct  284   PCYEYERSEGTQCCPQCNTRYKRQKGCPRVEGDEDDADDMDDFEEEFQMKSPTKQQKPHE  343

Query  353   PLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKT  532
             P++ +    N + P            ++  GSV GKDLE E +E+  + EWKDR++KWKT
Sbjct  344   PVNFDVYSENGEQPAQKWRPGGP-ALSSFTGSVAGKDLEQE-REMEGSMEWKDRIDKWKT  401

Query  533   RQEKRGLVTRFdddkggadnedddF-LMADARQPLWRKLPISSSLISPYRIVIVFRLIIL  709
             +QEKRG + R   D    D  DD++ L+A+ARQPLWRK+PI SS I+PYRIVIV RL++L
Sbjct  402   KQEKRGKLHRDGSDDDDDDKNDDEYMLLAEARQPLWRKVPIPSSKINPYRIVIVLRLVVL  461

Query  710   CFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERD  889
             CFF  FRI TPA DA PLWL SVICE+WF LSWILDQ PKWSP+ RETYLDRL+LR+ERD
Sbjct  462   CFFLKFRITTPAMDAVPLWLASVICELWFALSWILDQLPKWSPVTRETYLDRLALRYERD  521

Query  890   GEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFD  1069
             GE  R  L+ +D +VSTVDPLKEPPIITANTVLSILAVDYPVD+VSCYVSDDGASMLLFD
Sbjct  522   GEPCR--LSRLDFFVSTVDPLKEPPIITANTVLSILAVDYPVDRVSCYVSDDGASMLLFD  579

Query  1070  TLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYK  1249
             TL+ETAEFARRWVPFCKK+ IEPRAPEFYFS+KIDYLKDKVQPTFVKERRAMKREYEE+K
Sbjct  580   TLSETAEFARRWVPFCKKFTIEPRAPEFYFSQKIDYLKDKVQPTFVKERRAMKREYEEFK  639

Query  1250  VRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVY  1429
             VR+NALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS+GALDVEG ELP+LVY
Sbjct  640   VRINALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSQGALDVEGNELPRLVY  699

Query  1430  VSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             VSREKRPGY HHKKAGAMN LVRVSAVLTNAPF+LNLDCDHY
Sbjct  700   VSREKRPGYNHHKKAGAMNCLVRVSAVLTNAPFILNLDCDHY  741



>gb|ADI99492.1| cellulose synthase [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97174.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1044

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/494 (72%), Positives = 405/494 (82%), Gaps = 18/494 (4%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             K+CR C D++G  E+G  FVAC ECGFPVC+PCY+YERS+G QCCP CN RYKRHKGCPR
Sbjct  9     KVCRACGDDVGTREDGSPFVACAECGFPVCRPCYEYERSDGTQCCPQCNARYKRHKGCPR  68

Query  281   VVGddedhfegedf---eqefeTKNHPPL-----SENGDYHNNQLPHHNTTNSAAFQPTA  436
             V GDDED    +     + +   K H P+     SENG+    Q P        A   ++
Sbjct  69    VEGDDEDGDMDDLEEEFQVKSPKKPHEPVPFDVYSENGE----QPPQKWRPGGPAM--SS  122

Query  437   APGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRG-LVTRFdddkggadnedddFLM  613
               GSV GK+LE E +E+  + EWKDR++KWKT+QEKRG L     DD     N+D+  L+
Sbjct  123   FGGSVAGKELEAE-REMEGSMEWKDRIDKWKTKQEKRGKLNRDNSDDDDDDKNDDEYMLL  181

Query  614   ADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIW  793
             A+ARQPLWRKLP+ SS I+PYRIVIV RL++LCFF  FRI+TPA DA PLWL+SVICE+W
Sbjct  182   AEARQPLWRKLPVPSSQINPYRIVIVLRLVVLCFFLRFRIMTPANDAIPLWLVSVICELW  241

Query  794   FGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIIT  973
             F LSWILDQ PKWSP+ RETYLDRL+LR++R+GE  R  L+P+D +VSTVDPLKEPPIIT
Sbjct  242   FALSWILDQLPKWSPVTRETYLDRLALRYDREGEPSR--LSPIDFFVSTVDPLKEPPIIT  299

Query  974   ANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEF  1153
             ANTVLSILAVDYPVD+ SCYVSDDGASML FDTL+ETAEFARRWVPFCKK+ IEPRAPEF
Sbjct  300   ANTVLSILAVDYPVDRNSCYVSDDGASMLCFDTLSETAEFARRWVPFCKKFAIEPRAPEF  359

Query  1154  YFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPG  1333
             YFS+KIDYLKDKVQPTFVKERRAMKREYEE+KVR+N LVAKA+KKPEEGWVMQDGTPWPG
Sbjct  360   YFSQKIDYLKDKVQPTFVKERRAMKREYEEFKVRINGLVAKAEKKPEEGWVMQDGTPWPG  419

Query  1334  NNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVL  1513
             NNTRDHPGMIQVYLGS+GALDVEG ELP+LVYVSREKRPG+ HHKKAGAMNALVRVSAVL
Sbjct  420   NNTRDHPGMIQVYLGSQGALDVEGHELPRLVYVSREKRPGHNHHKKAGAMNALVRVSAVL  479

Query  1514  TNAPFMLNLDCDHY  1555
             TNAPF+LNLDCDHY
Sbjct  480   TNAPFILNLDCDHY  493



>ref|XP_003574029.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Brachypodium distachyon]
Length=1047

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/494 (70%), Positives = 402/494 (81%), Gaps = 18/494 (4%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             K CR C D++G+ ++G+ FVAC EC FPVC+PCY+YERS+G Q CP CNTRYKR +G PR
Sbjct  12    KACRACGDDVGLRDDGQPFVACAECAFPVCRPCYEYERSDGTQRCPQCNTRYKRLRGSPR  71

Query  281   VVGddedhfe----gedfeqefeTKNHPP-----LSENGDYHNNQLPHHNTTNSAAFQPT  433
             V GD+ED        E   +  +   H P      SENG+    Q P        A   +
Sbjct  72    VEGDEEDADMDDFEEEFQAKSPKKAAHEPAPFDVYSENGE----QPPQKWRPGGPAM--S  125

Query  434   AAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadnedddFLM  613
             +  GSV GK+L D ++E+  + EWKDR++KWKT+QEKRG + R D D     N+D+  L+
Sbjct  126   SFGGSVAGKEL-DAEREMEGSMEWKDRIDKWKTKQEKRGKLNRDDSDDDDDKNDDEYMLL  184

Query  614   ADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIW  793
             A+ARQPLWRK+PI SS I+PYRIVIV RL++LCFF  FRI+TPA DA PLWL+SVICE+W
Sbjct  185   AEARQPLWRKVPIPSSKINPYRIVIVLRLVVLCFFLRFRIMTPANDAIPLWLVSVICELW  244

Query  794   FGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIIT  973
             F LSWILDQ PKW+P+ RETYLDRL+LR++R+GE  R  L+P+D +VSTVDPLKEPPIIT
Sbjct  245   FALSWILDQLPKWAPVTRETYLDRLALRYDREGEPSR--LSPIDFFVSTVDPLKEPPIIT  302

Query  974   ANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEF  1153
             ANTVLSILAVDYPVD+ SCYVSDDGASML FD L+ETAEFARRWVPFCKK+ IEPRAPEF
Sbjct  303   ANTVLSILAVDYPVDRNSCYVSDDGASMLCFDALSETAEFARRWVPFCKKFAIEPRAPEF  362

Query  1154  YFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPG  1333
             YFS+KIDYLKDKVQPTFVKERRAMKREYEE+KVR+NALVAKA+KKPEEGWVMQDGTPWPG
Sbjct  363   YFSQKIDYLKDKVQPTFVKERRAMKREYEEFKVRINALVAKAEKKPEEGWVMQDGTPWPG  422

Query  1334  NNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVL  1513
             NNTRDHPGMIQVYLGS+GALDVEG ELP+LVYVSREKRPG+ HHKKAGAMNALVRVSAVL
Sbjct  423   NNTRDHPGMIQVYLGSQGALDVEGHELPRLVYVSREKRPGHDHHKKAGAMNALVRVSAVL  482

Query  1514  TNAPFMLNLDCDHY  1555
             TNAPF+LNLDCDHY
Sbjct  483   TNAPFILNLDCDHY  496



>gb|EMT11949.1| Cellulose synthase A catalytic subunit 7 (UDP-forming) [Aegilops 
tauschii]
Length=1076

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/530 (66%), Positives = 411/530 (78%), Gaps = 47/530 (9%)
 Frame = +2

Query  80    EVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYK  259
             E + ++ K+CR C D++G  E+G  FVAC ECGFPVC+PCY+YERS+G QCCP CNTRYK
Sbjct  5     EPKAKAAKVCRACGDDVGTREDGSPFVACAECGFPVCRPCYEYERSDGTQCCPQCNTRYK  64

Query  260   RHKG----------------------------CPRVVGddedhfegedf---eqefeTKN  346
             RHKG                            CPRV GD+ED    +     + +   K 
Sbjct  65    RHKGNPHWFRSSQLMPQFITTGHILAESTVAGCPRVEGDEEDGDMDDLEDEFQVKSPKKP  124

Query  347   HPPL-----SENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKD  511
             H P+     SENG+    Q P    +   A   ++  GSV GK+LE E +E+  + EWK+
Sbjct  125   HEPVPFDVYSENGE----QPPQKWRSGGPAM--SSFGGSVAGKELEAE-REMEGSMEWKE  177

Query  512   RVEKWKTRQEKRGLVTRFdddkggadneddd--FLMADARQPLWRKLPISSSLISPYRIV  685
             R++KWKT+QEKRG + R + D    D+++DD   L+ +ARQPLWRKLP+ SS I+PYRIV
Sbjct  178   RIDKWKTKQEKRGKLNRDNSDDDDDDDKNDDEYMLLTEARQPLWRKLPVPSSQINPYRIV  237

Query  686   IVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDR  865
             IV RL++LCFF  FR +TPA DA PLWL+SVICE+WF LSWILDQ PKWSP+ RETYLDR
Sbjct  238   IVRRLVVLCFFLRFRSMTPANDAIPLWLVSVICELWFALSWILDQLPKWSPVTRETYLDR  297

Query  866   LSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDD  1045
             L+LR++R+G   R  L+P+D +VSTVDPLKEPPIITANTVLSILAVDYPVD+ SCYVSDD
Sbjct  298   LALRYDREGAPSR--LSPIDFFVSTVDPLKEPPIITANTVLSILAVDYPVDRNSCYVSDD  355

Query  1046  GASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAM  1225
             GASML FDTL+ETAEFARRWVPFCKK+ IEPRAPEFYFS+KIDYLKDKVQPTFVKERRAM
Sbjct  356   GASMLCFDTLSETAEFARRWVPFCKKFAIEPRAPEFYFSQKIDYLKDKVQPTFVKERRAM  415

Query  1226  KREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEG  1405
             KREYEE+KVR+N LVAKA+KKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS+GALDVEG
Sbjct  416   KREYEEFKVRINGLVAKAEKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSQGALDVEG  475

Query  1406  KELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
              ELP+LVYVSREKRPG+ HHKKAGAMNALVRVSAVLTNAPF+LNLDCDHY
Sbjct  476   HELPRLVYVSREKRPGHNHHKKAGAMNALVRVSAVLTNAPFILNLDCDHY  525



>gb|AAX18648.1| cellulose synthase catalytic subunit [Pinus taeda]
Length=1057

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/518 (64%), Positives = 392/518 (76%), Gaps = 25/518 (5%)
 Frame = +2

Query  65    HDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHC  244
             HD  + + R + + C++C D+IG   NGE+FVAC ECGFPVC+PCY+YER +GN+CCP C
Sbjct  23    HDGPKPIRRSTLQDCQVCGDKIGHNPNGELFVACNECGFPVCRPCYEYERKDGNRCCPQC  82

Query  245   NTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPL---------------------S  361
              TRY+RHKG PRV GDDE+    +  ++    ++   +                     S
Sbjct  83    KTRYRRHKGSPRVEGDDEEDGMDDLEQEFNMERDRQSVVSHRGNAFDATPRAAHSIANRS  142

Query  362   ENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQE  541
              NGD +   LP     +S + Q      +V G  L D  KE + +A WK+RVE WK + +
Sbjct  143   INGDNYALSLPPIMDGDSLSVQRFPHAATVIGNGL-DPVKENYGSAAWKERVENWKAKHD  201

Query  542   KRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFF  721
             K+    + D      + +D     A+ARQPL RK+PI SSLI+PYRIVIV RLIIL FFF
Sbjct  202   KKSGSIK-DGIYDPDEADDIMMTEAEARQPLSRKVPIPSSLINPYRIVIVLRLIILGFFF  260

Query  722   HFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGE  901
              +R++ PA DA  LWL S+ICEIWF  SWILDQFPKW PI RETYLDRLS+R+ER  EGE
Sbjct  261   RYRLMNPAKDALGLWLTSIICEIWFAFSWILDQFPKWFPITRETYLDRLSMRYER--EGE  318

Query  902   RNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAE  1081
                LAPVD +VSTVDPLKEPP+ITANTVLSILA DYPVD+VSCYVSDDGASML FD++ E
Sbjct  319   PCKLAPVDFFVSTVDPLKEPPLITANTVLSILAADYPVDRVSCYVSDDGASMLTFDSMTE  378

Query  1082  TAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVN  1261
             T+EFAR+WVPFCKKY IEPRAP+FYFS+KIDYLKDKVQPTFVKERRAMKREYEE+KVR+N
Sbjct  379   TSEFARKWVPFCKKYSIEPRAPDFYFSQKIDYLKDKVQPTFVKERRAMKREYEEFKVRIN  438

Query  1262  ALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSRE  1441
             ALV+KAQK P+EGWVMQDGTPWPGNNTRDHPGMIQV+LGS GA D+EG ELP+LVYVSRE
Sbjct  439   ALVSKAQKTPDEGWVMQDGTPWPGNNTRDHPGMIQVFLGSSGAHDIEGNELPRLVYVSRE  498

Query  1442  KRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             KRPGYQHHKKAGAMNALVRVSAVLTNAPF+LNLDCDHY
Sbjct  499   KRPGYQHHKKAGAMNALVRVSAVLTNAPFILNLDCDHY  536



>ref|XP_008387657.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Malus domestica]
Length=765

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/538 (59%), Positives = 394/538 (73%), Gaps = 40/538 (7%)
 Frame = +2

Query  53    HAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQC  232
             H +D   +  V+  + ++C+IC D +G+   G+VFVAC EC FPVC+PCY+YER +GNQ 
Sbjct  22    HDSDSSSK-PVKNLNGQICQICGDTVGLTATGDVFVACNECAFPVCRPCYEYERKDGNQA  80

Query  233   CPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPL-----SENGDY-----HN  382
             CP C TRYKRHKG PRV GDD++    +   +   T+           E+ D      H 
Sbjct  81    CPQCKTRYKRHKGSPRVDGDDDEDDIDDLENEFNYTQGTSNARRQWQGEDADLSSSSRHE  140

Query  383   NQLPHHNTTNSAAFQ---PTAAPG------SVGGKD--------LEDEQKEVFS----NA  499
             +Q P    TN  +     P A P       + G  D        + D  K++ S    N 
Sbjct  141   SQQPIPLLTNGQSVSGEIPCATPDNQSVRTTSGPLDPRQPVPVRIVDPSKDLNSYGLGNV  200

Query  500   EWKDRVEKWKTRQEKR--GLVTRFddd---kggadnedddFLMAD-ARQPLWRKLPISSS  661
             +WK+RVE WK +Q+K    + +R+ +      G  +  ++  MAD ARQPL R +PISSS
Sbjct  201   DWKERVEGWKLKQDKSMMQMTSRYAEGKGDMEGTGSNGEELQMADDARQPLSRIVPISSS  260

Query  662   LISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPI  841
              ++PYR+VI+ RLIIL FF  +R   P  DA+PLWL SVICEIWF LSW+LDQFPKW PI
Sbjct  261   HLTPYRVVIILRLIILGFFLQYRATHPVKDAYPLWLTSVICEIWFALSWLLDQFPKWFPI  320

Query  842   NRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDK  1021
             NRETYLDRL+LR++RDGE  +  LAP+DV+VSTVDP+KEPP++TANTVLSIL+VDYPVDK
Sbjct  321   NRETYLDRLTLRYDRDGEPSQ--LAPIDVFVSTVDPMKEPPLVTANTVLSILSVDYPVDK  378

Query  1022  VSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPT  1201
             VSCYVSDDG++ML F++L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK+QP+
Sbjct  379   VSCYVSDDGSAMLTFESLSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKDKIQPS  438

Query  1202  FVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS  1381
             FVKERRAMKREYEE+KVR+NALVAKAQK PEEGW MQDGTPWPGNN RDHPGMIQV+LG 
Sbjct  439   FVKERRAMKREYEEFKVRINALVAKAQKMPEEGWTMQDGTPWPGNNPRDHPGMIQVFLGH  498

Query  1382  EGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
              G LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  499   SGGLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  556



>gb|AHL45023.1| cellulose synthase 1A [Linum usitatissimum]
Length=1079

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/536 (59%), Positives = 386/536 (72%), Gaps = 55/536 (10%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             + C+IC D +G+  NG+VFVAC EC FPVC+PCY+YER +G Q CP C TRYKRHKGCPR
Sbjct  37    QTCQICGDSVGLTANGDVFVACNECAFPVCRPCYEYERKDGTQACPQCKTRYKRHKGCPR  96

Query  281   V-----------------------VGddedhfegedfeqefeTKNHP-PLSENGDYHNNQ  388
             V                        G      + E           P PL  NG   + +
Sbjct  97    VDGDEDEDDIDDLEDEFSYQATGKAGRHWQGDDVELSSSSRHESQMPIPLLTNGQQISGE  156

Query  389   LPHHNTTNSAAFQPTAAPGSVGGKDLE----------------DEQKEV----FSNAEWK  508
             +P   T ++ + + T+ P     K+++                D  K++      N +WK
Sbjct  157   IPCA-TPDTQSVRTTSGPLGPADKNVQSSPYLDPRQPVPVRIVDPSKDLNSYGLGNVDWK  215

Query  509   DRVEKWKTRQEKRGLV------TRFdddkggadnedddFLMAD-ARQPLWRKLPISSSLI  667
             +RVE WK +QEK G++      +    D  G  +  ++  MAD ARQP+ R +PI SS +
Sbjct  216   ERVEGWKMKQEK-GMMHMSNRHSEGKGDIEGTGSNGEELQMADDARQPMSRVVPIPSSHM  274

Query  668   SPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINR  847
             +PYR+VI+ R IILCFF  +R+  P  DA+PLWLIS+ICEIWF LSW+LDQFPKW PINR
Sbjct  275   TPYRVVIILRFIILCFFLQYRVTHPVKDAYPLWLISIICEIWFALSWLLDQFPKWQPINR  334

Query  848   ETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVS  1027
             ETYLDRL+LRF+R  EGE + LAPVDV+VSTVDP+KEPP+ITANTVLSILAVDYPVDKVS
Sbjct  335   ETYLDRLALRFDR--EGEPSQLAPVDVFVSTVDPMKEPPLITANTVLSILAVDYPVDKVS  392

Query  1028  CYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFV  1207
             CYVSDDG++ML F++L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK+QP+FV
Sbjct  393   CYVSDDGSAMLSFESLSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKDKIQPSFV  452

Query  1208  KERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEG  1387
             KERRAMKREYEE+KVR+NALVAKAQK PEEGW MQDGTPWPGNN+RDHPGMIQV+LG  G
Sbjct  453   KERRAMKREYEEFKVRINALVAKAQKMPEEGWTMQDGTPWPGNNSRDHPGMIQVFLGHSG  512

Query  1388  ALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
              LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  513   GLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  568



>gb|AHL45026.1| cellulose synthase 3B [Linum usitatissimum]
Length=1059

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/550 (59%), Positives = 383/550 (70%), Gaps = 62/550 (11%)
 Frame = +2

Query  59    ADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCP  238
             ADH   + V+   Q++C+IC D+IG   +GE F+AC  C FPVC+PCY+YER +G Q CP
Sbjct  5     ADHGGTKNVK---QQVCQICSDDIGKTSDGEPFLACHVCAFPVCRPCYEYERKDGTQSCP  61

Query  239   HCNTRYKRHKGCP---------------------------------RVVGddedhfeged  319
              C T+Y RHKG P                                 R++G +      + 
Sbjct  62    QCKTKYTRHKGSPAIHGEQVDDGEFKDATKSTAQPGGIQDEKHKIDRMLGWESGSGRKDY  121

Query  320   feqefeTKNHPPLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEV----  487
                 +E   H P + +    + +L   +    +   P +  GS     L D+Q+E     
Sbjct  122   VAPSYENLTHIPYAASRPSMSGELSAASPGRYSMASPES--GSRATIRLGDQQREYGSGG  179

Query  488   FSNAEWKDRVEKWKTRQEK--------------RGLVTRFdddkggadnedddFLMADAR  625
             F N  WK+R++ WK + EK              RG V          D   DD L  + R
Sbjct  180   FGNVAWKERIDGWKMKPEKNTAPPSVSNAPSEGRGGVD----FDASTDILMDDLLNDETR  235

Query  626   QPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLS  805
             QPL RK+PISSS I+PYR+VIV RLIILC FFH+R+  P  DA PLWLISVICEIWF +S
Sbjct  236   QPLSRKVPISSSKINPYRMVIVLRLIILCIFFHYRLTNPVRDAIPLWLISVICEIWFAVS  295

Query  806   WILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTV  985
             WILDQFPKW P+NRETYLDRLSLR+E+  EGE + LA VD++VSTVDPLKEPPI+TANTV
Sbjct  296   WILDQFPKWFPVNRETYLDRLSLRYEK--EGEPSQLASVDIFVSTVDPLKEPPIVTANTV  353

Query  986   LSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSE  1165
             LSILAVDYPVDKVSCYVSDDGA+ML F++LAETAEFAR+WVPFCKKY IEPRAPEFYFS+
Sbjct  354   LSILAVDYPVDKVSCYVSDDGAAMLSFESLAETAEFARKWVPFCKKYNIEPRAPEFYFSQ  413

Query  1166  KIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTR  1345
             KIDYLKDKVQP+FVK+RR+MKREYEE+K+RVN LVAKAQK PEEGW MQDGTPWPGNNTR
Sbjct  414   KIDYLKDKVQPSFVKDRRSMKREYEEFKIRVNGLVAKAQKVPEEGWFMQDGTPWPGNNTR  473

Query  1346  DHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAP  1525
             DHPGMIQV+LG  G LD +G ELP+LVYVSREKRPG+QHHKKAGAMN+LVRVSAVLTN P
Sbjct  474   DHPGMIQVFLGHSGGLDSDGNELPRLVYVSREKRPGFQHHKKAGAMNSLVRVSAVLTNGP  533

Query  1526  FMLNLDCDHY  1555
             F+LNLDCDHY
Sbjct  534   FLLNLDCDHY  543



>ref|XP_004291468.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Fragaria vesca subsp. vesca]
Length=1069

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/535 (59%), Positives = 398/535 (74%), Gaps = 37/535 (7%)
 Frame = +2

Query  53    HAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQC  232
             H +D   +  ++  + ++C+IC D +G+   G+VFVAC EC FPVC+PCY+YER +GNQ 
Sbjct  22    HDSDSSSK-PLKNLNGQICQICGDTVGLTATGDVFVACNECAFPVCRPCYEYERKDGNQA  80

Query  233   CPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTK--------NHPPLSENGDYHNNQ  388
             CP C TRYKRHKG PRV GD+++    +   +    +        + P LS +  + + Q
Sbjct  81    CPQCKTRYKRHKGSPRVDGDEDEDDIDDLENEFNYAQGTRRQWQGDDPDLSSSSRHESGQ  140

Query  389   -LPHHNTTNSAAFQ-PTAAPG------SVGGKD--------LEDEQKEVFS----NAEWK  508
              +P      S + + P A P       + G  D        + D  K++ S    N +WK
Sbjct  141   PIPLLTNGQSVSGEIPCATPDNQSVRTTSGPLDPRQPVPVRIVDPSKDLNSYGLGNVDWK  200

Query  509   DRVEKWKTRQEKR--GLVTRFdddkggadneddd---FLMAD-ARQPLWRKLPISSSLIS  670
             +RVE WK +Q+K    + +R+ + KG  +    +     MAD ARQPL R +PISSS ++
Sbjct  201   ERVEGWKLKQDKNIMQITSRYTEGKGDTEGTGSNGEELQMADDARQPLSRIVPISSSHLT  260

Query  671   PYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRE  850
             PYR+VI+ RLIILCFF  +R   P  DA+PLWLISVICEIWF  SW+LDQFPKW PINRE
Sbjct  261   PYRVVIILRLIILCFFLQYRATHPVKDAYPLWLISVICEIWFAFSWLLDQFPKWFPINRE  320

Query  851   TYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSC  1030
             TYLDRL+LR++RDGE  +  LAPVDV+VSTVDP+KEPP++TANTVLSIL+VDYPVDK+SC
Sbjct  321   TYLDRLALRYDRDGEPSQ--LAPVDVFVSTVDPMKEPPLVTANTVLSILSVDYPVDKISC  378

Query  1031  YVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVK  1210
             YVSDDG++ML F++L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK+QP+FVK
Sbjct  379   YVSDDGSAMLTFESLSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKDKIQPSFVK  438

Query  1211  ERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGA  1390
             ERRAMKREYEE+KVR+NALVAKAQK PEEGW MQDGTPWPGNN+RDHPGMIQV+LG  G 
Sbjct  439   ERRAMKREYEEFKVRINALVAKAQKMPEEGWTMQDGTPWPGNNSRDHPGMIQVFLGHSGG  498

Query  1391  LDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  499   LDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  553



>gb|AHL45024.1| cellulose synthase 1B [Linum usitatissimum]
Length=1079

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/544 (58%), Positives = 389/544 (72%), Gaps = 55/544 (10%)
 Frame = +2

Query  77    REVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRY  256
             + ++  S + C+IC D +G+  NG+VFVAC EC FPVC+PCY+YER +G Q CP C TRY
Sbjct  29    KPLKNLSGQTCQICGDSVGLTANGDVFVACNECAFPVCRPCYEYERKDGTQACPQCKTRY  88

Query  257   KRHKGCPRV-----------------------VGddedhfegedfeqefeTKNHP-PLSE  364
             KRHKGCPRV                        G      + E           P PL  
Sbjct  89    KRHKGCPRVDGDEDEDDVDDLEDEFSYQATGKAGRHWQGDDVELSSSSRHESQMPIPLLT  148

Query  365   NGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLE----------------DEQKEV---  487
             NG   + ++P   T ++ + + T+ P     K+++                D  K++   
Sbjct  149   NGQQISGEIPCA-TPDTQSVRTTSGPLGPTDKNVQSSPYLDPRQPVPVRIVDPSKDLNSY  207

Query  488   -FSNAEWKDRVEKWKTRQEKRGLV------TRFdddkggadnedddFLMAD-ARQPLWRK  643
                N +WK+RVE WK +QEK G++      +    D  G  +  ++  MAD ARQP+ R 
Sbjct  208   GLGNVDWKERVEGWKMKQEK-GMMHMSNRHSEGKGDIEGTGSNGEELQMADDARQPMSRV  266

Query  644   LPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQF  823
             +PI SS ++PYR+VI+ R IILCFF  +R+  P  DA+PLWLIS+ICEIWF LSW+LDQF
Sbjct  267   VPIPSSHMTPYRVVIILRFIILCFFLQYRVTHPVKDAYPLWLISIICEIWFALSWLLDQF  326

Query  824   PKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAV  1003
             PKW PINRETYLDRL+LRF+R  EGE + LAPVDV+VSTVDP+KEPP+ITANTVLSILAV
Sbjct  327   PKWQPINRETYLDRLALRFDR--EGEPSQLAPVDVFVSTVDPMKEPPLITANTVLSILAV  384

Query  1004  DYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLK  1183
             DYPVDKVSCYVSDDG++ML F++L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLK
Sbjct  385   DYPVDKVSCYVSDDGSAMLSFESLSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLK  444

Query  1184  DKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMI  1363
             DK+QP+FVKERRAMK EYEE+KVR+NALVAKAQK PEEGW MQDGTPWPGNN+RDHPGMI
Sbjct  445   DKIQPSFVKERRAMKGEYEEFKVRINALVAKAQKMPEEGWTMQDGTPWPGNNSRDHPGMI  504

Query  1364  QVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLD  1543
             QV+LG  G LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+D
Sbjct  505   QVFLGHSGGLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVD  564

Query  1544  CDHY  1555
             CDHY
Sbjct  565   CDHY  568



>gb|AHL45025.1| cellulose synthase 3A [Linum usitatissimum]
Length=1060

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/551 (59%), Positives = 383/551 (70%), Gaps = 63/551 (11%)
 Frame = +2

Query  59    ADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCP  238
             ADH   + V+   Q++C+IC D+IG   +GE F+AC  C FPVC+PCY+YER +G Q CP
Sbjct  5     ADHGGTKNVK---QQVCQICSDDIGKTSDGEPFLACHVCAFPVCRPCYEYERKDGTQSCP  61

Query  239   HCNTRYKRHKGCP----------------------------------RVVGddedhfege  316
              C T+Y RHKG P                                  R++G +      +
Sbjct  62    QCKTKYTRHKGSPAIHGEQVDDGEFKDVGTKSTAQPGGIQDEKHKIDRMLGWESGSGRKD  121

Query  317   dfeqefeTKNHPPLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEV---  487
                  +E   H P + +    + +L   +    +   P +  GS     L D+Q+E    
Sbjct  122   YVTPSYENLTHIPYAASRPSMSGELSAASPGRYSMASPES--GSRATIRLGDQQREYGSG  179

Query  488   -FSNAEWKDRVEKWKTRQEK--------------RGLVTRFdddkggadnedddFLMADA  622
              F N  WK+R++ WK + EK              RG V          D   DD L  + 
Sbjct  180   GFGNVAWKERIDGWKMKPEKNTAPPSVSNAPSEGRGGVD----FDASTDILMDDLLNDET  235

Query  623   RQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGL  802
             RQPL RK+PISSS I+PYR+VIV RLIILC FFH+R+  P  DA PLWLISVICEIWF +
Sbjct  236   RQPLSRKVPISSSKINPYRMVIVLRLIILCIFFHYRLTNPVRDAIPLWLISVICEIWFAV  295

Query  803   SWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANT  982
             SWILDQFPKW P+NRETYLDRLSLR+E+  EGE + LA VD++VSTVDPLKEPPI+TANT
Sbjct  296   SWILDQFPKWFPVNRETYLDRLSLRYEK--EGEPSQLASVDIFVSTVDPLKEPPIVTANT  353

Query  983   VLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFS  1162
             VLSILAVDYPVDKVSCYVSDDGA+ML F++LAETAEFAR+WVPFCKKY IEPRAPEFYFS
Sbjct  354   VLSILAVDYPVDKVSCYVSDDGAAMLSFESLAETAEFARKWVPFCKKYNIEPRAPEFYFS  413

Query  1163  EKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNT  1342
             +KIDYLKDKVQP+FVK+RR+MKREYEE+K+RVN LVAKAQK PEEGW MQDGTPWPGNNT
Sbjct  414   QKIDYLKDKVQPSFVKDRRSMKREYEEFKIRVNGLVAKAQKVPEEGWFMQDGTPWPGNNT  473

Query  1343  RDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNA  1522
             RDHPGMIQV+LG  G LD +G ELP+LVYVSREKRPG+QHHKKAGAMN+LVRVSAVLTN 
Sbjct  474   RDHPGMIQVFLGHSGGLDSDGNELPRLVYVSREKRPGFQHHKKAGAMNSLVRVSAVLTNG  533

Query  1523  PFMLNLDCDHY  1555
             PF+LNLDCDHY
Sbjct  534   PFLLNLDCDHY  544



>dbj|BAG06269.1| cellulose synthase Z811 [Zinnia elegans]
Length=817

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/559 (57%), Positives = 386/559 (69%), Gaps = 55/559 (10%)
 Frame = +2

Query  14    VSMAALFTGGSH-------LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRE  172
             +  +A    GSH       +H   H+E + ++  + ++C IC DEIG+  +G++FVAC E
Sbjct  1     MQASAGLVAGSHNRNELVVIHG--HEEPKPLKDMTGQVCEICGDEIGLTVDGDLFVACNE  58

Query  173   CGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHP  352
             CGFPVC+PCY+YER EG+Q CP C TRYKR KG PRV GDD++    +   +      H 
Sbjct  59    CGFPVCRPCYEYERREGSQNCPQCKTRYKRLKGSPRVEGDDDEEDVDDIEHEFNIDDEHN  118

Query  353   PLSE---------NGDYHNNQLPHHNTTNSAAFQPTAAPGSV--------------GGKD  463
               +          +G     + P  +  N++A  P    G                G + 
Sbjct  119   KNNNNTNIAEAMLHGKMSYGRGPEDDDNNNSAQYPPVIAGRSRHVSGEFPISNQPHGEQM  178

Query  464   LEDEQKEVF---------------SNAEWKDRVEKWKTRQEKRGLVTRFdddkggadned  598
             L    K V                 +  WK+R+E WK  Q+           +     + 
Sbjct  179   LSSLHKRVHPYGSPENGSGRWDEKQDGGWKERLEDWKMHQQGN------LGAEIDDSADP  232

Query  599   ddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISV  778
             D  ++ +ARQPL RK+PI+SS I+PYR+VIV RL IL  F  +R+L P +DAF LWL SV
Sbjct  233   DMAMLDEARQPLSRKVPIASSKINPYRMVIVARLFILAIFLRYRLLNPVHDAFGLWLTSV  292

Query  779   ICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKE  958
             ICEIWF  SWILDQFPKW PI+RETYLDRLSLR+ER  EGE N L PVDV+VSTVDPLKE
Sbjct  293   ICEIWFAFSWILDQFPKWFPIDRETYLDRLSLRYER--EGEPNMLCPVDVFVSTVDPLKE  350

Query  959   PPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEP  1138
             PP++TANTVLSILA+DYPV+K+SCY+SDDGASML F++L+ETAEFAR+WVPFCK + IEP
Sbjct  351   PPLVTANTVLSILAMDYPVEKISCYISDDGASMLSFESLSETAEFARKWVPFCKNFAIEP  410

Query  1139  RAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDG  1318
             RAPE YFS+KIDYLKDKVQPTFVKERRAMKREYEE+KVR+NALVAKA K P EGW+MQDG
Sbjct  411   RAPEMYFSDKIDYLKDKVQPTFVKERRAMKREYEEFKVRINALVAKAMKAPAEGWIMQDG  470

Query  1319  TPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVR  1498
             TPWPGNNT+DHPGMIQV+LG  G  DVEG ELP+LVYVSREKRPG+QHHKKAGAMNALVR
Sbjct  471   TPWPGNNTKDHPGMIQVFLGQSGGTDVEGNELPRLVYVSREKRPGFQHHKKAGAMNALVR  530

Query  1499  VSAVLTNAPFMLNLDCDHY  1555
             VS VLTNAPFMLNLDCDHY
Sbjct  531   VSGVLTNAPFMLNLDCDHY  549



>emb|CAN73700.1| hypothetical protein VITISV_013112 [Vitis vinifera]
Length=1024

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/543 (59%), Positives = 390/543 (72%), Gaps = 47/543 (9%)
 Frame = +2

Query  23    AALFTGGSH-------LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGF  181
             +A    GSH       +H   H+E + +   + ++C IC DEIG+  +GEVFVAC ECGF
Sbjct  4     SAGLVAGSHNRNELVVIHG--HEEPKPLRSLNGQVCEICGDEIGLTVDGEVFVACNECGF  61

Query  182   PVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfeged----feqefeTKN-  346
             PVC+PCY+YER EG+Q CP C TR+KR KGC RV GDD++    +        + + KN 
Sbjct  62    PVCRPCYEYERREGSQLCPQCKTRFKRLKGCARVEGDDDEEDIDDIEHEFNIDDEQNKNK  121

Query  347   -------HPPLSE-----------NGDYHNNQLPHHNTTNSAAFQPTAAPGSVG--GKDL  466
                    H  +S            +G++  +   H     S++      P  V   G   
Sbjct  122   LIAEAMLHGKMSYGHELQTATVQVSGEFPISSHAHGEQGLSSSLHKRVHPYPVSEPGSAR  181

Query  467   EDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKL  646
              DE+KE      WK+R++ WK +Q   G             N+ D  ++ +ARQPL RK+
Sbjct  182   WDEKKE----GGWKERMDDWKMQQGNLG-------PDADDYNDPDMAMIEEARQPLSRKV  230

Query  647   PISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFP  826
             PI+SS ++PYR+VIV RL++L FF  +RIL P +DA  LWL+SVICEIWF  SWILDQFP
Sbjct  231   PIASSKVNPYRMVIVARLLVLAFFLRYRILNPVHDALGLWLVSVICEIWFAFSWILDQFP  290

Query  827   KWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVD  1006
             KW PI+RETYLDRLS R+ER  EGE N L+PVD++VSTVDPLKEPP++TANTVLSILA+D
Sbjct  291   KWFPIDRETYLDRLSFRYER--EGEPNMLSPVDIFVSTVDPLKEPPLVTANTVLSILAMD  348

Query  1007  YPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKD  1186
             YPVDK+SCY+SDDGAS+L F+ L+ETAEFARRWVPFCKK+ IEPRAPE YFS KIDYLKD
Sbjct  349   YPVDKISCYISDDGASILTFEALSETAEFARRWVPFCKKFSIEPRAPEMYFSLKIDYLKD  408

Query  1187  KVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQ  1366
             KVQPTFVKERRAMKREYEE+KVR+NA+VAKA K P EGW+MQDGTPWPGNNT+DHPGMIQ
Sbjct  409   KVQPTFVKERRAMKREYEEFKVRINAIVAKAVKVPPEGWIMQDGTPWPGNNTKDHPGMIQ  468

Query  1367  VYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDC  1546
             V+LG  G LD EG ELP+LVYVSREKRPG+ HHKKAGAMNAL+RVSAVLTNAPFMLNLDC
Sbjct  469   VFLGHSGGLDAEGNELPRLVYVSREKRPGFHHHKKAGAMNALIRVSAVLTNAPFMLNLDC  528

Query  1547  DHY  1555
             DHY
Sbjct  529   DHY  531



>ref|XP_008394069.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Malus domestica]
Length=1072

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/530 (60%), Positives = 388/530 (73%), Gaps = 39/530 (7%)
 Frame = +2

Query  77    REVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRY  256
             + V+  + ++C+IC D +GV   G+VFVAC EC FPVC+PCY+YER +GNQ CP C TRY
Sbjct  29    KPVKNLNGQICQICGDTVGVTATGDVFVACNECAFPVCRPCYEYERKDGNQACPQCKTRY  88

Query  257   KRHKGCPRVVGddedhfegedfeqefeTKNHPPL-----SENGDY-----HNNQLPHHNT  406
             KRHKG PRV GDD++    +   +    +           E+ D      H +Q P    
Sbjct  89    KRHKGSPRVDGDDDEDDIDDLENEFNYAQGTSNARRQWQGEDADLSSSSRHESQQPIPLL  148

Query  407   TNSAAFQ---PTAAPG------SVGGKD--------LEDEQKEVFS----NAEWKDRVEK  523
             TN  +     P A P       + G  D        + D  K++ S    N +WK+RVE 
Sbjct  149   TNGQSVSGEIPCATPDNQSVRTTSGPLDPRQPVPVRIVDPSKDLNSYGLGNVDWKERVEG  208

Query  524   WKTRQEKRGL-----VTRFdddkggadnedddFLMAD-ARQPLWRKLPISSSLISPYRIV  685
             WK +Q+K  +           D  G  +  ++  MAD ARQPL R +PISSS ++PYR+V
Sbjct  209   WKLKQDKNMMHMTNKYAEGKGDMEGTGSNGEELQMADDARQPLSRIVPISSSHLTPYRVV  268

Query  686   IVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDR  865
             I+ RLIIL FF  +R   P  DA+PLWL SVICEIWF LSW+LDQFPKW PINRETYLDR
Sbjct  269   IILRLIILGFFLQYRATHPVKDAYPLWLTSVICEIWFALSWLLDQFPKWFPINRETYLDR  328

Query  866   LSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDD  1045
             L+LR++RDGE  +  LAP+DV+VSTVDP+KEPP+ITANTVLSILAVDYPVDKVSCYVSDD
Sbjct  329   LALRYDRDGEPSQ--LAPIDVFVSTVDPMKEPPLITANTVLSILAVDYPVDKVSCYVSDD  386

Query  1046  GASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAM  1225
             G++ML F++L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK+QP+FVKERRAM
Sbjct  387   GSAMLTFESLSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKDKIQPSFVKERRAM  446

Query  1226  KREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEG  1405
             KREYEE+KVR+NALVAKAQK PEEGW MQDGTPWPGNN+RDHPGMIQV+LG  G LD +G
Sbjct  447   KREYEEFKVRINALVAKAQKMPEEGWTMQDGTPWPGNNSRDHPGMIQVFLGHSGGLDTDG  506

Query  1406  KELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
              ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  507   NELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  556



>ref|XP_008450511.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Cucumis melo]
Length=1068

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/550 (59%), Positives = 387/550 (70%), Gaps = 54/550 (10%)
 Frame = +2

Query  23    AALFTGGSH-------LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGF  181
             +A    GSH       +H   H+E + ++    ++C IC DE+G+  +G++FVAC ECGF
Sbjct  40    SAGLVAGSHNRNELVVIHG--HEEPKPLKNLDGQVCEICGDEVGLTVDGDLFVACNECGF  97

Query  182   PVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeT---KNHP  352
             PVC+PCY+YER EG+Q CP C TRYKR KG PRV GDD++    +   +        NH 
Sbjct  98    PVCRPCYEYERREGSQNCPQCKTRYKRLKGSPRVEGDDDEEDIDDIEHEFNIDDERNNHS  157

Query  353   PLSEN------------GDYHNNQLPHHNTTN---------------SAAFQPTAAPGSV  451
              L+E              D  N Q     T N               S++      P  V
Sbjct  158   HLAEAMLHGKMSYGRGPDDEENAQYGRSQTANGELPLSSQGYGEQMLSSSLHKRVHPYPV  217

Query  452   G--GKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadnedddFLMADAR  625
                G    DE++E      WKDR++ WK +Q   G        +     + D  ++  AR
Sbjct  218   SEPGSTRWDEKRE----EGWKDRMDDWKLQQGNLG-------PEPDDGCDPDMAMIDAAR  266

Query  626   QPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLS  805
             QPL RK+PI+SS I+PYR+VIV RL+IL FF  +RIL P +DA  LWL SVICEIWF  S
Sbjct  267   QPLSRKVPIASSKINPYRMVIVARLVILAFFLRYRILNPVHDALGLWLTSVICEIWFAFS  326

Query  806   WILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTV  985
             WILDQFPKW PI+RETYLDRLSLR+ER  EGE N LAPVD++VSTVDP+KEPP++TANT+
Sbjct  327   WILDQFPKWFPIDRETYLDRLSLRYER--EGEPNLLAPVDIFVSTVDPMKEPPLVTANTI  384

Query  986   LSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSE  1165
             LSILA+DYPVDK+SCYVSDDGASML F+ ++ETAEFAR+WVPFCKK+ IEPRAPE YF E
Sbjct  385   LSILAMDYPVDKISCYVSDDGASMLTFEAMSETAEFARKWVPFCKKFSIEPRAPEMYFCE  444

Query  1166  KIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTR  1345
             KIDYLKDKVQPTFVKERRAMKREYEE+KVR+NA VAKA K P EGW+MQDGTPWPGNNT+
Sbjct  445   KIDYLKDKVQPTFVKERRAMKREYEEFKVRINAQVAKAMKIPTEGWIMQDGTPWPGNNTK  504

Query  1346  DHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAP  1525
             DHPGMIQV+LG  G LD EG ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTNAP
Sbjct  505   DHPGMIQVFLGHSGGLDAEGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNAP  564

Query  1526  FMLNLDCDHY  1555
             FMLNLDCDHY
Sbjct  565   FMLNLDCDHY  574



>ref|XP_008366693.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Malus domestica]
Length=1072

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/538 (59%), Positives = 394/538 (73%), Gaps = 40/538 (7%)
 Frame = +2

Query  53    HAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQC  232
             H +D   +  V+  + ++C+IC D +G+   G+VFVAC EC FPVC+PCY+YER +GNQ 
Sbjct  22    HDSDSSSK-PVKNLNGQICQICGDTVGLTATGDVFVACNECAFPVCRPCYEYERKDGNQA  80

Query  233   CPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPL-----SENGDY-----HN  382
             CP C TRYKRHKG PRV GDD++    +   +   T+           E+ D      H 
Sbjct  81    CPQCKTRYKRHKGSPRVDGDDDEDDIDDLENEFNYTQGTSNARRQWQGEDADLSSSSRHE  140

Query  383   NQLPHHNTTNSAAFQ---PTAAPG------SVGGKD--------LEDEQKEVFS----NA  499
             +Q P    TN  +     P A P       + G  D        + D  K++ S    N 
Sbjct  141   SQQPIPLLTNGQSVSGEIPCATPDNQSVRTTSGPLDPRQPVPVRIVDPSKDLNSYGLGNV  200

Query  500   EWKDRVEKWKTRQEKR--GLVTRFdddkggadneddd---FLMAD-ARQPLWRKLPISSS  661
             +WK+RVE WK +Q+K    + +R+ + KG  +    +     MAD ARQPL R +PISSS
Sbjct  201   DWKERVEGWKLKQDKSMMQMTSRYAEGKGDMEGTGSNGEELQMADDARQPLSRIVPISSS  260

Query  662   LISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPI  841
              ++PYR+VI+ RLIIL FF  +R   P  DA+PLWL SVICEIWF LSW+LDQFPKW PI
Sbjct  261   HLTPYRVVIILRLIILGFFLQYRATHPVKDAYPLWLTSVICEIWFALSWLLDQFPKWFPI  320

Query  842   NRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDK  1021
             NRETYLDRL+LR++RDGE  +  LAP+DV+VSTVDP+KEPP++TANTVLSIL+VDYPVDK
Sbjct  321   NRETYLDRLTLRYDRDGEPSQ--LAPIDVFVSTVDPMKEPPLVTANTVLSILSVDYPVDK  378

Query  1022  VSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPT  1201
             VSCYVSDDG++ML F++L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK+QP+
Sbjct  379   VSCYVSDDGSAMLTFESLSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKDKIQPS  438

Query  1202  FVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS  1381
             FVKERRAMKREYEE+KVR+NALVAKAQK PEEGW MQDGTPWPGNN RDHPGMIQV+LG 
Sbjct  439   FVKERRAMKREYEEFKVRINALVAKAQKMPEEGWTMQDGTPWPGNNPRDHPGMIQVFLGH  498

Query  1382  EGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
              G LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  499   SGGLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  556



>ref|XP_007013842.1| Cellulose synthase 1 [Theobroma cacao]
 gb|EOY31461.1| Cellulose synthase 1 [Theobroma cacao]
Length=1085

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/569 (57%), Positives = 399/569 (70%), Gaps = 61/569 (11%)
 Frame = +2

Query  23    AALFTGGSH----LHAADHDER---REVERESQKMCRICRDEIGVVENGEVFVACRECGF  181
             +A    GSH    L    HD     + ++  + + C+IC D +G+   G+VFVAC EC F
Sbjct  4     SAGMVAGSHRRNELVRIRHDSDSGPKPLKNLNGQTCQICGDNVGLTAAGDVFVACNECAF  63

Query  182   PVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHP---  352
             PVC+PCY+YER +G QCCP C TRYKRHKG PRV GDD++    +   +    + H    
Sbjct  64    PVCRPCYEYERKDGTQCCPQCKTRYKRHKGSPRVEGDDDEDDVDDLENEFDYAQGHSKAR  123

Query  353   ----------------------PLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDL  466
                                   PL  NG   + ++P   T ++ + + T+ P     K++
Sbjct  124   RQWQGEDVDLSSSSRHESQQPIPLLTNGHSVSGEIPCA-TPDNESVRTTSGPLGPSEKNV  182

Query  467   E----------------DEQKEV----FSNAEWKDRVEKWKTRQEKR--GLVTRF---dd  571
                              D  K++      N +WK+RVE WK +QEK    + +R+     
Sbjct  183   SSSPYIDPRQPVPVRIVDPTKDLNSYGLGNVDWKERVESWKLKQEKNVMQMSSRYPEGKG  242

Query  572   dkggadnedddFLMAD-ARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAY  748
             D  G  +  ++  MAD ARQPL R +PISSS ++PYR+VI+ RLIIL FF  +R   P  
Sbjct  243   DIEGTGSNGEELQMADDARQPLSRVVPISSSHLTPYRVVIILRLIILGFFLQYRATHPVK  302

Query  749   DAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDV  928
             DA+PLWL SVICEIWF LSW+LDQFPKWSPINRETYLDRL+LR++RDGE  +  LAPVDV
Sbjct  303   DAYPLWLTSVICEIWFALSWLLDQFPKWSPINRETYLDRLALRYDRDGEPSQ--LAPVDV  360

Query  929   YVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWV  1108
             +VSTVDPLKEPP++TANTVLSILAVDYPVDKV+CYVSDDG++ML F+ L+ETAEFAR+WV
Sbjct  361   FVSTVDPLKEPPLVTANTVLSILAVDYPVDKVACYVSDDGSAMLTFEALSETAEFARKWV  420

Query  1109  PFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKK  1288
             PFCKK+ IEPRAPEFYF++KIDYLKDK+QP+FVKERRAMKREYEE+KVR+NALVAKAQK 
Sbjct  421   PFCKKHNIEPRAPEFYFAQKIDYLKDKIQPSFVKERRAMKREYEEFKVRINALVAKAQKM  480

Query  1289  PEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHK  1468
             PEEGW MQDGTPWPGNN RDHPGMIQV+LG  G LD +G ELP+L+YVSREKRPG+QHHK
Sbjct  481   PEEGWTMQDGTPWPGNNPRDHPGMIQVFLGHSGGLDTDGNELPRLIYVSREKRPGFQHHK  540

Query  1469  KAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             KAGAMNAL+RVSAVLTN  F+LN+DCDHY
Sbjct  541   KAGAMNALIRVSAVLTNGAFLLNVDCDHY  569



>ref|XP_004242614.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Solanum lycopersicum]
Length=1041

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/556 (58%), Positives = 385/556 (69%), Gaps = 60/556 (11%)
 Frame = +2

Query  23    AALFTGGSH-------LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGF  181
             +A    GSH       +H   H+E + ++  S ++C IC DEIG+  +G++FVAC ECGF
Sbjct  4     SAGLVAGSHNRNELVVIHG--HEEHKPLKDLSGQVCDICGDEIGLTVDGDLFVACNECGF  61

Query  182   PVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefe--------  337
             PVC+PCY+YER EG Q CP C TRYKR KG PRV GDD++    +   +           
Sbjct  62    PVCRPCYEYERREGTQQCPQCKTRYKRLKGSPRVAGDDDEEDIDDIEHEFKVDDDQNKNR  121

Query  338   ---------------------TKNHPPLSENGDYH--NNQLPHHNTTNSAAFQPTAA---  439
                                  +  +PP+      H  + + P  N  N      ++    
Sbjct  122   NIVETILHGKMTYGRGPEDEDSAQYPPVIAGTRSHPVSGEFPISNHGNGEQMLGSSLHKR  181

Query  440   ----PGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadnedddF  607
                 P S  G    D++KE      WK+R+E WK +Q   G              + D  
Sbjct  182   IHPYPASESGSARWDDKKE----GGWKERMEDWKFQQGHAG-------QDYDDSADVDMS  230

Query  608   LMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICE  787
             ++ +ARQPL RK+PI+SS I+PYR+VIV RL+IL  F  +RIL P +DA  LWL S+ICE
Sbjct  231   MVDEARQPLSRKVPIASSKINPYRMVIVARLVILAVFLRYRILNPVHDAIGLWLTSIICE  290

Query  788   IWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPI  967
             IWF  SWILDQFPKW PI+RETYLDRLSLR+ER  EGE N LAPVDV+VSTVDP+KEPP+
Sbjct  291   IWFAFSWILDQFPKWFPIDRETYLDRLSLRYER--EGEPNMLAPVDVFVSTVDPMKEPPL  348

Query  968   ITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAP  1147
             +TANT+LSILA+DYPVDK+SCY+SDDGASM  F+ L+ETAEFAR+WVPFCKK+ IEPRAP
Sbjct  349   VTANTILSILAMDYPVDKISCYLSDDGASMCTFEALSETAEFARKWVPFCKKFAIEPRAP  408

Query  1148  EFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPW  1327
             EFYFS KIDYLKDK+QPTFVKERRAMKREYEE+KVR+NALVAKA K P  GW+MQDGTPW
Sbjct  409   EFYFSLKIDYLKDKIQPTFVKERRAMKREYEEFKVRINALVAKATKMPPGGWIMQDGTPW  468

Query  1328  PGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSA  1507
             PGNNTRDHPGMIQV+LG  G  DV+G ELP+LVYVSREKRPG+QHHKKAGAMNALVRVS 
Sbjct  469   PGNNTRDHPGMIQVFLGQSGGTDVDGHELPRLVYVSREKRPGFQHHKKAGAMNALVRVSG  528

Query  1508  VLTNAPFMLNLDCDHY  1555
             VLTNAPFMLNLDCDHY
Sbjct  529   VLTNAPFMLNLDCDHY  544



>ref|XP_004152851.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Cucumis sativus]
 ref|XP_004163057.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase A catalytic 
subunit 7 [UDP-forming]-like [Cucumis sativus]
 gb|KGN61215.1| hypothetical protein Csa_2G070320 [Cucumis sativus]
Length=1032

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/550 (59%), Positives = 386/550 (70%), Gaps = 54/550 (10%)
 Frame = +2

Query  23    AALFTGGSH-------LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGF  181
             +A    GSH       +H   H+E + ++    ++C IC D +G+  +G++FVAC ECGF
Sbjct  4     SAGLVAGSHNRNELVVIHG--HEEPKPLKNLDGQVCEICGDAVGLTVDGDLFVACNECGF  61

Query  182   PVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeT---KNHP  352
             PVC+PCY+YER EG+Q CP C TRYKR KG PRV GDD++    +   +        NH 
Sbjct  62    PVCRPCYEYERREGSQNCPQCKTRYKRLKGSPRVEGDDDEEDIDDIEHEFNMDDERNNHS  121

Query  353   PLSEN------------GDYHNNQLPHHNTTN---------------SAAFQPTAAPGSV  451
              L+E              D  N Q     T N               S++      P  V
Sbjct  122   HLAEAMLHGKMSYGRGPDDEENAQYGRSQTVNGELPLSSQGYGEQMLSSSLHKRVHPYPV  181

Query  452   G--GKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadnedddFLMADAR  625
                G    DE++E      WKDR++ WK +Q   G        +     + D  ++  AR
Sbjct  182   SEPGSQRWDEKRE----EGWKDRMDDWKLQQGNLG-------PEPDDGYDPDMAMIDAAR  230

Query  626   QPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLS  805
             QPL RK+PI+SS I+PYR+VIV RL+IL FF  +RIL P +DA  LWL SVICEIWF  S
Sbjct  231   QPLSRKVPIASSKINPYRMVIVARLVILAFFLRYRILNPVHDALGLWLTSVICEIWFAFS  290

Query  806   WILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTV  985
             WILDQFPKW PI+RETYLDRLSLR+ER  EGE N LAPVD++VSTVDP+KEPP++TANT+
Sbjct  291   WILDQFPKWFPIDRETYLDRLSLRYER--EGEPNLLAPVDIFVSTVDPMKEPPLVTANTI  348

Query  986   LSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSE  1165
             LSILA+DYPVDK+SCYVSDDGASML F+ ++ETAEFAR+WVPFCKK+ IEPRAPE YF E
Sbjct  349   LSILAMDYPVDKISCYVSDDGASMLTFEAMSETAEFARKWVPFCKKFSIEPRAPEMYFCE  408

Query  1166  KIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTR  1345
             KIDYLKDKVQPTFVKERRAMKREYEE+KVR+NA VAKA K P EGW+MQDGTPWPGNNT+
Sbjct  409   KIDYLKDKVQPTFVKERRAMKREYEEFKVRINAQVAKAMKIPTEGWIMQDGTPWPGNNTK  468

Query  1346  DHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAP  1525
             DHPGMIQV+LG  G LD EG ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTNAP
Sbjct  469   DHPGMIQVFLGHSGGLDAEGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNAP  528

Query  1526  FMLNLDCDHY  1555
             FMLNLDCDHY
Sbjct  529   FMLNLDCDHY  538



>ref|XP_006474027.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
isoform X1 [Citrus sinensis]
Length=1041

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/557 (58%), Positives = 380/557 (68%), Gaps = 63/557 (11%)
 Frame = +2

Query  23    AALFTGGSH-----LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPV  187
             +A    GSH     +   +H+E + ++    ++C IC DEIG+  +G++FVAC ECGFPV
Sbjct  4     SAGLVAGSHNRNELVVIHNHEEPKPLKNLDAQVCEICGDEIGLTVDGDLFVACNECGFPV  63

Query  188   CKPCYQYERSEGNQCCPHCNTRYKRHKGCPR----------------------------V  283
             C+PCY+YER EG Q CP C TRYKR KG PR                            V
Sbjct  64    CRPCYEYERREGTQVCPQCKTRYKRLKGSPRVEGDEDEEDIDDIEHEFNIEDEKNKEKHV  123

Query  284   VGddedhfegedfeqefeTKNHPPLSENGDY-------------HNNQLPHHNTTNSAAF  424
                              E    PP+   G               H +Q+   +       
Sbjct  124   ADMLHGKMSYGRGPDSDENSQFPPVIAGGRSRPVSGEFPVGGYGHGDQMLSSSLHKRVHP  183

Query  425   QPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadneddd  604
              P + PGS       DE+KE      WKDR++ WK +Q   G  T          N+ D 
Sbjct  184   YPVSEPGSA----RWDEKKE----GGWKDRMDDWKMQQGNLGPET-------DDANDPDM  228

Query  605   FLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVIC  784
              ++ +ARQPL RK+PI+SS I+PYR+VIV RL+IL FFF +RIL P +DA  LWLISVIC
Sbjct  229   AMVDEARQPLSRKVPIASSKINPYRMVIVARLVILAFFFRYRILNPVHDAIGLWLISVIC  288

Query  785   EIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPP  964
             EIWF +SWILDQFPKW PI+RETYLDRLS R+ER  EGE N LAPVD++VSTVDPLKEPP
Sbjct  289   EIWFAISWILDQFPKWFPIDRETYLDRLSFRYER--EGEPNMLAPVDIFVSTVDPLKEPP  346

Query  965   IITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRA  1144
             ++TANTVLSILA+DYPVDK+SCY+SDDGAS++ FD LAETAEFAR+WVPFCKK+ IEPRA
Sbjct  347   LVTANTVLSILAMDYPVDKISCYISDDGASIITFDALAETAEFARKWVPFCKKFAIEPRA  406

Query  1145  PEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTP  1324
             PE YF+ K+DYLKDKVQPTFVKERRAMKREYEE+KVR+NA+VA+A K P EGW+M DGTP
Sbjct  407   PEMYFTLKVDYLKDKVQPTFVKERRAMKREYEEFKVRINAIVARASKIPPEGWIMPDGTP  466

Query  1325  WPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVS  1504
             WPGNNTRDHPGMIQV+LG  G  D EG ELP+LVYVSREKRPG+QHHKKAGAMNALVRVS
Sbjct  467   WPGNNTRDHPGMIQVFLGQSGGHDAEGNELPRLVYVSREKRPGFQHHKKAGAMNALVRVS  526

Query  1505  AVLTNAPFMLNLDCDHY  1555
              VLTNAPFMLNLDCDHY
Sbjct  527   GVLTNAPFMLNLDCDHY  543



>ref|XP_006474028.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
isoform X2 [Citrus sinensis]
Length=1040

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/557 (58%), Positives = 380/557 (68%), Gaps = 63/557 (11%)
 Frame = +2

Query  23    AALFTGGSH-----LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPV  187
             +A    GSH     +   +H+E + ++    ++C IC DEIG+  +G++FVAC ECGFPV
Sbjct  4     SAGLVAGSHNRNELVVIHNHEEPKPLKNLDAQVCEICGDEIGLTVDGDLFVACNECGFPV  63

Query  188   CKPCYQYERSEGNQCCPHCNTRYKRHKGCPR----------------------------V  283
             C+PCY+YER EG Q CP C TRYKR KG PR                            V
Sbjct  64    CRPCYEYERREGTQVCPQCKTRYKRLKGSPRVEGDEDEEDIDDIEHEFNIEDEKNKEKHV  123

Query  284   VGddedhfegedfeqefeTKNHPPLSENGDY-------------HNNQLPHHNTTNSAAF  424
                              E    PP+   G               H +Q+   +       
Sbjct  124   ADMLHGKMSYGRGPDSDENSQFPPVIAGGRSRPVSGEFPVGGYGHGDQMLSSSLHKRVHP  183

Query  425   QPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadneddd  604
              P + PGS       DE+KE      WKDR++ WK +Q   G  T          N+ D 
Sbjct  184   YPVSEPGSA----RWDEKKE----GGWKDRMDDWKMQQGNLGPET-------DDANDPDM  228

Query  605   FLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVIC  784
              ++ +ARQPL RK+PI+SS I+PYR+VIV RL+IL FFF +RIL P +DA  LWLISVIC
Sbjct  229   AMVDEARQPLSRKVPIASSKINPYRMVIVARLVILAFFFRYRILNPVHDAIGLWLISVIC  288

Query  785   EIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPP  964
             EIWF +SWILDQFPKW PI+RETYLDRLS R+ER  EGE N LAPVD++VSTVDPLKEPP
Sbjct  289   EIWFAISWILDQFPKWFPIDRETYLDRLSFRYER--EGEPNMLAPVDIFVSTVDPLKEPP  346

Query  965   IITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRA  1144
             ++TANTVLSILA+DYPVDK+SCY+SDDGAS++ FD LAETAEFAR+WVPFCKK+ IEPRA
Sbjct  347   LVTANTVLSILAMDYPVDKISCYISDDGASIITFDALAETAEFARKWVPFCKKFAIEPRA  406

Query  1145  PEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTP  1324
             PE YF+ K+DYLKDKVQPTFVKERRAMKREYEE+KVR+NA+VA+A K P EGW+M DGTP
Sbjct  407   PEMYFTLKVDYLKDKVQPTFVKERRAMKREYEEFKVRINAIVARASKIPPEGWIMPDGTP  466

Query  1325  WPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVS  1504
             WPGNNTRDHPGMIQV+LG  G  D EG ELP+LVYVSREKRPG+QHHKKAGAMNALVRVS
Sbjct  467   WPGNNTRDHPGMIQVFLGQSGGHDAEGNELPRLVYVSREKRPGFQHHKKAGAMNALVRVS  526

Query  1505  AVLTNAPFMLNLDCDHY  1555
              VLTNAPFMLNLDCDHY
Sbjct  527   GVLTNAPFMLNLDCDHY  543



>ref|XP_004149389.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cucumis sativus]
 gb|KGN53854.1| hypothetical protein Csa_4G166980 [Cucumis sativus]
Length=1050

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/521 (61%), Positives = 378/521 (73%), Gaps = 41/521 (8%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             ++C+IC D +G   +GE FVAC  C FPVC+PCY+YER +GNQ CP C T+YK HKG P 
Sbjct  18    QVCQICSDSVGTTADGEPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTKYKWHKGSPP  77

Query  281   VVGddedhfegedfeqefeTKNHPP---LSENGDYHN----NQLPHHNTTNSAAFQPTAA  439
             V G+  +  +G       E  +  P   LS + +Y      N +P   T  S + + +AA
Sbjct  78    VTGEAVEDGDGNGVGGAQERHHKMPERTLSWDTNYDKEGSFNHIPLLTTGRSVSGELSAA  137

Query  440   P-----------GSVGGKDLEDEQKEV----FSNAEWKDRVEKWKTRQEK----------  544
                         GS     + D+ ++     F N  WK+R++ WK +Q+K          
Sbjct  138   SPERLSMASPESGSRANYRIMDQSRDSGSARFGNVAWKERIDSWKVKQDKSVPPMSVSHA  197

Query  545   ----RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILC  712
                 RG       D       DD  L  +ARQPL RK+ I SS I+PYR+VIV RLIILC
Sbjct  198   PSEGRGGAD---FDASTDVVIDDSLLNDEARQPLSRKVSIPSSRINPYRMVIVLRLIILC  254

Query  713   FFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDG  892
              F H+RI  P  +AF LWLISVICEIWF +SWILDQFPKW P+NRETYLDRL+LR++R  
Sbjct  255   IFLHYRITNPVPNAFALWLISVICEIWFAISWILDQFPKWLPVNRETYLDRLALRYDR--  312

Query  893   EGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDT  1072
             EGE + LA VD++VSTVDPLKEPP++TANTVLSIL+VDYPVDKVSCYVSDDGA+ML F+ 
Sbjct  313   EGEPSQLAAVDIFVSTVDPLKEPPLVTANTVLSILSVDYPVDKVSCYVSDDGAAMLTFEA  372

Query  1073  LAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKV  1252
             L+ET+EFAR+WVPFCKKY IEPRAPE+YF++KIDYLKDKVQP+FVKERRAMKREYEE+K+
Sbjct  373   LSETSEFARKWVPFCKKYSIEPRAPEWYFAQKIDYLKDKVQPSFVKERRAMKREYEEFKI  432

Query  1253  RVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYV  1432
             RVN LVAKAQK P+EGWVMQDGTPWPGNNTRDHPGMIQV+LG  G LD +G ELP+LVYV
Sbjct  433   RVNGLVAKAQKIPDEGWVMQDGTPWPGNNTRDHPGMIQVFLGHSGGLDTDGNELPRLVYV  492

Query  1433  SREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             SREKRPG+QHHKKAGAMNALVRVSAVLTN PF+LNLDCDHY
Sbjct  493   SREKRPGFQHHKKAGAMNALVRVSAVLTNGPFLLNLDCDHY  533



>ref|XP_010110357.1| Protein radially swollen 1 [Morus notabilis]
 gb|EXC26044.1| Protein radially swollen 1 [Morus notabilis]
Length=1080

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/541 (59%), Positives = 391/541 (72%), Gaps = 51/541 (9%)
 Frame = +2

Query  77    REVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRY  256
             + V+  + ++C+IC D +G+  NG+VFVAC EC FPVC PCY+YER +GNQ CP C TRY
Sbjct  29    KPVKHLNGQICQICGDTVGLTANGDVFVACNECAFPVCHPCYEYERKDGNQSCPQCKTRY  88

Query  257   KRHKGCPRVVGddedhfegedfeqefeTKNHP-------------------------PLS  361
             KRHKG PRV GDD++    +   +    + +                          PL 
Sbjct  89    KRHKGSPRVDGDDDEDDVDDLENEFNYAQGNNNSRRQWRGEDADLSSSSRHESQQPIPLL  148

Query  362   ENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLE-------------DEQKEV----F  490
              NG   + ++P   T ++ + + T+ P   G K L              D  K++     
Sbjct  149   TNGQPVSGEIPCA-TPDNQSVRTTSGPLGPGDKHLPYVDPRLPVPVRIVDPSKDLNAYGL  207

Query  491   SNAEWKDRVEKWKTRQEKR--GLVTRF---dddkggadnedddFLMAD-ARQPLWRKLPI  652
              N +WK+RVE WK +Q+K    + +R+     D  G  +  ++  MAD ARQPL R +PI
Sbjct  208   GNVDWKERVEGWKLKQDKNIIQMTSRYPEGKGDMEGTGSNGEELQMADDARQPLSRVVPI  267

Query  653   SSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKW  832
              SS I+PYR+VI+ RLIIL FF  +R   P  DA+PLWL SVICEIWF LSW+LDQFPKW
Sbjct  268   PSSHITPYRVVIILRLIILGFFLQYRTTHPVKDAYPLWLTSVICEIWFALSWLLDQFPKW  327

Query  833   SPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYP  1012
             SPINRETYLDRL+LR++R  EGE + LAPVDV+VSTVDPLKEPP++TANTVLSILAVDYP
Sbjct  328   SPINRETYLDRLALRYDR--EGEPSQLAPVDVFVSTVDPLKEPPLVTANTVLSILAVDYP  385

Query  1013  VDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKV  1192
             VDKVSCYVSDDG++ML F+ L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK+
Sbjct  386   VDKVSCYVSDDGSAMLTFEALSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKDKI  445

Query  1193  QPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVY  1372
             QP+FVKERRAMKREYEE+KVR+NALVAKAQK PEEGW MQDGTPWPGNN RDHPGMIQV+
Sbjct  446   QPSFVKERRAMKREYEEFKVRINALVAKAQKMPEEGWTMQDGTPWPGNNPRDHPGMIQVF  505

Query  1373  LGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDH  1552
             LG  G LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDH
Sbjct  506   LGHSGGLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDH  565

Query  1553  Y  1555
             Y
Sbjct  566   Y  566



>ref|XP_006453581.1| hypothetical protein CICLE_v10007321mg [Citrus clementina]
 gb|ESR66821.1| hypothetical protein CICLE_v10007321mg [Citrus clementina]
Length=1040

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/557 (58%), Positives = 380/557 (68%), Gaps = 63/557 (11%)
 Frame = +2

Query  23    AALFTGGSH-----LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPV  187
             +A    GSH     +   +H+E + ++    ++C IC DEIG+  +G++FVAC ECGFPV
Sbjct  4     SAGLVAGSHNRNELVVIHNHEEPKPLKNLDAQVCEICGDEIGLTVDGDLFVACNECGFPV  63

Query  188   CKPCYQYERSEGNQCCPHCNTRYKRHKGCPR----------------------------V  283
             C+PCY+YER EG Q CP C TRYKR KG PR                            V
Sbjct  64    CRPCYEYERREGTQVCPQCKTRYKRLKGSPRVEGDEDEEDIDDIEHEFNIEDEKNKEKHV  123

Query  284   VGddedhfegedfeqefeTKNHPPLSENGDY-------------HNNQLPHHNTTNSAAF  424
                              E    PP+   G               H +Q+   +       
Sbjct  124   ADMLHGKMSYGRGPDSDENSQFPPVIAGGRSRPVSGEFPVGAYGHGDQMLSSSLHKRVHP  183

Query  425   QPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadneddd  604
              P + PGS       DE+KE      WKDR++ WK +Q   G  T          N+ D 
Sbjct  184   YPVSEPGSA----RWDERKE----GGWKDRMDDWKMQQGNLGPET-------DDANDPDM  228

Query  605   FLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVIC  784
              ++ +ARQPL RK+PI+SS I+PYR+VIV RL+IL FFF +RIL P +DA  LWLISVIC
Sbjct  229   AMVDEARQPLSRKVPIASSKINPYRMVIVARLVILAFFFRYRILNPVHDAIGLWLISVIC  288

Query  785   EIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPP  964
             EIWF +SWILDQFPKW PI+RETYLDRLS R+ER  EGE N LAPVD++VSTVDPLKEPP
Sbjct  289   EIWFAISWILDQFPKWFPIDRETYLDRLSFRYER--EGEPNMLAPVDIFVSTVDPLKEPP  346

Query  965   IITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRA  1144
             ++TANTVLSILA+DYPVDK+SCY+SDDGAS++ FD LAETAEFAR+WVPFCKK+ IEPRA
Sbjct  347   LVTANTVLSILAMDYPVDKISCYISDDGASIITFDALAETAEFARKWVPFCKKFAIEPRA  406

Query  1145  PEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTP  1324
             PE YF+ K+DYLKDKVQPTFVKERRAMKREYEE+KVR+NA+VA+A K P EGW+M DGTP
Sbjct  407   PEMYFTLKVDYLKDKVQPTFVKERRAMKREYEEFKVRINAIVARASKIPPEGWIMPDGTP  466

Query  1325  WPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVS  1504
             WPGNNTRDHPGMIQV+LG  G  D EG ELP+LVYVSREKRPG+QHHKKAGAMNALVRVS
Sbjct  467   WPGNNTRDHPGMIQVFLGQSGGHDAEGNELPRLVYVSREKRPGFQHHKKAGAMNALVRVS  526

Query  1505  AVLTNAPFMLNLDCDHY  1555
              VLTNAPFMLNLDCDHY
Sbjct  527   GVLTNAPFMLNLDCDHY  543



>ref|XP_003522926.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Glycine max]
 gb|KHN11139.1| Cellulose synthase A catalytic subunit 7 [UDP-forming] [Glycine 
soja]
Length=1039

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/557 (58%), Positives = 394/557 (71%), Gaps = 63/557 (11%)
 Frame = +2

Query  23    AALFTGGSH-------LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGF  181
             +A    GSH       +H   H+E + ++    ++C IC D +G+  +G++FVAC ECGF
Sbjct  4     SAGLVAGSHNRNELVVIHG--HEEPKALKNLDGQVCEICGDGVGLTVDGDLFVACNECGF  61

Query  182   PVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedf---eqefeTKNHP  352
             PVC+PCY+YER EG+Q CP C TRYKR KG PRV GDD++    +       + +T  H 
Sbjct  62    PVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRVEGDDDEEDVDDIEHEFNIDEQTNKHG  121

Query  353   PLSENG------------DYHNNQLP----------------------HHNTTNSAAFQP  430
              ++E              D  N+Q P                      + +   S++   
Sbjct  122   QVAEAMLHGKMSYGRGPEDDENSQFPTPVIAGGRSRPVSGEFPLSSNVYGDQMLSSSLHK  181

Query  431   TAAPGSVG--GKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadneddd  604
                P  V   G    DE+KE      WKDR++ WK +Q   G            D + D 
Sbjct  182   RVHPYPVSEPGSARWDEKKE----DGWKDRMDDWKLQQGNLG---------PEPDEDPDA  228

Query  605   FLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVIC  784
              ++ +ARQPL RK+PI+SS I+PYR+VIV RL+IL FF  +R++ P +DA  LWL S+IC
Sbjct  229   AMLDEARQPLSRKVPIASSKINPYRMVIVARLVILAFFLRYRLMNPVHDALGLWLTSIIC  288

Query  785   EIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPP  964
             EIWF  SWILDQFPKW PI+RETYLDRLS+R+ER  EGE N LAPVDV+VSTVDP+KEPP
Sbjct  289   EIWFAFSWILDQFPKWFPIDRETYLDRLSIRYER--EGEPNMLAPVDVFVSTVDPMKEPP  346

Query  965   IITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRA  1144
             ++TANTVLSILA+DYPVDK+SCY+SDDGASM  F++L+ETAEFAR+WVPFCKK+ IEPRA
Sbjct  347   LVTANTVLSILAMDYPVDKISCYISDDGASMCTFESLSETAEFARKWVPFCKKFSIEPRA  406

Query  1145  PEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTP  1324
             PE YFSEKIDYLKDKVQPTFVKERRAMKREYEE+KVR+NALVAKAQK P+ GW+MQDGTP
Sbjct  407   PEMYFSEKIDYLKDKVQPTFVKERRAMKREYEEFKVRINALVAKAQKVPQGGWIMQDGTP  466

Query  1325  WPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVS  1504
             WPGNNT+DHPGMIQV+LGS G LD EG +LP+LVYVSREKRPG+QHHKKAGAMNALVRVS
Sbjct  467   WPGNNTKDHPGMIQVFLGSSGGLDTEGNQLPRLVYVSREKRPGFQHHKKAGAMNALVRVS  526

Query  1505  AVLTNAPFMLNLDCDHY  1555
             AVLTNAPFMLNLDCDHY
Sbjct  527   AVLTNAPFMLNLDCDHY  543



>gb|KDO62270.1| hypothetical protein CISIN_1g039060mg [Citrus sinensis]
Length=1040

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/557 (58%), Positives = 380/557 (68%), Gaps = 63/557 (11%)
 Frame = +2

Query  23    AALFTGGSH-----LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPV  187
             +A    GSH     +   +H+E + ++    ++C IC DEIG+  +G++FVAC ECGFPV
Sbjct  4     SAGLVAGSHNRNELVVIHNHEEPKPLKNLDAQVCEICGDEIGLTVDGDLFVACNECGFPV  63

Query  188   CKPCYQYERSEGNQCCPHCNTRYKRHKGCPR----------------------------V  283
             C+PCY+YER EG Q CP C TRYKR KG PR                            V
Sbjct  64    CRPCYEYERREGTQVCPQCKTRYKRLKGSPRVEGDEDEEDIDDIEHEFNIEDEKNKEKHV  123

Query  284   VGddedhfegedfeqefeTKNHPPLSENGDY-------------HNNQLPHHNTTNSAAF  424
                              E    PP+   G               H +Q+   +       
Sbjct  124   ADMLHGKMSYGRGPDSDENSQFPPVIAGGRSRPVSGEFPVGGYGHGDQMLSSSLHKRVHP  183

Query  425   QPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadneddd  604
              P + PGS       DE+KE      WKDR++ WK +Q   G  T          N+ D 
Sbjct  184   YPVSEPGSA----RWDERKE----GGWKDRMDDWKMQQGNLGPET-------DDANDPDM  228

Query  605   FLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVIC  784
              ++ +ARQPL RK+PI+SS I+PYR+VIV RL+IL FFF +RIL P +DA  LWLISVIC
Sbjct  229   AMVDEARQPLSRKVPIASSKINPYRMVIVARLVILAFFFRYRILNPVHDAIGLWLISVIC  288

Query  785   EIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPP  964
             EIWF +SWILDQFPKW PI+RETYLDRLS R+ER  EGE N LAPVD++VSTVDPLKEPP
Sbjct  289   EIWFAISWILDQFPKWFPIDRETYLDRLSFRYER--EGEPNMLAPVDIFVSTVDPLKEPP  346

Query  965   IITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRA  1144
             ++TANTVLSILA+DYPVDK+SCY+SDDGAS++ FD LAETAEFAR+WVPFCKK+ IEPRA
Sbjct  347   LVTANTVLSILAMDYPVDKISCYISDDGASIITFDALAETAEFARKWVPFCKKFAIEPRA  406

Query  1145  PEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTP  1324
             PE YF+ K+DYLKDKVQPTFVKERRAMKREYEE+KVR+NA+VA+A K P EGW+M DGTP
Sbjct  407   PEMYFTLKVDYLKDKVQPTFVKERRAMKREYEEFKVRINAIVARASKIPPEGWIMPDGTP  466

Query  1325  WPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVS  1504
             WPGNNTRDHPGMIQV+LG  G  D EG ELP+LVYVSREKRPG+QHHKKAGAMNALVRVS
Sbjct  467   WPGNNTRDHPGMIQVFLGQSGGHDAEGNELPRLVYVSREKRPGFQHHKKAGAMNALVRVS  526

Query  1505  AVLTNAPFMLNLDCDHY  1555
              VLTNAPFMLNLDCDHY
Sbjct  527   GVLTNAPFMLNLDCDHY  543



>gb|AGT16647.1| cellulose synthase [Saccharum hybrid cultivar R570]
Length=1073

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/543 (59%), Positives = 389/543 (72%), Gaps = 44/543 (8%)
 Frame = +2

Query  53    HAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQC  232
             H  D    ++++  ++++C+IC D +G+   G+VFVAC EC FPVC+PCY+YER EGNQC
Sbjct  20    HDGDGAAAKQLKNVNEQICQICGDTVGLSATGDVFVACNECAFPVCRPCYEYERKEGNQC  79

Query  233   CPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNH---PPLSENGDYHNNQL----  391
             CP C TRYKRHKG PRV GD+E+    +   +   T+ +   P     G   +  L    
Sbjct  80    CPQCKTRYKRHKGSPRVRGDEEEDGVDDLDNEFNYTQGNVQGPQWQLRGQGEDVDLSSSS  139

Query  392   ---PHHNTTNSAAFQ------PTAAPGSVGGKD---------------LEDEQKEVFS--  493
                PHH        Q      P A+P     +                + D  K++ S  
Sbjct  140   RHEPHHRIPRLTTGQQMSGDIPDASPDRHSIRSPTPSYVDPSIPVPVRIVDPSKDLDSYG  199

Query  494   --NAEWKDRVEKWKTRQEKRGLVTRF------dddkggadnedddFLMA-DARQPLWRKL  646
               + +WK+RVE WK RQ+K  +            D  G  +  +D  MA DAR PL R +
Sbjct  200   VGSVDWKERVESWKVRQDKNMIQVTHKYPAEGKGDIEGTGSNGEDLQMADDARLPLSRIV  259

Query  647   PISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFP  826
             PIS + ++ YRIVIV RLIILCFFF +RI  P  DA+ LWL+SVICE+WF LSW+LDQFP
Sbjct  260   PISPNELNLYRIVIVLRLIILCFFFQYRITHPVNDAYGLWLVSVICEVWFALSWLLDQFP  319

Query  827   KWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVD  1006
             KW PINRETYLDRL+LR++R  EGE + LAP+DV+VSTVDPLKEPP+ITANTVLSILAVD
Sbjct  320   KWYPINRETYLDRLALRYDR--EGEPSQLAPIDVFVSTVDPLKEPPLITANTVLSILAVD  377

Query  1007  YPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKD  1186
             YPVDKVSCYVSDDG++ML F+ L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKD
Sbjct  378   YPVDKVSCYVSDDGSAMLTFEALSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKD  437

Query  1187  KVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQ  1366
             K+QP+FVKERRAMKREYEE+KVR+NALVAKAQK PEEGW M DGTPWPGNN RDHPGMIQ
Sbjct  438   KIQPSFVKERRAMKREYEEFKVRINALVAKAQKIPEEGWTMADGTPWPGNNPRDHPGMIQ  497

Query  1367  VYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDC  1546
             V+LG  G LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DC
Sbjct  498   VFLGHSGGLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDC  557

Query  1547  DHY  1555
             DHY
Sbjct  558   DHY  560



>ref|XP_004162186.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cucumis sativus]
Length=1070

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/521 (61%), Positives = 378/521 (73%), Gaps = 41/521 (8%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             ++C+IC D +G   +GE FVAC  C FPVC+PCY+YER +GNQ CP C T+YK HKG P 
Sbjct  38    QVCQICSDSVGTTADGEPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTKYKWHKGSPP  97

Query  281   VVGddedhfegedfeqefeTKNHPP---LSENGDYHN----NQLPHHNTTNSAAFQPTAA  439
             V G+  +  +G       E  +  P   LS + +Y      N +P   T  S + + +AA
Sbjct  98    VTGEAVEDGDGNGVGGAQERHHKMPERTLSWDTNYDKEGSFNHIPLLTTGRSVSGELSAA  157

Query  440   P-----------GSVGGKDLEDEQKEV----FSNAEWKDRVEKWKTRQEK----------  544
                         GS     + D+ ++     F N  WK+R++ WK +Q+K          
Sbjct  158   SPERLSMASPESGSRANYRIMDQSRDSGSARFGNVAWKERIDSWKVKQDKSVPPMSVSHA  217

Query  545   ----RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILC  712
                 RG       D       DD  L  +ARQPL RK+ I SS I+PYR+VIV RLIILC
Sbjct  218   PSEGRGGAD---FDASTDVVIDDSLLNDEARQPLSRKVSIPSSRINPYRMVIVLRLIILC  274

Query  713   FFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDG  892
              F H+RI  P  +AF LWLISVICEIWF +SWILDQFPKW P+NRETYLDRL+LR++R  
Sbjct  275   IFLHYRITNPVPNAFALWLISVICEIWFAISWILDQFPKWLPVNRETYLDRLALRYDR--  332

Query  893   EGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDT  1072
             EGE + LA VD++VSTVDPLKEPP++TANTVLSIL+VDYPVDKVSCYVSDDGA+ML F+ 
Sbjct  333   EGEPSQLAAVDIFVSTVDPLKEPPLVTANTVLSILSVDYPVDKVSCYVSDDGAAMLTFEA  392

Query  1073  LAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKV  1252
             L+ET+EFAR+WVPFCKKY IEPRAPE+YF++KIDYLKDKVQP+FVKERRAMKREYEE+K+
Sbjct  393   LSETSEFARKWVPFCKKYSIEPRAPEWYFAQKIDYLKDKVQPSFVKERRAMKREYEEFKI  452

Query  1253  RVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYV  1432
             RVN LVAKAQK P+EGWVMQDGTPWPGNNTRDHPGMIQV+LG  G LD +G ELP+LVYV
Sbjct  453   RVNGLVAKAQKIPDEGWVMQDGTPWPGNNTRDHPGMIQVFLGHSGGLDTDGNELPRLVYV  512

Query  1433  SREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             SREKRPG+QHHKKAGAMNALVRVSAVLTN PF+LNLDCDHY
Sbjct  513   SREKRPGFQHHKKAGAMNALVRVSAVLTNGPFLLNLDCDHY  553



>tpg|DAA59988.1| TPA: putative cellulose synthase family protein [Zea mays]
Length=788

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/564 (56%), Positives = 385/564 (68%), Gaps = 67/564 (12%)
 Frame = +2

Query  59    ADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCP  238
              D D  +   R   ++C+IC D +G    G+VF AC  CGFPVC+PCY+YER +G Q CP
Sbjct  3     GDADGVKSGRRGGGQVCQICGDGVGTTAEGDVFAACDVCGFPVCRPCYEYERKDGTQACP  62

Query  239   HCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHP----------------------  352
              C T+YKRHKG P + G++ D  + +       + N                        
Sbjct  63    QCKTKYKRHKGSPAIRGEEGDDTDADSDFNYPASGNEDQKQKIADRMRSWRMNAGGSGDV  122

Query  353   --PLSENGD-----YHNNQLPHH---NTTNS--AAFQPTAAP--------GSVGGK----  460
               P  ++G+     Y + ++P     + TNS  +   P A+P        G++G +    
Sbjct  123   GRPKYDSGEIGLTKYDSGEIPRGYIPSVTNSQISGEIPGASPDHHMMSPTGNIGKRAPFP  182

Query  461   ------DLEDEQKEVFSNAEWKDRVEKWKTRQEKRGL-------VTRFdddkggadnedd  601
                   +   E      N  WK+RV+ WK +Q+K  +       +   +    G  +   
Sbjct  183   YVNHSPNPSREFSGSIGNVAWKERVDGWKMKQDKGTIPMTNGTSIAPSEGRGVGDIDAST  242

Query  602   dFLMADA------RQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPL  763
             D+ M DA      RQPL RK+P+ SS I+PYR+VIV RLI+L  F H+RI  P  +A+PL
Sbjct  243   DYNMEDALLNDETRQPLSRKVPLPSSRINPYRMVIVLRLIVLSIFLHYRITNPVRNAYPL  302

Query  764   WLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTV  943
             WL+SVICEIWF LSWILDQFPKW PINRETYLDRL+LR++R  EGE + LA VD++VSTV
Sbjct  303   WLLSVICEIWFALSWILDQFPKWFPINRETYLDRLALRYDR--EGEPSQLAAVDIFVSTV  360

Query  944   DPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKK  1123
             DP+KEPP++TANTVLSILAVDYPVDKVSCYVSDDGA+ML FD LAET+EFAR+WVPF KK
Sbjct  361   DPMKEPPLVTANTVLSILAVDYPVDKVSCYVSDDGAAMLTFDALAETSEFARKWVPFVKK  420

Query  1124  YCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGW  1303
             Y IEPRAPE+YFS+KIDYLKDKV P+FVK+RRAMKREYEE+KVRVN LVAKAQK PEEGW
Sbjct  421   YNIEPRAPEWYFSQKIDYLKDKVHPSFVKDRRAMKREYEEFKVRVNGLVAKAQKVPEEGW  480

Query  1304  VMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAM  1483
             +MQDGTPWPGNNTRDHPGMIQV+LG  G LD EG ELP+LVYVSREKRPG+QHHKKAGAM
Sbjct  481   IMQDGTPWPGNNTRDHPGMIQVFLGHSGGLDTEGNELPRLVYVSREKRPGFQHHKKAGAM  540

Query  1484  NALVRVSAVLTNAPFMLNLDCDHY  1555
             NALVRVSAVLTN  +MLNLDCDHY
Sbjct  541   NALVRVSAVLTNGQYMLNLDCDHY  564



>ref|XP_010250039.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Nelumbo nucifera]
Length=1085

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/536 (58%), Positives = 384/536 (72%), Gaps = 53/536 (10%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             ++C+IC D +GV   G+VFVAC EC FPVC+PCY+YER +GNQ CP C TRYKRHKG PR
Sbjct  37    QVCQICGDTVGVTATGDVFVACNECAFPVCRPCYEYERRDGNQSCPQCKTRYKRHKGSPR  96

Query  281   VV-------------------GddedhfegedfeqefeTKNH------PPLSENGDYHNN  385
             V                    G+ +   + +  + +  + N        PL  NG   + 
Sbjct  97    VEGDDEEDDVDDLDNEFNYSHGNGKGMRQWQGDDVDLSSSNRHESQRPIPLLTNGQPVSG  156

Query  386   QLPHHNTTNSAAFQPTAAPGSVGGKDLE----------------DEQKEV----FSNAEW  505
             ++P+    + +    T+ P   G K +                 D  K++      N +W
Sbjct  157   EMPNATPDDQSVRTTTSGPLGSGEKRVHSLPYIDPSQPVPVRIVDPSKDLNTYGLGNVDW  216

Query  506   KDRVEKWKTRQEKR--GLVTRFdddkggadnedddF----LMADARQPLWRKLPISSSLI  667
             K+RVE WK +QEK    + +R+ + KG  +    +     +  DARQPL R +PISSS +
Sbjct  217   KERVEGWKLKQEKNMMQMTSRYTEGKGDVEGTGSNGEDLQIADDARQPLHRTVPISSSHL  276

Query  668   SPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINR  847
             +PYR+VI+ RLIIL FF  +R+  P  DA+PLWL SVICEIWF LSW+LDQFPKW PINR
Sbjct  277   TPYRVVIILRLIILGFFLQYRVSHPVRDAYPLWLTSVICEIWFALSWLLDQFPKWYPINR  336

Query  848   ETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVS  1027
             ETYLDRL+LR++R  EGE + L P+D++VSTVDPLKEPP+ITANTVLSILAVDYPVDKVS
Sbjct  337   ETYLDRLALRYDR--EGEPSQLPPIDIFVSTVDPLKEPPLITANTVLSILAVDYPVDKVS  394

Query  1028  CYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFV  1207
             CYVSDDG++ML F+ L+ET+EFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK+QP+FV
Sbjct  395   CYVSDDGSAMLTFEALSETSEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKDKIQPSFV  454

Query  1208  KERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEG  1387
             KERRAMKREYEE+KVR+NALVAKAQK PEEGW MQDGTPWPGNN RDHPGMIQV+LG  G
Sbjct  455   KERRAMKREYEEFKVRINALVAKAQKMPEEGWTMQDGTPWPGNNPRDHPGMIQVFLGHSG  514

Query  1388  ALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
              LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  515   GLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  570



>ref|XP_009355721.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Pyrus x bretschneideri]
 ref|XP_009348606.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Pyrus x bretschneideri]
Length=1072

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/530 (60%), Positives = 390/530 (74%), Gaps = 39/530 (7%)
 Frame = +2

Query  77    REVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRY  256
             + V+  + ++C+IC D +G+   G+VFVAC EC FPVC+PCY+YER +GNQ CP C TRY
Sbjct  29    KPVKNLNGQICQICGDTVGLTATGDVFVACNECAFPVCRPCYEYERKDGNQACPQCKTRY  88

Query  257   KRHKGCPRVVGddedhfegedfeqefeTKNHPPL-----SENGDY-----HNNQLPHHNT  406
             KRHKG PRV GDD++    +   +    +           E+ D      H +Q P    
Sbjct  89    KRHKGSPRVDGDDDEDDIDDLENEFNYAQGTSNARRQWQGEDADLSSSSRHESQQPIPLL  148

Query  407   TNSAAFQ---PTAAPG------SVGGKD--------LEDEQKEVFS----NAEWKDRVEK  523
             TN  +     P A P       + G  D        + D  K++ S    N +WK+RVE 
Sbjct  149   TNGQSVSGEIPCATPDNQSVRTTSGPLDPRQPVPVRIVDPSKDLNSYGLGNVDWKERVEG  208

Query  524   WKTRQEKR--GLVTRFdddkggadneddd---FLMAD-ARQPLWRKLPISSSLISPYRIV  685
             WK +Q+K    + +++ + KG  +    +     MAD ARQPL R +PISSS ++PYR+V
Sbjct  209   WKLKQDKNMMQMTSKYAEGKGDMEGTGSNGEELQMADDARQPLSRIVPISSSHLTPYRVV  268

Query  686   IVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDR  865
             I+ RLIIL FF  +R   P  DA+PLWL SVICEIWF LSW+LDQFPKW PINRETYLDR
Sbjct  269   IILRLIILGFFLQYRATHPVKDAYPLWLTSVICEIWFALSWLLDQFPKWFPINRETYLDR  328

Query  866   LSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDD  1045
             L+LR++RDGE  +  LAP+DV+VSTVDP+KEPP+ITANTVLSILAVDYPVDKVSCYVSDD
Sbjct  329   LTLRYDRDGEPSQ--LAPIDVFVSTVDPMKEPPLITANTVLSILAVDYPVDKVSCYVSDD  386

Query  1046  GASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAM  1225
             G++ML F++L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK+QP+FVKERRAM
Sbjct  387   GSAMLTFESLSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKDKIQPSFVKERRAM  446

Query  1226  KREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEG  1405
             KREYEE+KVR+NALVAKAQK PEEGW MQDGTPWPGNN RDHPGMIQV+LG  G LD +G
Sbjct  447   KREYEEFKVRINALVAKAQKMPEEGWTMQDGTPWPGNNPRDHPGMIQVFLGHSGGLDTDG  506

Query  1406  KELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
              ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  507   NELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  556



>ref|XP_006343620.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Solanum tuberosum]
Length=1041

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/556 (58%), Positives = 384/556 (69%), Gaps = 60/556 (11%)
 Frame = +2

Query  23    AALFTGGSH-------LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGF  181
              A    GSH       +H   H+E + ++  S ++C IC DEIG+  +G++FVAC ECGF
Sbjct  4     GAGLVAGSHNRNELVVIHG--HEEHKPLKDLSGQVCDICGDEIGLTVDGDLFVACNECGF  61

Query  182   PVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefe--------  337
             PVC+PCY+YER EG Q CP C TRYKR KG PRV GD+++    +   +           
Sbjct  62    PVCRPCYEYERREGTQQCPQCKTRYKRLKGSPRVAGDEDEEDIDDIEHEFKVDDEQNKNR  121

Query  338   ---------------------TKNHPPLSENGDYH--NNQLPHHNTTNSAAFQPTAA---  439
                                  +  +PP+      H  + + P  N  N      ++    
Sbjct  122   NIVETILHGKMTYGRGPEDEDSAQYPPVIAGTRSHPVSGEFPISNHGNGEQTLGSSLHKR  181

Query  440   ----PGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadnedddF  607
                 P S  G    D++KE      WK+R+E WK +Q   G              + D  
Sbjct  182   IHPYPASESGSARWDDKKE----GGWKERMEDWKLQQGHVG-------QDYDDSADVDMS  230

Query  608   LMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICE  787
             ++ +ARQPL RK+PI+SS I+PYR+VIV RL+IL  F  +RIL P +DA  LWL S+ICE
Sbjct  231   MVDEARQPLSRKVPIASSKINPYRMVIVARLVILAIFLRYRILNPVHDAIGLWLTSIICE  290

Query  788   IWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPI  967
             IWF  SWILDQFPKW PI+RETYLDRLSLR+ER  EGE N LAPVDV+VSTVDP+KEPP+
Sbjct  291   IWFAFSWILDQFPKWFPIDRETYLDRLSLRYER--EGEPNMLAPVDVFVSTVDPMKEPPL  348

Query  968   ITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAP  1147
             +TANT+LSILA+DYP+DK+SCY+SDDGASM  F+ L+ETAEFAR+WVPFCKK+ IEPRAP
Sbjct  349   VTANTILSILAMDYPIDKISCYLSDDGASMCTFEALSETAEFARKWVPFCKKFAIEPRAP  408

Query  1148  EFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPW  1327
             EFYFS KIDYLKDKVQPTFVKERRAMKREYEE+KVRVNALVAKA K P  GW+MQDGTPW
Sbjct  409   EFYFSLKIDYLKDKVQPTFVKERRAMKREYEEFKVRVNALVAKATKMPPGGWIMQDGTPW  468

Query  1328  PGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSA  1507
             PGNNTRDHPGMIQV+LG  G  DV+G ELP+LVYVSREKRPG+QHHKKAGAMNALVRV+ 
Sbjct  469   PGNNTRDHPGMIQVFLGQSGGTDVDGHELPRLVYVSREKRPGFQHHKKAGAMNALVRVAG  528

Query  1508  VLTNAPFMLNLDCDHY  1555
             VLTNAPFMLNLDCDHY
Sbjct  529   VLTNAPFMLNLDCDHY  544



>ref|XP_009407580.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009407588.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] isoform X1 [Musa acuminata subsp. malaccensis]
Length=1066

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/550 (57%), Positives = 387/550 (70%), Gaps = 54/550 (10%)
 Frame = +2

Query  59    ADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCP  238
              D ++ + V+    ++C+IC D +G   +G++FVAC  CGFPVC+PCY+YER +GNQ CP
Sbjct  3     VDGEKGKPVKHSGGQVCQICGDSVGTTVDGDLFVACDVCGFPVCRPCYEYERKDGNQSCP  62

Query  239   HCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNH-----------------------  349
              C T+YKRHKG P V  ++ D  + +D        +H                       
Sbjct  63    QCKTKYKRHKGSPPVRQEEGDDGDADDVSDFNYPTSHQDQKPKIAERMLGWHMGHEQGED  122

Query  350   --PPLSENGDYHNNQLPHHNTTNSAAFQ-PTAAPGSV-----GGKDLE-------DEQKE  484
                P  ++G+   N +P    +   + + P ++P  +     GGK +        +  +E
Sbjct  123   VGAPKYDSGEIPRNHIPLLTHSQGLSGELPMSSPDHMMSPGGGGKRVHPLPYRSPNSSRE  182

Query  485   VFSNAEWKDRVEKWKTRQEKRGLVTRFddd-------------kggadnedddFLMADAR  625
              F N  WK+RV+ WK +QEK  +                         N DD  L  +AR
Sbjct  183   -FGNVAWKERVDGWKMKQEKNVVPMTNGTSHAPSEGRGGGDIDATTDYNMDDALLNDEAR  241

Query  626   QPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLS  805
             QPL RK+ + SS I+PYR+VIV RL+ILC F H+RI  P  +A PLWL+SVICEIWF +S
Sbjct  242   QPLSRKVSVPSSRINPYRMVIVLRLVILCIFLHYRITNPVTNAIPLWLLSVICEIWFAIS  301

Query  806   WILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTV  985
             WILDQFPKW P+NRETYLDRLS+R++R  EGE + LA VD++VSTVDPLKEPP++TANTV
Sbjct  302   WILDQFPKWFPVNRETYLDRLSIRYDR--EGEPSELAAVDIFVSTVDPLKEPPLVTANTV  359

Query  986   LSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSE  1165
             LSILAVDYPVDKVSCYVSDDGA+ML F+ LAET+EFAR+WVPFCKKY IEPRAPE+YFS+
Sbjct  360   LSILAVDYPVDKVSCYVSDDGAAMLTFEALAETSEFARKWVPFCKKYIIEPRAPEWYFSQ  419

Query  1166  KIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTR  1345
             KIDYLKDKVQP+FVK+RRAMKREYEE+KVR+N LVAKAQK P+EGW+MQDGTPWPGNNTR
Sbjct  420   KIDYLKDKVQPSFVKDRRAMKREYEEFKVRINGLVAKAQKVPDEGWIMQDGTPWPGNNTR  479

Query  1346  DHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAP  1525
             DHPGMIQV+LG  G LD EG ELP+LVYVSREKRPG+QHHKKAGAMNALVRVSAVLTN P
Sbjct  480   DHPGMIQVFLGHSGGLDTEGNELPRLVYVSREKRPGFQHHKKAGAMNALVRVSAVLTNGP  539

Query  1526  FMLNLDCDHY  1555
             FMLNLDCDHY
Sbjct  540   FMLNLDCDHY  549



>gb|ACR38558.1| unknown [Zea mays]
Length=572

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/540 (57%), Positives = 376/540 (70%), Gaps = 51/540 (9%)
 Frame = +2

Query  77    REVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRY  256
             + +++ + ++C+IC D++G   +GE FVAC EC FP+C+ CY+YER EG Q CP C TR+
Sbjct  29    KPMDQRNGQVCQICGDDVGRNPDGEPFVACNECAFPICRDCYEYERREGTQNCPQCKTRF  88

Query  257   KRHKGCPRVVGddedhfegedfeqefeTKNHPP--LSEN-----------GDYHNNQLPH  397
             KR KGC RV GD+E+    +   +   +  H    L+E+            D      P 
Sbjct  89    KRLKGCARVPGDEEEDGVDDLENEFNWSDKHDSQYLAESMLHAHMSYGRGADLDGVPQPF  148

Query  398   HNTTNSAAF------------QPTAAPGSVGGKDLE------------------DEQKEV  487
             H   N                Q    P  VGG                      D  K++
Sbjct  149   HPIPNVPLLTNGQMVDDIPPDQHALVPSFVGGGGKRIHPLPYADPNLPVQPRSMDPSKDL  208

Query  488   ----FSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPIS  655
                 + +  WK+R+E WK +QE+            G D +    LM +ARQPL RK+P+ 
Sbjct  209   AAYGYGSVAWKERMESWKQKQERMHQTRNDGGGDDGDDADLP--LMDEARQPLSRKIPLP  266

Query  656   SSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWS  835
             SS I+PYR++I+ RL++LCFFFH+R++ P  DAF LWLISVICEIWF +SWILDQFPKW 
Sbjct  267   SSQINPYRMIIIIRLVVLCFFFHYRVMHPVPDAFALWLISVICEIWFAMSWILDQFPKWF  326

Query  836   PINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPV  1015
             PI RETYLDRLSLRF  D EG  + LAPVD +VSTVDPLKEPP++TANTVLSIL+VDYPV
Sbjct  327   PIERETYLDRLSLRF--DKEGHPSQLAPVDFFVSTVDPLKEPPLVTANTVLSILSVDYPV  384

Query  1016  DKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQ  1195
             DKVSCYVSDDGA+ML F+ L+ET+EFA++WVPFCK+Y +EPRAPE+YF +KIDYLKDKV 
Sbjct  385   DKVSCYVSDDGAAMLTFEALSETSEFAKKWVPFCKRYSLEPRAPEWYFQQKIDYLKDKVA  444

Query  1196  PTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYL  1375
             P FV+ERRAMKREYEE+KVR+NALVAKAQK PEEGW MQDGTPWPGNN RDHPGMIQV+L
Sbjct  445   PNFVRERRAMKREYEEFKVRINALVAKAQKVPEEGWTMQDGTPWPGNNVRDHPGMIQVFL  504

Query  1376  GSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             G  G  DVEG ELP+LVYVSREKRPGY HHKKAGAMNALVRVSAVLTNAP++LNLDCDHY
Sbjct  505   GQSGGHDVEGNELPRLVYVSREKRPGYNHHKKAGAMNALVRVSAVLTNAPYLLNLDCDHY  564



>ref|XP_001767133.1| cellulose synthase 4, glycosyltransferase family 2 [Physcomitrella 
patens]
 gb|ABI78957.1| cellulose synthase 4 [Physcomitrella patens]
 gb|EDQ68054.1| cellulose synthase 4, glycosyltransferase family 2 [Physcomitrella 
patens]
Length=1099

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/555 (57%), Positives = 379/555 (68%), Gaps = 59/555 (11%)
 Frame = +2

Query  62    DHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPH  241
             + D  + +   +  +C+IC D++G+   GE+FVAC ECGFPVC+PCY+YER +G Q CP 
Sbjct  23    EGDGPKPLSYVNSHICQICGDDVGLTVEGEMFVACNECGFPVCRPCYEYERKDGTQACPQ  82

Query  242   CNTRYKRHKGCPRVVGd---------------------------------dedhfegedf  322
             C TRY+RHKG PRV GD                                  +  +  +  
Sbjct  83    CRTRYRRHKGSPRVKGDDEEEDTDDLDNEFNHAVNLDNHDKQQVVDEMLHSQMAYGRDTE  142

Query  323   eqefeTKNHPPLSENGDYHNNQLPHHNTTNS----AAFQPTAAPGS--VGGKDLEDEQKE  484
                  T+   PL  +G  H   +   +   S    A F      GS  V   D+    + 
Sbjct  143   VMLSATQPRYPLLTDGHRHMVSVTSESNATSPDHQAIFHVAGGKGSHTVSYSDIGSPARS  202

Query  485   V----------FSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadnedddF--------L  610
             +          + +  WK+RVE WK RQ  +   T     +      DD          +
Sbjct  203   LDPAKDLGSYGYGSIAWKERVESWKLRQGMQMTTTAGGQLQANGKGGDDGSHQDCSDLPI  262

Query  611   MADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEI  790
             M ++RQPL RK+P  SS I+PYR++IV RL+++C FF +RIL P  +A+ LWL+SVICEI
Sbjct  263   MDESRQPLSRKVPFPSSKINPYRMIIVIRLVVICLFFRYRILNPVNEAYGLWLVSVICEI  322

Query  791   WFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPII  970
             WFG+SWILDQFPKW PINRETYLDRLSLRFE+  EGE + LAPVD+YVSTVDP+KEPP++
Sbjct  323   WFGISWILDQFPKWLPINRETYLDRLSLRFEK--EGEPSQLAPVDIYVSTVDPMKEPPLV  380

Query  971   TANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPE  1150
             TANTVLSILAVDYPVDKVSCY+SDDGASML F+ L+ET+EFAR+WVPFCKK+ IEPRAPE
Sbjct  381   TANTVLSILAVDYPVDKVSCYISDDGASMLTFEVLSETSEFARKWVPFCKKFNIEPRAPE  440

Query  1151  FYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWP  1330
              YF+ KIDYLKDKVQPTFVKERRAMKREYEE+KVRVNALVAKAQK P+EGW MQDGTPWP
Sbjct  441   VYFALKIDYLKDKVQPTFVKERRAMKREYEEFKVRVNALVAKAQKMPDEGWTMQDGTPWP  500

Query  1331  GNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAV  1510
             GNNTRDHPGMIQV+LG  G  D EG ELP+LVYVSREKRPG+ HHKKAGAMNALVRVSAV
Sbjct  501   GNNTRDHPGMIQVFLGHSGGHDTEGNELPRLVYVSREKRPGFNHHKKAGAMNALVRVSAV  560

Query  1511  LTNAPFMLNLDCDHY  1555
             LTNAPF LNLDCDHY
Sbjct  561   LTNAPFFLNLDCDHY  575



>ref|XP_009386450.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] [Musa acuminata subsp. malaccensis]
 ref|XP_009386451.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] [Musa acuminata subsp. malaccensis]
Length=1066

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/554 (58%), Positives = 393/554 (71%), Gaps = 62/554 (11%)
 Frame = +2

Query  59    ADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCP  238
              D ++R+  +    ++C+IC D +G   +G++FVAC  CGFPVC+PCY+YER +GNQ CP
Sbjct  3     VDGEKRKPGKHSGGQVCQICGDGVGTTVDGDIFVACDVCGFPVCRPCYEYERKDGNQSCP  62

Query  239   HCNTRYKRHKGCPRV-VGddedhfegedfeqefeTKNH----------------------  349
              C T+YKRH+G P V   + +D    +  +  + T N                       
Sbjct  63    QCKTKYKRHRGSPPVRGEEGDDGDADDVSDFNYPTGNQDQKPKITERMLGWHMSHEQGED  122

Query  350   --PPLSENGDYHNNQLP--HHNTTNSAAFQPTA-----APGSVGGKDLE-------DEQK  481
               PP  ++G    N +P   H+   S     T+     +PG  GGK +        +  +
Sbjct  123   IGPPKYDSGGIPRNHIPLLTHSQGLSGELPMTSPDHMMSPGG-GGKRVHPLPFRSPNTSR  181

Query  482   EVFSNAEWKDRVEKWKTRQEK----------------RGLVTRFdddkggadnedddFLM  613
             E F+N  WK+RV+ WK +QEK                RG     D D     N DD  L 
Sbjct  182   E-FANVAWKERVDGWKMKQEKNVAPMTNGTSHAPSEGRG---GGDIDATTDYNMDDALLN  237

Query  614   ADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIW  793
              +ARQPL RK+PISSS I+PYR+VIV RL+ILC F H+RI  P ++A+ LWL+SVICEIW
Sbjct  238   DEARQPLSRKVPISSSRINPYRMVIVLRLVILCIFLHYRITNPVHNAYALWLLSVICEIW  297

Query  794   FGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIIT  973
             F +SWILDQFPKW P+NRETYLDRL++R++R  EGE + LA VD++VSTVDPLKEPP++T
Sbjct  298   FAISWILDQFPKWFPVNRETYLDRLAIRYDR--EGEPSELAAVDIFVSTVDPLKEPPLVT  355

Query  974   ANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEF  1153
             ANTVLSILAVDYPVDKVSCYVSDDGA+ML F+ L+ET+EFAR+WVPFCKKY IEPRAPE+
Sbjct  356   ANTVLSILAVDYPVDKVSCYVSDDGAAMLTFEALSETSEFARKWVPFCKKYSIEPRAPEW  415

Query  1154  YFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPG  1333
             YFS+KIDYLKDKVQPTFVK+RRAMKREYEE+K+ +N LVAKAQK P+EGW+MQDGTPWPG
Sbjct  416   YFSQKIDYLKDKVQPTFVKDRRAMKREYEEFKICINGLVAKAQKVPDEGWIMQDGTPWPG  475

Query  1334  NNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVL  1513
             NNTRDHPGMIQV+LG  G LD EG ELP+LVYVSREKRPG+QHHKKAGAMNALVRVSAVL
Sbjct  476   NNTRDHPGMIQVFLGHSGGLDTEGNELPRLVYVSREKRPGFQHHKKAGAMNALVRVSAVL  535

Query  1514  TNAPFMLNLDCDHY  1555
             TN PFMLNLDCDHY
Sbjct  536   TNGPFMLNLDCDHY  549



>ref|XP_008460760.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cucumis melo]
Length=1050

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/521 (60%), Positives = 378/521 (73%), Gaps = 41/521 (8%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             ++C+IC D +G   +GE FVAC  C FPVC+PCY+YER +GNQ CP C T+YK HKG P 
Sbjct  18    QVCQICSDSVGTTADGEPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTKYKWHKGSPP  77

Query  281   VVGddedhfegedfeqefeTKNHPP---LSENGDYHN----NQLPHHNTTNSAAFQPTAA  439
             V G+  +  +G       E  +  P   LS + +Y      N +P   T  S + + +AA
Sbjct  78    VNGEAVEDGDGNGVGGAQERHHKMPERTLSWDTNYDKEGSFNHIPLLTTGRSVSGELSAA  137

Query  440   P-----------GSVGGKDLEDEQKEV----FSNAEWKDRVEKWKTRQEK----------  544
                         GS     + D+ ++     F N  WK+R++ WK +Q+K          
Sbjct  138   SPERLSMASPESGSRANYRIMDQSRDSGSARFGNVAWKERIDSWKVKQDKSVPPMSVSHA  197

Query  545   ----RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILC  712
                 RG       D       DD  L  +ARQPL RK+ I SS I+PYR+VIV RLIILC
Sbjct  198   PSEGRGGAD---FDASTDVVIDDSLLNDEARQPLSRKVSIPSSRINPYRMVIVLRLIILC  254

Query  713   FFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDG  892
              F H+RI  P  +AF LWLISVICEIWF +SWILDQFPKW P+NRETYLDRL+LR++R  
Sbjct  255   IFLHYRITNPVPNAFALWLISVICEIWFAISWILDQFPKWLPVNRETYLDRLALRYDR--  312

Query  893   EGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDT  1072
             EGE + LA VD++VSTVDPLKEPP++TANTVLSIL+VDYPVDKVSCYVSDDGA+ML F+ 
Sbjct  313   EGEPSQLAAVDIFVSTVDPLKEPPLVTANTVLSILSVDYPVDKVSCYVSDDGAAMLTFEA  372

Query  1073  LAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKV  1252
             L+ET+EFAR+WVPFCKKY IEPRAPE+YF++KIDYLKDKVQP+FVKERRAMKREYEE+K+
Sbjct  373   LSETSEFARKWVPFCKKYSIEPRAPEWYFAQKIDYLKDKVQPSFVKERRAMKREYEEFKI  432

Query  1253  RVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYV  1432
             R+N LVAKAQK P+EGWVMQDGTPWPGNNTRDHPGMIQV+LG  G LD +G ELP+LVYV
Sbjct  433   RINGLVAKAQKVPDEGWVMQDGTPWPGNNTRDHPGMIQVFLGHSGGLDTDGNELPRLVYV  492

Query  1433  SREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             SREKRPG+QHHKKAGAMNALVRVSAVLTN PF+LNLDCDHY
Sbjct  493   SREKRPGFQHHKKAGAMNALVRVSAVLTNGPFLLNLDCDHY  533



>ref|XP_009785781.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Nicotiana sylvestris]
Length=1085

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/569 (56%), Positives = 400/569 (70%), Gaps = 61/569 (11%)
 Frame = +2

Query  23    AALFTGGSH----LHAADHDER---REVERESQKMCRICRDEIGVVENGEVFVACRECGF  181
             +A    GSH    L    HD     + ++  + ++C+IC D +G+   G+VFVAC EC F
Sbjct  4     SAGMVAGSHKRNELVRIRHDSDSGPKPIKPLNSQICQICGDTVGLNAIGDVFVACNECAF  63

Query  182   PVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKN-----  346
             PVC+ CY+YER +GNQ CP C TRYKRHKGCPRV GDD++    +   +    +      
Sbjct  64    PVCRSCYEYERKDGNQSCPQCKTRYKRHKGCPRVDGDDDEDDVDDIDNEFNYAQGNSKAR  123

Query  347   -------------------HP-PLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKD-  463
                                HP PL  NG   + ++P   T ++ + +  + P   G K  
Sbjct  124   RQWQGEDVSLSSSSRHDPQHPIPLLTNGQSVSGEIPSA-TPDTQSVRSMSGPLGPGDKQA  182

Query  464   --------------LEDEQKEV----FSNAEWKDRVEKWKTRQEK-------RGLVTRFd  568
                           + D  K++      + +WK+RVE WK +QEK       R    +  
Sbjct  183   SLPYVDPRLPVPVRIVDPSKDLNSYGLGSVDWKERVEGWKIKQEKNMTHMNHRYTEGKGG  242

Query  569   ddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAY  748
             D +G   N ++  +  DARQPL R +PI SS ++PYR+VI+ RLIIL FF  +R+  P  
Sbjct  243   DIEGTGSNGEELQMADDARQPLSRVVPIPSSHLTPYRVVIILRLIILGFFMQYRLTHPVN  302

Query  749   DAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDV  928
             DA+PLWL+SVICE+WF LSW+LDQFPKWSPINRETYLDRL+LR++R  EGE + L P+DV
Sbjct  303   DAYPLWLVSVICEVWFALSWLLDQFPKWSPINRETYLDRLALRYDR--EGEPSQLVPIDV  360

Query  929   YVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWV  1108
             +VSTVDP+KEPP+ITANTVLSILAVDYPVDKVSCYVSDDG++ML F+ L+ETAEFAR+WV
Sbjct  361   FVSTVDPMKEPPLITANTVLSILAVDYPVDKVSCYVSDDGSAMLTFEALSETAEFARKWV  420

Query  1109  PFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKK  1288
             PFCKK+ IEPRAPEFYF++KIDYLKDK+QP+FVKERRAMKREYEE+K+R+NALVAKAQK 
Sbjct  421   PFCKKFNIEPRAPEFYFAQKIDYLKDKIQPSFVKERRAMKREYEEFKIRINALVAKAQKM  480

Query  1289  PEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHK  1468
             PEEGW MQDGTPWPGNN+RDHPGMIQV+LG  G LD++G ELP+LVYVSREKRPG+QHHK
Sbjct  481   PEEGWTMQDGTPWPGNNSRDHPGMIQVFLGHSGGLDIDGNELPRLVYVSREKRPGFQHHK  540

Query  1469  KAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             KAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  541   KAGAMNALIRVSAVLTNGAYILNVDCDHY  569



>ref|XP_011079380.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X1 [Sesamum indicum]
Length=1037

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/553 (57%), Positives = 382/553 (69%), Gaps = 58/553 (10%)
 Frame = +2

Query  23    AALFTGGSH-------LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGF  181
             +A    GSH       +H   H+E + ++  + ++C IC DEIG+  +GE+FVAC ECGF
Sbjct  4     SAGLVAGSHNRNELVVIHG--HEEPKPLKNLTGQVCEICGDEIGLTVDGELFVACNECGF  61

Query  182   PVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVG------------------------  289
             PVC+PCY+YER EGNQ CP C TRYKR KG PRV G                        
Sbjct  62    PVCRPCYEYERREGNQQCPQCKTRYKRLKGSPRVEGDDDEEDIDDIEHEFNINEQKSNTT  121

Query  290   ---ddedhfegedfeqefeTKNHPPLSENGDYH--NNQLP------HHNTTNSAAFQPTA  436
                             E +T  +PP+   G     + +LP         ++      P  
Sbjct  122   IAEAMLHGKMSYGRGPEDDTAQYPPVIAGGRSRPVSGELPISYGEQMMGSSLHKRVHPYP  181

Query  437   APGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadnedddFLMA  616
             AP   G    +D+     +   WK+R++ WK +Q   G        +     + D  ++ 
Sbjct  182   APDDTGSTRWDDK-----TEMGWKERMDDWKMQQGNLG-------HEPDDSADPDVAIVD  229

Query  617   DARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWF  796
             +ARQPL RK+PI+SS I+PYR+VIV RL++L FF  +RIL P +DA  LWL SVICEIWF
Sbjct  230   EARQPLSRKVPIASSKINPYRMVIVTRLVVLAFFLRYRILNPVHDALGLWLTSVICEIWF  289

Query  797   GLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITA  976
               SWILDQFPKW PI+RETYLDRLSLR+ER  EGE N L PVD++VSTVDP+KEPP++TA
Sbjct  290   AFSWILDQFPKWFPIDRETYLDRLSLRYER--EGEPNMLTPVDIFVSTVDPMKEPPLVTA  347

Query  977   NTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFY  1156
             NTVLSILA+DYPVDK+SCY+SDDGASM  F+ L+ETAEFAR+WVPFCKK+ IEPRAPE Y
Sbjct  348   NTVLSILAMDYPVDKISCYISDDGASMCTFEALSETAEFARKWVPFCKKFSIEPRAPEMY  407

Query  1157  FSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGN  1336
             F EK+DYLKDKVQPTFVKERRAMKREYEE+KVR+NA+VAKA K P  GW+MQDGTPWPGN
Sbjct  408   FFEKVDYLKDKVQPTFVKERRAMKREYEEFKVRINAMVAKAAKIPPGGWIMQDGTPWPGN  467

Query  1337  NTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLT  1516
             NT+DHPGMIQV+LG  G LDV+G ELP+LVYVSREKRPG+QHHKKAGAMNALVRVS VLT
Sbjct  468   NTKDHPGMIQVFLGHSGGLDVKGHELPRLVYVSREKRPGFQHHKKAGAMNALVRVSGVLT  527

Query  1517  NAPFMLNLDCDHY  1555
             NAPFMLNLDCDHY
Sbjct  528   NAPFMLNLDCDHY  540



>ref|XP_009407595.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] isoform X2 [Musa acuminata subsp. malaccensis]
Length=1065

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/546 (58%), Positives = 385/546 (71%), Gaps = 54/546 (10%)
 Frame = +2

Query  71    ERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNT  250
             E+  V+    ++C+IC D +G   +G++FVAC  CGFPVC+PCY+YER +GNQ CP C T
Sbjct  6     EKGPVKHSGGQVCQICGDSVGTTVDGDLFVACDVCGFPVCRPCYEYERKDGNQSCPQCKT  65

Query  251   RYKRHKGCPRVVGddedhfegedfeqefeTKNH-------------------------PP  355
             +YKRHKG P V  ++ D  + +D        +H                          P
Sbjct  66    KYKRHKGSPPVRQEEGDDGDADDVSDFNYPTSHQDQKPKIAERMLGWHMGHEQGEDVGAP  125

Query  356   LSENGDYHNNQLPHHNTTNSAAFQ-PTAAPGSV-----GGKDLE-------DEQKEVFSN  496
               ++G+   N +P    +   + + P ++P  +     GGK +        +  +E F N
Sbjct  126   KYDSGEIPRNHIPLLTHSQGLSGELPMSSPDHMMSPGGGGKRVHPLPYRSPNSSRE-FGN  184

Query  497   AEWKDRVEKWKTRQEKRGLVTRFddd-------------kggadnedddFLMADARQPLW  637
               WK+RV+ WK +QEK  +                         N DD  L  +ARQPL 
Sbjct  185   VAWKERVDGWKMKQEKNVVPMTNGTSHAPSEGRGGGDIDATTDYNMDDALLNDEARQPLS  244

Query  638   RKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILD  817
             RK+ + SS I+PYR+VIV RL+ILC F H+RI  P  +A PLWL+SVICEIWF +SWILD
Sbjct  245   RKVSVPSSRINPYRMVIVLRLVILCIFLHYRITNPVTNAIPLWLLSVICEIWFAISWILD  304

Query  818   QFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSIL  997
             QFPKW P+NRETYLDRLS+R++R  EGE + LA VD++VSTVDPLKEPP++TANTVLSIL
Sbjct  305   QFPKWFPVNRETYLDRLSIRYDR--EGEPSELAAVDIFVSTVDPLKEPPLVTANTVLSIL  362

Query  998   AVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDY  1177
             AVDYPVDKVSCYVSDDGA+ML F+ LAET+EFAR+WVPFCKKY IEPRAPE+YFS+KIDY
Sbjct  363   AVDYPVDKVSCYVSDDGAAMLTFEALAETSEFARKWVPFCKKYIIEPRAPEWYFSQKIDY  422

Query  1178  LKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPG  1357
             LKDKVQP+FVK+RRAMKREYEE+KVR+N LVAKAQK P+EGW+MQDGTPWPGNNTRDHPG
Sbjct  423   LKDKVQPSFVKDRRAMKREYEEFKVRINGLVAKAQKVPDEGWIMQDGTPWPGNNTRDHPG  482

Query  1358  MIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLN  1537
             MIQV+LG  G LD EG ELP+LVYVSREKRPG+QHHKKAGAMNALVRVSAVLTN PFMLN
Sbjct  483   MIQVFLGHSGGLDTEGNELPRLVYVSREKRPGFQHHKKAGAMNALVRVSAVLTNGPFMLN  542

Query  1538  LDCDHY  1555
             LDCDHY
Sbjct  543   LDCDHY  548



>ref|XP_002983910.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 gb|EFJ14922.1| family 2 glycosyltransferase [Selaginella moellendorffii]
Length=1072

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/570 (56%), Positives = 386/570 (68%), Gaps = 74/570 (13%)
 Frame = +2

Query  26    ALFTGGSH----LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCK  193
             A    GSH    L     D  + +   + +MC+IC DE+GV ENG++FVAC ECGFPVC+
Sbjct  5     AGLIAGSHQMNQLVVIPGDGVKPLNSVNSEMCQICGDEVGVSENGDLFVACNECGFPVCR  64

Query  194   PCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGdded----------hfegedfeqefeTK  343
             PCY+YER +GNQ CP C +RYKR KG PRV GD+E+              +    E   +
Sbjct  65    PCYEYERKDGNQSCPQCKSRYKRQKGSPRVEGDEEEDDVDDLDNEFKALPQQQTTEEMLQ  124

Query  344   NHP-----------------PLSENG-----------DYHNNQLPHH----------NTT  409
              H                  PL  NG           ++H   +P H          +  
Sbjct  125   GHMSYGRGDEENVHVVTPGLPLLTNGQEGVDPNEIPPEHHALVIPSHKRVHPMSDDFSGD  184

Query  410   NSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggad  589
             +S +  PT  P + G           + +  WK+R+E W+ +QEK  ++           
Sbjct  185   HSLSMDPTKDPSAYG-----------YGSVAWKERLESWRHKQEKMSIMMTEGAQHFSDG  233

Query  590   nedddF--------LMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPA  745
                 D+        L  ++RQPL RK+PI+SS I+PYR++I+ RL +L  F  +RIL P 
Sbjct  234   KGGGDYGADGPDAPLTDESRQPLSRKIPIASSKINPYRMIIIIRLAVLGIFLRYRILNPV  293

Query  746   YDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVD  925
              +A+ LWL SVICEIWF  SWILDQFPKW PINRETYLDRLSLR+ERDGE +   L+ VD
Sbjct  294   KNAYGLWLTSVICEIWFAFSWILDQFPKWFPINRETYLDRLSLRYERDGESQ---LSSVD  350

Query  926   VYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRW  1105
             +YVSTVDPLKEPP++TANTVLSILAVDYPVDKVSCYVSDDGA+ML F+ LAET+EFAR+W
Sbjct  351   IYVSTVDPLKEPPLVTANTVLSILAVDYPVDKVSCYVSDDGAAMLTFEALAETSEFARKW  410

Query  1106  VPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQK  1285
             VPFCKK+ IEPRAPE YF++KIDYLKDKVQPTFVK+RRAMKREYEE+KVR+NALVAKA K
Sbjct  411   VPFCKKFSIEPRAPEMYFAQKIDYLKDKVQPTFVKDRRAMKREYEEFKVRINALVAKAHK  470

Query  1286  KPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHH  1465
              PEEGW MQDGTPWPGNNTRDHPGMIQV+LG  G  D +G ELP+LVYVSREKRPG+ HH
Sbjct  471   MPEEGWTMQDGTPWPGNNTRDHPGMIQVFLGHSGGHDTDGNELPRLVYVSREKRPGFNHH  530

Query  1466  KKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             KKAGAMN+LVRVSAVLTNAPF+LNLDCDHY
Sbjct  531   KKAGAMNSLVRVSAVLTNAPFLLNLDCDHY  560



>ref|XP_002960761.1| cellulose synthase 4-1 [Selaginella moellendorffii]
 gb|EFJ38300.1| cellulose synthase 4-1 [Selaginella moellendorffii]
Length=1072

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/570 (56%), Positives = 385/570 (68%), Gaps = 74/570 (13%)
 Frame = +2

Query  26    ALFTGGSH----LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCK  193
             A    GSH    L     D  + +   + +MC+IC DE+GV  NG++FVAC ECGFPVC+
Sbjct  5     AGLIAGSHQMNQLVVIPGDGVKPLNSVNSEMCQICGDEVGVSANGDLFVACNECGFPVCR  64

Query  194   PCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGdded----------hfegedfeqefeTK  343
             PCY+YER +GNQ CP C +RYKR KG PRV GD+E+              +    E   +
Sbjct  65    PCYEYERKDGNQSCPQCKSRYKRQKGSPRVEGDEEEDDVDDLDNEFKALPQQQTTEEMLQ  124

Query  344   NHP-----------------PLSENG-----------DYHNNQLPHH----------NTT  409
              H                  PL  NG           ++H   +P H          +  
Sbjct  125   GHMSYGRGDEENVHVVTPGLPLLTNGQEGVDPNEIPPEHHALVIPSHKRVHPMSDDFSGD  184

Query  410   NSAAFQPTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggad  589
             NS +  PT  P + G           + +  WK+R+E W+ +QEK  ++           
Sbjct  185   NSLSMDPTKDPSAYG-----------YGSVAWKERLESWRHKQEKMSIMMTEGAQHFSDG  233

Query  590   nedddF--------LMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPA  745
                 D+        L  ++RQPL RK+PI+SS I+PYR++I+ RL +L  F  +RIL P 
Sbjct  234   KGGGDYGADGPDAPLTDESRQPLSRKIPIASSKINPYRMIIIIRLAVLGIFLRYRILNPV  293

Query  746   YDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVD  925
              +A+ LWL SVICEIWF  SWILDQFPKW PINRETYLDRLSLR+ERDGE +   L+ VD
Sbjct  294   KNAYGLWLTSVICEIWFAFSWILDQFPKWFPINRETYLDRLSLRYERDGESQ---LSSVD  350

Query  926   VYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRW  1105
             +YVSTVDPLKEPP++TANTVLSILAVDYPVDKVSCYVSDDGA+ML F+ LAET+EFAR+W
Sbjct  351   IYVSTVDPLKEPPLVTANTVLSILAVDYPVDKVSCYVSDDGAAMLTFEALAETSEFARKW  410

Query  1106  VPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQK  1285
             VPFCKK+ IEPRAPE YF++KIDYLKDKVQPTFVK+RRAMKREYEE+KVR+NALVAKA K
Sbjct  411   VPFCKKFSIEPRAPEMYFAQKIDYLKDKVQPTFVKDRRAMKREYEEFKVRINALVAKAHK  470

Query  1286  KPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHH  1465
              PEEGW MQDGTPWPGNNTRDHPGMIQV+LG  G  D +G ELP+LVYVSREKRPG+ HH
Sbjct  471   MPEEGWTMQDGTPWPGNNTRDHPGMIQVFLGHSGGHDTDGNELPRLVYVSREKRPGFNHH  530

Query  1466  KKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             KKAGAMN+LVRVSAVLTNAPF+LNLDCDHY
Sbjct  531   KKAGAMNSLVRVSAVLTNAPFLLNLDCDHY  560



>ref|XP_009777624.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Nicotiana sylvestris]
Length=1041

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/556 (57%), Positives = 384/556 (69%), Gaps = 60/556 (11%)
 Frame = +2

Query  23    AALFTGGSH-------LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGF  181
             +A    GSH       +H   H+E + ++  S ++C IC DEIG+  +G++FVAC ECGF
Sbjct  4     SAGLVAGSHNRNELVVIHG--HEEHKPLKDLSGQVCEICGDEIGLTVDGDLFVACNECGF  61

Query  182   PVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefe--------  337
             PVC+PCY+YER EG Q CP C TRYKR KG PRV GD+++    +   +           
Sbjct  62    PVCRPCYEYERREGTQQCPQCKTRYKRLKGSPRVAGDEDEEDIDDIEHEFKIDDEQNRNR  121

Query  338   ---------------------TKNHPPLSENGDYH--NNQLPHHNTTNSAAFQPTAA---  439
                                  +  +PP+      H  + + P  +  N      ++    
Sbjct  122   NIVETILHGKMTYGRGPEDEDSAQYPPVIAGIRSHPVSGEFPISSHANGEQMLGSSLHKR  181

Query  440   ----PGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadnedddF  607
                 P S  G    D++KE      WK+R++ WK +Q   G              + D  
Sbjct  182   IHPYPASEPGSARWDDKKE----GGWKERMDDWKLQQGNLG-------QDYDDYADPDMA  230

Query  608   LMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICE  787
             ++ +ARQPL RK+PI+SS I+PYR+VIV RL IL  F  +RIL P +DA  LWL S+ICE
Sbjct  231   MVDEARQPLSRKVPIASSKINPYRMVIVARLFILAIFLRYRILNPVHDAIGLWLTSIICE  290

Query  788   IWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPI  967
             IWF  SWILDQFPKW PI+RETYLDRLSLR+ER  EGE N LAPVD++VSTVDP+KEPP+
Sbjct  291   IWFAFSWILDQFPKWFPIDRETYLDRLSLRYER--EGEPNMLAPVDIFVSTVDPMKEPPL  348

Query  968   ITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAP  1147
             +TANT+LSILA+DYPVDK SCY+SDDGASM  F+ L+ETAEFAR+WVPFCKK+ IEPRAP
Sbjct  349   VTANTILSILAMDYPVDKTSCYLSDDGASMCTFEALSETAEFARKWVPFCKKFAIEPRAP  408

Query  1148  EFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPW  1327
             EFYFS+KIDYLKDKVQPTFVKERRAMKREYEE+KVR+NALVAKA K P  GW+MQDGTPW
Sbjct  409   EFYFSQKIDYLKDKVQPTFVKERRAMKREYEEFKVRINALVAKATKMPPGGWIMQDGTPW  468

Query  1328  PGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSA  1507
             PGNNTRDHPGMIQV+LG  G  DVEG ELP+LVYVSREKRPG+QHHKKAGAMNALVRVS 
Sbjct  469   PGNNTRDHPGMIQVFLGQSGGTDVEGNELPRLVYVSREKRPGFQHHKKAGAMNALVRVSG  528

Query  1508  VLTNAPFMLNLDCDHY  1555
             VLTNAPFMLNLDCDHY
Sbjct  529   VLTNAPFMLNLDCDHY  544



>gb|AAT66941.1| CesA2 [Acacia mangium]
Length=1075

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/547 (58%), Positives = 377/547 (69%), Gaps = 68/547 (12%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             ++C+IC D +G   +GE F+AC  C FPVC+PCY+YER +GNQ CP C TRYKRHKG P 
Sbjct  18    QVCQICGDSVGKTVDGEPFIACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPA  77

Query  281   VVGddedhfegedfeq--------------------------------------efeTKN  346
             ++GD E+    +D                                         +  + N
Sbjct  78    ILGDGEEDGVADDGTSDLNYDSENQNQKQKISERMLSWHMTYGRTEEIGAPNYDKEVSHN  137

Query  347   HPPLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLE--------DEQKEV-----  487
               PL  NG   + +L    +  S      A+PG  GGK +         ++   +     
Sbjct  138   QIPLLTNGQEVSGEL----SAASPERLSMASPGGPGGKRVHSLPYSSDINQSPNIRAVDP  193

Query  488   -FSNAEWKDRVEKWKTRQEKRGLVTRFdddkg----------gadnedddFLMADARQPL  634
                N  WK+RV+ WK +QEK  +                        DD  L  +ARQPL
Sbjct  194   GLGNVAWKERVDGWKMKQEKNVVPMSTGQAASERGAGDIDASTDVLVDDSLLNDEARQPL  253

Query  635   WRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWIL  814
              RK+ I SS I+PYR+VI+ RLIILCFF H+RI  P  +A+PLWL+SVICEIWF LSWIL
Sbjct  254   SRKVSIPSSRINPYRMVIILRLIILCFFLHYRITNPVRNAYPLWLVSVICEIWFALSWIL  313

Query  815   DQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSI  994
             DQFPKW P+NRETYLDRL+LR++R  EGE + LA VD++VSTVDPLKEPP++TANT LSI
Sbjct  314   DQFPKWLPVNRETYLDRLALRYDR--EGEPSQLAAVDIFVSTVDPLKEPPLVTANTALSI  371

Query  995   LAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKID  1174
             LAVDYPVDKVSCYVSDDGA+ML F+ L+ETAEFAR+WVPFCKKY IEPRAPE+YF++KID
Sbjct  372   LAVDYPVDKVSCYVSDDGAAMLTFEALSETAEFARKWVPFCKKYNIEPRAPEWYFTQKID  431

Query  1175  YLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHP  1354
             YLKDKVQ +FVK+RRAMKREYEE+KVRVNALVAKAQK PEEGWVMQDGTPWPGNNTRDHP
Sbjct  432   YLKDKVQTSFVKDRRAMKREYEEFKVRVNALVAKAQKIPEEGWVMQDGTPWPGNNTRDHP  491

Query  1355  GMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFML  1534
             GMIQV+LG  G LD EG ELP+LVYVSREKRPG+QHHKKAGAMNALVRVSAVLTN PF+L
Sbjct  492   GMIQVFLGQSGGLDAEGNELPRLVYVSREKRPGFQHHKKAGAMNALVRVSAVLTNGPFLL  551

Query  1535  NLDCDHY  1555
             NLDCDHY
Sbjct  552   NLDCDHY  558



>emb|CBI21020.3| unnamed protein product [Vitis vinifera]
Length=921

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/536 (58%), Positives = 387/536 (72%), Gaps = 54/536 (10%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             ++C+IC D +G+   G+VFVAC EC FPVC+PCY+YER +GNQ CP C TRYKRHKG PR
Sbjct  37    QICQICGDTVGLTAAGDVFVACNECAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPR  96

Query  281   VVGddedhfegedfeqefeTKNHP-------------------------PLSENGDYHNN  385
             V GDDE+    +   +    + +                          PL  NG   + 
Sbjct  97    VEGDDEEDDVDDIENEFNYAQGNSKARRQWQGEDADLSSSSRHESQQPIPLLTNGQPLSG  156

Query  386   QLPHHNTTNSAAFQPTAAPGSVGGKDLE----------------DEQKEVFS----NAEW  505
             ++P   T ++ + + T+ P   G K +                 D  K++ S    N +W
Sbjct  157   EIPS-GTPDNQSVRTTSGPLGPGEKHVHSLPYVDPRQPVPVRIVDPSKDLNSYGLGNVDW  215

Query  506   KDRVEKWKTRQEKRGL--VTRF---dddkggadnedddFLMAD-ARQPLWRKLPISSSLI  667
             K+RVE WK +QEK  +   +R+     D  G  +  ++  MAD ARQPL R +PI SS +
Sbjct  216   KERVEGWKLKQEKNMMQVTSRYPEGKGDLEGTGSNGEELQMADDARQPLSRVVPIPSSHL  275

Query  668   SPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINR  847
             +PYR+VI+ RLIIL FF  +R   P  DA+PLWL SVICEIWF LSW+LDQFPKW PINR
Sbjct  276   TPYRVVIILRLIILGFFLQYRTTHPVKDAYPLWLTSVICEIWFALSWLLDQFPKWYPINR  335

Query  848   ETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVS  1027
             ET+L+RL+LR++R  EGE + LAP+DV+VSTVDPLKEPP++TANTVLSILAVDYPVDKVS
Sbjct  336   ETFLERLALRYDR--EGEPSQLAPIDVFVSTVDPLKEPPLVTANTVLSILAVDYPVDKVS  393

Query  1028  CYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFV  1207
             CYVSDDG++ML F+ L+ET+EFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK+QP+FV
Sbjct  394   CYVSDDGSAMLTFEALSETSEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKDKIQPSFV  453

Query  1208  KERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEG  1387
             KERRAMKREYEE+K+R+NALVAKAQK PEEGW MQDGTPWPGNN RDHPGMIQV+LG  G
Sbjct  454   KERRAMKREYEEFKIRINALVAKAQKTPEEGWTMQDGTPWPGNNPRDHPGMIQVFLGHSG  513

Query  1388  ALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
              LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  514   GLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  569



>ref|XP_009597841.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Nicotiana tomentosiformis]
Length=1085

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/569 (56%), Positives = 399/569 (70%), Gaps = 61/569 (11%)
 Frame = +2

Query  23    AALFTGGSH----LHAADHDER---REVERESQKMCRICRDEIGVVENGEVFVACRECGF  181
             +A    GSH    L    HD     + ++  + ++C+IC D +G+   G+VFVAC EC F
Sbjct  4     SAGMVAGSHKRNELVRIRHDSDSGPKPIKPLNSQICQICGDNVGLNAIGDVFVACNECAF  63

Query  182   PVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKN-----  346
             PVC+ CY+YER +GNQ CP C TRYKRHKGCPRV GDD++    +   +    +      
Sbjct  64    PVCRSCYEYERKDGNQSCPQCKTRYKRHKGCPRVDGDDDEDDVDDIDNEFNYAQGNSKAR  123

Query  347   -------------------HP-PLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKD-  463
                                HP PL  NG   + ++P   T ++ + +  + P   G K  
Sbjct  124   RQWQGEDASLSSSSRQDPQHPIPLLTNGQSVSGEIPSA-TPDTQSVRSMSGPLGPGDKQA  182

Query  464   --------------LEDEQKEV----FSNAEWKDRVEKWKTRQEK-------RGLVTRFd  568
                           + D  K++      + +WK+RVE WK +QEK       R    +  
Sbjct  183   SLPYVDPRLPVPVRIVDPSKDLNSYGLGSVDWKERVEGWKLKQEKNMTHMNHRYTEGKGG  242

Query  569   ddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAY  748
             D +G   N ++  +  DARQPL R +PI SS ++PYR+VI+ RLIIL FF  +R+  P  
Sbjct  243   DIEGTGSNGEELQMADDARQPLSRVVPIPSSHLTPYRVVIILRLIILGFFMQYRLTHPVN  302

Query  749   DAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDV  928
             DA+PLWL+SVICE+WF LSW+LDQFPKWSPINRETYLDRL+LR++R  EGE + L P+DV
Sbjct  303   DAYPLWLVSVICEVWFALSWLLDQFPKWSPINRETYLDRLALRYDR--EGEPSQLVPIDV  360

Query  929   YVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWV  1108
             +VSTVDP+KEPP+ITANTVLSILAVDYPVDKVSCYVSDDG++ML F+ L+ETAEFAR+WV
Sbjct  361   FVSTVDPMKEPPLITANTVLSILAVDYPVDKVSCYVSDDGSAMLTFEALSETAEFARKWV  420

Query  1109  PFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKK  1288
             PFCKK+ IEPRAPEFYF++KIDYLKDK+QP+FVKERRAMKREYEE+K+R+NALVAKAQK 
Sbjct  421   PFCKKFNIEPRAPEFYFAQKIDYLKDKIQPSFVKERRAMKREYEEFKIRINALVAKAQKM  480

Query  1289  PEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHK  1468
             PEEGW MQDGTPWPGNN+RDHPGMIQV+LG  G LD +G ELP+LVYVSREKRPG+QHHK
Sbjct  481   PEEGWTMQDGTPWPGNNSRDHPGMIQVFLGHSGGLDTDGNELPRLVYVSREKRPGFQHHK  540

Query  1469  KAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             KAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  541   KAGAMNALIRVSAVLTNGAYILNVDCDHY  569



>ref|XP_008673642.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Zea mays]
 tpg|DAA53226.1| TPA: cellulose synthase3 [Zea mays]
Length=1074

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/543 (58%), Positives = 388/543 (71%), Gaps = 44/543 (8%)
 Frame = +2

Query  53    HAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQC  232
             H  D    ++++  ++++C+IC D +G+   G++FVAC EC FPVC+PCY+YER EGNQC
Sbjct  20    HDGDGAAAKQLKNVNEQICQICGDTLGLSATGDIFVACNECAFPVCRPCYEYERKEGNQC  79

Query  233   CPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNH---PPLSENGDYHNNQL----  391
             CP C TRYKRHKG PRV GD+E+    +   +   T+ +   P     G   +  +    
Sbjct  80    CPQCKTRYKRHKGSPRVRGDEEEDGVDDLDNEFNYTQGNVQGPQWQLRGQGEDVDISSSS  139

Query  392   ---PHHNTTNSAAFQ------PTAAPGSVGGKD---------------LEDEQKEVFS--  493
                PHH        Q      P A+P     +                + D  K++ S  
Sbjct  140   RHEPHHRIPRLTTGQQMSGDIPDASPDRHSIRSPTPSYVDPSIPVPVRIVDPSKDLNSYG  199

Query  494   --NAEWKDRVEKWKTRQEKRGLVTRF------dddkggadnedddFLMA-DARQPLWRKL  646
               + +WK+RVE WK RQ+K  +            D  G  +  +D  MA DAR PL R +
Sbjct  200   VGSVDWKERVESWKVRQDKNMIQVTHKYPAEGKGDIEGTGSNGEDLQMADDARLPLSRIV  259

Query  647   PISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFP  826
             PIS + ++ YRIVIV RLIILCFFF +RI  P  DA+ LWL+SVICE+WF LSW+LDQFP
Sbjct  260   PISPNELNLYRIVIVLRLIILCFFFQYRITHPVEDAYGLWLVSVICEVWFALSWLLDQFP  319

Query  827   KWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVD  1006
             KW PINRETYLDRL+LR++R  EGE + LAP+DV+VSTVDPLKEPP+IT NTVLSILAVD
Sbjct  320   KWYPINRETYLDRLALRYDR--EGEPSQLAPIDVFVSTVDPLKEPPLITGNTVLSILAVD  377

Query  1007  YPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKD  1186
             YPVDKVSCYVSDDG++ML F+ L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKD
Sbjct  378   YPVDKVSCYVSDDGSAMLTFEALSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKD  437

Query  1187  KVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQ  1366
             K+QP+FVKERRAMKREYEE+KVR+NALVAKAQK PEEGW M DGTPWPGNN RDHPGMIQ
Sbjct  438   KIQPSFVKERRAMKREYEEFKVRINALVAKAQKIPEEGWTMADGTPWPGNNPRDHPGMIQ  497

Query  1367  VYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDC  1546
             V+LG  G LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DC
Sbjct  498   VFLGHSGGLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDC  557

Query  1547  DHY  1555
             DHY
Sbjct  558   DHY  560



>ref|XP_008375180.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Malus domestica]
Length=1082

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/550 (58%), Positives = 375/550 (68%), Gaps = 67/550 (12%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             K+C+IC D +G   +GE F+AC  C FPVC+PCY+YER +GNQ CP C TRYKRHKG P 
Sbjct  18    KVCQICGDNVGKTADGEPFIACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPA  77

Query  281   VVGddedhfegedfeq--------------------------------------efeTKN  346
             ++GD E+    +D                                         +  + N
Sbjct  78    ILGDREEDAVADDDTSDFNYTSENQNEKQKIAERMLSWHMTYGRGEDVSAPNYDKEVSHN  137

Query  347   HPPLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVG-----GKDLE--------DEQKEV  487
             H PL  +G   + +L   +    +   P   PG        G D+         D  +E 
Sbjct  138   HIPLLASGQEVSGELSAASPERLSMASPGVGPGKRAHHHSYGSDVNQSPNIRVVDPVREF  197

Query  488   FS----NAEWKDRVEKWKTRQEKRGLVTRFdddkg----------gadnedddFLMADAR  625
              S    N  WK+RV+ WK +QEK  +                        DD  L  +AR
Sbjct  198   GSPGIGNVAWKERVDGWKMKQEKNVIPMSTGQATSERGGGDIDARSDVIVDDSLLNDEAR  257

Query  626   QPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLS  805
             QPL RK+ I SS I+PYR+VIV RLIILC F H+RI  P  +A+ LWLISVICEIWF +S
Sbjct  258   QPLSRKVSIPSSRINPYRMVIVLRLIILCIFLHYRITNPVQNAYALWLISVICEIWFAIS  317

Query  806   WILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTV  985
             WILDQFPKW P+NRETYLDRLSLR++R  EGE + LA VD++VSTVDPLKEPP++TANTV
Sbjct  318   WILDQFPKWLPVNRETYLDRLSLRYDR--EGEPSNLAAVDIFVSTVDPLKEPPMVTANTV  375

Query  986   LSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSE  1165
             LSILAVDYPVDKVSCYVSDDGA+ML F+ L+ET+EFAR+WVPFCKKY IEPRAPE+YFS+
Sbjct  376   LSILAVDYPVDKVSCYVSDDGAAMLTFEALSETSEFARKWVPFCKKYAIEPRAPEWYFSQ  435

Query  1166  KIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTR  1345
             KIDYLKDKVQP+FVKERRAMKREYEE+KVRVN LVAKA K PEEGW+MQDGTPWPGNNTR
Sbjct  436   KIDYLKDKVQPSFVKERRAMKREYEEFKVRVNGLVAKATKIPEEGWIMQDGTPWPGNNTR  495

Query  1346  DHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAP  1525
             DHPGMIQV+LG  G LD +G ELP+LVYVSREKRPG+QHHKKAGAMNALVRVSAVLTN P
Sbjct  496   DHPGMIQVFLGQSGGLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALVRVSAVLTNGP  555

Query  1526  FMLNLDCDHY  1555
             F+LNLDCDHY
Sbjct  556   FLLNLDCDHY  565



>ref|XP_007221583.1| hypothetical protein PRUPE_ppa000611mg [Prunus persica]
 gb|EMJ22782.1| hypothetical protein PRUPE_ppa000611mg [Prunus persica]
Length=1072

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/522 (61%), Positives = 387/522 (74%), Gaps = 39/522 (7%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             ++C+IC D +G+   G+VFVAC EC FPVC+PCY+YER +GNQ CP C TRYKRHKG PR
Sbjct  37    QICQICGDTVGLTATGDVFVACNECAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPR  96

Query  281   VVGddedhfegedfeqefeTKNHPPL-----SENGDY-----HNNQLPHHNTTNSAAFQ-  427
             V GDD++    +   +    + +         E+ D      H +Q P    TN      
Sbjct  97    VDGDDDEDDIDDLENEFNYAQGNSNARRQWQGEDADLSSSSRHESQQPIPLLTNGQPMSG  156

Query  428   --PTAAPG------SVGGKD--------LEDEQKEVFS----NAEWKDRVEKWKTRQEKR  547
               P A P       + G  D        + D  K++ S    N +WK+RVE WK +Q+K 
Sbjct  157   EIPCATPDNQSVRTTSGPLDPRQPVPVRIVDPSKDLNSYGLGNVDWKERVEGWKLKQDKN  216

Query  548   --GLVTRFdddk---ggadnedddFLMAD-ARQPLWRKLPISSSLISPYRIVIVFRLIIL  709
                + +R+ + K    G  +  ++  MAD ARQPL R +PISSS ++PYR+VI+ RLIIL
Sbjct  217   MMQMTSRYAEGKGDNEGTGSNGEELQMADDARQPLSRIVPISSSHLTPYRVVIILRLIIL  276

Query  710   CFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERD  889
              FF  +R   P  DA+PLWL SVICEIWF LSW+LDQFPKW PINRETYLDRL+LR++R 
Sbjct  277   GFFLQYRATHPVKDAYPLWLTSVICEIWFALSWLLDQFPKWFPINRETYLDRLTLRYDR-  335

Query  890   GEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFD  1069
              EGE + LAP+DV+VSTVDP+KEPP++TANTVLSIL+VDYPVDKVSCYVSDDG++ML F+
Sbjct  336   -EGEPSQLAPIDVFVSTVDPMKEPPLVTANTVLSILSVDYPVDKVSCYVSDDGSAMLTFE  394

Query  1070  TLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYK  1249
             +L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK+QP+FVKERRAMKREYEE+K
Sbjct  395   SLSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKDKIQPSFVKERRAMKREYEEFK  454

Query  1250  VRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVY  1429
             VR+NALVAKAQK PEEGW MQDGTPWPGNN RDHPGMIQV+LG  G LD +G ELP+LVY
Sbjct  455   VRINALVAKAQKMPEEGWTMQDGTPWPGNNPRDHPGMIQVFLGHSGGLDTDGNELPRLVY  514

Query  1430  VSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             VSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  515   VSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  556



>ref|XP_006842872.1| hypothetical protein AMTR_s00081p00171100 [Amborella trichopoda]
 gb|ERN04547.1| hypothetical protein AMTR_s00081p00171100 [Amborella trichopoda]
Length=1083

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/545 (57%), Positives = 383/545 (70%), Gaps = 54/545 (10%)
 Frame = +2

Query  77    REVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRY  256
             + ++  + ++C+IC D +G+  +GE FVAC EC FPVC+PCY+YER +GNQ CP C TRY
Sbjct  29    KPIKNLNSQVCQICGDTVGLTASGEPFVACNECAFPVCRPCYEYERKDGNQSCPQCKTRY  88

Query  257   KRHKGCPRVVGddedhf----------------------------egedfeqefeTKNHP  352
             KR KG PRV GDD++                                        ++   
Sbjct  89    KRQKGSPRVEGDDDEEDIDDLENEFNYRGNGNSKRQWQMYGQGEDANLSASSGPNSQQPI  148

Query  353   PLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKD--------------LEDEQKEV-  487
             PL  NG   + ++P     +       + P S G K               + D  K++ 
Sbjct  149   PLLTNGQQMSGEIPDATPEHQPMATLNSGPLSSGEKRSLPYIDPSLPVPVRIVDPTKDLN  208

Query  488   ---FSNAEWKDRVEKWKTRQEKR--GLVTRFdddkggadnedd----dFLMADARQPLWR  640
                  N +WK+RVE WK +QEK    + +R+ D KG  +          +  DARQPL R
Sbjct  209   SYGLGNVDWKERVEGWKLKQEKNMMQMTSRYTDGKGDMEGTGSNGEDLLIADDARQPLSR  268

Query  641   KLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQ  820
              +PI SS ++PYR+VI+ RLIIL FF  +R+  P  DA+PLWL+S+ICEIWF LSW+LDQ
Sbjct  269   VVPIPSSQLTPYRVVIILRLIILGFFLQYRVTHPVNDAYPLWLVSIICEIWFALSWLLDQ  328

Query  821   FPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILA  1000
             FPKW P+NRETYLDRL+LR++R  EGE + LAPVDV+VSTVDPLKEPP++TANTVLSILA
Sbjct  329   FPKWFPVNRETYLDRLALRYDR--EGEPSQLAPVDVFVSTVDPLKEPPLVTANTVLSILA  386

Query  1001  VDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYL  1180
             VDYPVDKVSCYVSDDG++ML F+ L+ET+EFAR+WVPFCKK+ IEPRAPEFYF++KIDYL
Sbjct  387   VDYPVDKVSCYVSDDGSAMLTFEALSETSEFARKWVPFCKKHNIEPRAPEFYFAQKIDYL  446

Query  1181  KDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGM  1360
             KDK+QP+FVKERRAMKREYEE+KVR+NALVAKAQK PEEGW MQDGTPWPGNN RDHPGM
Sbjct  447   KDKIQPSFVKERRAMKREYEEFKVRINALVAKAQKTPEEGWTMQDGTPWPGNNPRDHPGM  506

Query  1361  IQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNL  1540
             IQV+LG  G LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  F+LN+
Sbjct  507   IQVFLGHSGGLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAFLLNV  566

Query  1541  DCDHY  1555
             DCDHY
Sbjct  567   DCDHY  571



>ref|XP_002276890.2| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Vitis vinifera]
 emb|CBI36551.3| unnamed protein product [Vitis vinifera]
Length=1037

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/556 (59%), Positives = 392/556 (71%), Gaps = 60/556 (11%)
 Frame = +2

Query  23    AALFTGGSH-------LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGF  181
             +A    GSH       +H   H+E + +   + ++C IC DEIG+  +GEVFVAC ECGF
Sbjct  4     SAGLVAGSHNRNELVVIHG--HEEPKPLRSLNGQVCEICGDEIGLTVDGEVFVACNECGF  61

Query  182   PVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfeged----feqefeTKN-  346
             PVC+PCY+YER EG+Q CP C TR+KR KGC RV GDD++    +        + + KN 
Sbjct  62    PVCRPCYEYERREGSQLCPQCKTRFKRLKGCARVEGDDDEEDIDDIEHEFNIDDEQNKNK  121

Query  347   -------HPPLSEN---GDYHNNQLPHHNTT-----NSAAFQPTA-APGSVG--------  454
                    H  +S      D  N Q P   T       S  F  ++ APG  G        
Sbjct  122   LIAEAMLHGKMSYGRGPEDDDNAQFPPVITGVRSRPVSGEFPISSHAPGEQGLSSSLHKR  181

Query  455   ---------GKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadnedddF  607
                      G    DE+KE      WK+R++ WK +Q   G             N+ D  
Sbjct  182   VHPYPVSEPGSARWDEKKE----GGWKERMDDWKMQQGNLG-------PDADDYNDPDMA  230

Query  608   LMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICE  787
             ++ +ARQPL RK+PI+SS ++PYR+VIV RL++L FF  +RIL P +DA  LWL+SVICE
Sbjct  231   MIEEARQPLSRKVPIASSKVNPYRMVIVARLLVLAFFLRYRILNPVHDALGLWLVSVICE  290

Query  788   IWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPI  967
             IWF  SWILDQFPKW PI+RETYLDRLS R+ER  EGE N L+PVD++VSTVDPLKEPP+
Sbjct  291   IWFAFSWILDQFPKWFPIDRETYLDRLSFRYER--EGEPNMLSPVDIFVSTVDPLKEPPL  348

Query  968   ITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAP  1147
             +TANTVLSILA+DYPVDK+SCY+SDDGAS+L F+ L+ETAEFARRWVPFCKK+ IEPRAP
Sbjct  349   VTANTVLSILAMDYPVDKISCYISDDGASILTFEALSETAEFARRWVPFCKKFSIEPRAP  408

Query  1148  EFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPW  1327
             E YFS KIDYLKDKVQPTFVKERRAMKREYEE+KVR+NA+VAKA K P EGW+MQDGTPW
Sbjct  409   EMYFSLKIDYLKDKVQPTFVKERRAMKREYEEFKVRINAIVAKAVKVPPEGWIMQDGTPW  468

Query  1328  PGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSA  1507
             PGNNT+DHPGMIQV+LG  G LD EG ELP+LVYVSREKRPG+ HHKKAGAMNAL+RVSA
Sbjct  469   PGNNTKDHPGMIQVFLGHSGGLDAEGNELPRLVYVSREKRPGFHHHKKAGAMNALIRVSA  528

Query  1508  VLTNAPFMLNLDCDHY  1555
             VLTNAPFMLNLDCDHY
Sbjct  529   VLTNAPFMLNLDCDHY  544



>ref|XP_008219478.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Prunus mume]
Length=1072

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/522 (61%), Positives = 387/522 (74%), Gaps = 39/522 (7%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             ++C+IC D +G+   G+VFVAC EC FPVC+PCY+YER +GNQ CP C TRYKRHKG PR
Sbjct  37    QICQICGDTVGLTATGDVFVACNECAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPR  96

Query  281   VVGddedhfegedfeqefeTKNHPP-----LSENGDY-----HNNQLPHHNTTNSAAFQ-  427
             V GDD++    +   +    + +         E+ D      H +Q P    TN      
Sbjct  97    VDGDDDEDDIDDLENEFNYAQGNSNGRRQWQGEDADLSSSSRHESQQPIPLLTNGQPMSG  156

Query  428   --PTAAPG------SVGGKD--------LEDEQKEVFS----NAEWKDRVEKWKTRQEKR  547
               P A P       + G  D        + D  K++ S    N +WK+RVE WK +Q+K 
Sbjct  157   EIPCATPDNQSVRTTSGPLDPRQPVPVRIVDPSKDLNSYGLGNVDWKERVEGWKLKQDKN  216

Query  548   --GLVTRFdddk---ggadnedddFLMAD-ARQPLWRKLPISSSLISPYRIVIVFRLIIL  709
                + +R+ + K    G  +  ++  MAD ARQPL R +PISSS ++PYR+VI+ RLIIL
Sbjct  217   MMQMTSRYAEGKGDNEGTGSNGEELQMADDARQPLSRIVPISSSHLTPYRVVIILRLIIL  276

Query  710   CFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERD  889
              FF  +R   P  DA+PLWL SVICEIWF LSW+LDQFPKW PINRETYLDRL+LR++R 
Sbjct  277   GFFLQYRATHPVKDAYPLWLTSVICEIWFALSWLLDQFPKWFPINRETYLDRLTLRYDR-  335

Query  890   GEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFD  1069
              EGE + LAP+DV+VSTVDP+KEPP++TANTVLSIL+VDYPVDKVSCYVSDDG++ML F+
Sbjct  336   -EGEPSQLAPIDVFVSTVDPMKEPPLVTANTVLSILSVDYPVDKVSCYVSDDGSAMLTFE  394

Query  1070  TLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYK  1249
             +L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK+QP+FVKERRAMKREYEE+K
Sbjct  395   SLSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKDKIQPSFVKERRAMKREYEEFK  454

Query  1250  VRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVY  1429
             VR+NALVAKAQK PEEGW MQDGTPWPGNN RDHPGMIQV+LG  G LD +G ELP+LVY
Sbjct  455   VRINALVAKAQKMPEEGWTMQDGTPWPGNNPRDHPGMIQVFLGHSGGLDTDGNELPRLVY  514

Query  1430  VSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             VSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  515   VSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  556



>gb|EYU46413.1| hypothetical protein MIMGU_mgv1a000605mg [Erythranthe guttata]
Length=882

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/348 (86%), Positives = 328/348 (94%), Gaps = 3/348 (1%)
 Frame = +2

Query  515   VEKWKTRQEKRGLVTR-FdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIV  691
             +EKWK+RQEKRGLVT+  D      D++DDDFL+A+ARQPLWRK+PI S LISPYRIVIV
Sbjct  1     MEKWKSRQEKRGLVTKTGDGGNDKNDDDDDDFLIAEARQPLWRKVPIPSRLISPYRIVIV  60

Query  692   FRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLS  871
              R +ILCFFFHFRILTPA DA+PLW+ISVICEIWFGLSWILDQFPKW+PINRETYLDRLS
Sbjct  61    VRFVILCFFFHFRILTPAQDAYPLWIISVICEIWFGLSWILDQFPKWAPINRETYLDRLS  120

Query  872   LRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGA  1051
             LRFER+GE +R  LAPVD +VS+VDPLKEPPIITANT+LSILAVDYPVDKVSCY+SDDGA
Sbjct  121   LRFEREGEPDR--LAPVDFFVSSVDPLKEPPIITANTILSILAVDYPVDKVSCYLSDDGA  178

Query  1052  SMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKR  1231
             SMLLFD L+ETAEFARRWVPFCKKY +EPRAPEFYFSEK+DYLKDKVQPTFVK+RRAMKR
Sbjct  179   SMLLFDALSETAEFARRWVPFCKKYSVEPRAPEFYFSEKMDYLKDKVQPTFVKDRRAMKR  238

Query  1232  EYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKE  1411
             EYEE+KVR+NALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALD+EGKE
Sbjct  239   EYEEFKVRINALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDIEGKE  298

Query  1412  LPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             LP+LVYVSREKRPGYQHHKKAGA NALVRVSAVLTNAPF+LNLDCDHY
Sbjct  299   LPRLVYVSREKRPGYQHHKKAGAENALVRVSAVLTNAPFILNLDCDHY  346



>gb|ACZ82297.1| cellulose synthase [Phyllostachys edulis]
Length=1076

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/544 (58%), Positives = 394/544 (72%), Gaps = 43/544 (8%)
 Frame = +2

Query  53    HAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQC  232
             H  D    + ++  ++++C+IC D +G+   G+VFVAC EC FPVC+PCY+YER +GNQC
Sbjct  20    HDGDGAAAKPLKNVNEQICQICGDTVGLSATGDVFVACNECAFPVCRPCYEYERKDGNQC  79

Query  233   CPHCNTRYKRHKGCPRVVGdd------------------------edhfegedfeqefeT  340
             CP C TRYKRHKG PRV GDD                        +   +GED +    +
Sbjct  80    CPQCKTRYKRHKGSPRVPGDDEEEDVDDLDNEFNYKQGNSKGLQWQLQAQGEDVDLSSSS  139

Query  341   KNHP----PLSENGDYHNNQLPHHNTTNSAAFQPTAA---PGSVGGKDLEDEQKEVFS--  493
             ++ P    P   +G   +  +P  +    +   PT++   P       + D  K++ S  
Sbjct  140   RHEPHHRIPRLTSGQQISGDIPDASPDRHSIRSPTSSYVDPSIPVPVRIVDPSKDLNSYG  199

Query  494   --NAEWKDRVEKWKTRQEKRGL-VTR-----FdddkggadnedddFLMA-DARQPLWRKL  646
                 +WK+RVE W+ +QEK  + VT         D  G  +  +D  MA DAR PL R +
Sbjct  200   VGTVDWKERVESWRVKQEKNMIQVTNKYPAEGKGDIEGTGSNGEDLQMADDARLPLSRIV  259

Query  647   PISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFP  826
             PI ++ ++ YR+VI+FRLIILCFFF +RI  P +DA+ LWL+SVICE+WF LSW+LDQFP
Sbjct  260   PIPANQLNLYRVVIIFRLIILCFFFQYRITHPVWDAYGLWLVSVICEVWFALSWLLDQFP  319

Query  827   KWSPINRETYLDRLSLRFERDGE-GERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAV  1003
             KW PINRETYLDRL+LRF+R+GE  +   LAP+DV+VSTVDPLKEPP+ITANTVLSILAV
Sbjct  320   KWYPINRETYLDRLALRFDREGEPSQLAPLAPIDVFVSTVDPLKEPPLITANTVLSILAV  379

Query  1004  DYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLK  1183
             DYPVDKVSCYVSDDG++ML F+ L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLK
Sbjct  380   DYPVDKVSCYVSDDGSAMLTFEALSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLK  439

Query  1184  DKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMI  1363
             DK+QP+FVKERRAMKREYEE+KVR+NALVAKAQK PEEGW M DGTPWPGNN RDHPGMI
Sbjct  440   DKIQPSFVKERRAMKREYEEFKVRINALVAKAQKVPEEGWTMADGTPWPGNNPRDHPGMI  499

Query  1364  QVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLD  1543
             QV+LG  G LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+D
Sbjct  500   QVFLGHSGGLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVD  559

Query  1544  CDHY  1555
             CDHY
Sbjct  560   CDHY  563



>ref|XP_009354747.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Pyrus x bretschneideri]
 ref|XP_009354748.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Pyrus x bretschneideri]
Length=1082

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/550 (58%), Positives = 375/550 (68%), Gaps = 67/550 (12%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             K+C+IC D +G   +GE F+AC  C FPVC+PCY+YER +GNQ CP C TRYKRHKG P 
Sbjct  18    KVCQICGDNVGKTADGEPFIACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPA  77

Query  281   VVGddedhfegedfeq--------------------------------------efeTKN  346
             ++GD E+    +D                                         +  + N
Sbjct  78    ILGDREEDAVADDGTSDFNYTSENQNEKQKIAERMLSWHMTYGRGEDVSAPNYDKEVSHN  137

Query  347   HPPLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVG-----GKDLE--------DEQKEV  487
             H PL  +G   + +L   +    +   P   PG        G D+         D  +E 
Sbjct  138   HIPLLASGQEVSGELSAASPERLSMASPGVGPGKRAHHHSYGSDVNQSPNIRVVDPVREF  197

Query  488   FS----NAEWKDRVEKWKTRQEKRGLVTRFdddkg----------gadnedddFLMADAR  625
              S    N  WK+RV+ WK +QEK  +                        DD  L  +AR
Sbjct  198   GSPGIGNVAWKERVDGWKMKQEKNVIPMSTGQATSERGGGDIDARSDVIVDDSLLNDEAR  257

Query  626   QPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLS  805
             QPL RK+ I SS I+PYR+VIV RLIILC F H+RI  P  +A+ LWLISVICEIWF +S
Sbjct  258   QPLSRKVSIPSSRINPYRMVIVLRLIILCIFLHYRITNPVPNAYALWLISVICEIWFAIS  317

Query  806   WILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTV  985
             WILDQFPKW P+NRETYLDRLSLR++R  EGE + LA VD++VSTVDPLKEPP++TANTV
Sbjct  318   WILDQFPKWLPVNRETYLDRLSLRYDR--EGEPSNLAAVDIFVSTVDPLKEPPMVTANTV  375

Query  986   LSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSE  1165
             LSILAVDYPVDKVSCYVSDDGA+ML F+ L+ET+EFAR+WVPFCKKY IEPRAPE+YFS+
Sbjct  376   LSILAVDYPVDKVSCYVSDDGAAMLTFEALSETSEFARKWVPFCKKYAIEPRAPEWYFSQ  435

Query  1166  KIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTR  1345
             KIDYLKDKVQP+FVKERRAMKREYEE+KVRVN LVAKA K PEEGW+MQDGTPWPGNNTR
Sbjct  436   KIDYLKDKVQPSFVKERRAMKREYEEFKVRVNGLVAKATKIPEEGWIMQDGTPWPGNNTR  495

Query  1346  DHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAP  1525
             DHPGMIQV+LG  G LD +G ELP+LVYVSREKRPG+QHHKKAGAMNALVRVSAVLTN P
Sbjct  496   DHPGMIQVFLGQSGGLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALVRVSAVLTNGP  555

Query  1526  FMLNLDCDHY  1555
             F+LNLDCDHY
Sbjct  556   FLLNLDCDHY  565



>ref|XP_011079381.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X2 [Sesamum indicum]
Length=1036

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/553 (58%), Positives = 384/553 (69%), Gaps = 59/553 (11%)
 Frame = +2

Query  23    AALFTGGSH-------LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGF  181
             +A    GSH       +H   H+E + ++  + ++C IC DEIG+  +GE+FVAC ECGF
Sbjct  4     SAGLVAGSHNRNELVVIHG--HEEPKPLKNLTGQVCEICGDEIGLTVDGELFVACNECGF  61

Query  182   PVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVG------------------------  289
             PVC+PCY+YER EGNQ CP C TRYKR KG PRV G                        
Sbjct  62    PVCRPCYEYERREGNQQCPQCKTRYKRLKGSPRVEGDDDEEDIDDIEHEFNINEQKSNTT  121

Query  290   ---ddedhfegedfeqefeTKNHPPLSENGDYH--NNQLP------HHNTTNSAAFQPTA  436
                             E +T  +PP+   G     + +LP         ++      P  
Sbjct  122   IAEAMLHGKMSYGRGPEDDTAQYPPVIAGGRSRPVSGELPISYGEQMMGSSLHKRVHPYP  181

Query  437   APGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadnedddFLMA  616
             AP   G   + D++ E+     WK+R++ WK +Q   G        +     + D  ++ 
Sbjct  182   APDDTG--KVWDDKTEM----GWKERMDDWKMQQGNLG-------HEPDDSADPDVAIVD  228

Query  617   DARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWF  796
             +ARQPL RK+PI+SS I+PYR+VIV RL++L FF  +RIL P +DA  LWL SVICEIWF
Sbjct  229   EARQPLSRKVPIASSKINPYRMVIVTRLVVLAFFLRYRILNPVHDALGLWLTSVICEIWF  288

Query  797   GLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITA  976
               SWILDQFPKW PI+RETYLDRLSLR+ER  EGE N L PVD++VSTVDP+KEPP++TA
Sbjct  289   AFSWILDQFPKWFPIDRETYLDRLSLRYER--EGEPNMLTPVDIFVSTVDPMKEPPLVTA  346

Query  977   NTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFY  1156
             NTVLSILA+DYPVDK+SCY+SDDGASM  F+ L+ETAEFAR+WVPFCKK+ IEPRAPE Y
Sbjct  347   NTVLSILAMDYPVDKISCYISDDGASMCTFEALSETAEFARKWVPFCKKFSIEPRAPEMY  406

Query  1157  FSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGN  1336
             F EK+DYLKDKVQPTFVKERRAMKREYEE+KVR+NA+VAKA K P  GW+MQDGTPWPGN
Sbjct  407   FFEKVDYLKDKVQPTFVKERRAMKREYEEFKVRINAMVAKAAKIPPGGWIMQDGTPWPGN  466

Query  1337  NTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLT  1516
             NT+DHPGMIQV+LG  G LDV+G ELP+LVYVSREKRPG+QHHKKAGAMNALVRVS VLT
Sbjct  467   NTKDHPGMIQVFLGHSGGLDVKGHELPRLVYVSREKRPGFQHHKKAGAMNALVRVSGVLT  526

Query  1517  NAPFMLNLDCDHY  1555
             NAPFMLNLDCDHY
Sbjct  527   NAPFMLNLDCDHY  539



>ref|XP_004968377.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming]-like [Setaria italica]
Length=1075

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/535 (59%), Positives = 388/535 (73%), Gaps = 44/535 (8%)
 Frame = +2

Query  77    REVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRY  256
             ++++  ++++C+IC D +G+   G+VFVAC EC FPVC+PCY+YER EGNQCCP C TRY
Sbjct  29    KQLKNANEQICQICGDTVGLSATGDVFVACNECAFPVCRPCYEYERKEGNQCCPQCKTRY  88

Query  257   KRHKGCPRVVGddedhfegedfeqefeTKNH---PPLSENGDYHNNQL-------PHHNT  406
             KRHKG PRV GDDE+    +   +   T+ +   P     G   +  +       PHH  
Sbjct  89    KRHKGSPRVPGDDEEDEVDDLDNEFNYTQGNGKGPQWQLQGQGEDVDISSSSRHEPHHRI  148

Query  407   TNSAAFQ------PTAAPGSVGGKD---------------LEDEQKEVFS----NAEWKD  511
                 + Q      P A+P     +                + D  K++ S    + +WK+
Sbjct  149   PCLTSGQQISGDIPDASPDRHSIRSPTPSYVDPSIPVPVRIVDPSKDLNSYGVGSVDWKE  208

Query  512   RVEKWKTRQEKRGL------VTRFdddkggadnedddFLMA-DARQPLWRKLPISSSLIS  670
             RVE W+ +QEK  +            D  G  +  +D  MA DAR PL R +PIS + ++
Sbjct  209   RVESWRVKQEKNMIQVTHKYAAEGKGDIEGTGSNGEDLQMADDARLPLSRIVPISPNELN  268

Query  671   PYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRE  850
              YR VIV RLIILCFFF +RI  P +DA+ LWL+SVICE+WF LSW+LDQFPKW PINRE
Sbjct  269   LYRTVIVLRLIILCFFFQYRITHPVWDAYGLWLVSVICEVWFALSWLLDQFPKWYPINRE  328

Query  851   TYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSC  1030
             TYLDRL+LR++R  EGE + LAP+DV+VSTVDPLKEPP+ITANTVLSILAVDYPVDKVSC
Sbjct  329   TYLDRLALRYDR--EGEPSQLAPIDVFVSTVDPLKEPPLITANTVLSILAVDYPVDKVSC  386

Query  1031  YVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVK  1210
             YVSDDG++ML F+ L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK+QP+FVK
Sbjct  387   YVSDDGSAMLTFEALSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKDKIQPSFVK  446

Query  1211  ERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGA  1390
             ERRAMKREYEE+KVR+NALVAKAQK PEEGW M DGTPWPGNN RDHPGMIQV+LG  G 
Sbjct  447   ERRAMKREYEEFKVRINALVAKAQKIPEEGWTMADGTPWPGNNPRDHPGMIQVFLGHSGG  506

Query  1391  LDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  507   LDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  561



>gb|AFZ78556.1| cellulose synthase [Populus tomentosa]
Length=1075

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/535 (59%), Positives = 388/535 (73%), Gaps = 53/535 (10%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             + C+IC D +GV ENG++FVAC EC FPVC+PCY+YER +G Q CP C TRY+RHKG PR
Sbjct  37    QTCQICGDNVGVTENGDIFVACNECAFPVCRPCYEYERKDGTQSCPQCKTRYRRHKGSPR  96

Query  281   V---------------------VGddedhfegedfeqefeTKNHP---PLSENGDYHNNQ  388
             V                     +G     ++GED E    +++     PL  NG   + +
Sbjct  97    VDGDEDEDDVDDLENEFNYAQGIGKARRQWQGEDIELSSSSRHESQPIPLLTNGQQVSGE  156

Query  389   LPHHNTTNSAAFQPTAAPGSVGGKDLE----------------DEQKEV----FSNAEWK  508
             +P   T ++ + + T+ P     +++                 D  K++      N +WK
Sbjct  157   IPCA-TPDNQSVRTTSGPLGPAERNVNSSPYIDPRQPVPVRIVDPSKDLNSYGLGNIDWK  215

Query  509   DRVEKWKTRQEKR--GLVTRF---dddkggadnedddFLMAD-ARQPLWRKLPISSSLIS  670
             +RVE WK +Q+K    +  R+     D  G  +  D+  MAD ARQPL R +PISSS ++
Sbjct  216   ERVEGWKLKQDKNIMQMTNRYPEGKGDIEGTGSNGDELQMADDARQPLSRVVPISSSHLT  275

Query  671   PYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRE  850
             PYR+VI+ RLIIL FF  +R+  P  DA+ LWL SVICEIWF LSW+LDQFPKW PINRE
Sbjct  276   PYRVVIILRLIILGFFLQYRVTHPVKDAYGLWLTSVICEIWFALSWLLDQFPKWMPINRE  335

Query  851   TYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSC  1030
             TYLDRL+LR+ERDGE  +  LAP+D++VSTVDP+KEPPI+TANTVLSILAVDYPVDKVSC
Sbjct  336   TYLDRLALRYERDGEPSQ--LAPIDIFVSTVDPMKEPPIVTANTVLSILAVDYPVDKVSC  393

Query  1031  YVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVK  1210
             YVSDDG++ML F+ L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK+QP+FVK
Sbjct  394   YVSDDGSAMLTFEALSETAEFARKWVPFCKKHSIEPRAPEFYFAQKIDYLKDKIQPSFVK  453

Query  1211  ERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGA  1390
             ERRAMKREYEE+KVR+NALVAKAQK PEEGW MQDGTPWPGNN RDHPGMIQV+LG  G 
Sbjct  454   ERRAMKREYEEFKVRINALVAKAQKMPEEGWTMQDGTPWPGNNPRDHPGMIQVFLGHSGG  513

Query  1391  LDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  514   LDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  568



>ref|XP_011079382.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X3 [Sesamum indicum]
Length=1029

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/540 (58%), Positives = 388/540 (72%), Gaps = 40/540 (7%)
 Frame = +2

Query  23    AALFTGGSH-------LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGF  181
             +A    GSH       +H   H+E + ++  + ++C IC DEIG+  +GE+FVAC ECGF
Sbjct  4     SAGLVAGSHNRNELVVIHG--HEEPKPLKNLTGQVCEICGDEIGLTVDGELFVACNECGF  61

Query  182   PVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeT--KNHPP  355
             PVC+PCY+YER EGNQ CP C TRYKR KG PRV GDD++    +   +      K++  
Sbjct  62    PVCRPCYEYERREGNQQCPQCKTRYKRLKGSPRVEGDDDEEDIDDIEHEFNINEQKSNTT  121

Query  356   LSENGDYHNNQLPHHNTTNSAAFQPTAAPGS---VGGKDLEDEQKEVFSNA---------  499
             ++E   +           ++A + P  A G    V G+      +++  ++         
Sbjct  122   IAEAMLHGKMSYGRGPEDDTAQYPPVIAGGRSRPVSGELPISYGEQMMGSSLHKRVHPYP  181

Query  500   --------EWKDRVEKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPIS  655
                      WK+R++ WK +Q   G        +     + D  ++ +ARQPL RK+PI+
Sbjct  182   APDDTGKMGWKERMDDWKMQQGNLG-------HEPDDSADPDVAIVDEARQPLSRKVPIA  234

Query  656   SSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWS  835
             SS I+PYR+VIV RL++L FF  +RIL P +DA  LWL SVICEIWF  SWILDQFPKW 
Sbjct  235   SSKINPYRMVIVTRLVVLAFFLRYRILNPVHDALGLWLTSVICEIWFAFSWILDQFPKWF  294

Query  836   PINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPV  1015
             PI+RETYLDRLSLR+ER  EGE N L PVD++VSTVDP+KEPP++TANTVLSILA+DYPV
Sbjct  295   PIDRETYLDRLSLRYER--EGEPNMLTPVDIFVSTVDPMKEPPLVTANTVLSILAMDYPV  352

Query  1016  DKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQ  1195
             DK+SCY+SDDGASM  F+ L+ETAEFAR+WVPFCKK+ IEPRAPE YF EK+DYLKDKVQ
Sbjct  353   DKISCYISDDGASMCTFEALSETAEFARKWVPFCKKFSIEPRAPEMYFFEKVDYLKDKVQ  412

Query  1196  PTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYL  1375
             PTFVKERRAMKREYEE+KVR+NA+VAKA K P  GW+MQDGTPWPGNNT+DHPGMIQV+L
Sbjct  413   PTFVKERRAMKREYEEFKVRINAMVAKAAKIPPGGWIMQDGTPWPGNNTKDHPGMIQVFL  472

Query  1376  GSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             G  G LDV+G ELP+LVYVSREKRPG+QHHKKAGAMNALVRVS VLTNAPFMLNLDCDHY
Sbjct  473   GHSGGLDVKGHELPRLVYVSREKRPGFQHHKKAGAMNALVRVSGVLTNAPFMLNLDCDHY  532



>ref|XP_010254360.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Nelumbo nucifera]
Length=1085

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/536 (58%), Positives = 382/536 (71%), Gaps = 53/536 (10%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             ++C+IC D +GV   G+VFVAC EC FPVC+PCY+YER +GNQ CP C TRYKRHKG PR
Sbjct  37    QICQICGDTVGVTATGDVFVACNECAFPVCRPCYEYERRDGNQSCPQCKTRYKRHKGSPR  96

Query  281   VVGddedhfegedfeqefeTKNHP-------------------------PLSENGDYHNN  385
             V GDDE+    +   +   T  +                          PL  NG   + 
Sbjct  97    VEGDDEEDDIDDLDNEFNYTHGNGKGMRQWQGDDVELSSSSRHESLRSIPLLTNGQPVSG  156

Query  386   QLPHHNTTNSAAFQPTAAPGSVGGKDLE----------------DEQKEV----FSNAEW  505
             ++P+    N +    T+     G K +                 D  K++      N +W
Sbjct  157   EMPNATPDNQSVRTTTSGHLGSGEKRVHSLPYVDPTQPVPVRIVDPSKDLNSYGLGNVDW  216

Query  506   KDRVEKWKTRQEKR--GLVTRFdddkggadnedddF----LMADARQPLWRKLPISSSLI  667
             K+RVE WK +QEK    + +R+ + KG  +    +     +  DARQPL R +PISSS +
Sbjct  217   KERVEGWKLKQEKNMNQIPSRYTEGKGDMEGTGSNGEDLQIADDARQPLHRVVPISSSHL  276

Query  668   SPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINR  847
             +PYR+VI+ RLIIL FF  +RI  P  DA+PLWL SVICEIWF LSW+LDQFPKW P+ R
Sbjct  277   TPYRVVIILRLIILGFFLQYRITHPVNDAYPLWLTSVICEIWFALSWLLDQFPKWYPVER  336

Query  848   ETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVS  1027
             ETYLDRL+LR++R  EGE + L P+D++VSTVDPLKEPP++TANTVLSILAVDYPVDKVS
Sbjct  337   ETYLDRLALRYDR--EGEPSQLPPIDIFVSTVDPLKEPPLVTANTVLSILAVDYPVDKVS  394

Query  1028  CYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFV  1207
             CYVSDDG++ML F+ L+ET+EFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK+QP+FV
Sbjct  395   CYVSDDGSAMLTFEALSETSEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKDKIQPSFV  454

Query  1208  KERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEG  1387
             KERRAMKREYEEYKVR+NALVAKAQK PEEGW MQDGTPWPGNN RDHPGMIQV+LG  G
Sbjct  455   KERRAMKREYEEYKVRINALVAKAQKMPEEGWTMQDGTPWPGNNPRDHPGMIQVFLGHSG  514

Query  1388  ALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
              LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  515   GLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  570



>ref|XP_010241248.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Nelumbo nucifera]
 ref|XP_010241249.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Nelumbo nucifera]
 ref|XP_010241250.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Nelumbo nucifera]
Length=1071

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/545 (58%), Positives = 373/545 (68%), Gaps = 66/545 (12%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             ++C+IC D +G   +GE+F+AC  C F VC+PCY+YER +G Q CP C TRYKRHKG P 
Sbjct  16    QVCQICGDNVGTTVSGELFIACDVCAFSVCRPCYEYERKDGTQSCPQCKTRYKRHKGSPP  75

Query  281   VVG---------------------------------ddedhfegedfeqefeTKNHPPLS  361
             + G                                              +  + NH PL 
Sbjct  76    IRGDPVEDDVDNVDYPSGNQDQKQKIAERMLSWHMSYGRGEDVRTTKYDKEVSLNHIPLL  135

Query  362   ENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGK----------DLED-------EQKEVF  490
              NG   + +L    +  S      A+PG+ GG           D+         +  + F
Sbjct  136   TNGQSVSGEL----SAASPERISMASPGAGGGSKRVHPLPYSADINQSPNIRVVDPAQGF  191

Query  491   SNAEWKDRVEKWKTRQEKRGLVTRFdddkggadn----edddFLMAD------ARQPLWR  640
              N  WK+RVE WK +QEK  +         G          D LM D      ARQPL R
Sbjct  192   GNVAWKERVEGWKVKQEKNVVPVSTHATSEGRGGGDIDAITDVLMDDSLMNDEARQPLSR  251

Query  641   KLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQ  820
             K+PI SS I+PYR+VIV RLIILC F H+RI  P  +A+ LWLISVICEIWF +SWILDQ
Sbjct  252   KVPIPSSRINPYRMVIVLRLIILCIFLHYRITNPVPNAYALWLISVICEIWFAISWILDQ  311

Query  821   FPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILA  1000
             FPKW PINRETYLDRLSLR++R  EGE + LA VD++VSTVDPLKEPP++TANTVLSILA
Sbjct  312   FPKWFPINRETYLDRLSLRYDR--EGETSQLAAVDIFVSTVDPLKEPPLVTANTVLSILA  369

Query  1001  VDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYL  1180
             VDYPVDKVSCYVSDDGA+ML F+ L+ET+EFAR+WVPFCKKY IEPRAPE+YF++KIDYL
Sbjct  370   VDYPVDKVSCYVSDDGAAMLTFEALSETSEFARKWVPFCKKYNIEPRAPEWYFAQKIDYL  429

Query  1181  KDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGM  1360
             KDKVQP+FVK+RRAMKREYEE+KVRVN LVAKAQK P+EGWVMQDGTPWPGNNTRDHPGM
Sbjct  430   KDKVQPSFVKDRRAMKREYEEFKVRVNGLVAKAQKVPDEGWVMQDGTPWPGNNTRDHPGM  489

Query  1361  IQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNL  1540
             IQV+LG  G LD EG ELP+LVYVSREKRPG+QHHKKAGAMNALVRVSAVLTN P++LNL
Sbjct  490   IQVFLGHSGGLDSEGNELPRLVYVSREKRPGFQHHKKAGAMNALVRVSAVLTNGPYLLNL  549

Query  1541  DCDHY  1555
             DCDHY
Sbjct  550   DCDHY  554



>ref|XP_004300066.1| PREDICTED: probable cellulose synthase A catalytic subunit 3 
[UDP-forming]-like [Fragaria vesca subsp. vesca]
Length=1094

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/572 (56%), Positives = 395/572 (69%), Gaps = 64/572 (11%)
 Frame = +2

Query  26    ALFTGGSHLHAADHDERREVERESQ------KMCRICRDEIGVVENGEVFVACRECGFPV  187
             A    GSH        RRE + +S       ++C+IC D++G+  +GE+FVAC EC FP+
Sbjct  5     AGLVAGSHNRNELVVIRRERDGDSAPKGVKGQICQICGDDVGLNADGELFVACNECAFPI  64

Query  188   CKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGdd-----------------edhfege  316
             C+ CY+YER EG+Q CP C TR+KR KGC RV GD+                   H    
Sbjct  65    CRTCYEYERREGSQVCPQCKTRFKRLKGCARVAGDEEEDGVDDLENEFSFDGRSRHDLQH  124

Query  317   dfeqefeTKNHPPL----SENGDYHNN--QLPHHNTTNSA-----------AFQPTAAPG  445
                 +     H       S + D+HN+   +PH     +            A  P+    
Sbjct  125   ALSADAMLHGHMSYGRASSVSSDFHNDLHSIPHLPLLTNGQMVDDIPPEQHALVPSFMGA  184

Query  446   SVGGKDLE----------------DEQKEV----FSNAEWKDRVEKWKTRQEKRGLVT--  559
             + GGK +                 D  K++    + +  WK+R+E WK +QEK  ++   
Sbjct  185   NSGGKRIHPLPFSDPAFPVQPRSMDPSKDLAAYGYGSVAWKERMESWKQKQEKLQMMKHE  244

Query  560   RFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILT  739
                 D     N  D  LM +ARQPL RKLPISSS I+PYR++I+ RL+ L FFFH+R+L 
Sbjct  245   NGGKDSDYDGNGPDLPLMDEARQPLSRKLPISSSQINPYRMIIIIRLVALGFFFHYRVLN  304

Query  740   PAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAP  919
             P  DA+PLWLISVICEIWFG+SWILDQFPKW PI+RETYLDRLSLR+E+  EG+ + L+P
Sbjct  305   PVKDAYPLWLISVICEIWFGVSWILDQFPKWLPIDRETYLDRLSLRYEK--EGQPSQLSP  362

Query  920   VDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFAR  1099
             VD+YVSTVDPLKEPP++TANTVLSILAVDYPVDKVSCYVSDDGA+ML F+ L+ET+EFA+
Sbjct  363   VDIYVSTVDPLKEPPLVTANTVLSILAVDYPVDKVSCYVSDDGAAMLTFEALSETSEFAK  422

Query  1100  RWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKA  1279
             +WVPFCKK+ IEPRAPEFYF++KIDYL+DKV P+FVK+RRAMKREYEE+KVR+NALVAKA
Sbjct  423   KWVPFCKKFNIEPRAPEFYFAQKIDYLRDKVLPSFVKDRRAMKREYEEFKVRINALVAKA  482

Query  1280  QKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQ  1459
              K PEEGW MQDGTPWPGNN RDHPGMIQV+LG  G LD +G ELP+LVYVSREKRPG+ 
Sbjct  483   TKVPEEGWTMQDGTPWPGNNVRDHPGMIQVFLGQSGGLDTDGNELPRLVYVSREKRPGFT  542

Query  1460  HHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             HHKKAGAMNALVRVSAVLTNAP+MLNLDCDHY
Sbjct  543   HHKKAGAMNALVRVSAVLTNAPYMLNLDCDHY  574



>gb|AAY43219.2| cellulose synthase BoCesA3 [Bambusa oldhamii]
Length=1074

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/543 (57%), Positives = 391/543 (72%), Gaps = 44/543 (8%)
 Frame = +2

Query  53    HAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQC  232
             H  D    + ++  ++++C+IC D +G+   G+VFVAC EC FPVC+PCY+YER +GNQC
Sbjct  20    HDGDGAAAKPLKNVNEQICQICGDTVGLSATGDVFVACNECAFPVCRPCYEYERKDGNQC  79

Query  233   CPHCNTRYKRHKGCPRVVGdd------------------------edhfegedfeqefeT  340
             CP C TRYKRHKG PRV GD+                        +   +GED +    +
Sbjct  80    CPQCKTRYKRHKGSPRVPGDEEEDDVDDLDNEFNYKQGNSKGQQWQLRAQGEDVDILSSS  139

Query  341   KNHP----PLSENGDYHNNQLPHHNTTNSAAFQPTAA---PGSVGGKDLEDEQKEVFS--  493
             ++ P    P   +G   +  +P  +    +   PT++   P       + D  K++ S  
Sbjct  140   RHEPHHRIPCLTSGQQISGDIPDASPDRHSIRSPTSSYVDPSIPVPVRIVDPSKDLISYG  199

Query  494   --NAEWKDRVEKWKTRQEKR--GLVTRFdddkggadnedddF-----LMADARQPLWRKL  646
               + +WK+RVE W+ +QEK    +  ++  +  G             ++ DAR PL R +
Sbjct  200   LGSVDWKERVESWRVKQEKNMVHVTNKYPAEGKGDIEGTGSNGEDLQMVDDARLPLSRIV  259

Query  647   PISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFP  826
             PI ++ ++ YR+VI+ RLIILCFFF +RI  P +DA+ LWL+SVICE+WF LSW+LDQFP
Sbjct  260   PIPANQLNLYRVVIILRLIILCFFFQYRITHPVWDAYGLWLVSVICEVWFALSWLLDQFP  319

Query  827   KWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVD  1006
             KW PINRETYLDRL+LR++R  EGE + LAP+DV+VSTVDPLKEPP+ITANTVLSILAVD
Sbjct  320   KWYPINRETYLDRLALRYDR--EGEPSQLAPIDVFVSTVDPLKEPPLITANTVLSILAVD  377

Query  1007  YPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKD  1186
             YPVDKVSCYVSDDG++ML F+ L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKD
Sbjct  378   YPVDKVSCYVSDDGSAMLTFEALSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKD  437

Query  1187  KVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQ  1366
             K+QP+FVKERRAMKREYEE+KVR+NALVAKAQK PEEGW M DGTPWPGNN RDHPGMIQ
Sbjct  438   KIQPSFVKERRAMKREYEEFKVRINALVAKAQKVPEEGWTMADGTPWPGNNPRDHPGMIQ  497

Query  1367  VYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDC  1546
             V+LG  G LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DC
Sbjct  498   VFLGHSGGLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDC  557

Query  1547  DHY  1555
             DHY
Sbjct  558   DHY  560



>gb|KEH32616.1| cellulose synthase-like protein [Medicago truncatula]
Length=734

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/553 (58%), Positives = 388/553 (70%), Gaps = 57/553 (10%)
 Frame = +2

Query  23    AALFTGGSH-------LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGF  181
             +A    GSH       +H   H+E + ++    ++C IC D++G+  +G++FVAC ECGF
Sbjct  4     SAGLVAGSHNRNELVVIHG--HEEHKPLKNLDGQVCEICGDDVGLTVDGDLFVACNECGF  61

Query  182   PVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedf---eqefeTKNHP  352
             PVC+PCY+YER EG Q CP C TRYKR KG PRV GDD++    +     + E +  NH 
Sbjct  62    PVCRPCYEYERREGRQLCPQCKTRYKRLKGSPRVEGDDDEEDVDDIEHEFKIEDKMNNHD  121

Query  353   PLSE---NGDYHNNQLPHHNTTNSAAFQPTAAPG--------------SVGGKDLEDEQK  481
               +E   +G     + P  +   +A F    A G              S G + L    K
Sbjct  122   HSAEAMLHGKMSYGRGPEDD--ENAHFPAVIAGGRSRNVSGEFPISSHSYGEQMLSSLHK  179

Query  482   EVF-------SNAEWK--------DRVEKWKTRQEKRGLVTRFdddkggadnedddFLMA  616
              V         +A W         DR++ WK +Q   G            D + D  +  
Sbjct  180   RVHPYSASDSRSAGWDERREDGSYDRMDDWKLQQGNLG---------PEPDEDLDANMSD  230

Query  617   DARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWF  796
             +ARQPL RK+PI+SS I+PYR+VIV RL+IL FF  +R++ P +DA  LWL S+ICEIWF
Sbjct  231   EARQPLSRKVPIASSKINPYRMVIVARLVILGFFLRYRLMNPVHDAMGLWLTSIICEIWF  290

Query  797   GLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITA  976
              +SWILDQFPKW PI+RETYLDRLSLR+ER  EGE N LAPVDV+VSTVDPLKEPP+ TA
Sbjct  291   AISWILDQFPKWYPIDRETYLDRLSLRYER--EGEPNMLAPVDVFVSTVDPLKEPPLNTA  348

Query  977   NTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFY  1156
             NTVLSILA+DYP+DK+SCY+SDDGASM  F+ L+ETAEFAR+WVPFCKK+ IEPRAPE Y
Sbjct  349   NTVLSILAMDYPIDKISCYISDDGASMCTFEALSETAEFARKWVPFCKKFLIEPRAPEMY  408

Query  1157  FSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGN  1336
             FSEKIDYLKDKVQPTFVKERR+MKREYEE+KVR+NALVAKAQK P  GW+MQDGTPWPGN
Sbjct  409   FSEKIDYLKDKVQPTFVKERRSMKREYEEFKVRINALVAKAQKVPAGGWIMQDGTPWPGN  468

Query  1337  NTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLT  1516
             NT+DHPGMIQV+LG  G  D EG +LP+LVYVSREKRPG+QHHKKAGAMNALVRVSAVLT
Sbjct  469   NTKDHPGMIQVFLGHSGGHDSEGNQLPRLVYVSREKRPGFQHHKKAGAMNALVRVSAVLT  528

Query  1517  NAPFMLNLDCDHY  1555
             NAPFMLNLDCDHY
Sbjct  529   NAPFMLNLDCDHY  541



>ref|XP_006660635.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming]-like 
[Oryza brachyantha]
Length=1053

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/563 (57%), Positives = 385/563 (68%), Gaps = 62/563 (11%)
 Frame = +2

Query  23    AALFTGGSH-----LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPV  187
             +A    GSH     +    H+E + +   S ++C IC DE+G+  +G++FVAC ECGFPV
Sbjct  4     SAGLVAGSHNRNELVLIRGHEEPKPLRALSGQVCEICGDEVGLTVDGDLFVACNECGFPV  63

Query  188   CKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSEN  367
             C+PCY+YER EG Q CP C TRYKR KG PRV GDD++    +   +    +    L + 
Sbjct  64    CRPCYEYERREGTQNCPQCKTRYKRLKGSPRVPGDDDEEDIDDLEHEFNIDEKQKQLQQE  123

Query  368   GDYHNNQL--------------PHHNTTNSAAFQPTAA----------------------  439
                 N+ +              P     NS    P                         
Sbjct  124   EGMQNSHITEAMLHGKMSYGRGPDDGDGNSTPLPPIITGARSVPVSGEFPISNSHGHGEF  183

Query  440   -----------PGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkgga  586
                        P S  G    DE+KEV     WK+R++ WK++Q   G+V          
Sbjct  184   SSSLHKRIHPYPVSEPGSAKWDEKKEV----SWKERMDDWKSKQ---GIVAGGGAADPDD  236

Query  587   dnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLW  766
              + D   L  +ARQPL RK+ I+SS ++PYR+VI+ RL++L FF  +RIL P  DA PLW
Sbjct  237   YDADVP-LNDEARQPLSRKVAIASSKVNPYRMVIILRLVVLGFFLRYRILHPVPDAIPLW  295

Query  767   LISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVD  946
             L S+ICEIWF  SWILDQFPKW PI+RETYLDRLSLR+ER  EGE + LA VD++VSTVD
Sbjct  296   LTSIICEIWFAFSWILDQFPKWFPIDRETYLDRLSLRYER--EGEPSLLAAVDLFVSTVD  353

Query  947   PLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKY  1126
             PLKEPP++TANTVLSILAVDYPVDKVSCYVSDDGASML F++L+ETAEFAR+WVPFCKK+
Sbjct  354   PLKEPPLVTANTVLSILAVDYPVDKVSCYVSDDGASMLTFESLSETAEFARKWVPFCKKF  413

Query  1127  CIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWV  1306
              IEPRAPEFYFS+K+DYLKDKV P FV+ERRAMKREYEE+KVR+NALVAKAQK P EGW+
Sbjct  414   SIEPRAPEFYFSQKVDYLKDKVHPNFVQERRAMKREYEEFKVRINALVAKAQKVPAEGWI  473

Query  1307  MQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMN  1486
             M+DGTPWPGNNTRDHPGMIQV+LG  G  D EG ELP+LVYVSREKRPG+QHHKKAGAMN
Sbjct  474   MKDGTPWPGNNTRDHPGMIQVFLGHSGGHDTEGNELPRLVYVSREKRPGFQHHKKAGAMN  533

Query  1487  ALVRVSAVLTNAPFMLNLDCDHY  1555
             AL+RVSAVLTNAPFMLNLDCDHY
Sbjct  534   ALIRVSAVLTNAPFMLNLDCDHY  556



>tpg|DAA53225.1| TPA: cellulose synthase3 [Zea mays]
Length=1073

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/556 (58%), Positives = 392/556 (71%), Gaps = 45/556 (8%)
 Frame = +2

Query  17    SMAALFTGGSHLHAADHD-ERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCK  193
              M A   GG      D D   ++++  ++++C+IC D +G+   G++FVAC EC FPVC+
Sbjct  6     GMVAGSRGGVVTIRHDGDGAAKQLKNVNEQICQICGDTLGLSATGDIFVACNECAFPVCR  65

Query  194   PCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNH---PPLSE  364
             PCY+YER EGNQCCP C TRYKRHKG PRV GD+E+    +   +   T+ +   P    
Sbjct  66    PCYEYERKEGNQCCPQCKTRYKRHKGSPRVRGDEEEDGVDDLDNEFNYTQGNVQGPQWQL  125

Query  365   NGDYHNNQL-------PHHNTTNSAAFQ------PTAAPGSVGGKD--------------  463
              G   +  +       PHH        Q      P A+P     +               
Sbjct  126   RGQGEDVDISSSSRHEPHHRIPRLTTGQQMSGDIPDASPDRHSIRSPTPSYVDPSIPVPV  185

Query  464   -LEDEQKEVFS----NAEWKDRVEKWKTRQEKRGLVTRF------dddkggadnedddFL  610
              + D  K++ S    + +WK+RVE WK RQ+K  +            D  G  +  +D  
Sbjct  186   RIVDPSKDLNSYGVGSVDWKERVESWKVRQDKNMIQVTHKYPAEGKGDIEGTGSNGEDLQ  245

Query  611   MA-DARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICE  787
             MA DAR PL R +PIS + ++ YRIVIV RLIILCFFF +RI  P  DA+ LWL+SVICE
Sbjct  246   MADDARLPLSRIVPISPNELNLYRIVIVLRLIILCFFFQYRITHPVEDAYGLWLVSVICE  305

Query  788   IWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPI  967
             +WF LSW+LDQFPKW PINRETYLDRL+LR++R  EGE + LAP+DV+VSTVDPLKEPP+
Sbjct  306   VWFALSWLLDQFPKWYPINRETYLDRLALRYDR--EGEPSQLAPIDVFVSTVDPLKEPPL  363

Query  968   ITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAP  1147
             IT NTVLSILAVDYPVDKVSCYVSDDG++ML F+ L+ETAEFAR+WVPFCKK+ IEPRAP
Sbjct  364   ITGNTVLSILAVDYPVDKVSCYVSDDGSAMLTFEALSETAEFARKWVPFCKKHNIEPRAP  423

Query  1148  EFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPW  1327
             EFYF++KIDYLKDK+QP+FVKERRAMKREYEE+KVR+NALVAKAQK PEEGW M DGTPW
Sbjct  424   EFYFAQKIDYLKDKIQPSFVKERRAMKREYEEFKVRINALVAKAQKIPEEGWTMADGTPW  483

Query  1328  PGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSA  1507
             PGNN RDHPGMIQV+LG  G LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSA
Sbjct  484   PGNNPRDHPGMIQVFLGHSGGLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSA  543

Query  1508  VLTNAPFMLNLDCDHY  1555
             VLTN  ++LN+DCDHY
Sbjct  544   VLTNGAYLLNVDCDHY  559



>gb|AAY43225.1| cellulose synthase BoCesA3 [Bambusa oldhamii]
Length=1074

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/543 (58%), Positives = 390/543 (72%), Gaps = 44/543 (8%)
 Frame = +2

Query  53    HAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQC  232
             H  D    + ++  ++++C+IC D +G+   G+VFVAC EC FPVC+PCY+YER +GNQC
Sbjct  20    HDGDGAAAKPLKNVNEQICQICGDTVGLSATGDVFVACNECAFPVCRPCYEYERKDGNQC  79

Query  233   CPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPP-----LSENGD-----YHN  382
             CP C TRYKRHKG PRV GD+E+    +   +    + +       L   G+       +
Sbjct  80    CPQCKTRYKRHKGSPRVPGDEEEEDVDDLDNEFNYKQGNSKGQQWQLRAQGEDVDILSSS  139

Query  383   NQLPHHNTTNSAAFQ------PTAAPGSVGGKD---------------LEDEQKEVFS--  493
                PHH      + Q      P A+P     +                + D  K++ S  
Sbjct  140   RHEPHHRIPRLTSGQQISGDIPDASPDRHSIRSPASSYVDPSIPVPVRIVDPSKDLISYG  199

Query  494   --NAEWKDRVEKWKTRQEKRGL-VTRFdddkggadnedddF------LMADARQPLWRKL  646
               + +WK+RVE W+ +QEK  + VT     +G  D E          ++ DAR PL R +
Sbjct  200   LGSVDWKERVESWRVKQEKNMVHVTNKYPAEGKGDIEGTGSNGEDLQMVDDARLPLSRIV  259

Query  647   PISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFP  826
             PI ++ ++ YR+VI+ RLIILCFFF +RI  P +DA+ LWL+SVICE+WF LSW+LDQFP
Sbjct  260   PIPANQLNLYRVVIILRLIILCFFFQYRITHPVWDAYGLWLVSVICEVWFALSWLLDQFP  319

Query  827   KWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVD  1006
             KW PINRETYLDRL+LR++R  EGE + LAP+DV+VSTVDPLKEPP+ITANTVLSILAVD
Sbjct  320   KWYPINRETYLDRLALRYDR--EGEPSQLAPIDVFVSTVDPLKEPPLITANTVLSILAVD  377

Query  1007  YPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKD  1186
             YPVDKVSCYVSDDG++ML F+ L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKD
Sbjct  378   YPVDKVSCYVSDDGSAMLTFEALSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKD  437

Query  1187  KVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQ  1366
             K+QP+FVKERRAMKREYEE+KVR+NALVAKAQK PEEGW M DGTPWPGNN RDHPGMIQ
Sbjct  438   KIQPSFVKERRAMKREYEEFKVRINALVAKAQKVPEEGWTMADGTPWPGNNPRDHPGMIQ  497

Query  1367  VYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDC  1546
             V+LG  G LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DC
Sbjct  498   VFLGHSGGLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDC  557

Query  1547  DHY  1555
             DHY
Sbjct  558   DHY  560



>emb|CDX85455.1| BnaA02g03580D [Brassica napus]
Length=975

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/546 (58%), Positives = 384/546 (70%), Gaps = 50/546 (9%)
 Frame = +2

Query  23    AALFTGGSH-----LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPV  187
             +A    GSH     +   +H+E + ++    + C IC D+IG+   G++FVAC ECGFP 
Sbjct  4     SAGLVAGSHNRNELVVIHNHEEPKPLKNLDGQFCEICGDQIGLTVEGDLFVACNECGFPA  63

Query  188   CKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNH------  349
             C+PCY+YER EG Q CP C TRYKR +G PRV GD+++    +   +      H      
Sbjct  64    CRPCYEYERREGTQNCPQCKTRYKRLRGSPRVEGDEDEEDIDDIEHEFNIDDEHNKQNHS  123

Query  350   --------------PPLSENGDYHNNQLPHHNTTNSAAFQPTAA----------PGSVGG  457
                           P   ENG +       H+   S  F               P S  G
Sbjct  124   AESMLYGKMSYGRGPDDDENGRFPPVIAGGHSRHVSGEFPAGGEHGLHKRVHPYPSSEAG  183

Query  458   KDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLW  637
              +  D++KE      W++R++ WK +Q   G            D++ D  L+ +ARQPL 
Sbjct  184   SERWDDKKE----GGWRERMDDWKLQQGNLG---------PEPDDDPDMGLIDEARQPLS  230

Query  638   RKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILD  817
             RK+PI+SS I+PYR+VIV RL+IL  F  +R+L P +DA  LWL SVICEIWF +SWILD
Sbjct  231   RKVPIASSKINPYRMVIVARLVILAVFLRYRLLNPVHDALGLWLTSVICEIWFAVSWILD  290

Query  818   QFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSIL  997
             QFPKW PI+RETYLDRLSLR+ER  EGE N LAPVDV+VSTVDP+KEPP++T+NTVLSIL
Sbjct  291   QFPKWFPIDRETYLDRLSLRYER--EGEPNMLAPVDVFVSTVDPMKEPPLVTSNTVLSIL  348

Query  998   AVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDY  1177
             A+DYPV+K+SCYVSDDGASML FD+LAETAEFAR+WVPFCKK+ IEPRAPE YF+ KIDY
Sbjct  349   AMDYPVEKISCYVSDDGASMLTFDSLAETAEFARKWVPFCKKFSIEPRAPEMYFTLKIDY  408

Query  1178  LKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPG  1357
             LKDKVQPTFVKERRAMKREYEE+KVR+NALVAKA K P EGW+M DGTPWPGNNT+DHPG
Sbjct  409   LKDKVQPTFVKERRAMKREYEEFKVRINALVAKASKVPLEGWIMPDGTPWPGNNTKDHPG  468

Query  1358  MIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLN  1537
             MIQV+LGS G  DVEG ELP+LVYVSREKRPG+QHHKKAGAMNALVRV+ VLTNAPFMLN
Sbjct  469   MIQVFLGSNGGFDVEGHELPRLVYVSREKRPGFQHHKKAGAMNALVRVAGVLTNAPFMLN  528

Query  1538  LDCDHY  1555
             LDCDHY
Sbjct  529   LDCDHY  534



>gb|AFS95066.1| cellulose synthase [Rosa hybrid cultivar]
Length=1094

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/572 (57%), Positives = 400/572 (70%), Gaps = 64/572 (11%)
 Frame = +2

Query  26    ALFTGGSHLHAADHDERREVERESQ------KMCRICRDEIGVVENGEVFVACRECGFPV  187
             A    GSH        RRE + +S       ++C+IC D++G+  +GE+FVAC EC FPV
Sbjct  5     AGLVAGSHNRNELVVIRRERDGDSAPKGLKGQICQICGDDVGLNADGELFVACSECAFPV  64

Query  188   CKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqef-eTKNHPPL--  358
             C+ CY+YER EG+Q CP C TR+KR KGC RV GD+E+    +   +   + +N   L  
Sbjct  65    CRTCYEYERREGSQVCPQCKTRFKRLKGCARVAGDEEEDGVDDLENEFSFDGRNRHDLQH  124

Query  359   ------------------SENGDYHNN--QLPHHNTTNSA-----------AFQPTAAPG  445
                               S + D+HN+   +PH     +            A  P+    
Sbjct  125   ALSADAMLHGHMSYGRASSVSSDFHNDLHSIPHLPLLTNGQMVDDIPPEQHALVPSFMGA  184

Query  446   SVGGKDLE----------------DEQKEV----FSNAEWKDRVEKWKTRQEKRGLVT--  559
             + GGK +                 D  K++    + +  WK+R+E WK +QEK  ++   
Sbjct  185   NSGGKRIHPLPFSDPAFPVQPRSMDPSKDLAAYGYGSVAWKERMESWKQKQEKLQMMKHE  244

Query  560   RFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILT  739
                 D     N  D  LM +ARQPL RKLPISSS I+PYR++I+ RL+ L FFFH+RIL 
Sbjct  245   NGGKDYDYDGNGPDLPLMDEARQPLSRKLPISSSQINPYRMIIIIRLVALGFFFHYRILN  304

Query  740   PAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAP  919
             P  DA+PLWLISVICEIWFG+SWILDQFPKW PI+RETYLDRLSLR+E+  EG+ + L+P
Sbjct  305   PVNDAYPLWLISVICEIWFGVSWILDQFPKWLPIDRETYLDRLSLRYEK--EGQPSQLSP  362

Query  920   VDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFAR  1099
             VD++VSTVDPLKEPP++TANTVLSILAVDYPVDKVSCYVSDDGA+ML F+ L+ET+EFA+
Sbjct  363   VDIFVSTVDPLKEPPLVTANTVLSILAVDYPVDKVSCYVSDDGAAMLTFEALSETSEFAK  422

Query  1100  RWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKA  1279
             +WVPFCKK+ IEPRAPEFYF++KIDYL+DKV P+FVK+RRAMKREYEE+KVR+NALVAKA
Sbjct  423   KWVPFCKKFNIEPRAPEFYFAQKIDYLRDKVLPSFVKDRRAMKREYEEFKVRINALVAKA  482

Query  1280  QKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQ  1459
              K PEEGW MQDGTPWPGN+ RDHPGMIQV+LG  G LD +G ELP+LVYVSREKRPG+ 
Sbjct  483   TKVPEEGWTMQDGTPWPGNSVRDHPGMIQVFLGQSGGLDTDGNELPRLVYVSREKRPGFT  542

Query  1460  HHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             HHKKAGAMNALVRVSAVLTNAP+MLNLDCDHY
Sbjct  543   HHKKAGAMNALVRVSAVLTNAPYMLNLDCDHY  574



>ref|XP_002308657.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEE92180.1| cellulose synthase family protein [Populus trichocarpa]
Length=1075

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/535 (59%), Positives = 388/535 (73%), Gaps = 53/535 (10%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             + C+IC D +GV ENG++FVAC EC FPVC+PCY+YER +G Q CP C TRY+RHKG PR
Sbjct  37    QTCQICGDNVGVTENGDIFVACNECAFPVCRPCYEYERKDGTQSCPQCKTRYRRHKGSPR  96

Query  281   V---------------------VGddedhfegedfeqefeTKNHP---PLSENGDYHNNQ  388
             V                     +G     ++GED E    +++     PL  NG   + +
Sbjct  97    VDGDEDEDDVDDLENEFNYAQGIGKARRQWQGEDIELSSSSRHESQPIPLLTNGQPVSGE  156

Query  389   LPHHNTTNSAAFQPTAAPGSVGGKDLE----------------DEQKEV----FSNAEWK  508
             +P   T ++ + + T+ P     +++                 D  K++      N +WK
Sbjct  157   IPCA-TPDNQSVRTTSGPLGPAERNVNSSPYIDPRQPVHVRIVDPSKDLNSYGLGNVDWK  215

Query  509   DRVEKWKTRQEKR--GLVTRF---dddkggadnedddFLMAD-ARQPLWRKLPISSSLIS  670
             +RVE WK +Q+K    +  R+     D  G  +  D+  MAD ARQPL R +PISSS ++
Sbjct  216   ERVEGWKLKQDKNIMQMTNRYPEGKGDIEGTGSNGDELQMADDARQPLSRVVPISSSHLT  275

Query  671   PYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRE  850
             PYR+VI+ RLIIL FF  +R+  P  DA+ LWL SVICEIWF LSW+LDQFPKW PINRE
Sbjct  276   PYRVVIILRLIILGFFLQYRVTHPVKDAYGLWLTSVICEIWFALSWLLDQFPKWMPINRE  335

Query  851   TYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSC  1030
             TYLDRL+LR++RDGE  +  LAP+D++VSTVDPLKEPPI+TANTVLSILAVDYPVDKVSC
Sbjct  336   TYLDRLALRYDRDGEPSQ--LAPIDIFVSTVDPLKEPPIVTANTVLSILAVDYPVDKVSC  393

Query  1031  YVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVK  1210
             YVSDDG++ML F+ L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK+QP+FVK
Sbjct  394   YVSDDGSAMLTFEALSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKDKIQPSFVK  453

Query  1211  ERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGA  1390
             ERRAMKREYEE+KVR+NALVAKAQK PEEGW MQDGTPWPGNN RDHPGMIQV+LG  G 
Sbjct  454   ERRAMKREYEEFKVRINALVAKAQKMPEEGWTMQDGTPWPGNNPRDHPGMIQVFLGHSGG  513

Query  1391  LDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  514   LDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  568



>ref|XP_007137035.1| hypothetical protein PHAVU_009G094200g [Phaseolus vulgaris]
 gb|ESW09029.1| hypothetical protein PHAVU_009G094200g [Phaseolus vulgaris]
Length=1084

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/550 (57%), Positives = 389/550 (71%), Gaps = 51/550 (9%)
 Frame = +2

Query  53    HAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQC  232
             H +     + ++  + ++C+IC D +G+   G+VFVAC EC FPVC+PCY+YER +GNQ 
Sbjct  22    HDSSDSGSKPLKSLNGQICQICGDTVGLTATGDVFVACNECAFPVCRPCYEYERKDGNQS  81

Query  233   CPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHP--------------------  352
             CP C TRYKRH+G PRV GD+++    +   +                            
Sbjct  82    CPQCKTRYKRHRGSPRVEGDEDEEDSDDIENEFNYAPGKAKARRQWEEDADLSSSSRRES  141

Query  353   ----PLSENGDYHNNQLP------HHNTTNSAAFQPTAAPGSVGGKD--------LEDEQ  478
                 PL  NG   + ++P          T S    P+    S+   D        + D  
Sbjct  142   QQPIPLLTNGQTISGEIPCATPDTQSVRTTSGPLGPSEKVHSLPYIDPRQPVPVRIVDPS  201

Query  479   KEV----FSNAEWKDRVEKWKTRQEKR--GLVTRFdd-----dkggadnedddFLMADAR  625
             K++      N +WK+RVE WK +QEK    +  R+ +      +G   N ++  ++ DAR
Sbjct  202   KDLNSYGLGNVDWKERVEGWKLKQEKNMVQMTGRYAEGKGGDVEGTGSNGEELQMVDDAR  261

Query  626   QPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLS  805
             QP+ R +PISSS ++PYR+VIV RLIIL FF  +R+  P  DA+PLWL SVICEIWF LS
Sbjct  262   QPMSRVVPISSSQLTPYRVVIVLRLIILGFFLQYRVTHPVKDAYPLWLTSVICEIWFALS  321

Query  806   WILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTV  985
             WILDQFPKWSPINRETYL+RL+LR++R  EGE + L PVDV+VSTVDPLKEPP++TANTV
Sbjct  322   WILDQFPKWSPINRETYLERLALRYDR--EGEPSQLDPVDVFVSTVDPLKEPPLVTANTV  379

Query  986   LSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSE  1165
             LSIL+VDYPVDKVSCYVSDDG++ML F+ L+ETAEFA++WVPFCKK+ IEPRAPEFYF++
Sbjct  380   LSILSVDYPVDKVSCYVSDDGSAMLTFEALSETAEFAKKWVPFCKKHNIEPRAPEFYFAQ  439

Query  1166  KIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTR  1345
             KIDYLKDK+QP+FVKERRAMKREYEE+KVR+NALVAKAQK PEEGW MQDGTPWPGNN R
Sbjct  440   KIDYLKDKIQPSFVKERRAMKREYEEFKVRINALVAKAQKTPEEGWTMQDGTPWPGNNPR  499

Query  1346  DHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAP  1525
             DHPGMIQV+LG  G LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  
Sbjct  500   DHPGMIQVFLGHSGGLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGA  559

Query  1526  FMLNLDCDHY  1555
             ++LN+DCDHY
Sbjct  560   YLLNVDCDHY  569



>ref|XP_010048223.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Eucalyptus grandis]
 gb|KCW80412.1| hypothetical protein EUGRSUZ_C01769 [Eucalyptus grandis]
Length=1082

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/532 (60%), Positives = 387/532 (73%), Gaps = 49/532 (9%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             +MC+IC D +G+  +G+VFVAC EC FPVC+PCY+YER +GNQCCP C TRYKR KG PR
Sbjct  37    QMCQICGDTVGLSASGDVFVACNECAFPVCRPCYEYERKDGNQCCPQCKTRYKRQKGSPR  96

Query  281   VVGddedhfegedfeqefeTKN-----------------------HP-PLSENGDYHNNQ  388
             V GDD++    +   +   T+                        HP PL  NG   + +
Sbjct  97    VEGDDDEDGVDDLENEFSYTRGNARRRQWQGEDPDLSSSSRRESQHPVPLLTNGLPISGE  156

Query  389   LPHHNTTNSAAFQPTAAPG-----SVGGKD--------LEDEQKEVFS----NAEWKDRV  517
             +P     N +    +   G     SV   D        + D  +++ S    N +WK+RV
Sbjct  157   IPCATPDNQSVRTTSGPLGPSDRHSVHSVDPRQPVPVRIVDPSRDLNSYGLGNVDWKERV  216

Query  518   EKWKTRQEKR--GLVTRF---dddkggadnedddFLMA-DARQPLWRKLPISSSLISPYR  679
             E WK +QEK    + +RF     D  G  +  ++  MA DAR PL R +PISSS ++PYR
Sbjct  217   ESWKLKQEKNIPHMTSRFPEGKGDIEGTGSNGEELQMANDARLPLSRVVPISSSHLTPYR  276

Query  680   IVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYL  859
             +VI+ RLIIL FF  +R   P  DA+PLWL SVICEIWF LSW+LDQFPKW PINRETYL
Sbjct  277   VVIILRLIILGFFLQYRATHPVKDAYPLWLTSVICEIWFALSWLLDQFPKWFPINRETYL  336

Query  860   DRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVS  1039
             DRL+LR++R  EGE + LAP+D++VSTVDPLKEPP++TANTVLSILAVDYPVDKVSCYVS
Sbjct  337   DRLALRYDR--EGEPSQLAPIDIFVSTVDPLKEPPLVTANTVLSILAVDYPVDKVSCYVS  394

Query  1040  DDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERR  1219
             DDG++ML F+ L+ETAEFA++WVPFCKK+ IEPRAPEFYF++KIDYLKDK+QP+FVKERR
Sbjct  395   DDGSAMLTFEALSETAEFAKKWVPFCKKHNIEPRAPEFYFAQKIDYLKDKIQPSFVKERR  454

Query  1220  AMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDV  1399
             AMKREYEE+KVR+NALVAKAQK PEEGW MQDGTPWPGNN RDHPGMIQV+LG  G LD 
Sbjct  455   AMKREYEEFKVRINALVAKAQKVPEEGWTMQDGTPWPGNNPRDHPGMIQVFLGHSGGLDT  514

Query  1400  EGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  515   DGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  566



>ref|XP_002529615.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative 
[Ricinus communis]
 gb|EEF32760.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative 
[Ricinus communis]
Length=899

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/546 (57%), Positives = 377/546 (69%), Gaps = 58/546 (11%)
 Frame = +2

Query  77    REVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRY  256
             +  ++ + ++C+IC D +G   NGE FVAC  C FPVC+PCY+YER +GNQ CP C T+Y
Sbjct  13    KNAKQNAIQICQICSDNVGTTVNGEPFVACHVCAFPVCRPCYEYERKDGNQSCPQCKTKY  72

Query  257   KRHKGCPRVVGddedhfegedfeqefeTKNH----------------------------P  352
             KRHKG P + G+D +  +  D E      NH                             
Sbjct  73    KRHKGSPPIRGEDVEDTDYSDVED---KPNHHASGIQDEKQKIEHMLGWEASSGRKDYVA  129

Query  353   PLSENGDYHNNQLPHHNTTNSAAFQPTAAP-----------GS---VGGKDLEDEQKEVF  490
             P + + +   N +P+     S + + +AA            GS   +  +D   E    F
Sbjct  130   PTNYDKEVSLNHIPYLAGRRSVSGELSAASPERYSMASPESGSRVNIRVRDPARESGSSF  189

Query  491   SNAEWKDRVEKWKTRQEKRGLVTRFddd-----------kggadnedddFLMADARQPLW  637
              N  WK+R++ WK + EK        +                   DD  L  + RQPL 
Sbjct  190   GNVAWKERIDGWKMKPEKNPAPMSVSNAPSEGRGGGDFDASTDVLMDDSLLNDETRQPLS  249

Query  638   RKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILD  817
             RK+ + SS I+PYR+VIV RLIILC F H+RI  P  DA+PLWLISVICEIWF +SWILD
Sbjct  250   RKVSLPSSRINPYRMVIVLRLIILCIFLHYRITNPVKDAYPLWLISVICEIWFAISWILD  309

Query  818   QFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSIL  997
             QFPKW P+NRETYLDRL+LR+E+  EGE + LA VD++VSTVDPLKEPP++TANTVLSIL
Sbjct  310   QFPKWLPVNRETYLDRLALRYEK--EGEPSQLASVDIFVSTVDPLKEPPLVTANTVLSIL  367

Query  998   AVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDY  1177
             AVDYPVDKVSCYVSDDGA+ML F+ L+ET+EFAR+WVPFCKKY IEPRAPE+YF++KIDY
Sbjct  368   AVDYPVDKVSCYVSDDGAAMLTFEALSETSEFARKWVPFCKKYNIEPRAPEWYFAQKIDY  427

Query  1178  LKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPG  1357
             LKDKVQP+FVK+RR+MKREYEE+K+R+N LVAKAQK P+EGWVMQDGTPWPGNN RDHPG
Sbjct  428   LKDKVQPSFVKDRRSMKREYEEFKIRINGLVAKAQKVPDEGWVMQDGTPWPGNNIRDHPG  487

Query  1358  MIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLN  1537
             MIQV+LG  G  D EG ELP+LVYVSREKRPG+QHHKKAGAMNALVRVSAVLTN PF+LN
Sbjct  488   MIQVFLGHSGGFDTEGNELPRLVYVSREKRPGFQHHKKAGAMNALVRVSAVLTNGPFLLN  547

Query  1538  LDCDHY  1555
             LDCDHY
Sbjct  548   LDCDHY  553



>ref|XP_011083940.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Sesamum indicum]
Length=1041

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/547 (59%), Positives = 388/547 (71%), Gaps = 42/547 (8%)
 Frame = +2

Query  23    AALFTGGSH-------LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGF  181
             +A    GSH       +H   H+E + ++  S ++C IC DEIG+  +GE+FVAC ECGF
Sbjct  4     SAGLVAGSHNRNELVVIHG--HEEPKPLKNLSGQVCEICGDEIGLTVDGELFVACNECGF  61

Query  182   PVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedf--eqefeTKNHPP  355
             PVC+PCY+YER EG+Q CP C TRYKR KG PRV GDD++    +        E K +  
Sbjct  62    PVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRVEGDDDEEDIDDIEHEFNIDEQKTNTS  121

Query  356   LSE---NGDYHNNQLPHHNTTNSAAFQPTAAPG------------------SVGGKDLED  472
             ++E   +G     + P  +  ++A + P  A G                   + G  L  
Sbjct  122   IAEAMLHGKMRYGRGPEDD--DNAQYPPVIAGGRSRPVSGEIPISSHAYGEQMMGASLHK  179

Query  473   EQKEVFS-----NAEWKDRVE-KWKTRQEKRGLVTRFdddkggadnedddFLMADARQPL  634
                   S     +  W D+ E  WK R ++  +             + D  ++ +ARQPL
Sbjct  180   RVHPYPSIDGPGSGRWDDKKEMGWKERMDEWKMQQGNLGHDNDDFADPDMAIVDEARQPL  239

Query  635   WRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWIL  814
              RK+PI+SS I+PYR+VIV RL++L FF  +RIL P +DA  LWL S+ICEIWF  SWIL
Sbjct  240   SRKVPIASSKINPYRMVIVTRLVVLAFFLRYRILNPVHDALGLWLTSIICEIWFAFSWIL  299

Query  815   DQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSI  994
             DQFPKW PI+RETYLDRLSLR+ER  EGE N LAPVD++VSTVDP+KEPP++TANTVLSI
Sbjct  300   DQFPKWFPIDRETYLDRLSLRYER--EGEPNMLAPVDIFVSTVDPMKEPPLVTANTVLSI  357

Query  995   LAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKID  1174
             LA+DYPVDK+SCY+SDDGASM  F+ L+ETAEFAR+WVPFCKK+ IEPRAPE YFSEK+D
Sbjct  358   LAMDYPVDKISCYISDDGASMCTFEALSETAEFARKWVPFCKKFAIEPRAPEMYFSEKVD  417

Query  1175  YLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHP  1354
             YLKDKVQPTFVKERRAMKREYEE+KVR+NA+VAKA K P  GW+MQDGTPWPGNNT+DHP
Sbjct  418   YLKDKVQPTFVKERRAMKREYEEFKVRINAMVAKATKVPPGGWIMQDGTPWPGNNTKDHP  477

Query  1355  GMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFML  1534
             GMIQV+LG  G LDVEG ELP+LVYVSREKRPG+QHHKKAGAMNALVRVS VLTNAPFML
Sbjct  478   GMIQVFLGQSGGLDVEGHELPRLVYVSREKRPGFQHHKKAGAMNALVRVSGVLTNAPFML  537

Query  1535  NLDCDHY  1555
             NLDCDHY
Sbjct  538   NLDCDHY  544



>ref|XP_011018058.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Populus euphratica]
Length=1032

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/554 (58%), Positives = 392/554 (71%), Gaps = 60/554 (11%)
 Frame = +2

Query  23    AALFTGGSH-------LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGF  181
             +A    GSH       +H   H+E + ++    ++C IC DEIG+  +G++FVAC ECGF
Sbjct  4     SAGLVAGSHNRNELVVIHG--HEEHKPLKNLDGQVCEICGDEIGLTVDGDLFVACNECGF  61

Query  182   PVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedf---eqefeTKNHP  352
             PVC+PCY+YER EG Q CP C TRYKR KG PRV GDDE+    +       E E   + 
Sbjct  62    PVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRVEGDDEEDDVDDIEHEFIIEDEQDKNK  121

Query  353   PLSE------------NGDYHNNQLP-------------------HHNTTNSAAFQPTAA  439
              L+E            + D  N+Q P                   H     S++      
Sbjct  122   HLTEAMLHGKMTYGRGHDDEENSQFPPVITGIRSRPVSGEFSIGSHGEQMLSSSLHKRVH  181

Query  440   PGSVG--GKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadnedddFLM  613
             P  V   G    DE+KE      WK+R+++WK +Q   G            D++ +  ++
Sbjct  182   PYPVSEPGSARWDEKKE----GGWKERMDEWKMQQGNLG---------PEQDDDAEAAML  228

Query  614   ADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIW  793
              DARQPL RK+PI+SS I+PYR+VIV RLIIL  F  +RIL P +DA  LWL S++CEIW
Sbjct  229   EDARQPLSRKVPIASSKINPYRMVIVARLIILAVFLRYRILHPVHDAIGLWLTSIVCEIW  288

Query  794   FGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIIT  973
             F +SWILDQFPKW PI+RETYLDRLSLR+E+  EGE N LAPVD++VSTVDP+KEPP++T
Sbjct  289   FAISWILDQFPKWLPIDRETYLDRLSLRYEQ--EGEPNMLAPVDIFVSTVDPMKEPPLVT  346

Query  974   ANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEF  1153
              NT+LSILA+DYPV+K+SCY+SDDGASM  F+T++ETAEFAR+WVPFCKK+ IEPRAPEF
Sbjct  347   GNTILSILAMDYPVEKISCYLSDDGASMCTFETMSETAEFARKWVPFCKKFNIEPRAPEF  406

Query  1154  YFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPG  1333
             YF+ K+DYLKDKVQPTFVKERRAMKREYEE+KVR+NA+VAKAQK P EGW+MQDGTPWPG
Sbjct  407   YFTLKVDYLKDKVQPTFVKERRAMKREYEEFKVRINAIVAKAQKVPTEGWIMQDGTPWPG  466

Query  1334  NNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVL  1513
             NNTRDHPGMIQV+LG  G  DVEG ELP+LVYVSREKRPG+ HHKKAGAMNAL+RVSAVL
Sbjct  467   NNTRDHPGMIQVFLGHSGGHDVEGNELPRLVYVSREKRPGFSHHKKAGAMNALIRVSAVL  526

Query  1514  TNAPFMLNLDCDHY  1555
             TNAPFMLNLDCDHY
Sbjct  527   TNAPFMLNLDCDHY  540



>emb|CDP13491.1| unnamed protein product [Coffea canephora]
Length=1082

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/548 (57%), Positives = 389/548 (71%), Gaps = 50/548 (9%)
 Frame = +2

Query  53    HAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQC  232
             H +     + ++  + ++C+IC D +G+  +G++FVAC EC FPVC+PCY+YER +GNQ 
Sbjct  22    HDSTDSGPKPLKNLNGQICQICGDGVGLTADGDMFVACNECAFPVCRPCYEYERKDGNQS  81

Query  233   CPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHP--------------------  352
             CP C TRYKRHKG PRV GDD++    +   +    +                       
Sbjct  82    CPQCKTRYKRHKGSPRVDGDDDEDDVDDLDNEFNYAQGTSKARRQWQGEDAELSSSSRHD  141

Query  353   ---PLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDL-----------------ED  472
                PL  NG   + ++P   T  + + + T+ P   G K L                 +D
Sbjct  142   RPIPLLTNGQPVSGEIPIA-TPETRSVRSTSGPLGPGDKALPYLDPRQPVPVRIVDPSKD  200

Query  473   EQKEVFSNAEWKDRVEKWKTRQEKR--GLVTRF----dddkggadnedddFLMAD-ARQP  631
                    + +WK+RVE WK +QEK    +  R+      D  G  +  ++  MAD ARQP
Sbjct  201   LNSYGLGSVDWKERVESWKLKQEKNMVHMANRYPEGKGGDIEGTGSNGEELQMADDARQP  260

Query  632   LWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWI  811
             + R +PISSS ++PYR+VI+ RLIIL FF  +R   P  DA+PLWL SVICEIWF LSW+
Sbjct  261   MSRIVPISSSHVTPYRVVIILRLIILGFFLQYRCTHPVKDAYPLWLTSVICEIWFALSWL  320

Query  812   LDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLS  991
             LDQFPKW PINRET++DRL++R++R  EGE + LAPVDV+VSTVDP+KEPP+ITANTVLS
Sbjct  321   LDQFPKWYPINRETFVDRLAMRYDR--EGEPSQLAPVDVFVSTVDPMKEPPLITANTVLS  378

Query  992   ILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKI  1171
             ILAVDYPVDKVSCYVSDDG++ML F+ L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KI
Sbjct  379   ILAVDYPVDKVSCYVSDDGSAMLTFEALSETAEFARKWVPFCKKHSIEPRAPEFYFAQKI  438

Query  1172  DYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDH  1351
             DYLKDK+QP+FVKERRAMKREYEE+KVR+NALVAKAQK PEEGW MQDGTPWPGNN RDH
Sbjct  439   DYLKDKIQPSFVKERRAMKREYEEFKVRINALVAKAQKMPEEGWTMQDGTPWPGNNARDH  498

Query  1352  PGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFM  1531
             PGMIQV+LG  G LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++
Sbjct  499   PGMIQVFLGHSGGLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYL  558

Query  1532  LNLDCDHY  1555
             LN+DCDHY
Sbjct  559   LNVDCDHY  566



>gb|AFG25776.1| cellulose synthase 2 [Bambusa emeiensis]
Length=1074

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/543 (57%), Positives = 387/543 (71%), Gaps = 44/543 (8%)
 Frame = +2

Query  53    HAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQC  232
             H  D    + ++  ++++C+IC D +G+   G+VFVAC EC FPVC+PCY+YER +GNQC
Sbjct  20    HDGDGAAAKPLKNVNEQICQICGDTVGLSATGDVFVACNECAFPVCRPCYEYERKDGNQC  79

Query  233   CPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPP-----LSENGD-----YHN  382
             CP C TRYKRHKG PRV GD+E+    +   +    + +       L   G+       +
Sbjct  80    CPQCKTRYKRHKGSPRVPGDEEEEDVDDLDNEFNYKQGNSKGQQWQLQAQGEDVDILSSS  139

Query  383   NQLPHHNTTNSAAFQ------PTAAPGSVGGKD---------------LEDEQKEV----  487
                PHH      + Q      P A+P     +                + D  K++    
Sbjct  140   RHEPHHRIPRLTSGQQISGDIPDASPDRHSIRSPTSSYVDPSIPVPVRIVDPSKDLNSYG  199

Query  488   FSNAEWKDRVEKWKTRQEKR--GLVTRFdddkggadnedddF-----LMADARQPLWRKL  646
               + +WK+RVE W+ +QEK    +  ++  +  G             ++ DAR PL R +
Sbjct  200   LGSVDWKERVESWRVKQEKNMVHVTNKYPAEGKGDIEGTGSNGEDLQMVDDARLPLSRIV  259

Query  647   PISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFP  826
             PI ++ ++ YR+VI+ RLIILCFFF +RI  P +DA+ LWL+SVICE+WF LSW+LDQFP
Sbjct  260   PIPANQLNLYRVVIILRLIILCFFFQYRITHPVWDAYGLWLVSVICEVWFALSWLLDQFP  319

Query  827   KWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVD  1006
             KW PINRETYLDRL+LR++R  EGE + LAP+DV+VSTVDPLKEPP+ITANTVLSILAVD
Sbjct  320   KWYPINRETYLDRLALRYDR--EGEPSQLAPIDVFVSTVDPLKEPPLITANTVLSILAVD  377

Query  1007  YPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKD  1186
             YPVDKVSCYVSDDG++ML F+ L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKD
Sbjct  378   YPVDKVSCYVSDDGSAMLTFEALSETAEFARKWVPFCKKHHIEPRAPEFYFAQKIDYLKD  437

Query  1187  KVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQ  1366
             K+QP+FVKERRAMKREYEE+KVR+NALVAKAQK PEEGW M DGTPWPGNN RDHPGMIQ
Sbjct  438   KIQPSFVKERRAMKREYEEFKVRINALVAKAQKVPEEGWTMADGTPWPGNNPRDHPGMIQ  497

Query  1367  VYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDC  1546
             V+LG  G LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DC
Sbjct  498   VFLGHSGGLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDC  557

Query  1547  DHY  1555
             DHY
Sbjct  558   DHY  560



>gb|ACJ38667.1| cellulose synthase [Betula luminifera]
Length=1093

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/543 (58%), Positives = 397/543 (73%), Gaps = 52/543 (10%)
 Frame = +2

Query  77    REVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRY  256
             R +++ S ++C+IC D++G+  +GE+FVAC EC FP+C+ CY+YER EGNQ CP C TR+
Sbjct  29    RPLQQLSGQICQICGDDVGLTVDGELFVACNECAFPICRTCYEYERREGNQVCPQCKTRF  88

Query  257   KRHKGCPRVVGddedhfegedfeq---efeTKN--HPPLSENGDYH-----NNQLPH--H  400
             KR KGC RV GD+E+    +   +   +  TK   H  L+ +   H     ++ LPH  H
Sbjct  89    KRLKGCARVQGDEEEDGIDDLENEFNFDARTKQDMHHALAADAMLHYGRASDSDLPHVIH  148

Query  401   NT------TNSA----------AFQPTAAPGSVGGKDLE----------------DEQKE  484
             +T      TN            A  P+   G+ GGK +                 D  K+
Sbjct  149   STPQVPLLTNGQMVDDIPPEQHALVPSFMGGAGGGKRIHPLPLSDPAFPVQPRSMDPSKD  208

Query  485   V----FSNAEWKDRVEKWKTRQEKRGLVTRFdddkg--gadnedddFLMADARQPLWRKL  646
             +    + +  WK+R+E WK +Q+K  ++ + +  K      +  D  LM +ARQPL RKL
Sbjct  209   LAAYGYGSVAWKERMENWKQKQDKLQMMKKENSGKDWDYDGDGPDLPLMDEARQPLSRKL  268

Query  647   PISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFP  826
             PI SS I+PYR++I+ RL++L FFFH+R++ P +DAF LWL+SVICEIWF LSWILDQFP
Sbjct  269   PIPSSQINPYRMIIIIRLVVLGFFFHYRVMHPVHDAFALWLVSVICEIWFALSWILDQFP  328

Query  827   KWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVD  1006
             KW PI+RETYLDRLSLR+E+  EG+ + L PVD++VSTVDPLKEPP++TANTVLSILAVD
Sbjct  329   KWLPIDRETYLDRLSLRYEK--EGQPSQLCPVDIFVSTVDPLKEPPLVTANTVLSILAVD  386

Query  1007  YPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKD  1186
             YPVDKVSCYVSDDGA+ML F+ L+ET+EFA++WVPF KK+ IEPRAPEFYF++K+DYLKD
Sbjct  387   YPVDKVSCYVSDDGAAMLTFEALSETSEFAKKWVPFSKKFNIEPRAPEFYFAQKMDYLKD  446

Query  1187  KVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQ  1366
             KV P+FVKERRAMKREYEE+KVR+NALVAKAQK PEEGW MQDGTPWPGNN RDHPGMIQ
Sbjct  447   KVLPSFVKERRAMKREYEEFKVRINALVAKAQKVPEEGWTMQDGTPWPGNNVRDHPGMIQ  506

Query  1367  VYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDC  1546
             V+LG  G  D +G ELP+LVYVSREKRPG+ HHKKAGAMNALVRVSAVLTNA +MLNLDC
Sbjct  507   VFLGQSGGHDTDGNELPRLVYVSREKRPGFNHHKKAGAMNALVRVSAVLTNAAYMLNLDC  566

Query  1547  DHY  1555
             DHY
Sbjct  567   DHY  569



>ref|XP_011081578.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Sesamum indicum]
Length=1084

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/566 (57%), Positives = 394/566 (70%), Gaps = 58/566 (10%)
 Frame = +2

Query  26    ALFTGGSH----LHAADHDE---RREVERESQKMCRICRDEIGVVENGEVFVACRECGFP  184
             A    GSH    L    HD     + ++  + ++C+IC D +G+  NG+VFVAC EC FP
Sbjct  5     AGMVAGSHKRNELVRIRHDSDTGSKPLKNLNGQICQICGDTVGLAANGDVFVACNECAFP  64

Query  185   VCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhf-------------------  307
             VC+ CY+YER +GNQ CP C TRYKRHKG PRV GDD++                     
Sbjct  65    VCRACYEYERKDGNQACPQCKTRYKRHKGSPRVDGDDDEDDIDDLENEFSYSQGKVKARS  124

Query  308   ------egedfeqefeTKNHPPLSENGDYHNNQLP------HHNTTNSAAFQPTAAPGSV  451
                            E++   PL  NG   + ++P      H   + S    P     S+
Sbjct  125   QWPGDDAELSASSRRESQQPIPLLTNGQSVSGEIPPSLQDTHSVRSTSGPLGPGDRVHSL  184

Query  452   GGKD--------LEDEQKEVFS----NAEWKDRVEKWKTRQEKRGL-----VTRFdddkg  580
                D        + D  K++ S    N +WK+RVE WK +QEK  +      +    D  
Sbjct  185   PYVDPRQPVPVRIIDPSKDLNSYGLGNVDWKERVEGWKLKQEKNMVQMNNRYSEGKGDVE  244

Query  581   gadnedddFLMAD-ARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAF  757
             G  +  ++  MAD ARQPL R +PISS+ ++PYR+VI+ RLIIL FF  +R   P  DA+
Sbjct  245   GTGSNGEELQMADDARQPLSRVVPISSTHLTPYRVVIILRLIILGFFLQYRCTHPVKDAY  304

Query  758   PLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVS  937
             PLWL SVICE+WF LSW+LDQFPKW P++RETYL+RL+LR++R  EGE + LAPVDV+VS
Sbjct  305   PLWLTSVICEVWFALSWLLDQFPKWYPVDRETYLERLALRYDR--EGEPSQLAPVDVFVS  362

Query  938   TVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFC  1117
             TVDP+KEPP+ITANTVLSILAVDYPVDKVSCYVSDDGA+ML F+ L+ETAEFAR+WVPFC
Sbjct  363   TVDPMKEPPLITANTVLSILAVDYPVDKVSCYVSDDGAAMLTFEALSETAEFARKWVPFC  422

Query  1118  KKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEE  1297
             KK+ IEPRAPEFYF++KIDYLKDK+QP+FVKERRAMKREYEE+KVR+NALVAKAQK PEE
Sbjct  423   KKHNIEPRAPEFYFAQKIDYLKDKIQPSFVKERRAMKREYEEFKVRINALVAKAQKMPEE  482

Query  1298  GWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAG  1477
             GW MQDGTPWPGNNTRDHPGMIQV+LG  G LD +G ELP+LVYVSREKRPG+QHHKKAG
Sbjct  483   GWTMQDGTPWPGNNTRDHPGMIQVFLGHSGGLDTDGNELPRLVYVSREKRPGFQHHKKAG  542

Query  1478  AMNALVRVSAVLTNAPFMLNLDCDHY  1555
             AMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  543   AMNALIRVSAVLTNGAYLLNVDCDHY  568



>gb|KDP33612.1| hypothetical protein JCGZ_07183 [Jatropha curcas]
Length=1084

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/536 (58%), Positives = 385/536 (72%), Gaps = 54/536 (10%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             + C+IC D +GV  +G+ FVAC EC FPVC+PCY+YER +G Q CP C TRY+RHKG PR
Sbjct  37    QTCQICGDNVGVTASGDTFVACNECAFPVCRPCYEYERKDGTQSCPQCKTRYRRHKGSPR  96

Query  281   VVGddedhfegedfeqefeTKNHP-------------------------PLSENGDYHNN  385
             V GD+++    +   +    + +                          PL  NG   + 
Sbjct  97    VEGDEDEDDVDDLENEFNYAQGNSKTRRQWQGEDVDLSSSSRHESQQPIPLLTNGQSVSG  156

Query  386   QLPHHNTTNSAAFQPTAAPGSVGGKDLE----------------DEQKEVFS----NAEW  505
             ++P   T ++ + + T+ P     K++                 D  K++ S    N +W
Sbjct  157   EIPCA-TLDTQSVRTTSGPLGPAEKNVNSTPYIDPRQPVPVRIVDPSKDLNSYGLGNVDW  215

Query  506   KDRVEKWKTRQEKRGL-----VTRFdddkggadnedddFLMAD-ARQPLWRKLPISSSLI  667
             K+RVE WK +QEK  +      T    D  G  +  ++  MAD ARQPL R +PI SS +
Sbjct  216   KERVEGWKLKQEKNMMQMTNRYTEGKGDMEGTGSNGEELQMADDARQPLSRVVPIPSSHL  275

Query  668   SPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINR  847
             +PYR+VI+ RLIIL FF  +R   P   A+PLWL SVICEIWF LSW+LDQFPKWSPINR
Sbjct  276   TPYRVVIILRLIILGFFLQYRASHPVEGAYPLWLTSVICEIWFALSWLLDQFPKWSPINR  335

Query  848   ETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVS  1027
             ETYLDRL+LR++R  EGE + LAPVDV+VSTVDPLKEPP++TANTVLSILAVDYPVDKVS
Sbjct  336   ETYLDRLALRYDR--EGEPSQLAPVDVFVSTVDPLKEPPLVTANTVLSILAVDYPVDKVS  393

Query  1028  CYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFV  1207
             CYVSDDG++ML F+ L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK+QP+FV
Sbjct  394   CYVSDDGSAMLTFEALSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKDKIQPSFV  453

Query  1208  KERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEG  1387
             KERRAMKREYEE+KVR+NALVAKAQK PEEGW MQDGTPWPGNN RDHPGMIQV+LG  G
Sbjct  454   KERRAMKREYEEFKVRINALVAKAQKMPEEGWTMQDGTPWPGNNPRDHPGMIQVFLGHNG  513

Query  1388  ALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             +LD++G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  514   SLDMDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  569



>ref|XP_002324291.1| TGACG-motif binding family protein [Populus trichocarpa]
 gb|EEF02856.1| TGACG-motif binding family protein [Populus trichocarpa]
Length=1084

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/535 (58%), Positives = 390/535 (73%), Gaps = 53/535 (10%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             + C+IC D +GV ENG++FVAC EC FPVC+PCY+YER +G Q CP C TRY+RHKG PR
Sbjct  37    QTCQICGDNVGVTENGDIFVACNECAFPVCRPCYEYERKDGTQSCPQCKTRYRRHKGSPR  96

Query  281   V---------------------VGddedhfegedfeqefeTKNHP---PLSENGDYHNNQ  388
             V                     +G+ +  ++G+D E    +++     PL  NG   + +
Sbjct  97    VDGDEDEDGVDDLENEFNYAQGIGNAKHQWQGDDIELSSSSRHESQPIPLLTNGQPVSGE  156

Query  389   LPHHNTTNSAAFQPTAAPGSVGGKDLE----------------DEQKEV----FSNAEWK  508
             +P   T ++ + + T+ P     +++                 D  K++      N +WK
Sbjct  157   IPCA-TPDNQSVRTTSGPLGPAERNVHSSPYIDPRQPVHVRIVDPSKDLNSYGLGNVDWK  215

Query  509   DRVEKWKTRQEKR--GLVTRFdddkggadneddd---FLMAD-ARQPLWRKLPISSSLIS  670
             +RVE WK +Q+K    +  R+ + KG  +    +     MAD ARQP+ R +PISSS ++
Sbjct  216   ERVEGWKLKQDKNMMQMTNRYSEGKGDMEGTGSNGDELQMADDARQPMSRVVPISSSYLT  275

Query  671   PYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRE  850
             PYR+VI+ RLIIL FF  +R+  P  DA+ LWL SVICEIWF LSW+LDQFPKW PINRE
Sbjct  276   PYRVVIILRLIILGFFLQYRVTHPVKDAYGLWLTSVICEIWFALSWLLDQFPKWMPINRE  335

Query  851   TYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSC  1030
             TYLDRL+LR++R  EGE + LAP+D++VSTVDP+KEPP++TANTVLSILAVDYPVDKVSC
Sbjct  336   TYLDRLALRYDR--EGEPSQLAPIDIFVSTVDPMKEPPLVTANTVLSILAVDYPVDKVSC  393

Query  1031  YVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVK  1210
             YVSDDG++ML F+ L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK+QP+FVK
Sbjct  394   YVSDDGSAMLTFEALSETAEFARKWVPFCKKHSIEPRAPEFYFAQKIDYLKDKIQPSFVK  453

Query  1211  ERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGA  1390
             ERRAMKREYEE+KVR+NALVAKAQK PEEGW MQDGTPWPGNN RDHPGMIQV+LG  G 
Sbjct  454   ERRAMKREYEEFKVRINALVAKAQKMPEEGWTMQDGTPWPGNNPRDHPGMIQVFLGHSGG  513

Query  1391  LDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  514   LDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  568



>ref|XP_010257191.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Nelumbo nucifera]
Length=1076

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/550 (58%), Positives = 375/550 (68%), Gaps = 71/550 (13%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             ++C+IC D +G   +GE+F+AC  C FPVC+PCY+YER +G Q CP C TRYKRHKG P 
Sbjct  16    QVCQICGDNVGTTVSGELFIACDVCAFPVCRPCYEYERKDGTQSCPQCKTRYKRHKGSPP  75

Query  281   VVGddedhfegedfeqef---------------------------------eTKNHPPLS  361
             + GD  +    +                                        + NH PL 
Sbjct  76    IRGDPVEDDMDDVDYSSGNQDQKQKIAERMLSWHMSYGRGEDVRTPNYDKEVSLNHIPLL  135

Query  362   ENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKD------------------LEDEQKEV  487
              NG   + +L    +  S      A+PG+ GG                    + D  +E 
Sbjct  136   TNGQSVSGEL----SAASPERISMASPGAGGGSKRVHPLPYSVDANQSPNIRVVDPAREF  191

Query  488   ----FSNAEWKDRVEKWKTRQEKRGLVTRFdddk---------ggadnedddFLMAD-AR  625
                 F N  WKDRVE WK +QEK  +                    D   DD LM D AR
Sbjct  192   GSQGFGNVAWKDRVEGWKVKQEKNVVPVSTHATSEGRGGGDIDASTDVLLDDSLMNDEAR  251

Query  626   QPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLS  805
             QPL RK+ I S+ I+PYR+VIV RLIILC F H+RI  P  +A+ LWLISVICEIWF +S
Sbjct  252   QPLSRKVSIPSARINPYRMVIVLRLIILCIFLHYRITNPVPNAYALWLISVICEIWFAMS  311

Query  806   WILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTV  985
             WILDQFPKW P+NRETYLDRLSLR++R  EGE + LA VD++VSTVDPLKEPP++TANTV
Sbjct  312   WILDQFPKWLPVNRETYLDRLSLRYDR--EGEPSQLAAVDIFVSTVDPLKEPPLVTANTV  369

Query  986   LSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSE  1165
             LSILAVDYPVDKVSCYVSDDGA+ML F+ L+ET+EFAR+WVPFCKKY IEPRAPE+YF++
Sbjct  370   LSILAVDYPVDKVSCYVSDDGAAMLTFEALSETSEFARKWVPFCKKYNIEPRAPEWYFAQ  429

Query  1166  KIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTR  1345
             KIDYLKDKV P+FVK+RRAMKREYEE+KVRVN LVAKAQK PEEGWVMQDGTPWPGNNTR
Sbjct  430   KIDYLKDKVHPSFVKDRRAMKREYEEFKVRVNGLVAKAQKVPEEGWVMQDGTPWPGNNTR  489

Query  1346  DHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAP  1525
             DHPGMIQV+LG  G LD EG ELP+LVYVSREKRPG+QHHKKAGAMNALVRVSAVLTN P
Sbjct  490   DHPGMIQVFLGHSGGLDSEGNELPRLVYVSREKRPGFQHHKKAGAMNALVRVSAVLTNGP  549

Query  1526  FMLNLDCDHY  1555
             ++LNLDCDHY
Sbjct  550   YLLNLDCDHY  559



>ref|XP_003578137.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming] 
[Brachypodium distachyon]
Length=1051

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/565 (57%), Positives = 389/565 (69%), Gaps = 67/565 (12%)
 Frame = +2

Query  23    AALFTGGSH-----LHAADHDERREVERESQKMCRICRDEIGVVENG-EVFVACRECGFP  184
              A    GSH     +    H++ + V   S ++C IC DE+G   +G ++FVAC ECGFP
Sbjct  4     GAGLVAGSHNRNELVLIRGHEDHKPVRALSGQVCEICGDEVGRTADGDQLFVACNECGFP  63

Query  185   VCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVG------------------------d  292
             VC+PCY+YER EG Q CP C TRYKR KG PRV G                         
Sbjct  64    VCRPCYEYERREGTQNCPQCKTRYKRLKGSPRVEGDDDEEDIDDIEHEFNIDDDDKQRAI  123

Query  293   dedhfegedfeqefeTKNHPPLSENGDYHNNQ--LPHHNTTN-----SAAFQPTAAPG--  445
                +             ++   SE+G   NN   +P   T N     S  F  +A+ G  
Sbjct  124   QLHNNSHITEAMLHGRMSYGRASEDGGEGNNTPLVPPIITGNRSMPVSGEFPMSASHGHG  183

Query  446   ---------------SVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkg  580
                            S  G    DE+KEV     WK+R++ WK++Q   G          
Sbjct  184   DFSSSLHKRIHPYPMSEPGSAKWDEKKEV----SWKERMDDWKSKQGILGTAD-------  232

Query  581   gadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFP  760
               D + D  +  +ARQPL RK+ I+SS ++PYR+VI+ RLI+LC F  +RIL P  +A P
Sbjct  233   PDDMDADVPINDEARQPLSRKVSIASSKVNPYRMVIILRLIVLCVFLRYRILNPVPEAIP  292

Query  761   LWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVST  940
             LWL S+ICEIWF +SWILDQFPKW PI+RETYLDRLSLR+ER  EGE + L+PVD++VST
Sbjct  293   LWLTSIICEIWFAVSWILDQFPKWYPIDRETYLDRLSLRYER--EGEPSLLSPVDLFVST  350

Query  941   VDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCK  1120
             VDPLKEPP++TANTVLSILAVDYPVDKVSCYVSDDGASML F++L+ETAEFAR+WVPFCK
Sbjct  351   VDPLKEPPLVTANTVLSILAVDYPVDKVSCYVSDDGASMLSFESLSETAEFARKWVPFCK  410

Query  1121  KYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEG  1300
             K+ IEPRAPEFYFS K+DYLKDKVQPTFV+ERRAMKREYEE+KVR+NALV+KAQK P+EG
Sbjct  411   KFNIEPRAPEFYFSRKVDYLKDKVQPTFVQERRAMKREYEEFKVRINALVSKAQKVPDEG  470

Query  1301  WVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGA  1480
             W+M+DGTPWPGNNTRDHPGMIQV+LG  G LD +G ELP+LVYVSREKRPG+QHHKKAGA
Sbjct  471   WIMKDGTPWPGNNTRDHPGMIQVFLGHSGGLDTDGNELPRLVYVSREKRPGFQHHKKAGA  530

Query  1481  MNALVRVSAVLTNAPFMLNLDCDHY  1555
             MNAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  531   MNALIRVSAVLTNAPFMLNLDCDHY  555



>gb|AAY43218.1| cellulose synthase BoCesA2 [Bambusa oldhamii]
Length=1073

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/543 (58%), Positives = 389/543 (72%), Gaps = 44/543 (8%)
 Frame = +2

Query  53    HAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQC  232
             H  D    + +   ++++C+IC D +G+   G+VFVAC EC FPVC+PCY+YER +GNQC
Sbjct  20    HDGDGAAAKPLNNVNEQICQICGDTLGLSATGDVFVACNECAFPVCRPCYEYERKDGNQC  79

Query  233   CPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHP--------PLSENGDYHNNQ  388
             CP C TRYKRHKG PRV GDDE+    +   +    + +            E+ D  ++ 
Sbjct  80    CPQCKTRYKRHKGSPRVPGDDEEEDVDDLDNEFNYKQGNSKGQQWQLRAQGEDVDISSSS  139

Query  389   L--PHHNTTNSAAFQ------PTAAPGSVGGKD---------------LEDEQKEV----  487
                PHH      + Q      P A+P     +                + D  K++    
Sbjct  140   RHEPHHRIPRLTSGQQISGDIPDASPDRHSIRSPTSSYIDPSIPVPVRIVDPSKDLNSYG  199

Query  488   FSNAEWKDRVEKWKTRQEKRGLV------TRFdddkggadnedddFLMAD-ARQPLWRKL  646
               + +WK+RVE W+ +QEK  +       T    D  G  +  +D  MAD AR PL R +
Sbjct  200   LGSVDWKERVESWRVKQEKNMIQVTNKYPTEGKGDIEGTGSNGEDLQMADDARLPLSRIV  259

Query  647   PISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFP  826
             PI ++ ++ YR+VI+ RLIILCFFF +RI  P +DA+ LWL+SVICE+WF LSW+LDQFP
Sbjct  260   PIPANQLNLYRVVIILRLIILCFFFQYRITHPVWDAYGLWLVSVICEVWFALSWLLDQFP  319

Query  827   KWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVD  1006
             KW P+NRETYLDRL+LR++R  EGE + LAP+DV+VSTVDPLKEPP+ITANTVLSILAVD
Sbjct  320   KWYPMNRETYLDRLALRYDR--EGEPSQLAPIDVFVSTVDPLKEPPLITANTVLSILAVD  377

Query  1007  YPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKD  1186
             YPVDKVSCYVSDDG++ML F+ L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKD
Sbjct  378   YPVDKVSCYVSDDGSAMLTFEALSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKD  437

Query  1187  KVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQ  1366
             K+QP+FVKERRAMKREYEE+KVR+NALVAKAQK PEEGW M DGTPWPGNN RDHPGMIQ
Sbjct  438   KIQPSFVKERRAMKREYEEFKVRINALVAKAQKVPEEGWTMADGTPWPGNNPRDHPGMIQ  497

Query  1367  VYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDC  1546
             V+LG  G LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DC
Sbjct  498   VFLGHSGGLDADGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDC  557

Query  1547  DHY  1555
             DHY
Sbjct  558   DHY  560



>ref|XP_011093547.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Sesamum indicum]
Length=1047

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/534 (59%), Positives = 381/534 (71%), Gaps = 52/534 (10%)
 Frame = +2

Query  95    SQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGC  274
               ++C+IC D +G+  +GE FVAC  C FPVC+PCY+YER +GNQ CP C TRYKRHKG 
Sbjct  2     GSQVCQICGDNVGLTVDGEPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGS  61

Query  275   PRVVGddedhfegedfeqefeTKNHPPLSE-------------------NGDYHNNQLPH  397
             P + GD ++    +D        +   +SE                   + +  +N +P 
Sbjct  62    PAIHGDGDEDSVADDLHYSENHGDKQKISERMLSWHMNYGREGVGAPKYDKEVSHNHIPL  121

Query  398   -HNTTNSAAFQPTAAPGSVGGKD----------LEDEQKEVFS----NAEWKDRVEKWKT  532
               N T+ +     A+PG +              + D  +E  S    N  WK+RV+ WK 
Sbjct  122   LTNGTDVSGELSAASPGRLSMASPPPGGGGKPRIVDPVREFGSPGLGNVAWKERVDGWKM  181

Query  533   RQEK-------------RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISP  673
             +QEK             RG     D D       DD  L  +ARQPL RK+ I SS I+P
Sbjct  182   KQEKPVVPMTTSHPPSERG---AGDIDASTDVLVDDSLLNDEARQPLSRKVSIPSSKINP  238

Query  674   YRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRET  853
             YR+VIV RL+ILC F H+RI  P  +AF LWLISVICEIWF +SWILDQFPKW P+NRET
Sbjct  239   YRMVIVLRLVILCIFLHYRITNPVPNAFALWLISVICEIWFAISWILDQFPKWLPVNRET  298

Query  854   YLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCY  1033
             YLDRL+LR++R  EGE + LA VD++VSTVDPLKEPP++TANTVLSIL+VDYPVDKVSCY
Sbjct  299   YLDRLALRYDR--EGEPSQLAAVDIFVSTVDPLKEPPLVTANTVLSILSVDYPVDKVSCY  356

Query  1034  VSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKE  1213
             VSDDGA+ML F+ L+ET+EFAR+WVPFCKKY IEPRAPE+YF++KIDYLKDKVQP+FVK+
Sbjct  357   VSDDGAAMLTFEALSETSEFARKWVPFCKKYNIEPRAPEWYFAQKIDYLKDKVQPSFVKD  416

Query  1214  RRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGAL  1393
             RRAMKREYEE+K+R+NALVAKAQK PEEGW+MQDGTPWPGNNTRDHPGMIQV+LG  G L
Sbjct  417   RRAMKREYEEFKIRINALVAKAQKVPEEGWIMQDGTPWPGNNTRDHPGMIQVFLGQSGGL  476

Query  1394  DVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             D +G ELP+LVYVSREKRPG+QHHKKAGAMNALVRVSAVLTN PF+LNLDCDHY
Sbjct  477   DSDGNELPRLVYVSREKRPGFQHHKKAGAMNALVRVSAVLTNGPFLLNLDCDHY  530



>ref|XP_001757887.1| cellulose synthase 5, glycosyltransferase family 2 [Physcomitrella 
patens]
 gb|EDQ77129.1| cellulose synthase 5, glycosyltransferase family 2 [Physcomitrella 
patens]
Length=1081

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/553 (57%), Positives = 387/553 (70%), Gaps = 65/553 (12%)
 Frame = +2

Query  62    DHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPH  241
             DH+  + + + + + C+IC D++GV  +GE+FVAC ECGFPVC+PC++YER EGNQ CP 
Sbjct  23    DHEGPKPLSQVNSQFCQICGDDVGVTVDGELFVACFECGFPVCRPCFEYERKEGNQSCPQ  82

Query  242   CNTRYKRHKGCPRVVGddedhfegedfeqefeTKN------------HPPLSENGDYHNN  385
             C +RY R KG PRV GD+E+    +   +                  H  +S  G+Y +N
Sbjct  83    CKSRYNRQKGSPRVPGDEEEDDTDDLENEFALEMGQLDEQNVTDAMLHGHMSYGGNYDHN  142

Query  386   QLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEV--------------------------  487
                 H T       P    G +G  DL+D+   +                          
Sbjct  143   LPNLHQTPQF----PLLTDGKMG--DLDDDSHAIVLPPPMNGGKRVHPLPYIESNLPVQA  196

Query  488   -------------FSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadnedddF----LMA  616
                          + +  WKDRVE WK RQEK  ++T       G D + D+     +M 
Sbjct  197   RPMDPTKDLAAYGYGSVAWKDRVESWKMRQEK--MMTEGSHHHKGGDMDGDNGPDLPIMD  254

Query  617   DARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWF  796
             +ARQPL RK+PISS+ I+PYR++IV RL++L FFF +RIL P   A+ +WL SVICEIWF
Sbjct  255   EARQPLSRKVPISSARINPYRMLIVIRLVVLAFFFRYRILNPVEGAYGMWLTSVICEIWF  314

Query  797   GLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITA  976
              +SWILDQFPKW PINRETYLDRLSLR+E+  EGE + L  VD++VSTVDP+KEPP++TA
Sbjct  315   AISWILDQFPKWLPINRETYLDRLSLRYEK--EGEPSQLEHVDIFVSTVDPMKEPPLVTA  372

Query  977   NTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFY  1156
             NT+LSILAVDYPVDKVSCY+SDDGA+ML F+ ++ET+EFAR+WVPFCKK+ IEPRAPE Y
Sbjct  373   NTILSILAVDYPVDKVSCYLSDDGAAMLTFECISETSEFARKWVPFCKKFSIEPRAPEMY  432

Query  1157  FSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGN  1336
             F++KIDYLKDKVQPTFVKERRAMKREYEE+KVRVNALVAKAQK PEEGW MQDGTPWPGN
Sbjct  433   FAQKIDYLKDKVQPTFVKERRAMKREYEEFKVRVNALVAKAQKVPEEGWTMQDGTPWPGN  492

Query  1337  NTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLT  1516
             N+RDHPGMIQV+LG  G  D +G ELP+LVYVSREKRPG+ HHKKAGAMNALVRVSAVLT
Sbjct  493   NSRDHPGMIQVFLGHSGGHDTDGNELPRLVYVSREKRPGFNHHKKAGAMNALVRVSAVLT  552

Query  1517  NAPFMLNLDCDHY  1555
             NAP+ LNLDCDHY
Sbjct  553   NAPYFLNLDCDHY  565



>ref|XP_002325122.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEF03687.1| cellulose synthase family protein [Populus trichocarpa]
Length=1032

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/554 (58%), Positives = 391/554 (71%), Gaps = 60/554 (11%)
 Frame = +2

Query  23    AALFTGGSH-------LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGF  181
             +A    GSH       +H   H+E + ++    ++C IC DEIGV  +G++FVAC ECGF
Sbjct  4     SAGLVAGSHNRNELVVIHG--HEEHKPLKNLDGQVCEICGDEIGVTVDGDLFVACNECGF  61

Query  182   PVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedf---eqefeTKNHP  352
             PVC+PCY+YER EG Q CP C TRYKR KG PRV GDDE+    +       E E   + 
Sbjct  62    PVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRVEGDDEEDDVDDIEHEFIIEDEQDKNK  121

Query  353   PLSE------------NGDYHNNQLP-------------------HHNTTNSAAFQPTAA  439
              L+E            + D  N+Q P                   H     S++      
Sbjct  122   HLTEAMLHGKMTYGRGHDDEENSQFPPVITGIRSRPVSGEFSIGSHGEQMLSSSLHKRVH  181

Query  440   PGSVG--GKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadnedddFLM  613
             P  V   G    DE+KE      WK+R+++WK +Q   G            D++ +  ++
Sbjct  182   PYPVSEPGSARWDEKKE----GGWKERMDEWKMQQGNLG---------PEQDDDAEAAML  228

Query  614   ADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIW  793
              DARQPL RK+PI+SS I+PYR+VIV RLIIL  F  +RIL P +DA  LWL S++CEIW
Sbjct  229   EDARQPLSRKVPIASSKINPYRMVIVARLIILAVFLRYRILHPVHDAIGLWLTSIVCEIW  288

Query  794   FGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIIT  973
             F +SWILDQFPKW PI+RETYLDRLSLR+E+  EGE N LAPVD++VSTVDP+KEPP++T
Sbjct  289   FAISWILDQFPKWLPIDRETYLDRLSLRYEK--EGEPNMLAPVDIFVSTVDPMKEPPLVT  346

Query  974   ANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEF  1153
              NT+LSILA+DYPV+K+SCY+SDDGASM  F+ ++ETAEFAR+WVPFCKK+ IEPRAPEF
Sbjct  347   GNTLLSILAMDYPVEKISCYLSDDGASMCTFEAMSETAEFARKWVPFCKKFNIEPRAPEF  406

Query  1154  YFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPG  1333
             YF+ K+DYLKDKVQPTFVKERRAMKREYEE+KVR+NA+VAKAQK P EGW+MQDGTPWPG
Sbjct  407   YFTLKVDYLKDKVQPTFVKERRAMKREYEEFKVRINAIVAKAQKVPTEGWIMQDGTPWPG  466

Query  1334  NNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVL  1513
             NNTRDHPGMIQV+LG  G  DVEG ELP+LVYVSREKRPG+ HHKKAGAMNAL+RVSAVL
Sbjct  467   NNTRDHPGMIQVFLGHSGGHDVEGNELPRLVYVSREKRPGFSHHKKAGAMNALIRVSAVL  526

Query  1514  TNAPFMLNLDCDHY  1555
             TNAPFMLNLDCDHY
Sbjct  527   TNAPFMLNLDCDHY  540



>ref|XP_010088232.1| OsCesA3 protein [Morus notabilis]
 gb|EXB32784.1| OsCesA3 protein [Morus notabilis]
Length=1077

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/549 (59%), Positives = 380/549 (69%), Gaps = 70/549 (13%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             ++C+IC D +G   +GE FVAC  C FPVC+PCY+YER +GNQ CP C TRYKRHKG P 
Sbjct  18    QVCQICGDNVGKTVDGEPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPA  77

Query  281   VVGddedhfegedfeq---------------------------------efeTKNHPPLS  361
             ++GD E+  + +D                                    +  + NH PL 
Sbjct  78    ILGDKEEDLDVDDGASNFNYTSENQTEKQKIAERMLSWQMTYGRGEDIDKEASHNHIPLL  137

Query  362   ENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLE-----------------DEQKEVF  490
              NG   + +L    +  S      A+PG  G K +                  D  +E  
Sbjct  138   TNGQEVSGEL----SAASPERLSMASPGVGGAKRIHPLPYSSDVNQSPNMRVVDPVREFG  193

Query  491   S----NAEWKDRVEKWKTRQEKR------GLVTR----FdddkggadnedddFLMADARQ  628
             S    N  WK+RV+ WK +QEK       G  T      D D       DD  L  +ARQ
Sbjct  194   SPGLGNVAWKERVDGWKMKQEKNVVPMSAGQATSERGGGDIDASTDVLVDDSLLNDEARQ  253

Query  629   PLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSW  808
             PL RK+ I SS I+PYR+VIV RLIILC F H+RI  P  +A+ LWLISVICEIWF +SW
Sbjct  254   PLSRKVSIPSSKINPYRMVIVLRLIILCIFLHYRITNPVPNAYALWLISVICEIWFAISW  313

Query  809   ILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVL  988
             I DQFPKW P+NRETYLDRL+LR++R  EGE + LA VD++VSTVDPLKEPP++TANTVL
Sbjct  314   IFDQFPKWLPVNRETYLDRLALRYDR--EGEPSQLAAVDIFVSTVDPLKEPPLVTANTVL  371

Query  989   SILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEK  1168
             SILAVDYPVDKVSCYVSDDGA+ML F+ L+ET+EFAR+WVPFCKKY IEPRAPE+YF++K
Sbjct  372   SILAVDYPVDKVSCYVSDDGAAMLTFEALSETSEFARKWVPFCKKYNIEPRAPEWYFTQK  431

Query  1169  IDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRD  1348
             IDYLKDKVQP+FVKERRAMKREYEE+KVRVN LVAKA K PEEGW+MQDGTPWPGNNTRD
Sbjct  432   IDYLKDKVQPSFVKERRAMKREYEEFKVRVNGLVAKATKVPEEGWIMQDGTPWPGNNTRD  491

Query  1349  HPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPF  1528
             HPGMIQV+LG  G LDV+G ELP+LVYVSREKRPG+QHHKKAGAMNALVRVSAVLTN PF
Sbjct  492   HPGMIQVFLGQSGGLDVDGNELPRLVYVSREKRPGFQHHKKAGAMNALVRVSAVLTNGPF  551

Query  1529  MLNLDCDHY  1555
             +LNLDCDHY
Sbjct  552   LLNLDCDHY  560



>ref|XP_003518592.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Glycine max]
Length=1078

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/557 (57%), Positives = 387/557 (69%), Gaps = 51/557 (9%)
 Frame = +2

Query  32    FTGGSH------LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCK  193
                GSH      L  AD   R  V   S ++C+IC DE+ V  NGE FVAC EC FPVC+
Sbjct  7     LVAGSHNRNEFVLINADETARVAVTELSGQICQICGDELEVTVNGEPFVACNECAFPVCR  66

Query  194   PCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSENGD  373
             PCY+YER EGNQ CP C TRYKR KG PRV GD+E+    +   +             G 
Sbjct  67    PCYEYERREGNQVCPQCKTRYKRIKGSPRVEGDEEEDDSDDLESEFDIGSVFSARLNYGS  126

Query  374   YHNNQLPHHNTTNSAAFQPTAAPG-SVGGKDLE---------------------------  469
               N  + H  +   AA   +  P  + G +D+                            
Sbjct  127   QVNGSVIHAPSEFDAASVASEIPLLTYGQEDVGISADKHALILPPFTARGKRVHPMPFPD  186

Query  470   ----------DEQKEV----FSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadnedddF  607
                       D +K++    + +  WK+R+E WK +Q ++  V R +  K   + +D D 
Sbjct  187   SSVPVQPRPMDPKKDIAVYGYGSVAWKERMEDWKKKQSEKLQVVRHEGGKDSDELDDPDL  246

Query  608   -LMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVIC  784
               M + RQPLWRKLPISSS I+PYRI+IV R+ ILC FFH+RIL P  DA+ LWL SVIC
Sbjct  247   PKMDEGRQPLWRKLPISSSRINPYRIIIVLRIAILCLFFHYRILHPVNDAYALWLTSVIC  306

Query  785   EIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPP  964
             EIWF +SWI DQFPKWSPI RETYLDRLSLR+E+  EG+ + LA +DV+VSTVDP+KEPP
Sbjct  307   EIWFAVSWIFDQFPKWSPILRETYLDRLSLRYEK--EGKPSLLADIDVFVSTVDPMKEPP  364

Query  965   IITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRA  1144
             +ITANTVLSILAVDYPVDKV+CYVSDDGA+ML F+ L+ET+EFAR+WVPFCKK+CIEPRA
Sbjct  365   LITANTVLSILAVDYPVDKVACYVSDDGAAMLTFEALSETSEFARKWVPFCKKFCIEPRA  424

Query  1145  PEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTP  1324
             PE+YF++K+DYLKDKV  TF++ERRA+KREYEE+KVR+NALVA AQK PE+GW MQDGTP
Sbjct  425   PEWYFAQKVDYLKDKVDATFIRERRAIKREYEEFKVRINALVALAQKVPEDGWTMQDGTP  484

Query  1325  WPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVS  1504
             WPGNN RDHPGMIQV+LG  G  D+EG ELP+LVYVSREKRPGY HHKKAGAMNALVRVS
Sbjct  485   WPGNNVRDHPGMIQVFLGQNGVRDIEGNELPRLVYVSREKRPGYDHHKKAGAMNALVRVS  544

Query  1505  AVLTNAPFMLNLDCDHY  1555
             A++TNAP++LN+DCDHY
Sbjct  545   AIITNAPYVLNVDCDHY  561



>ref|XP_002463687.1| hypothetical protein SORBIDRAFT_01g004210 [Sorghum bicolor]
 gb|EER90685.1| hypothetical protein SORBIDRAFT_01g004210 [Sorghum bicolor]
Length=1032

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/504 (62%), Positives = 370/504 (73%), Gaps = 25/504 (5%)
 Frame = +2

Query  104   MCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRV  283
             +C+IC D +G   +GE+F AC  CGFPVC+PCY+YER +G Q CP C T+YKRHKG P V
Sbjct  21    VCQICGDGVGTAADGELFTACDVCGFPVCRPCYEYERKDGTQACPQCKTKYKRHKGSPPV  80

Query  284   VGddedhfegedfeqefeTKNHPPLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVG-GK  460
              G++ +  + +D        +     +            N+  S         G +G GK
Sbjct  81    HGEENEDVDADDVSDYNYQASGNQDQKQKIAERMLTWRTNSRGSDIGLAKYDSGEIGHGK  140

Query  461   -DLEDEQKEV---FSNAEWKDRVEKWKTR---------------QEKRGLVTRFdddkgg  583
              D  +  +E      N  WK+RV+ WK +                E RGL      D   
Sbjct  141   YDSANPSREFSGSLGNVAWKERVDGWKMKDRGAIPMTNGTSIAPSEGRGLND---IDAST  197

Query  584   adnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPL  763
               N +D  L  + RQPL RK+PI SS I+PYR+VIV RL++LC F  +RI  P  +A+PL
Sbjct  198   DYNMEDALLNDETRQPLSRKVPIPSSRINPYRMVIVLRLVVLCIFLRYRITHPVNNAYPL  257

Query  764   WLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTV  943
             WL+SVICEIWF LSWILDQFPKWSPINRETYLDRL+LR++R  EGE + LAPVD++VSTV
Sbjct  258   WLLSVICEIWFALSWILDQFPKWSPINRETYLDRLALRYDR--EGEPSQLAPVDIFVSTV  315

Query  944   DPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKK  1123
             DP+KEPP++TANTVLSILAVDYPVDKVSCYVSDDGA+ML FD L+ET+EFAR+WVPFCKK
Sbjct  316   DPMKEPPLVTANTVLSILAVDYPVDKVSCYVSDDGAAMLTFDALSETSEFARKWVPFCKK  375

Query  1124  YCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGW  1303
             Y IEPRAPE+YF++KIDYLKDKVQ +FVKERRAMKREYEE+KVR+NALVAKAQK PEEGW
Sbjct  376   YNIEPRAPEWYFAQKIDYLKDKVQTSFVKERRAMKREYEEFKVRINALVAKAQKVPEEGW  435

Query  1304  VMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAM  1483
             +MQDGTPWPGNNTRDHPGMIQV+LG  G LDV+G ELP+LVYVSREKRPG+QHHKKAGAM
Sbjct  436   IMQDGTPWPGNNTRDHPGMIQVFLGHSGGLDVDGNELPRLVYVSREKRPGFQHHKKAGAM  495

Query  1484  NALVRVSAVLTNAPFMLNLDCDHY  1555
             NALVRVSAVLTN  +MLNLDCDHY
Sbjct  496   NALVRVSAVLTNGQYMLNLDCDHY  519



>gb|ACT16001.1| cellulose synthase [Phyllostachys edulis]
Length=1070

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/543 (57%), Positives = 389/543 (72%), Gaps = 44/543 (8%)
 Frame = +2

Query  53    HAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQC  232
             H  +    ++++  ++++C+IC D +G+   G++FVAC EC FPVC+PCY+YER +GNQC
Sbjct  20    HDGEGAAAKQLKNVNEQICQICGDTVGLSATGDIFVACNECAFPVCRPCYEYERKDGNQC  79

Query  233   CPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHP--------------------  352
             CP C TRYKRHKG PRV GDDE+    +   +    + +                     
Sbjct  80    CPQCKTRYKRHKGSPRVPGDDEEEDVDDLDNEFNYKQGNSKSQQWQLRVQGEEVDLSSSC  139

Query  353   --------PLSENGDYHNNQLPHHNTTNSAAFQPTAA---PGSVGGKDLEDEQKEV----  487
                     P   +G   +  +P  +    +   PT++   P       + D  K++    
Sbjct  140   RHEPHHRIPRLTSGQQISGDIPDASPDRHSIRSPTSSYVDPSIPVPVRIVDPTKDLNSYG  199

Query  488   FSNAEWKDRVEKWKTRQEKRGLV------TRFdddkggadnedddFLMAD-ARQPLWRKL  646
               + +WK+RVE W+ +Q+K  +       T    D  G  +  +D  MAD AR PL R +
Sbjct  200   LGSVDWKERVESWRVKQDKNMIQVTNKYPTEGKGDIEGTGSNGEDLQMADDARLPLSRIV  259

Query  647   PISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFP  826
             PI ++ ++ YR+VI+ RLIILCFFF +RI  P +DA+ LWL+SVICE+WF LSW+LDQFP
Sbjct  260   PIPANQLNLYRVVIILRLIILCFFFQYRITHPVWDAYGLWLVSVICEVWFALSWLLDQFP  319

Query  827   KWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVD  1006
             KW PINRETYLDRL+LR++R  EGE + LAP+DV+VSTVDPLKEPP+ITANTVLSILAVD
Sbjct  320   KWYPINRETYLDRLALRYDR--EGEPSQLAPIDVFVSTVDPLKEPPLITANTVLSILAVD  377

Query  1007  YPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKD  1186
             YPVDKVSCYVSDDG++ML F+ L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKD
Sbjct  378   YPVDKVSCYVSDDGSAMLTFEALSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKD  437

Query  1187  KVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQ  1366
             K+QP+FVKERRAMKREYEE+KVR+NALVAKAQK PEEGW M DGTPWPGNN RDHPGMIQ
Sbjct  438   KIQPSFVKERRAMKREYEEFKVRINALVAKAQKVPEEGWTMADGTPWPGNNPRDHPGMIQ  497

Query  1367  VYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDC  1546
             V+LG  G LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DC
Sbjct  498   VFLGHSGGLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDC  557

Query  1547  DHY  1555
             DHY
Sbjct  558   DHY  560



>ref|XP_010689561.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Beta vulgaris subsp. vulgaris]
Length=1086

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/535 (59%), Positives = 376/535 (70%), Gaps = 52/535 (10%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             ++C+IC D +G+  +G+VFVAC EC FPVC+PCY YER +GNQCCP C TRYKRHKG PR
Sbjct  38    QICQICGDTVGLTPSGDVFVACNECAFPVCRPCYDYERKDGNQCCPQCKTRYKRHKGSPR  97

Query  281   VVGddedhfegedfeqefeTKNHP------------------------PLSENGDYHNNQ  388
             V GDDE+    +   +   T+                           PL  NG   + +
Sbjct  98    VEGDDEEDDIDDLENEFNYTRGTSKARHQWQGEDVDLSSSSRHESQPIPLLTNGQVVSGE  157

Query  389   LPHHNTTNSAAFQPTA--APGSVGGKDL-----------------EDEQKEVFSNAEWKD  511
             +P     N +    +    P   G   L                 +D       + +WK+
Sbjct  158   IPSATPDNQSVRSTSGPIGPEKRGNHALPYIDPCQPVPVRIVDPSKDLNSYGLGSVDWKE  217

Query  512   RVEKWKTRQEK-------RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLIS  670
             RVE WK +QEK       R    +  D +G   N ++  +  D RQP+ R +PI SS ++
Sbjct  218   RVESWKLKQEKNMTHMGNRYAEGKGGDMEGSGSNGEELQMADDVRQPMSRIVPIPSSHLT  277

Query  671   PYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRE  850
             PYR+VI+ RLIIL FF  +RI  P  DA+PLWL SVICEIWF +SWILDQFPKW PINRE
Sbjct  278   PYRVVIILRLIILAFFLQYRITHPVKDAYPLWLTSVICEIWFAMSWILDQFPKWYPINRE  337

Query  851   TYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSC  1030
             TYLDRL+ R +R  EGE + LAP+DV+VSTVDPLKEPPIITANTVLSILAVDYPVDKVSC
Sbjct  338   TYLDRLAFRHDR--EGEPSQLAPIDVFVSTVDPLKEPPIITANTVLSILAVDYPVDKVSC  395

Query  1031  YVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVK  1210
             YVSDDG++ML F+ L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK+QP+FVK
Sbjct  396   YVSDDGSAMLSFEALSETAEFARKWVPFCKKFSIEPRAPEFYFAQKIDYLKDKIQPSFVK  455

Query  1211  ERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGA  1390
             ERR+MKREYEE+KVR+NALVAKAQK PEEGW MQDGT WPGNN RDHPGMIQV+LG  G 
Sbjct  456   ERRSMKREYEEFKVRINALVAKAQKVPEEGWTMQDGTAWPGNNPRDHPGMIQVFLGHSGG  515

Query  1391  LDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             LD++G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  F+LN+DCDHY
Sbjct  516   LDMDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAFLLNVDCDHY  570



>gb|KHN28928.1| Cellulose synthase A catalytic subunit 4 [UDP-forming], partial 
[Glycine soja]
Length=1068

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/369 (83%), Positives = 335/369 (91%), Gaps = 6/369 (2%)
 Frame = +2

Query  449   VGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadnedddFLMADARQ  628
             V GK+ E E KE FSN EW++R++KWK RQEKR L  +   ++G  D  +DD+L+A+ARQ
Sbjct  173   VVGKEFEGE-KEFFSNGEWEERLDKWKARQEKRDLQNK---EEGKDDQGEDDYLLAEARQ  228

Query  629   PLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSW  808
             PLWRK+PISSSLI+PYRIVI+ RL+IL FF  FRILTPAYDA+PLWL SVICEIWF LSW
Sbjct  229   PLWRKVPISSSLINPYRIVIIMRLVILVFFLRFRILTPAYDAYPLWLASVICEIWFALSW  288

Query  809   ILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVL  988
             ILDQFPKW PI RETYLDRLS+RFER  EGE N LAPVDVYVSTVDPLKEPPIITANTVL
Sbjct  289   ILDQFPKWFPITRETYLDRLSIRFER--EGEPNLLAPVDVYVSTVDPLKEPPIITANTVL  346

Query  989   SILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEK  1168
             SILAVDYPV+KV CYVSDDGASMLLFDTL+ET++FARRWVPFCKKY IEPRAPEFYFS+K
Sbjct  347   SILAVDYPVEKVCCYVSDDGASMLLFDTLSETSDFARRWVPFCKKYSIEPRAPEFYFSQK  406

Query  1169  IDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRD  1348
             IDYLKDKV PTFVKERRAMKREYEE+KV++NALVAKAQKKPEEGWVMQDGTPWPGNNTRD
Sbjct  407   IDYLKDKVHPTFVKERRAMKREYEEFKVKINALVAKAQKKPEEGWVMQDGTPWPGNNTRD  466

Query  1349  HPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPF  1528
             HPGMIQVYLGS GALDVEGKELP++VYVSREKRPGY HHKKAGAMNALVRVSAVL+NAPF
Sbjct  467   HPGMIQVYLGSGGALDVEGKELPRIVYVSREKRPGYNHHKKAGAMNALVRVSAVLSNAPF  526

Query  1529  MLNLDCDHY  1555
             MLNLDCDHY
Sbjct  527   MLNLDCDHY  535


 Score =   117 bits (294),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  89   RESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHK  268
            + + K+CR+C DEIG  E+G++FVAC  C FPVC+PCY+YERSEGN CCP CNTRYKRHK
Sbjct  5    QSASKVCRVCSDEIGYGEDGKLFVACHVCRFPVCRPCYEYERSEGNHCCPQCNTRYKRHK  64

Query  269  GCPRVVG  289
            GCPRV G
Sbjct  65   GCPRVAG  71



>gb|AFZ78551.1| cellulose synthase [Populus tomentosa]
Length=1032

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/554 (58%), Positives = 390/554 (70%), Gaps = 60/554 (11%)
 Frame = +2

Query  23    AALFTGGSH-------LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGF  181
             +A    GSH       +H   H+E + ++    ++C IC DEIG+  +G++FVAC ECGF
Sbjct  4     SAGLVAGSHNRNELVVIHG--HEEHKPLKNLDGQVCEICGDEIGLTVDGDLFVACNECGF  61

Query  182   PVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPP--  355
             PVC+PCY+YER EG Q CP C TRYKR KG PRV GDDE+    +   +     +     
Sbjct  62    PVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRVEGDDEEDDVDDIEHEFIIEDDQDKNK  121

Query  356   -LSE------------NGDYHNNQLP-------------------HHNTTNSAAFQPTAA  439
              L+E            + D  N+Q P                   H     S++      
Sbjct  122   HLTEAMLHGKMTYGRGHDDEENSQFPPVITGIRSRPVSGEFSIGSHGEQMLSSSLHKRVH  181

Query  440   PGSVG--GKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadnedddFLM  613
             P  V   G    DE+KE      WK+R+++WK +Q   G            D++ +  ++
Sbjct  182   PYPVSEPGSARWDEKKE----GGWKERMDEWKMQQGNLG---------PEQDDDAEAAML  228

Query  614   ADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIW  793
              DARQPL RK+PI+SS I+PYR+VIV RLIIL  F  +RIL P +DA  LWL S++CEIW
Sbjct  229   EDARQPLSRKVPIASSKINPYRMVIVARLIILAVFLRYRILHPVHDAIGLWLTSIVCEIW  288

Query  794   FGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIIT  973
             F +SWILDQFPKW PI+RETYLDRLSLR+E+  EGE N LAPVDV+VSTVDP+KEPP++T
Sbjct  289   FAISWILDQFPKWLPIDRETYLDRLSLRYEQ--EGEPNMLAPVDVFVSTVDPMKEPPLVT  346

Query  974   ANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEF  1153
              NT+LSILA+DYPV+K+SCY+SDDGASM  F+ ++ETAEFAR+WVPFCKK+ IEPRAPEF
Sbjct  347   GNTLLSILAMDYPVEKISCYLSDDGASMCTFEAMSETAEFARKWVPFCKKFNIEPRAPEF  406

Query  1154  YFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPG  1333
             YF+ K+DYLKDKVQPTFVKERRAMKREYEE+KVR+NA+VAKAQK P EGW+MQDGTPWPG
Sbjct  407   YFTLKVDYLKDKVQPTFVKERRAMKREYEEFKVRINAIVAKAQKVPTEGWIMQDGTPWPG  466

Query  1334  NNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVL  1513
             NNTRDHPGMIQV+LG  G  DVEG ELP+LVYVSREKRPG+ HHKKAGAMNAL+RVSAVL
Sbjct  467   NNTRDHPGMIQVFLGHSGGHDVEGNELPRLVYVSREKRPGFSHHKKAGAMNALIRVSAVL  526

Query  1514  TNAPFMLNLDCDHY  1555
             TNAPFMLNLDCDHY
Sbjct  527   TNAPFMLNLDCDHY  540



>gb|KCW81422.1| hypothetical protein EUGRSUZ_C02801 [Eucalyptus grandis]
Length=991

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/538 (59%), Positives = 386/538 (72%), Gaps = 58/538 (11%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             ++C+IC D +G+  +G+VFVAC EC FPVC+PCY+YER +GNQ CP C +RYKRHKG PR
Sbjct  37    QICQICGDTVGLTASGDVFVACNECAFPVCRPCYEYERKDGNQSCPQCKSRYKRHKGSPR  96

Query  281   VVGddedhfegedfeqefeTKNHP-------------------------PLSENGDYHNN  385
             V GDD++    +   +    +                            PL  NG   + 
Sbjct  97    VDGDDDEDEVDDLENEFNYAQGTSAARQQWQGEDPDLSSSSRHESRHPIPLLTNGQPMSG  156

Query  386   QLPHHNTTNSAAFQPTAAPGSVGGKDLE----------------DEQKEV----FSNAEW  505
             ++P   + +S + + T+ P     K +                 D  K++      N +W
Sbjct  157   EIPCA-SIDSQSVRTTSGPLGPSDKHVHSLPYVDPRQPVPVRIVDPSKDLNTYGLGNVDW  215

Query  506   KDRVEKWKTRQEKRGLVTRF-------dddkggadnedddFLMAD-ARQPLWRKLPISSS  661
             K+RVE WK +QEK   +T+         +D  G  +  ++  MAD ARQP+ R +PISSS
Sbjct  216   KERVEGWKLKQEKN--MTQMPNKYHEGKNDIEGTGSNGEELQMADDARQPMSRVVPISSS  273

Query  662   LISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPI  841
              ++PYR+VI+ RLIIL FF  +R+  P  DA+PLWL SVICEIWF LSW+LDQFPKWSPI
Sbjct  274   HLTPYRVVIILRLIILGFFLQYRVTHPVKDAYPLWLTSVICEIWFALSWLLDQFPKWSPI  333

Query  842   NRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDK  1021
             NRETYLDRL+LR +R  EGE + LAPVDV+VSTVDPLKEPP+ITANTVLSILAVDYPVDK
Sbjct  334   NRETYLDRLALRHDR--EGEPSQLAPVDVFVSTVDPLKEPPLITANTVLSILAVDYPVDK  391

Query  1022  VSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPT  1201
             VSCYVSDDG++ML F+ L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK+QP+
Sbjct  392   VSCYVSDDGSAMLTFEALSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKDKIQPS  451

Query  1202  FVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS  1381
             FVKERRAMKREYEE+KVR+NALVAKAQK PEEGW MQDGT WPGNN RDHPGMIQV+LG 
Sbjct  452   FVKERRAMKREYEEFKVRINALVAKAQKMPEEGWTMQDGTAWPGNNPRDHPGMIQVFLGH  511

Query  1382  EGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
              G LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  512   SGGLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  569



>gb|KHN08123.1| Cellulose synthase A catalytic subunit 1 [UDP-forming] [Glycine 
soja]
Length=1084

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/550 (56%), Positives = 390/550 (71%), Gaps = 51/550 (9%)
 Frame = +2

Query  53    HAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQC  232
             H +     + ++  + ++C+IC D +G+   G+VFVAC EC FPVC+PCY+YER +GNQ 
Sbjct  22    HDSSDSGSKPMKNLNGQICQICGDTVGLTATGDVFVACNECAFPVCRPCYEYERKDGNQS  81

Query  233   CPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHP--------------------  352
             CP C TRYKRH+G PRV GD+++    +   +    +                       
Sbjct  82    CPQCKTRYKRHRGSPRVEGDEDEDDSDDIENEFNYAQGKAKARRQWEDDPDLSSSSRRES  141

Query  353   ----PLSENGDYHNNQLP------HHNTTNSAAFQPTAAPGSVGGKD--------LEDEQ  478
                 PL  NG   + ++P          T S    P+    S+   D        + D  
Sbjct  142   QQPIPLLTNGQTMSGEIPCATPDTQSVRTTSGPLGPSEKVHSLPYVDPRQPVPVRIVDPS  201

Query  479   KEVFS----NAEWKDRVEKWKTRQEKR--GLVTRFdd-----dkggadnedddFLMADAR  625
             K++ S    N +WK+RVE WK +QEK    +  R+ +      +G   N ++  ++ DAR
Sbjct  202   KDLSSYGLGNVDWKERVEGWKLKQEKNMVQMTGRYAEGKGGDVEGTGSNGEELQMVDDAR  261

Query  626   QPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLS  805
             QP+ R +PI SS ++PYR+VI+ RLIIL FF  +R+  P  DA+PLWL SVICEIWF LS
Sbjct  262   QPMSRVVPIPSSQLTPYRVVIILRLIILGFFLQYRVTHPVKDAYPLWLTSVICEIWFALS  321

Query  806   WILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTV  985
             W+LDQFPKWSPINRETYL+RL+LR++R  EGE + L PVDV+VSTVDPLKEPP++TANTV
Sbjct  322   WLLDQFPKWSPINRETYLERLALRYDR--EGEPSQLDPVDVFVSTVDPLKEPPLVTANTV  379

Query  986   LSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSE  1165
             LSIL+VDYPVDKVSCYVSDDG++ML F+ L+ETAEFA++WVPFCKK+ IEPRAPEFYF++
Sbjct  380   LSILSVDYPVDKVSCYVSDDGSAMLTFEALSETAEFAKKWVPFCKKHNIEPRAPEFYFAQ  439

Query  1166  KIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTR  1345
             KIDYLKDK+QP+FVKERRAMKREYEE+KVR+NALVAKAQK PEEGW MQDGTPWPGNN R
Sbjct  440   KIDYLKDKIQPSFVKERRAMKREYEEFKVRINALVAKAQKMPEEGWTMQDGTPWPGNNPR  499

Query  1346  DHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAP  1525
             DHPGMIQV+LG  G LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  
Sbjct  500   DHPGMIQVFLGHSGGLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGA  559

Query  1526  FMLNLDCDHY  1555
             ++LN+DCDHY
Sbjct  560   YLLNVDCDHY  569



>ref|XP_007028786.1| Cellulose synthase family protein [Theobroma cacao]
 gb|EOY09288.1| Cellulose synthase family protein [Theobroma cacao]
Length=1069

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/549 (56%), Positives = 367/549 (67%), Gaps = 55/549 (10%)
 Frame = +2

Query  68    DERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCN  247
             D   +  +   ++C+IC D +G+  + E FVAC  C FPVC+PCY+YER +G Q CP C 
Sbjct  6     DSVSKSGKMGGQVCQICSDNVGLTADSEPFVACHVCAFPVCRPCYEYERKDGTQSCPQCK  65

Query  248   TRYKRHKGCPRVV-------GddedhfegedfeqefeTK---------------------  343
             T+YKRHKG P +        G +               K                     
Sbjct  66    TKYKRHKGSPPIAGEEVEDAGANNVANNSNHTAGTQGEKYKKAERTLSWDTNYSRGEDVA  125

Query  344   ----------NHPPLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEV--  487
                       NH P   NG   + +L   +    +   P +     G   L D  +E   
Sbjct  126   PPNYDKEVPLNHIPFLTNGSSVSGELSAASPARISMASPESGIRGKGNIRLADPAREFGS  185

Query  488   --FSNAEWKDRVEKWKTRQEKRGLVTRFddd-----------kggadnedddFLMADARQ  628
               F N  WK+R++ WK + EK  +     +                   DD  L  +ARQ
Sbjct  186   SGFGNVAWKERIDGWKIKPEKNAVPMSVSNAPSEGRGGGDFDASTDVVMDDSILNDEARQ  245

Query  629   PLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSW  808
             PL RK+ + SS I+PYR+VIV RLIILC F H+RI  P  +A+ LWLISVICEIWF +SW
Sbjct  246   PLSRKVSVPSSRINPYRMVIVLRLIILCIFLHYRITNPVRNAYALWLISVICEIWFAISW  305

Query  809   ILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVL  988
             ILDQFPKW P+NRETYLDRL+LR++R  EGE + LA VD++VSTVDPLKEPP++TANTVL
Sbjct  306   ILDQFPKWLPVNRETYLDRLALRYDR--EGEPSQLAAVDIFVSTVDPLKEPPLVTANTVL  363

Query  989   SILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEK  1168
             SILAVDYPVDKVSCYVSDDGA+ML F+ L+ET+EFAR+WVPFCKKY IEPRAPE+YFS+K
Sbjct  364   SILAVDYPVDKVSCYVSDDGAAMLTFEALSETSEFARKWVPFCKKYSIEPRAPEWYFSQK  423

Query  1169  IDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRD  1348
             IDYLKDKVQP FVKERRAMKREYEE+KVR+N LVAKAQK P+EGWVMQDGTPWPGNNTRD
Sbjct  424   IDYLKDKVQPAFVKERRAMKREYEEFKVRINGLVAKAQKVPDEGWVMQDGTPWPGNNTRD  483

Query  1349  HPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPF  1528
             HPGMIQV+LG  G LD +G ELP+LVYVSREKRPG+ HHKKAGAMNALVRVSAVLTN PF
Sbjct  484   HPGMIQVFLGHSGGLDSDGNELPRLVYVSREKRPGFLHHKKAGAMNALVRVSAVLTNGPF  543

Query  1529  MLNLDCDHY  1555
             +LNLDCDHY
Sbjct  544   LLNLDCDHY  552



>ref|XP_003522623.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Glycine max]
Length=1084

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/550 (56%), Positives = 389/550 (71%), Gaps = 51/550 (9%)
 Frame = +2

Query  53    HAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQC  232
             H +     + ++  + ++C+IC D +G+   G+VFVAC EC FPVC+PCY+YER +GNQ 
Sbjct  22    HDSSDSGSKPMKNLNGQICQICGDTVGLTATGDVFVACNECAFPVCRPCYEYERKDGNQS  81

Query  233   CPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHP--------------------  352
             CP C TRYKRH+G PRV GD+++    +   +    +                       
Sbjct  82    CPQCKTRYKRHRGSPRVEGDEDEDDSDDIENEFNYAQGKAKARRQWEDDPDLSSSSRRES  141

Query  353   ----PLSENGDYHNNQLP------HHNTTNSAAFQPTAAPGSVGGKD--------LEDEQ  478
                 PL  NG   + ++P          T S    P+    S+   D        + D  
Sbjct  142   QQPIPLLTNGQTMSGEIPCATPDTQSVRTTSGPLGPSEKVHSLPYVDPRQPVPVRIVDPS  201

Query  479   KEV----FSNAEWKDRVEKWKTRQEKR--GLVTRFdd-----dkggadnedddFLMADAR  625
             K++      N +WK+RVE WK +QEK    +  R+ +      +G   N ++  ++ DAR
Sbjct  202   KDLNSYGLGNVDWKERVEGWKLKQEKNMVQMTGRYAEGKGGDVEGTGSNGEELQMVDDAR  261

Query  626   QPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLS  805
             QP+ R +PI SS ++PYR+VI+ RLIIL FF  +R+  P  DA+PLWL SVICEIWF LS
Sbjct  262   QPMSRVVPIPSSQLTPYRVVIILRLIILGFFLQYRVTHPVKDAYPLWLTSVICEIWFALS  321

Query  806   WILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTV  985
             W+LDQFPKWSPINRETYL+RL+LR++R  EGE + L PVDV+VSTVDPLKEPP++TANTV
Sbjct  322   WLLDQFPKWSPINRETYLERLALRYDR--EGEPSQLDPVDVFVSTVDPLKEPPLVTANTV  379

Query  986   LSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSE  1165
             LSIL+VDYPVDKVSCYVSDDG++ML F+ L+ETAEFA++WVPFCKK+ IEPRAPEFYF++
Sbjct  380   LSILSVDYPVDKVSCYVSDDGSAMLTFEALSETAEFAKKWVPFCKKHNIEPRAPEFYFAQ  439

Query  1166  KIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTR  1345
             KIDYLKDK+QP+FVKERRAMKREYEE+KVR+NALVAKAQK PEEGW MQDGTPWPGNN R
Sbjct  440   KIDYLKDKIQPSFVKERRAMKREYEEFKVRINALVAKAQKMPEEGWTMQDGTPWPGNNPR  499

Query  1346  DHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAP  1525
             DHPGMIQV+LG  G LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  
Sbjct  500   DHPGMIQVFLGHSGGLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGA  559

Query  1526  FMLNLDCDHY  1555
             ++LN+DCDHY
Sbjct  560   YLLNVDCDHY  569



>ref|XP_008466397.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Cucumis melo]
Length=1081

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/537 (58%), Positives = 388/537 (72%), Gaps = 53/537 (10%)
 Frame = +2

Query  95    SQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGC  274
             + + C+IC D +G+  +G+VFVAC EC FPVC+PCY+YER +GNQ CP C TRYKRHKG 
Sbjct  35    NSQTCQICGDTVGLTASGDVFVACNECAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGS  94

Query  275   PR-------------------VVGddedhfegedfeqefeT----KNHP-PLSENGDYHN  382
             PR                   V G  +   +    + E  T    ++ P PL  NG   +
Sbjct  95    PRVDGDDDEDDVDDIENEFNYVQGSSKTKRQWHGEDAELSTSARHESQPIPLLTNGQSVS  154

Query  383   NQLPHHNTTNSAAFQPTAAPGSVGGKDLE----------------DEQKEVFS----NAE  502
              ++P   T ++ + + T+ P     K ++                D  K++ S    N +
Sbjct  155   GEIPCA-TPDNQSVRTTSGPLGPPEKHMQSHPYVDPRQPVPVRIVDPSKDLNSYGLGNVD  213

Query  503   WKDRVEKWKTRQEKRGL-----VTRFdddkggadnedddFLMAD-ARQPLWRKLPISSSL  664
             WK+RVE WK +QEK  +      T    D  G  +  ++  MAD ARQPL R +PI SS 
Sbjct  214   WKERVEGWKLKQEKNMMQMTSRYTEGKGDMEGTGSNGEELQMADDARQPLSRVVPIPSSH  273

Query  665   ISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPIN  844
             ++PYR+VI+ RLIIL FF  +R+  P  DA+PLWL SVICE+WF LSW+LDQFPKWSP+N
Sbjct  274   LTPYRVVIILRLIILGFFLQYRLTHPVKDAYPLWLTSVICEVWFALSWLLDQFPKWSPVN  333

Query  845   RETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKV  1024
             RET+L+RL+LR++R  EGE + LAPVDV+VSTVDPLKEPP++TANTVLSILAVDYPVDKV
Sbjct  334   RETFLERLALRYDR--EGEPSQLAPVDVFVSTVDPLKEPPLVTANTVLSILAVDYPVDKV  391

Query  1025  SCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTF  1204
             SCYVSDDG++ML F+ L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK++P+F
Sbjct  392   SCYVSDDGSAMLTFEALSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKDKIKPSF  451

Query  1205  VKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSE  1384
             VKERRAMKREYEE+K+R+NALVAKAQK PEEGW MQDGTPWPGNN RDHPGMIQV+LG  
Sbjct  452   VKERRAMKREYEEFKIRINALVAKAQKMPEEGWTMQDGTPWPGNNPRDHPGMIQVFLGHS  511

Query  1385  GALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             G LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  512   GGLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  568



>ref|XP_010670651.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Beta vulgaris subsp. vulgaris]
Length=1086

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/535 (59%), Positives = 375/535 (70%), Gaps = 52/535 (10%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             ++C+IC D +G+  +G+VFVAC EC FPVC+PCY YER +GNQCCP C TRYKRHKG PR
Sbjct  38    QICQICGDTVGLTPSGDVFVACNECAFPVCRPCYDYERKDGNQCCPQCKTRYKRHKGSPR  97

Query  281   VVGddedhfegedfeqefeTKNHP------------------------PLSENGDYHNNQ  388
             V GDDE+    +   +   T                            PL  NG   + +
Sbjct  98    VEGDDEEDDIDDLENEFNYTSGTSKARHQWQGEDVDLSSSSRHESQPIPLLTNGQVVSGE  157

Query  389   LPHHNTTNSAAFQPTA--APGSVGGKDL-----------------EDEQKEVFSNAEWKD  511
             +P     N +    +    P   G   L                 +D       + +WK+
Sbjct  158   IPSATPDNQSVRSTSGPIGPEKRGNHALPYIDPCQPVPVRIVDPSKDLNSYGLGSVDWKE  217

Query  512   RVEKWKTRQEK-------RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLIS  670
             RVE WK +QEK       R    +  D +G   N ++  +  D RQP+ R +PI SS ++
Sbjct  218   RVESWKLKQEKNMTHMGNRYAEGKGGDMEGSGSNGEELQMADDVRQPMSRIVPIPSSHLT  277

Query  671   PYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRE  850
             PYR+VI+ RLIIL FF  +RI  P  DA+PLWL SVICEIWF +SWILDQFPKW PINRE
Sbjct  278   PYRVVIILRLIILAFFLQYRITHPVKDAYPLWLTSVICEIWFAMSWILDQFPKWYPINRE  337

Query  851   TYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSC  1030
             TYLDRL+ R +R  EGE + LAP+DV+VSTVDPLKEPPIITANTVLSILAVDYPVDKVSC
Sbjct  338   TYLDRLAFRHDR--EGEPSQLAPIDVFVSTVDPLKEPPIITANTVLSILAVDYPVDKVSC  395

Query  1031  YVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVK  1210
             YVSDDG++ML F+ L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK+QP+FVK
Sbjct  396   YVSDDGSAMLSFEALSETAEFARKWVPFCKKFSIEPRAPEFYFAQKIDYLKDKIQPSFVK  455

Query  1211  ERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGA  1390
             ERR+MKREYEE+KVR+NALVAKAQK PEEGW MQDGT WPGNN RDHPGMIQV+LG  G 
Sbjct  456   ERRSMKREYEEFKVRINALVAKAQKVPEEGWTMQDGTAWPGNNPRDHPGMIQVFLGHSGG  515

Query  1391  LDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             LD++G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  F+LN+DCDHY
Sbjct  516   LDMDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAFLLNVDCDHY  570



>gb|AFZ78558.1| cellulose synthase [Populus tomentosa]
Length=1084

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/543 (57%), Positives = 393/543 (72%), Gaps = 53/543 (10%)
 Frame = +2

Query  77    REVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRY  256
             + ++  + + C+IC D +GV ENG++FVAC EC FPVC+PCY+YER +G Q CP C TRY
Sbjct  29    KPLQNLNGQTCQICGDTVGVTENGDIFVACNECAFPVCRPCYEYERKDGTQSCPQCKTRY  88

Query  257   KRHKGCPRVV---------------------GddedhfegedfeqefeTKNHP---PLSE  364
             +RHKG PRV                      G+ +  ++G+D E    +++     PL  
Sbjct  89    RRHKGSPRVDGDEDEDDVDDLENEFNYPQGNGNAKHQWQGDDIELSSSSRHESQPIPLLT  148

Query  365   NGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLE----------------DEQKEV---  487
             NG   + ++P   T ++ + + T+ P     +++                 D  K++   
Sbjct  149   NGQPVSGEIPCA-TPDNQSVRTTSGPLGPAERNVHSSPYIDPRQPVHVRIVDPSKDLNSY  207

Query  488   -FSNAEWKDRVEKWKTRQEKR--GLVTRFdddkggadneddd---FLMAD-ARQPLWRKL  646
                N +WK+RVE WK +Q+K    +  R+ + KG  +    +     MAD ARQP+ R +
Sbjct  208   GLGNVDWKERVEGWKLKQDKNMMQMTNRYSEGKGDMEGTGSNGDELQMADDARQPMSRVV  267

Query  647   PISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFP  826
             PISSS ++PYR+VI+ RLIIL FF  +R+  P  DA+ LWL SVICEIWF LSW+LDQFP
Sbjct  268   PISSSYLTPYRVVIILRLIILGFFLQYRVTHPVKDAYGLWLTSVICEIWFALSWLLDQFP  327

Query  827   KWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVD  1006
             KW PINRETYLDRL+LR++R  EGE + LAP+D++VSTVDP+KEPP++TANTVLSILAVD
Sbjct  328   KWMPINRETYLDRLALRYDR--EGEPSQLAPIDIFVSTVDPMKEPPLVTANTVLSILAVD  385

Query  1007  YPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKD  1186
             YPVDKVSCYVSDDG++ML F+ L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKD
Sbjct  386   YPVDKVSCYVSDDGSAMLTFEALSETAEFARKWVPFCKKHSIEPRAPEFYFAQKIDYLKD  445

Query  1187  KVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQ  1366
             K+QP+FVKERRAMKREYEE+KVR+NALVAKAQK PEEGW MQDGTPWPGNN RDHPGMIQ
Sbjct  446   KIQPSFVKERRAMKREYEEFKVRINALVAKAQKMPEEGWTMQDGTPWPGNNPRDHPGMIQ  505

Query  1367  VYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDC  1546
             V+LG  G LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DC
Sbjct  506   VFLGHSGGLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDC  565

Query  1547  DHY  1555
             DHY
Sbjct  566   DHY  568



>ref|XP_010648652.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Vitis vinifera]
Length=1084

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/536 (58%), Positives = 386/536 (72%), Gaps = 54/536 (10%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             ++C+IC D +G+   G+VFVAC EC FPVC+PCY+YER +GNQ CP C TRYKRHKG PR
Sbjct  37    QICQICGDTVGLTAAGDVFVACNECAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPR  96

Query  281   VVGddedhfegedfeqefeTKNHP-------------------------PLSENGDYHNN  385
             V GDDE+    +   +    + +                          PL  NG   + 
Sbjct  97    VEGDDEEDDVDDIENEFNYAQGNSKARRQWQGEDADLSSSSRHESQQPIPLLTNGQPLSG  156

Query  386   QLPHHNTTNSAAFQPTAAPGSVGGKDLE----------------DEQKEV----FSNAEW  505
             ++P   T ++ + + T+ P   G K +                 D  K++      N +W
Sbjct  157   EIPS-GTPDNQSVRTTSGPLGPGEKHVHSLPYVDPRQPVPVRIVDPSKDLNSYGLGNVDW  215

Query  506   KDRVEKWKTRQEKRGL--VTRF---dddkggadnedddFLMAD-ARQPLWRKLPISSSLI  667
             K+RVE WK +QEK  +   +R+     D  G  +  ++  MAD ARQPL R +PI SS +
Sbjct  216   KERVEGWKLKQEKNMMQVTSRYPEGKGDLEGTGSNGEELQMADDARQPLSRVVPIPSSHL  275

Query  668   SPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINR  847
             +PYR+VI+ RLIIL FF  +R   P  DA+PLWL SVICEIWF LSW+LDQFPKW PINR
Sbjct  276   TPYRVVIILRLIILGFFLQYRTTHPVKDAYPLWLTSVICEIWFALSWLLDQFPKWYPINR  335

Query  848   ETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVS  1027
             ET+L+RL+LR++R  EGE + LAP+DV+VSTVDPLKEPP++TANTVLSILAVDYPVDKVS
Sbjct  336   ETFLERLALRYDR--EGEPSQLAPIDVFVSTVDPLKEPPLVTANTVLSILAVDYPVDKVS  393

Query  1028  CYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFV  1207
             CYVSDDG++ML F+ L+ET+EFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK+QP+FV
Sbjct  394   CYVSDDGSAMLTFEALSETSEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKDKIQPSFV  453

Query  1208  KERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEG  1387
             KERRAMKREYEE+K+R+NALVAKAQK PEEGW MQDGTPWPGNN RDHPGMIQV+LG  G
Sbjct  454   KERRAMKREYEEFKIRINALVAKAQKTPEEGWTMQDGTPWPGNNPRDHPGMIQVFLGHSG  513

Query  1388  ALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
              LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  514   GLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  569



>gb|ACU87559.2| cellulose synthase [Leucaena leucocephala]
Length=1075

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/547 (57%), Positives = 376/547 (69%), Gaps = 68/547 (12%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             ++C+IC D +G   +GE F+AC  C FPVC+PCY+YER +GNQ CP C TRYKRHKG P 
Sbjct  18    QVCQICGDNVGKTVDGEPFIACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPA  77

Query  281   VVGddedhfegedfeq--------------------------------------efeTKN  346
             ++GD E+    +D                                         +  + +
Sbjct  78    ILGDGEEDGVADDGASDLNYDSENQNQKQKISERMLSWQMTYGRAEAISAPNYDKEVSHS  137

Query  347   HPPLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLE--------DEQKEV-----  487
             H PL  +G   + +L    +  S      A+PG  GGK +         ++   +     
Sbjct  138   HIPLLTSGQEVSGEL----SAASPERLSMASPGVGGGKRVHSLPYSSDINQSPNIRVVDP  193

Query  488   -FSNAEWKDRVEKWKTRQEKRGLVTRFdddkg----------gadnedddFLMADARQPL  634
                N  WK+RV+ WK +QEK  +                        +D  L  +ARQPL
Sbjct  194   GLGNVAWKERVDGWKMKQEKNVVPMSTGQAASERGAGDIDASTDVLVEDSLLNDEARQPL  253

Query  635   WRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWIL  814
              RK+ I SS I+PYR+VI+ RLIILC F H+RI  P  + + LWL+SVICEIWF +SWIL
Sbjct  254   SRKVSIPSSRINPYRMVIILRLIILCMFLHYRITNPVQNTYALWLVSVICEIWFAMSWIL  313

Query  815   DQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSI  994
             DQFPKW P+NRETYLDRL+LR++RDGE  +  LA VD++VSTVDPLKEPP++TANTVLSI
Sbjct  314   DQFPKWLPVNRETYLDRLALRYDRDGEPSQ--LAAVDIFVSTVDPLKEPPLVTANTVLSI  371

Query  995   LAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKID  1174
             LAVDYPVDKVSCYVSDDGA+ML F+ L+ET+EFARRWVPFCKKY IEPRAPE+YF++KID
Sbjct  372   LAVDYPVDKVSCYVSDDGAAMLTFEALSETSEFARRWVPFCKKYSIEPRAPEWYFAQKID  431

Query  1175  YLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHP  1354
             YLKDK+Q +FVK+RRAMKREYEE+KVRVNALVAKAQK PEEGWVMQDGTPWPGNNTRDHP
Sbjct  432   YLKDKIQTSFVKDRRAMKREYEEFKVRVNALVAKAQKVPEEGWVMQDGTPWPGNNTRDHP  491

Query  1355  GMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFML  1534
             GMIQV+LG  G LD EG ELP+LVYVSREKRPG+QHHKKAGAMNALVRVSAVLTN PF+L
Sbjct  492   GMIQVFLGQSGGLDTEGNELPRLVYVSREKRPGFQHHKKAGAMNALVRVSAVLTNGPFLL  551

Query  1535  NLDCDHY  1555
             NLDCDHY
Sbjct  552   NLDCDHY  558



>ref|XP_011071168.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Sesamum indicum]
Length=1084

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/535 (58%), Positives = 386/535 (72%), Gaps = 53/535 (10%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             ++C+IC D +GV  +G++FVAC EC FPVC+ CY+YER +GNQ CP C TRYKR KGCPR
Sbjct  37    QICQICGDTVGVTASGDLFVACNECAFPVCRACYEYERKDGNQSCPQCKTRYKRQKGCPR  96

Query  281   VVGddedhfegedfeqefeTKNHP-------------------------PLSENGDYHNN  385
             V GDDE+    +  ++   ++                            PL  +G   + 
Sbjct  97    VDGDDEEEDIDDLEDEFNYSQGKSKARSQWLGDDVELSASSRRESQQPIPLLTHGQSVSG  156

Query  386   QLPHHNTTNSAAFQPTAAPGSVGGK---------------DLEDEQKEV----FSNAEWK  508
             ++P  +T ++ + + T+ P   G +                + D  K++      N +WK
Sbjct  157   EIPP-STQDTHSVRSTSGPLGPGDRVQSLPYVDPRRPVPVRIVDPSKDLNSYGLGNVDWK  215

Query  509   DRVEKWKTRQEKR--GLVTRFdddkggadnedddF----LMADARQPLWRKLPISSSLIS  670
             +RVE WK +QEK    +  ++ + KG  +    +        DARQPL R +PI SS ++
Sbjct  216   ERVEGWKLKQEKNMVQMTNKYSEGKGDIEGTGSNGEELQTADDARQPLSRVVPIPSSHLT  275

Query  671   PYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRE  850
             PYR+VI+ RLIIL FF  +R   P  DA+PLWL SVICEIWF LSW+LDQFPKW PINRE
Sbjct  276   PYRVVIILRLIILGFFLQYRCTHPVKDAYPLWLTSVICEIWFALSWLLDQFPKWYPINRE  335

Query  851   TYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSC  1030
             TYL+RL+LR++R  EGE + LAPVDV+VSTVDP+KEPP+ITANTVLSILAVDYPVDKVSC
Sbjct  336   TYLERLALRYDR--EGEPSQLAPVDVFVSTVDPMKEPPLITANTVLSILAVDYPVDKVSC  393

Query  1031  YVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVK  1210
             YVSDDGA+ML F+ L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK+QP+FVK
Sbjct  394   YVSDDGAAMLTFEALSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKDKIQPSFVK  453

Query  1211  ERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGA  1390
             ERRAMKREYEE+KVR+NALVAKAQK PEEGW MQDGTPWPGNNTRDHPGMIQV+LG  G 
Sbjct  454   ERRAMKREYEEFKVRINALVAKAQKMPEEGWTMQDGTPWPGNNTRDHPGMIQVFLGHSGG  513

Query  1391  LDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  514   LDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  568



>gb|EYU32338.1| hypothetical protein MIMGU_mgv1a000544mg [Erythranthe guttata]
Length=1084

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/535 (58%), Positives = 388/535 (73%), Gaps = 53/535 (10%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             ++C+IC D +GV  NG+VFVAC EC FPVC+ CY+YER +GNQ CP C TRYKR KG PR
Sbjct  37    QICQICGDTVGVTANGDVFVACNECAFPVCRACYEYERKDGNQSCPQCKTRYKRQKGSPR  96

Query  281   VVGddedhfegedfeqefeTKNHP-------------------------PLSENGDYHNN  385
             V GDD++    +   +   ++                            PL  NG   + 
Sbjct  97    VDGDDDEDDVDDLENEFSYSQGKNKARSQWHGDEIELSASSRRESQQPIPLLTNGQQVSG  156

Query  386   QLPHHNTTNSAAFQPTAAPGSVGGK---------------DLEDEQKEVFS----NAEWK  508
             ++P  +  ++ + + T+ P   G +                + D  K++ S    N +WK
Sbjct  157   EIPP-SIQDTNSIRSTSGPLGPGDRIHSLPYVDPRQPVPVRIVDPSKDLNSYGLGNVDWK  215

Query  509   DRVEKWKTRQEKRGL-----VTRFdddkggadnedddFLMA-DARQPLWRKLPISSSLIS  670
             +RV+ WK +Q+K  +      +    D  G  +  ++  MA DARQP+ R +PISSS ++
Sbjct  216   ERVDSWKLKQDKNMVHINNKYSEGKGDTEGTGSNGEELQMADDARQPMSRIVPISSSHLT  275

Query  671   PYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRE  850
             PYR++I+FRLIIL FF  +R   P  DA+PLWL SVICEIWF LSW+LDQFPKW PINRE
Sbjct  276   PYRVIIIFRLIILGFFLQYRCTHPVKDAYPLWLTSVICEIWFALSWLLDQFPKWYPINRE  335

Query  851   TYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSC  1030
             TYL+RL+LR++R  EGE + LAP+DV+VSTVDPLKEPP++TANTVLSIL+VDYPVDKVSC
Sbjct  336   TYLERLALRYDR--EGEPSQLAPIDVFVSTVDPLKEPPLVTANTVLSILSVDYPVDKVSC  393

Query  1031  YVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVK  1210
             YVSDDG++ML F++L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK+QP+FVK
Sbjct  394   YVSDDGSAMLSFESLSETAEFARKWVPFCKKHSIEPRAPEFYFAQKIDYLKDKIQPSFVK  453

Query  1211  ERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGA  1390
             ERRAMKREYEE+KVR+NALVAKAQK PEEGW MQDGTPWPGNNTRDHPGMIQV+LG  G 
Sbjct  454   ERRAMKREYEEFKVRINALVAKAQKMPEEGWTMQDGTPWPGNNTRDHPGMIQVFLGHSGG  513

Query  1391  LDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  514   LDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  568



>ref|NP_001105532.1| cellulose synthase catalytic subunit 12 [Zea mays]
 gb|AAR23312.1| cellulose synthase catalytic subunit 12 [Zea mays]
 tpg|DAA61528.1| TPA: putative cellulose synthase family protein [Zea mays]
Length=1052

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/564 (57%), Positives = 386/564 (68%), Gaps = 65/564 (12%)
 Frame = +2

Query  23    AALFTGGSH-----LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPV  187
             +A    GSH     +    H++ + +   S ++C IC DE+G+  +G++FVAC ECGFPV
Sbjct  4     SAGLVAGSHNRNELVLIRGHEDPKPLRALSGQVCEICGDEVGLTVDGDLFVACNECGFPV  63

Query  188   CKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSEN  367
             C+PCY+YER EG Q CP C TRYKR KG PRV GDD++    +   +      +      
Sbjct  64    CRPCYEYERREGTQNCPQCKTRYKRLKGSPRVAGDDDEEDIDDLEHEFNIDDENQQRQLE  123

Query  368   GDYHNNQL--------------PHHNTTNSAAFQPTAAPGSVG-----------------  454
             G+  N+Q+              P     N+    P    GS                   
Sbjct  124   GNMQNSQITEAMLHGRMSYGRGPDDGDGNNTPQIPPIITGSRSVPVSGEFPITNGYGHGE  183

Query  455   -----------------GKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkgg  583
                              G    DE+KEV     WK+R++ WK++Q   G           
Sbjct  184   VSSSLHKRIHPYPVSEPGSAKWDEKKEV----SWKERMDDWKSKQGILG------GGADP  233

Query  584   adnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPL  763
              D + D  L  +ARQPL RK+ I+SS ++PYR+VIV RL++L FF  +RIL P  DA  L
Sbjct  234   EDMDADVALNDEARQPLSRKVSIASSKVNPYRMVIVVRLVVLAFFLRYRILHPVPDAIGL  293

Query  764   WLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTV  943
             WL+S+ICEIWF +SWILDQFPKW PI+RETYLDRLSLR+ER  EGE + L+ VD++VSTV
Sbjct  294   WLVSIICEIWFAISWILDQFPKWFPIDRETYLDRLSLRYER--EGEPSLLSAVDLFVSTV  351

Query  944   DPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKK  1123
             DPLKEPP++TANTVLSILAVDYPVDKVSCYVSDDGASML F++L+ETAEFAR+WVPFCKK
Sbjct  352   DPLKEPPLVTANTVLSILAVDYPVDKVSCYVSDDGASMLTFESLSETAEFARKWVPFCKK  411

Query  1124  YCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGW  1303
             + IEPRAPEFYFS K+DYLKDKVQPTFV+ERRAMKREYEE+KVR+NALVAKA K P EGW
Sbjct  412   FGIEPRAPEFYFSLKVDYLKDKVQPTFVQERRAMKREYEEFKVRINALVAKAMKVPAEGW  471

Query  1304  VMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAM  1483
             +M+DGTPWPGNNTRDHPGMIQV+LG  G  D EG ELP+LVYVSREKRPG+QHHKKAGAM
Sbjct  472   IMKDGTPWPGNNTRDHPGMIQVFLGHSGGHDTEGNELPRLVYVSREKRPGFQHHKKAGAM  531

Query  1484  NALVRVSAVLTNAPFMLNLDCDHY  1555
             NAL+RVSAVLTNAPFMLNLDCDHY
Sbjct  532   NALIRVSAVLTNAPFMLNLDCDHY  555



>gb|KDO61693.1| hypothetical protein CISIN_1g001399mg [Citrus sinensis]
Length=1059

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/536 (58%), Positives = 383/536 (71%), Gaps = 54/536 (10%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             + C+IC D +G+   G++FVAC EC FPVC+PCY+YER +G Q CP C TRYKRHKG PR
Sbjct  11    QTCQICGDNVGLTAMGDIFVACNECAFPVCRPCYEYERKDGTQSCPQCKTRYKRHKGSPR  70

Query  281   VVGddedhfegedfeqefeTKNHP-------------------------PLSENGDYHNN  385
             V GDDE+    +   +    + +                          PL  NG   + 
Sbjct  71    VEGDDEEDDIDDLENEFNYAQGNSKARRQWQGEDLELSASSRHESQQPIPLLTNGQSVSG  130

Query  386   QLPHHNTTNSAAFQPTAAPGSVGGKDLE----------------DEQKEV----FSNAEW  505
             ++P   T ++ + + T+ P     +++                 D  K++      N +W
Sbjct  131   EIPCA-TPDTQSVRTTSGPLGPSERNVHSSPYTDPRQPVPVRIVDPSKDLNSYGLGNVDW  189

Query  506   KDRVEKWKTRQEKR-----GLVTRFdddkggadnedddFLMAD-ARQPLWRKLPISSSLI  667
             K+RVE WK +QEK      G  +    D  G  +  ++  MAD ARQPL R +PI SS +
Sbjct  190   KERVEGWKLKQEKNMMQVTGKYSEGKGDIEGTGSNGEELQMADDARQPLSRVVPIPSSHL  249

Query  668   SPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINR  847
             +PYR+VI+ RLIIL FF  +R+  P  DA+PLWL SVICEIWF LSW+LDQFPKW P+NR
Sbjct  250   TPYRVVIILRLIILGFFLQYRVTHPVKDAYPLWLTSVICEIWFALSWLLDQFPKWYPVNR  309

Query  848   ETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVS  1027
             ETYLDRL+LR++R  EGE + LAPVD++VSTVDPLKEPP++TANTVLSILAVDYPVDKVS
Sbjct  310   ETYLDRLALRYDR--EGEPSQLAPVDIFVSTVDPLKEPPLVTANTVLSILAVDYPVDKVS  367

Query  1028  CYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFV  1207
             CYVSDDG++ML F+ L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK+QP+FV
Sbjct  368   CYVSDDGSAMLTFEALSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKDKIQPSFV  427

Query  1208  KERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEG  1387
             KERRAMKREYEE+KVR+NALVAKAQK PEEGW MQDGTPWPGNN RDHPGMIQV+LG  G
Sbjct  428   KERRAMKREYEEFKVRINALVAKAQKMPEEGWTMQDGTPWPGNNPRDHPGMIQVFLGRSG  487

Query  1388  ALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
              LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  488   GLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  543



>gb|AGX27214.1| cellulose synthase 7 [Populus tomentosa]
Length=1037

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/558 (57%), Positives = 390/558 (70%), Gaps = 67/558 (12%)
 Frame = +2

Query  23    AALFTGGSH-------LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGF  181
             +A    GSH       +H   H+E + ++    ++C IC DEIG+  +G++FVAC ECGF
Sbjct  4     SAGLVAGSHNRNELVVIHG--HEEHKPLKNLDGQVCEICGDEIGLTVDGDLFVACNECGF  61

Query  182   PVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLS  361
             P C+PCY+YER EG+Q CP C TRYKR KG PRV GDD+D  + +D E EF  ++     
Sbjct  62    PACRPCYEYERREGSQNCPQCKTRYKRLKGSPRVEGDDDDEDDLDDIEHEFIIEDE---Q  118

Query  362   ENGDYHNNQLPH--------HNTTNSAAFQPTAA--------------------------  439
             +   Y    + H        H+   ++ F P                             
Sbjct  119   DKNKYLTEAMLHGKMTYGRGHDDEENSHFPPVITGIRSRPVSGEFPIGSHGEQMLSSSLH  178

Query  440   ------PGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadnedd  601
                   P S  G    D +KE      WK+R++ WK +Q   G            +++ +
Sbjct  179   KRVHPYPVSEPGSARWDAKKE----GGWKERMDGWKMQQGNLG---------PEQEDDAE  225

Query  602   dFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVI  781
               ++ +ARQPL RK+PI+SS I+PYR+VIV RL+IL FF  +RIL P +DA  LWL S++
Sbjct  226   AAMLDEARQPLSRKVPIASSKINPYRMVIVARLVILAFFLRYRILHPVHDAIGLWLTSIV  285

Query  782   CEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEP  961
             CEIWF +SWILDQFPKW PI+RETYLDRLSLR+ER  EGE N LAPVD++VSTVDP+KEP
Sbjct  286   CEIWFAISWILDQFPKWLPIDRETYLDRLSLRYER--EGEPNMLAPVDIFVSTVDPMKEP  343

Query  962   PIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPR  1141
             P++T NT+LSILA+DYPV+K+SCY+SDDGASM  F+ ++ETAEFAR+WVPFCKKY IEPR
Sbjct  344   PLVTGNTILSILAMDYPVEKISCYLSDDGASMCTFEAMSETAEFARKWVPFCKKYSIEPR  403

Query  1142  APEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGT  1321
             APEFYF+ KIDYLKDKVQPTFVKERRAMKREYEE+KVR+NA+VAKAQK P EGW+MQDGT
Sbjct  404   APEFYFALKIDYLKDKVQPTFVKERRAMKREYEEFKVRINAIVAKAQKVPPEGWIMQDGT  463

Query  1322  PWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRV  1501
             PWPGNNTRDHPGMIQV+LG  G  D EG ELP+LVYVSREKRPG+ HHKKAGAMNAL+RV
Sbjct  464   PWPGNNTRDHPGMIQVFLGHSGGHDTEGNELPRLVYVSREKRPGFSHHKKAGAMNALIRV  523

Query  1502  SAVLTNAPFMLNLDCDHY  1555
             SAVLTNAPFMLNLDCDHY
Sbjct  524   SAVLTNAPFMLNLDCDHY  541



>gb|EYU29030.1| hypothetical protein MIMGU_mgv1a000570mg [Erythranthe guttata]
Length=1065

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/556 (57%), Positives = 383/556 (69%), Gaps = 62/556 (11%)
 Frame = +2

Query  50    LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQ  229
             + +   ++ + ++    ++C+IC D +G+  +G+ FVAC  C FPVC+PCY+YER +GNQ
Sbjct  1     MESEAENKGKALKNMGSQVCQICGDNVGLTADGDAFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  230   CCPHCNTRYKRHKGCPRVVGddedhfegedfeqef-------------------------  334
              CP C TRYKRHKG P + GD E     +D   +                          
Sbjct  61    SCPQCKTRYKRHKGSPAIHGDGEQDGVADDGADDLHFSENQSDKQKISERMLSWHMSYGR  120

Query  335   ------------eTKNHPPLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQ  478
                          + NH PL  NG   + +L    +  S      A+P   G   + D  
Sbjct  121   GEGAGAPKYDKEVSHNHIPLLTNGTDVSGEL----SAASPGRLSMASPPPGGKPRIVDPV  176

Query  479   KEVFS----NAEWKDRVEKWKTRQEK-------------RGLVTRFdddkggadnedddF  607
             +E  S    N  WK+RV+ WK +QEK             RG     D D       DD  
Sbjct  177   REFGSPGLGNVAWKERVDGWKMKQEKPVIPMTTSHPPSERG--GGGDIDASTDILVDDAL  234

Query  608   LMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICE  787
             L  +ARQPL RK+ + SS I+PYR+VIV RL+ILC F H+RI  P  +AF LWLISVICE
Sbjct  235   LNDEARQPLSRKVSVPSSRINPYRMVIVLRLVILCIFLHYRITNPVPNAFALWLISVICE  294

Query  788   IWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPI  967
             IWF +SWILDQFPKW P+NRETYLDRLSLR++R  EGE + LA VD++VSTVDPLKEPP+
Sbjct  295   IWFAVSWILDQFPKWLPVNRETYLDRLSLRYDR--EGETSQLAAVDIFVSTVDPLKEPPL  352

Query  968   ITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAP  1147
             +TANTVLSILAVDYPVDKVSCYVSDDG++ML F++L+ETAEFAR+WVPFCKKY IEPRAP
Sbjct  353   VTANTVLSILAVDYPVDKVSCYVSDDGSAMLSFESLSETAEFARKWVPFCKKYAIEPRAP  412

Query  1148  EFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPW  1327
             E+YFS+KIDYLKDKVQP+FVK+RRAMKREYEE+K+R+NALVAKAQK P+ GWVMQDGTPW
Sbjct  413   EWYFSQKIDYLKDKVQPSFVKDRRAMKREYEEFKIRINALVAKAQKVPDGGWVMQDGTPW  472

Query  1328  PGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSA  1507
             PGNN RDHPGMIQV+LG  G LD EG ELP+LVYVSREKRPG+ HHKKAGAMNALVRVSA
Sbjct  473   PGNNIRDHPGMIQVFLGQSGGLDSEGNELPRLVYVSREKRPGFTHHKKAGAMNALVRVSA  532

Query  1508  VLTNAPFMLNLDCDHY  1555
             VLTN PF+LNLDCDHY
Sbjct  533   VLTNGPFLLNLDCDHY  548



>ref|XP_006450469.1| hypothetical protein CICLE_v10007296mg [Citrus clementina]
 ref|XP_006483338.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
isoform X2 [Citrus sinensis]
 gb|ESR63709.1| hypothetical protein CICLE_v10007296mg [Citrus clementina]
 gb|KDO61692.1| hypothetical protein CISIN_1g001399mg [Citrus sinensis]
Length=1085

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/536 (58%), Positives = 383/536 (71%), Gaps = 54/536 (10%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             + C+IC D +G+   G++FVAC EC FPVC+PCY+YER +G Q CP C TRYKRHKG PR
Sbjct  37    QTCQICGDNVGLTAMGDIFVACNECAFPVCRPCYEYERKDGTQSCPQCKTRYKRHKGSPR  96

Query  281   VVGddedhfegedfeqefeTKNHP-------------------------PLSENGDYHNN  385
             V GDDE+    +   +    + +                          PL  NG   + 
Sbjct  97    VEGDDEEDDIDDLENEFNYAQGNSKARRQWQGEDLELSASSRHESQQPIPLLTNGQSVSG  156

Query  386   QLPHHNTTNSAAFQPTAAPGSVGGKDLE----------------DEQKEV----FSNAEW  505
             ++P   T ++ + + T+ P     +++                 D  K++      N +W
Sbjct  157   EIPCA-TPDTQSVRTTSGPLGPSERNVHSSPYTDPRQPVPVRIVDPSKDLNSYGLGNVDW  215

Query  506   KDRVEKWKTRQEKR-----GLVTRFdddkggadnedddFLMAD-ARQPLWRKLPISSSLI  667
             K+RVE WK +QEK      G  +    D  G  +  ++  MAD ARQPL R +PI SS +
Sbjct  216   KERVEGWKLKQEKNMMQVTGKYSEGKGDIEGTGSNGEELQMADDARQPLSRVVPIPSSHL  275

Query  668   SPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINR  847
             +PYR+VI+ RLIIL FF  +R+  P  DA+PLWL SVICEIWF LSW+LDQFPKW P+NR
Sbjct  276   TPYRVVIILRLIILGFFLQYRVTHPVKDAYPLWLTSVICEIWFALSWLLDQFPKWYPVNR  335

Query  848   ETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVS  1027
             ETYLDRL+LR++R  EGE + LAPVD++VSTVDPLKEPP++TANTVLSILAVDYPVDKVS
Sbjct  336   ETYLDRLALRYDR--EGEPSQLAPVDIFVSTVDPLKEPPLVTANTVLSILAVDYPVDKVS  393

Query  1028  CYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFV  1207
             CYVSDDG++ML F+ L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK+QP+FV
Sbjct  394   CYVSDDGSAMLTFEALSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKDKIQPSFV  453

Query  1208  KERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEG  1387
             KERRAMKREYEE+KVR+NALVAKAQK PEEGW MQDGTPWPGNN RDHPGMIQV+LG  G
Sbjct  454   KERRAMKREYEEFKVRINALVAKAQKMPEEGWTMQDGTPWPGNNPRDHPGMIQVFLGRSG  513

Query  1388  ALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
              LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  514   GLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  569



>gb|AAQ63935.1| cellulose synthase [Pinus radiata]
Length=1096

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/554 (58%), Positives = 383/554 (69%), Gaps = 76/554 (14%)
 Frame = +2

Query  104   MCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRV  283
             +C+IC +++G+  +GE FVAC EC FPVC+PCY+YE  +GNQ CP C TRYK HKG P+V
Sbjct  38    ICQICGEDVGLAADGEFFVACNECAFPVCRPCYEYEWKDGNQSCPQCKTRYKWHKGSPQV  97

Query  284   VGddedhfegedfeqefeTKNH--------------------------------------  349
              GD ED    +       T+ +                                      
Sbjct  98    DGDKEDECADDLDHDFNSTQGNRNEKQQIAEAMLHWQMAYGRGEDVGPSRSESQELPQLQ  157

Query  350   PPLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKD------------------LEDE  475
              PL  NG   + +LP      S+ ++  AAP + GG                     ED 
Sbjct  158   VPLITNGQAISGELP----AGSSEYRRIAAPPTGGGSGKRVHPLPFPDSTQTGQVRAEDP  213

Query  476   QKEV----FSNAEWKDRVEKWKTRQEKRGL-VTRFdddkggadnedddFLMAD-------  619
              K+     F N  WK+RVE WK +Q+K  L VT          + D D  +AD       
Sbjct  214   AKDFNSYGFGNVAWKERVESWKNKQDKNTLQVTSDTYYASEGKDGDIDGCVADEEDLQMS  273

Query  620   --ARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIW  793
               ARQPL RK+PI+SS I+PYR+VIV RL+ILCFFF +RIL P  +A+ LW  SVICEIW
Sbjct  274   DEARQPLSRKVPIASSKINPYRMVIVLRLVILCFFFRYRILNPVRNAYGLWFTSVICEIW  333

Query  794   FGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIIT  973
             F +SWILDQFPKW PINRETYLDRL LR++R  EGE + LA VD++VSTVDP+KEPP++T
Sbjct  334   FAISWILDQFPKWLPINRETYLDRLCLRYDR--EGEPSQLAAVDIFVSTVDPMKEPPLVT  391

Query  974   ANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEF  1153
             ANTVLSIL+VDYPVDKVSCYVSDDGA+ML F+ L+ET+EFAR+WVPF KK+ IEPRAPE+
Sbjct  392   ANTVLSILSVDYPVDKVSCYVSDDGAAMLTFEALSETSEFARKWVPFVKKFDIEPRAPEW  451

Query  1154  YFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPG  1333
             YF++KIDYLKDKVQP+FVKERRAMKREYEE+KVR+NALVAKAQK PEEGW+MQDGTPWPG
Sbjct  452   YFAQKIDYLKDKVQPSFVKERRAMKREYEEFKVRINALVAKAQKVPEEGWIMQDGTPWPG  511

Query  1334  NNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVL  1513
             NNTRDHPGMIQV+LG  G LD +G ELP+LVYVSREKRPG++HHKKAGAMN+LVRVSAVL
Sbjct  512   NNTRDHPGMIQVFLGHSGGLDTDGNELPRLVYVSREKRPGFEHHKKAGAMNSLVRVSAVL  571

Query  1514  TNAPFMLNLDCDHY  1555
             TN P+MLNLDCDHY
Sbjct  572   TNGPYMLNLDCDHY  585



>ref|XP_010265522.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Nelumbo nucifera]
Length=1034

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/546 (58%), Positives = 385/546 (71%), Gaps = 39/546 (7%)
 Frame = +2

Query  23    AALFTGGSH-------LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGF  181
             +A    GSH       +H   H+E + ++    ++C IC DE+G+   G++FVAC ECGF
Sbjct  4     SAGLVAGSHNRNELVVIHG--HEEPKPLKALDGQVCEICGDEVGITAEGDLFVACNECGF  61

Query  182   PVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGdd------------edhfegedfe  325
             PVC+PCY+YER EGNQ CP C TRYKR KG PRV GD+                E    +
Sbjct  62    PVCRPCYEYERREGNQQCPQCKTRYKRLKGSPRVEGDEDEEDVDDLEHEFNMEDEQNKQK  121

Query  326   qefeTKNHPPLSEN-GDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKDLEDE------QKE  484
                E   H  +S   G   ++ + +      A  +P +    + G    D+       K 
Sbjct  122   HLAEAMLHGKMSYGRGPDDDDNVQYPPVIAGAKSRPVSGEFPISGHGYGDQMLSSSLHKR  181

Query  485   VF-------SNAEWKDRVE-KWKTRQEKRGLVTRFdddkggadnedddFLMAD-ARQPLW  637
             +         N +W D+ E  WK R +   L  + +      D  D D  M D ARQPL 
Sbjct  182   IHPYPSDDPGNMKWDDKKEGSWKERMDDWKLRQQGNIGPDPDDAVDPDMPMTDEARQPLS  241

Query  638   RKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILD  817
             RK+PI+SSL++PYR++IV RL++L FF  +RIL P +DA  LWL SVICEIWF +SWILD
Sbjct  242   RKVPIASSLVNPYRMIIVIRLVVLAFFLRYRILNPVHDAIGLWLTSVICEIWFAISWILD  301

Query  818   QFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSIL  997
             QFPKW PI+RETYLDRLSLR+ER  EGE + L+ VD++VSTVDPLKEPP++T NTVLSIL
Sbjct  302   QFPKWFPIDRETYLDRLSLRYER--EGEPSMLSAVDIFVSTVDPLKEPPLVTGNTVLSIL  359

Query  998   AVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDY  1177
             A++YPVDK+SCYVSDDGASML F++L+ETAEFAR+WVPFCKK+ IEPRAPE YFS K+DY
Sbjct  360   AMBYPVDKISCYVSDDGASMLTFESLSETAEFARKWVPFCKKFSIEPRAPEMYFSLKMDY  419

Query  1178  LKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPG  1357
             LKDK+QPTFVKERRAMKREYEE+KVR+NALVAKA K P  GW+MQDGTPWPGNNT+DHPG
Sbjct  420   LKDKIQPTFVKERRAMKREYEEFKVRINALVAKAMKVPPTGWIMQDGTPWPGNNTKDHPG  479

Query  1358  MIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLN  1537
             MIQV+LG  G LD EG ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTNAPFMLN
Sbjct  480   MIQVFLGHSGGLDTEGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNAPFMLN  539

Query  1538  LDCDHY  1555
             LDCDHY
Sbjct  540   LDCDHY  545



>ref|XP_011026459.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Populus euphratica]
Length=1084

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/535 (58%), Positives = 390/535 (73%), Gaps = 53/535 (10%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             + C+IC D +GV ENG++FVAC EC FPVC+PCY+YER +G Q CP C TRY+RHKG PR
Sbjct  37    QTCQICGDNVGVTENGDIFVACNECAFPVCRPCYEYERKDGTQSCPQCKTRYRRHKGSPR  96

Query  281   V---------------------VGddedhfegedfeqefeTKNHP---PLSENGDYHNNQ  388
             V                     +G+ +  ++G+D E    +++     PL  NG   + +
Sbjct  97    VDGDEDEDDVDDLENEFNYAQGIGNAKHQWQGDDIELSSSSRHESQPIPLLTNGQPVSGE  156

Query  389   LPHHNTTNSAAFQPTAAPGSVGGKDLE----------------DEQKEV----FSNAEWK  508
             +P   T ++ + + T+ P     +++                 D  K++      N +WK
Sbjct  157   IPCA-TPDNQSVRTTSGPLGPAERNVHSSPYIDPRQPVPVRIVDPSKDLNSYGLGNVDWK  215

Query  509   DRVEKWKTRQEKRGL--VTRFdddkgg---adnedddFLMAD-ARQPLWRKLPISSSLIS  670
             +RVE WK +Q+K  +    R+ + KG      +  D+  MAD ARQPL R +PISSS ++
Sbjct  216   ERVEGWKLKQDKNAMQMTNRYSEGKGDMECTGSNGDELQMADDARQPLSRVVPISSSYLT  275

Query  671   PYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRE  850
             PYR VI+ RLIIL FF  +R+  P  DA+ LWL SVICEIWF LSW+LDQFPKW PINRE
Sbjct  276   PYRGVIILRLIILGFFLQYRVTHPVKDAYGLWLTSVICEIWFALSWLLDQFPKWMPINRE  335

Query  851   TYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSC  1030
             TYLDRL+LR++R  EGE + LAP+D++VSTVDP+KEPP++TANTVLSIL+VDYPVDKVSC
Sbjct  336   TYLDRLALRYDR--EGEPSQLAPIDIFVSTVDPMKEPPLVTANTVLSILSVDYPVDKVSC  393

Query  1031  YVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVK  1210
             YVSDDG++ML F+ L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK+QP+FVK
Sbjct  394   YVSDDGSAMLTFEALSETAEFARKWVPFCKKHSIEPRAPEFYFAQKIDYLKDKIQPSFVK  453

Query  1211  ERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGA  1390
             ERRAMKREYEE+KVR+NALVAKAQK PEEGW MQDGTPWPGNN RDHPGMIQV+LG  G 
Sbjct  454   ERRAMKREYEEFKVRINALVAKAQKMPEEGWTMQDGTPWPGNNPRDHPGMIQVFLGHSGG  513

Query  1391  LDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  514   LDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  568



>ref|XP_010545449.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010545450.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X2 [Tarenaya hassleriana]
Length=1032

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/550 (57%), Positives = 386/550 (70%), Gaps = 54/550 (10%)
 Frame = +2

Query  23    AALFTGGSH-----LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPV  187
             +A    GSH     +   +H+E + ++    + C IC D+IG+  +G++FVAC ECGFPV
Sbjct  4     SAGLVAGSHNRNELVVIHNHEEPKPLKNLDGQFCEICGDQIGLTVDGDLFVACNECGFPV  63

Query  188   CKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVV--------------------------G  289
             C+PCY+YER EG Q CP C TRYKR KG PRV                            
Sbjct  64    CRPCYEYERREGTQNCPQCKTRYKRLKGSPRVERDEDEEDIDDIEHEFNIEDEQNRQKQS  123

Query  290   ddedhfegedfeqefeTKNHPPL------SENGDYHNNQLPHHNTTNSAAFQPTAAP--G  445
              +        + +  + +++P        S +G++      H     S++      P   
Sbjct  124   AEAMLNGKMSYGRGPDDEDNPHFSLVHARSVSGEFPVGGYGHGEQGLSSSLHKRVHPYPA  183

Query  446   SVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadnedddFLMADAR  625
             S  G +  D++KE    A W++R++ WK +Q   G            D++ +  L+ +A 
Sbjct  184   SEAGSERWDDKKE----AGWRERMDDWKLQQGNLG---------PEPDDDPEMGLIDEAT  230

Query  626   QPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLS  805
             QPL RK+PI+SS I+PYR+VIV RL+IL FF  +RIL P +DA  LWL SVICEIWF +S
Sbjct  231   QPLSRKVPIASSKINPYRMVIVARLLILAFFLRYRILNPVHDAIGLWLTSVICEIWFAIS  290

Query  806   WILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTV  985
             WILDQFPKW PI+RETYLDRLSLR+ER  EGE N LAP DV+VSTVDP+KEPP++TANTV
Sbjct  291   WILDQFPKWFPIDRETYLDRLSLRYER--EGEPNLLAPADVFVSTVDPMKEPPLVTANTV  348

Query  986   LSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSE  1165
             LSILA+DYPV+K+SCYVSDDGASML F++L+ETAEFAR+WVPFCKK+ IEPRAPE YF+ 
Sbjct  349   LSILAMDYPVEKISCYVSDDGASMLTFESLSETAEFARKWVPFCKKFSIEPRAPEMYFTL  408

Query  1166  KIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTR  1345
             K+DYLKDKVQPTFVKERR+MKREYEE+KVR+NALVAKA K P EGW+MQDGTPWPGNNT+
Sbjct  409   KVDYLKDKVQPTFVKERRSMKREYEEFKVRINALVAKASKVPLEGWIMQDGTPWPGNNTK  468

Query  1346  DHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAP  1525
             DHPGMIQV+LG  G  DVEG ELP+LVYVSREKRPG+QHHKKAGAMNALVRVS VLTNAP
Sbjct  469   DHPGMIQVFLGHSGGHDVEGNELPRLVYVSREKRPGFQHHKKAGAMNALVRVSGVLTNAP  528

Query  1526  FMLNLDCDHY  1555
             FMLNLDCDHY
Sbjct  529   FMLNLDCDHY  538



>ref|XP_004229630.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Solanum lycopersicum]
Length=1083

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/566 (56%), Positives = 381/566 (67%), Gaps = 82/566 (14%)
 Frame = +2

Query  77    REVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRY  256
             + ++    ++C+IC D +G   NGE FVAC  C FPVC+PCY+YER +GNQ CP C TRY
Sbjct  10    KSLKTLGGQVCQICGDGVGTTVNGEPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRY  69

Query  257   KRHKGCPRVVGddedhfegedfeqef----------------------------------  334
             KRHKG P + G+  +  + +D   +                                   
Sbjct  70    KRHKGSPAISGESVEDGDADDGASDLNYSSENLNEKQKVADRVLSWHATYGRGEETGAPK  129

Query  335   ----eTKNHPPLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKD-------------  463
                  + NH PL  NG   + +L    +  S      A+PG  GG               
Sbjct  130   YDKEVSHNHIPLLTNGTDVSGEL----SAASPGRYSMASPGPAGGAKHIHPLTYSTDANQ  185

Query  464   -----LEDEQKEVFS----NAEWKDRVEKWKTRQEK-------------RGLVTRFdddk  577
                  + D  +E  S    N  WK+RV+ WK +Q+K             RG+      D 
Sbjct  186   SPNIRVVDPVREFGSPGLGNVAWKERVDGWKMKQDKNVVPMTTSQPPSERGVGD---IDA  242

Query  578   ggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAF  757
                   DD  L  +ARQPL RK+ I SS I+PYR+VIV RL+ILC F H+RI+ P  +A 
Sbjct  243   STDILGDDSLLNDEARQPLSRKVSIPSSRINPYRMVIVLRLVILCIFLHYRIMNPVPNAI  302

Query  758   PLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVS  937
             PLWL+SVICEIWF  SWILDQFPKW PINRETYLDRL+LR++R  EGE + LA VD++VS
Sbjct  303   PLWLLSVICEIWFAFSWILDQFPKWLPINRETYLDRLALRYDR--EGEPSQLAAVDIFVS  360

Query  938   TVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFC  1117
             TVDPLKEPP++TANTVLSILAVDYPVDKVSCYVSDDGA+ML F+ L+ETAEFAR+WVPF 
Sbjct  361   TVDPLKEPPLVTANTVLSILAVDYPVDKVSCYVSDDGAAMLTFEALSETAEFARKWVPFS  420

Query  1118  KKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEE  1297
             KKY IEPRAPE+YFS+K+DYLKDKVQ +FVKERRAMKREYEE+K+R+N+LVAKAQK PEE
Sbjct  421   KKYSIEPRAPEWYFSQKVDYLKDKVQTSFVKERRAMKREYEEFKIRINSLVAKAQKVPEE  480

Query  1298  GWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAG  1477
             GW+MQDGTPWPGNNTRDHPGMIQV+LG  G LD +G ELP+LVYVSREKRPG+QHHKKAG
Sbjct  481   GWIMQDGTPWPGNNTRDHPGMIQVFLGQSGGLDSDGNELPRLVYVSREKRPGFQHHKKAG  540

Query  1478  AMNALVRVSAVLTNAPFMLNLDCDHY  1555
             AMNALVRVSAVLTN PFMLNLDCDHY
Sbjct  541   AMNALVRVSAVLTNGPFMLNLDCDHY  566



>gb|ACS68197.1| cellulose synthase 7.1 catalytic subunit [Brassica napus]
Length=1031

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/553 (58%), Positives = 385/553 (70%), Gaps = 59/553 (11%)
 Frame = +2

Query  23    AALFTGGSH-----LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPV  187
             +A    GSH     +   +H+E + ++    ++C IC D+IG+   G++FVAC ECGFP 
Sbjct  4     SAGLVAGSHNRNELVVIHNHEEPKPLKNLDGQVCEICGDQIGLTVEGDLFVACNECGFPA  63

Query  188   CKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVV-------------------Gddedhfe  310
             C+PCY+YER EG+Q CP C TRYKR +G PRV                    G D+    
Sbjct  64    CRPCYEYERREGSQNCPQCKTRYKRLRGSPRVEGDEDEEDIDDIEDEFNIDDGQDKQKQS  123

Query  311   gedfeqefeTKNHPPLS-ENGDYHNNQLPHHNTTNSAAF-----------------QPTA  436
              E       +    P   ENG +       H+   S  F                  P A
Sbjct  124   AESTLYGKMSYGRGPEDDENGRFPPVIAGGHSRHVSGEFPVGGGYANGEHGLHKRVHPYA  183

Query  437   APGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadnedddFLMA  616
             +  S  G +  D++KE      W++R++ WK +Q   G            D++ +  L+ 
Sbjct  184   S--SEAGSERWDDKKE----GGWRERMDDWKLQQGNLG---------PEPDDDPEMGLID  228

Query  617   DARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWF  796
             +ARQPL RK+PI+SS I+PYR+VIV RL+IL  F  +R+L P +DA  LWL SVICEIWF
Sbjct  229   EARQPLSRKVPIASSKINPYRMVIVARLVILAVFLRYRLLNPVHDALGLWLTSVICEIWF  288

Query  797   GLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITA  976
              +SWILDQFPKW PI+RETYLDRLSLR+ER  EGE N LAPVDV+VSTVDP+KEPP++T+
Sbjct  289   AVSWILDQFPKWFPIDRETYLDRLSLRYER--EGEPNMLAPVDVFVSTVDPMKEPPLVTS  346

Query  977   NTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFY  1156
             NTVLSILA+DYPV+K+SCYVSDDGASML FD+LAETAEFAR+WVPFCKK+ IEPRAPE Y
Sbjct  347   NTVLSILAMDYPVEKISCYVSDDGASMLTFDSLAETAEFARKWVPFCKKFSIEPRAPEMY  406

Query  1157  FSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGN  1336
             F+ KIDYLKDKVQPTFVKERRAMKREYEE+KVR+NALVAKA K P EGW+M DGTPWPGN
Sbjct  407   FTLKIDYLKDKVQPTFVKERRAMKREYEEFKVRINALVAKASKAPIEGWIMPDGTPWPGN  466

Query  1337  NTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLT  1516
             NT+DHPGMIQV+LGS G  DVEG ELP+LVYVSREKRPG+QHHKKAGAMNALVRV+ VLT
Sbjct  467   NTKDHPGMIQVFLGSNGGFDVEGNELPRLVYVSREKRPGFQHHKKAGAMNALVRVAGVLT  526

Query  1517  NAPFMLNLDCDHY  1555
             NAPFMLNLDCDHY
Sbjct  527   NAPFMLNLDCDHY  539



>gb|EYU35355.1| hypothetical protein MIMGU_mgv1a000638mg [Erythranthe guttata]
Length=1036

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/553 (57%), Positives = 383/553 (69%), Gaps = 55/553 (10%)
 Frame = +2

Query  23    AALFTGGSH-------LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGF  181
             +A    GSH       +H   H+E + ++  S + C IC DE+G+  +GE+FVAC ECGF
Sbjct  4     SAGLVAGSHNRNELVVIHG--HEEPKTLKNLSGQDCEICGDEVGLTVDGELFVACNECGF  61

Query  182   PVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRV--------------------------  283
             PVC+PCY+YER EGNQ CP C TR+KR KG PRV                          
Sbjct  62    PVCRPCYEYERREGNQLCPQCKTRFKRLKGSPRVEGDEDEEDIDDIEHEFNIDEQKKNTN  121

Query  284   VGddedhfegedfeqefeTKN-HPPLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSV---  451
             + +   H +        + +N H P+   G   +  +    T +S A+       S+   
Sbjct  122   IAEAMLHGKMSYGRGPEDEENIHLPVIAGG--RSRHVSGEITISSHAYGDQMTGASLHKR  179

Query  452   -----GGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadnedddFLMA  616
                  G  D    + +   +  WKDR++ WK +Q   G        +     + D  ++ 
Sbjct  180   VHPYSGTDDPGSAKWDEKKDMGWKDRMDDWKMQQGNLG-------PEHDDFVDPDMGIVD  232

Query  617   DARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWF  796
             +ARQPL RK+PI+SS I+PYR+VIV RL +L  F  +RIL P +DAF LWL S+ICEIWF
Sbjct  233   EARQPLSRKVPIASSKINPYRMVIVARLFVLAIFLRYRILNPVHDAFGLWLTSIICEIWF  292

Query  797   GLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITA  976
               SWILDQFPKW PI+RETYLDRLSLR+ER  EGE N LAPVD++VSTVDP+KEPP++TA
Sbjct  293   AFSWILDQFPKWFPIDRETYLDRLSLRYER--EGEPNMLAPVDIFVSTVDPMKEPPLVTA  350

Query  977   NTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFY  1156
             NT+LSILAVDYPVDK+SCY+SDDGASM  F+ L+ETAEF+R+WVPFCKK+ IEPRAPE Y
Sbjct  351   NTLLSILAVDYPVDKISCYISDDGASMCTFEALSETAEFSRKWVPFCKKFTIEPRAPEMY  410

Query  1157  FSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGN  1336
             FSEK+DYLKDKVQPTFVKERRAMKREYEE+K+R+NA+VAKA K P  GW+MQDGTPWPGN
Sbjct  411   FSEKVDYLKDKVQPTFVKERRAMKREYEEFKIRINAMVAKATKVPPGGWIMQDGTPWPGN  470

Query  1337  NTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLT  1516
             NT+DHPGMIQV+LG  G LDVEG ELP+LVYVSREKRP +QHHKKAGAMNALVRV+ VLT
Sbjct  471   NTKDHPGMIQVFLGQSGGLDVEGNELPRLVYVSREKRPSFQHHKKAGAMNALVRVAGVLT  530

Query  1517  NAPFMLNLDCDHY  1555
             NAPFMLNLDCDHY
Sbjct  531   NAPFMLNLDCDHY  543



>ref|NP_001275292.1| cellulose synthase [Solanum tuberosum]
 gb|AAP97495.1| cellulose synthase [Solanum tuberosum]
Length=1083

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/566 (57%), Positives = 382/566 (67%), Gaps = 82/566 (14%)
 Frame = +2

Query  77    REVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRY  256
             + ++    ++C+IC D +G   NGE FVAC  C FPVC+PCY+YER +GNQ CP C TRY
Sbjct  10    KSLKTLGGQVCQICGDGVGTTVNGEPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRY  69

Query  257   KRHKGCPRVVGddedhfegedfeqef----------------------------------  334
             KRHKG P + G+  +  + +D   +                                   
Sbjct  70    KRHKGSPAISGESVEDGDADDGASDLNYSSENLNEKQKVADRVLSWHATYGRGEETGAPK  129

Query  335   ----eTKNHPPLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKD-------------  463
                  + NH PL  NG   + +L    +  S      A+PG  GG               
Sbjct  130   YDKEVSHNHIPLLTNGTDVSGEL----SAASPERYSMASPGPAGGAKHIHPLTYSTDANQ  185

Query  464   -----LEDEQKEVFS----NAEWKDRVEKWKTRQEK-------------RGLVTRFdddk  577
                  + D  +E  S    N  WK+RV+ WK +Q+K             RG+      D 
Sbjct  186   SPNIRVVDPVREFGSPGIGNVAWKERVDGWKMKQDKNVVPMTTSHPPSERGVGD---IDA  242

Query  578   ggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAF  757
                   DD  L  +ARQPL RK+ I SS I+PYR+VIV RL+ILC F H+RI+ P  +A 
Sbjct  243   STDILGDDSLLNDEARQPLSRKVSIPSSRINPYRMVIVLRLVILCIFLHYRIMNPVPNAI  302

Query  758   PLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVS  937
             PLWL+SVICEIWF +SWILDQFPKW PINRETYLDRL+LR++R  EGE + LA VD++VS
Sbjct  303   PLWLLSVICEIWFAVSWILDQFPKWLPINRETYLDRLALRYDR--EGEPSQLAAVDIFVS  360

Query  938   TVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFC  1117
             TVDPLKEPP++TANTVLSILAVDYPVDKVSCYVSDDGA+ML F+ L+ETAEFAR+WVPF 
Sbjct  361   TVDPLKEPPLVTANTVLSILAVDYPVDKVSCYVSDDGAAMLTFEALSETAEFARKWVPFS  420

Query  1118  KKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEE  1297
             KKY IEPRAPE+YFS+K+DYLKDKVQ +FVKERRAMKREYEE+K+R+NALVAKAQK PEE
Sbjct  421   KKYSIEPRAPEWYFSQKVDYLKDKVQTSFVKERRAMKREYEEFKIRINALVAKAQKVPEE  480

Query  1298  GWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAG  1477
             GW+MQDGTPWPGNNTRDHPGMIQV+LG  G LD +G ELP+LVYVSREKRPG+QHHKKAG
Sbjct  481   GWIMQDGTPWPGNNTRDHPGMIQVFLGQSGGLDSDGNELPRLVYVSREKRPGFQHHKKAG  540

Query  1478  AMNALVRVSAVLTNAPFMLNLDCDHY  1555
             AMNALVRVSAVLTN PFMLNLDCDHY
Sbjct  541   AMNALVRVSAVLTNGPFMLNLDCDHY  566



>gb|KHN00756.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] [Glycine 
soja]
Length=1052

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/557 (57%), Positives = 386/557 (69%), Gaps = 51/557 (9%)
 Frame = +2

Query  32    FTGGSH------LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCK  193
                GSH      L  AD   R  V   S ++C+IC DE+ V  NGE FVAC EC FPVC+
Sbjct  7     LVAGSHNRNEFVLINADETARVAVTELSGQICQICGDELEVTVNGEPFVACNECAFPVCR  66

Query  194   PCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHPPLSENGD  373
             PCY+YER EGNQ CP C TRYKR KG PRV GD+E+    +   +             G 
Sbjct  67    PCYEYERREGNQVCPQCKTRYKRIKGSPRVEGDEEEDDSDDLESEFDIGSVFSARLNYGS  126

Query  374   YHNNQLPHHNTTNSAAFQPTAAPG-SVGGKDLE---------------------------  469
               N  + H  +   AA   +  P  + G +D+                            
Sbjct  127   QVNGSVIHAPSEFDAASVASEIPLLTYGQEDVGISADKHALILPPFTARGKRVHPMPFPD  186

Query  470   ----------DEQKEV----FSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadnedddF  607
                       D +K++    + +  WK+R+E WK +Q ++  V R +  K   + +D D 
Sbjct  187   SSVPVQPRPMDPKKDIAVYGYGSVAWKERMEDWKKKQSEKLQVVRHEGGKDSDELDDPDL  246

Query  608   -LMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVIC  784
               M + RQPLWRKLPISSS I+PYRI+IV R+ ILC FFH+RIL P  DA+ LWL SVIC
Sbjct  247   PKMDEGRQPLWRKLPISSSRINPYRIIIVLRIAILCLFFHYRILHPVNDAYALWLTSVIC  306

Query  785   EIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPP  964
             EIWF +SWI DQFPKWSPI RETYLDRLSLR+E+  EG+ + LA +DV+VSTVDP+KEPP
Sbjct  307   EIWFAVSWIFDQFPKWSPILRETYLDRLSLRYEK--EGKPSLLADIDVFVSTVDPMKEPP  364

Query  965   IITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRA  1144
             +ITANTVLSILAVDYPVDKV+CYVSDDGA+ML F+ L+ET+EFAR+WVPFCKK+CIEPRA
Sbjct  365   LITANTVLSILAVDYPVDKVACYVSDDGAAMLTFEALSETSEFARKWVPFCKKFCIEPRA  424

Query  1145  PEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTP  1324
             PE+YF++K+DYLKDKV  TF++ER A+KREYEE+KVR+NALVA AQK PE+GW MQDGTP
Sbjct  425   PEWYFAQKVDYLKDKVDATFIRERHAIKREYEEFKVRINALVALAQKVPEDGWTMQDGTP  484

Query  1325  WPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVS  1504
             WPGNN RDHPGMIQV+LG  G  D+EG ELP+LVYVSREKRPGY HHKKAGAMNALVRVS
Sbjct  485   WPGNNVRDHPGMIQVFLGQNGVRDIEGNELPRLVYVSREKRPGYDHHKKAGAMNALVRVS  544

Query  1505  AVLTNAPFMLNLDCDHY  1555
             A++TNAP++LN+DCDHY
Sbjct  545   AIITNAPYVLNVDCDHY  561



>gb|KGN60109.1| hypothetical protein Csa_3G878780 [Cucumis sativus]
Length=1062

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/537 (58%), Positives = 387/537 (72%), Gaps = 53/537 (10%)
 Frame = +2

Query  95    SQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGC  274
             + + C+IC D +G+  +G+VFVAC EC FPVC+PCY+YER +GNQ CP C TRYKRHKG 
Sbjct  35    NSQTCQICGDTVGLTASGDVFVACNECAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGS  94

Query  275   PR-------------------VVGddedhfegedfeqefeT----KNHP-PLSENGDYHN  382
             PR                   V G  +   +    + E  T    ++ P PL  NG   +
Sbjct  95    PRVDGDDDEDDVDDIENEFNYVQGSSKTKRQWHGEDAELSTSARHESQPIPLLTNGQSVS  154

Query  383   NQLPHHNTTNSAAFQPTAAPGSVGGKDLE----------------DEQKEVFS----NAE  502
              ++P   T ++ + + T+ P     K ++                D  K++ S    N +
Sbjct  155   GEIPCA-TPDNQSVRTTSGPLGPPEKHMQSHPYVDPRQPVPVRIVDPSKDLNSYGLGNVD  213

Query  503   WKDRVEKWKTRQEKRGL-----VTRFdddkggadnedddFLMAD-ARQPLWRKLPISSSL  664
             WK+RVE WK +QEK  +      T    D  G  +  ++  MAD ARQPL R +PI SS 
Sbjct  214   WKERVEGWKLKQEKNMMQMTSRYTEGKGDMEGTGSNGEELQMADDARQPLSRVVPIPSSH  273

Query  665   ISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPIN  844
             ++PYR+VI+ RLIIL FF  +R+  P  DA+PLWL SVICE+WF LSW+LDQFPKWSP+N
Sbjct  274   LTPYRVVIILRLIILGFFLQYRLTHPVKDAYPLWLTSVICEVWFALSWLLDQFPKWSPVN  333

Query  845   RETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKV  1024
             RET+L+RL+LR++R  EGE + LAPVDV+VSTVDPLKEPP++TANTVLSIL+VDYPVDKV
Sbjct  334   RETFLERLALRYDR--EGEPSQLAPVDVFVSTVDPLKEPPLVTANTVLSILSVDYPVDKV  391

Query  1025  SCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTF  1204
             SCYVSDDG++ML F+ L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK++P+F
Sbjct  392   SCYVSDDGSAMLTFEALSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKDKIKPSF  451

Query  1205  VKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSE  1384
             VKERRAMKREYEE+KVR+NALVAKAQK PEEGW MQDGT WPGNN RDHPGMIQV+LG  
Sbjct  452   VKERRAMKREYEEFKVRINALVAKAQKMPEEGWTMQDGTAWPGNNPRDHPGMIQVFLGHS  511

Query  1385  GALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             G LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  512   GGLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  568



>ref|XP_010547260.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase A catalytic 
subunit 3 [UDP-forming]-like [Tarenaya hassleriana]
Length=1078

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/563 (57%), Positives = 389/563 (69%), Gaps = 63/563 (11%)
 Frame = +2

Query  50    LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQ  229
             + A      + ++    ++C+IC D +G    G+ FVAC  C FPVC+ CY+YER +GNQ
Sbjct  2     IGAEGESGAKSMKSLGGQVCQICGDSVGKTAEGDPFVACDVCAFPVCRACYEYERKDGNQ  61

Query  230   CCPHCNTRYKRHKGCPRVVGdded----------------hfegedfeqefeTKNHPPLS  361
              CP C T+YKRHKG P +VGD E+                +   +    E     H    
Sbjct  62    SCPQCKTKYKRHKGSPAIVGDAEEDVNIDEDAIGFSYTPDNQSQKQKISERMLSWHLTGG  121

Query  362   ENGDY---------HNNQLPHHNTTNSAAFQPTAA---------PGSVGGKDLE------  469
             ++GD           +N +P   +    + + +AA         P   GGK L       
Sbjct  122   QSGDLGLPEYDKEPSHNHIPRLTSGQEVSGELSAASPERLSIASPPRGGGKRLPYASDIN  181

Query  470   --------DEQKEVFS----NAEWKDRVEKWKTRQEKR------GLVT--RFdddkggad  589
                     D  +E  S    N  WK+RV+ WK +QEK       GL    R  D++   D
Sbjct  182   QSPNIRVVDPVREFGSPGIGNVAWKERVDGWKMKQEKNVIPMSTGLAASERGGDNETSTD  241

Query  590   nedddFLMAD-ARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLW  766
                DD L+ D ARQPL RK+ + SS I+PYR+VIV RL+ILC F H+RI  P  +AF LW
Sbjct  242   VFVDDSLLNDEARQPLSRKVSVPSSRINPYRMVIVLRLVILCLFLHYRITNPVPNAFGLW  301

Query  767   LISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVD  946
             L+SVICEIWF +SWILDQFPKW P+NRETYLDRL+LR++R  EGE + LA VD++VSTVD
Sbjct  302   LVSVICEIWFAISWILDQFPKWLPVNRETYLDRLALRYDR--EGEPSQLAAVDIFVSTVD  359

Query  947   PLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKY  1126
             PLKEPP++TANTVLSIL+VDYPVDKVSCYVSDDGA+ML F+ L+ET+EFAR+WVPFCKKY
Sbjct  360   PLKEPPLVTANTVLSILSVDYPVDKVSCYVSDDGAAMLTFEALSETSEFARKWVPFCKKY  419

Query  1127  CIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWV  1306
              IEPRAPE+YF++KIDYLKDKVQP+FVKERRAMKREYEE+K+R+NALVAKAQK PEEGWV
Sbjct  420   NIEPRAPEWYFAQKIDYLKDKVQPSFVKERRAMKREYEEFKIRINALVAKAQKVPEEGWV  479

Query  1307  MQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMN  1486
             MQDGTPWPGNNTRDHPGMIQV+LG  G LD EG ELP+LVYVSREKRPG+QHHKKAGAMN
Sbjct  480   MQDGTPWPGNNTRDHPGMIQVFLGQNGGLDAEGNELPRLVYVSREKRPGFQHHKKAGAMN  539

Query  1487  ALVRVSAVLTNAPFMLNLDCDHY  1555
             ALVRVSAVLTN PF+LNLDCDHY
Sbjct  540   ALVRVSAVLTNGPFLLNLDCDHY  562



>ref|NP_001104954.1| cellulose synthase-1 [Zea mays]
 gb|AAF89961.1|AF200525_1 cellulose synthase-1 [Zea mays]
Length=1075

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/525 (59%), Positives = 381/525 (73%), Gaps = 42/525 (8%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             ++C+IC D +GV   G+VFVAC EC FPVC+PCY+YER EGNQCCP C TRYKR KG PR
Sbjct  39    QVCQICGDSVGVSATGDVFVACNECAFPVCRPCYEYERKEGNQCCPQCKTRYKRQKGSPR  98

Query  281   VVGddedhfegedfeqefeTKNH---PPLSENGDYHN-----NQLPHHNTTNSAAFQ---  427
             V GD+++    +   +    +     P     GD  +        PHH      + Q   
Sbjct  99    VHGDEDEEDVDDLDNEFNYKQGSGKGPEWQLQGDDADLSSSARHEPHHRIPRLTSGQQIS  158

Query  428   ---PTAAPGSVGGKD---------------LEDEQKEV----FSNAEWKDRVEKWKTRQE  541
                P A+P     +                + D  K++     ++ +WK+RVE W+ +Q+
Sbjct  159   GEIPDASPDRHSIRSPTSSYVDPSVPVPVRIVDPSKDLNSYGLNSVDWKERVESWRVKQD  218

Query  542   KRGLVT-------RFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRL  700
             K  +         R  D +G   N +   ++ DAR PL R +PISS+ ++ YR+VI+ RL
Sbjct  219   KNMMQVTNKYPEARGGDMEGTGSNGEXMQMVDDARLPLSRIVPISSNQLNLYRVVIILRL  278

Query  701   IILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRF  880
             IILCFFF +R+  P  DA+ LWL+SVICE+WF LSW+LDQFPKW PINRETYLDRL+LR+
Sbjct  279   IILCFFFQYRVSHPVRDAYGLWLVSVICEVWFALSWLLDQFPKWYPINRETYLDRLALRY  338

Query  881   ERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASML  1060
             +R  EGE + LAP+DV+VSTVDPLKEPP+ITANTVLSIL+VDYPVDKVSCYVSDDG++ML
Sbjct  339   DR--EGEPSQLAPIDVFVSTVDPLKEPPLITANTVLSILSVDYPVDKVSCYVSDDGSAML  396

Query  1061  LFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYE  1240
              F++L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK+QP+FVKERRAMKREYE
Sbjct  397   TFESLSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKDKIQPSFVKERRAMKREYE  456

Query  1241  EYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPK  1420
             E+KVR+NALVAKAQK PEEGW M DGT WPGNN RDHPGMIQV+LG  G LD +G ELP+
Sbjct  457   EFKVRINALVAKAQKVPEEGWTMADGTAWPGNNPRDHPGMIQVFLGHSGGLDTDGNELPR  516

Query  1421  LVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  517   LVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  561



>gb|AFW81389.1| cellulose synthase1 [Zea mays]
Length=1071

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/521 (59%), Positives = 383/521 (74%), Gaps = 38/521 (7%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             ++C+IC D +GV   G+VFVAC EC FPVC+PCY+YER EGNQCCP C TRYKR KG PR
Sbjct  39    QVCQICGDSVGVSATGDVFVACNECAFPVCRPCYEYERKEGNQCCPQCKTRYKRQKGSPR  98

Query  281   VVGddedhfegedfeqefeTKNH---PPLSENGDYHN-----NQLPHHNTTNSAAFQ--P  430
             V GD+++    +   +    + +   P     GD  +        PHH      + Q  P
Sbjct  99    VHGDEDEEDVDDLDNEFNYKQGNGKGPEWQLQGDDADLSSSARHEPHHRIPRLTSGQQIP  158

Query  431   TAAPGSVGGKD---------------LEDEQKEV----FSNAEWKDRVEKWKTRQEKRGL  553
              A+P     +                + D  K++     ++ +WK+RVE W+ +Q+K  +
Sbjct  159   DASPDRHSIRSPTSSYVDPSVPVPVRIVDPSKDLNSYGLNSVDWKERVESWRVKQDKNMM  218

Query  554   VT-------RFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILC  712
                      R  D +G   N +D  ++ DAR PL R +PISS+ ++ YR+VI+ RLIILC
Sbjct  219   QVTNKYPEARGGDMEGTGSNGEDMQMVDDARLPLSRIVPISSNQLNLYRVVIILRLIILC  278

Query  713   FFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDG  892
             FFF +R+  P  +A+ LWL+SVICE+WF LSW+LDQFPKW PINRETYLDRL+LR++R  
Sbjct  279   FFFQYRVSHPVRNAYGLWLVSVICEVWFALSWLLDQFPKWYPINRETYLDRLALRYDR--  336

Query  893   EGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDT  1072
             EGE + LAP+DV+VSTVDPLKEPP+ITANTVLSIL+VDYPVDKVSCYVSDDG++ML F++
Sbjct  337   EGEPSQLAPIDVFVSTVDPLKEPPLITANTVLSILSVDYPVDKVSCYVSDDGSAMLTFES  396

Query  1073  LAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKV  1252
             L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK+QP+FVKERRAMKREYEE+KV
Sbjct  397   LSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKDKIQPSFVKERRAMKREYEEFKV  456

Query  1253  RVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYV  1432
             R+NALVAKAQK PEEGW M DGT WPGNN RDHPGMIQV+LG  G LD +G ELP+LVYV
Sbjct  457   RINALVAKAQKVPEEGWTMADGTAWPGNNPRDHPGMIQVFLGHSGGLDTDGNELPRLVYV  516

Query  1433  SREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             SREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  517   SREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  557



>ref|XP_010695250.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Beta vulgaris subsp. vulgaris]
Length=1050

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/525 (59%), Positives = 377/525 (72%), Gaps = 45/525 (9%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
              +C+IC + +G   NG++FVAC ECGFPVC+PCY+YER EGNQ C  C TRY+RH+G P 
Sbjct  14    NLCQICGENVGKAVNGKLFVACGECGFPVCRPCYEYERKEGNQSCLQCKTRYRRHEGSPV  73

Query  281   VVGddedhfegedfeqefeTKNHPPLSEN----------------GDYHNNQLPHHNTTN  412
             V GD E+  +  + +      N+ P ++N                G   N    +++   
Sbjct  74    VQGDSEEDGDAAEGDS---DSNYTPANQNEKLKTEQRSLSWRTSYGKLENTGATNNSRRE  130

Query  413   SAAFQPTAAP--------GSVGGK----DLEDEQKEVFS----NAEWKDRVEKWKTRQEK  544
              +    T +P        G  GG      + D  +E  S    N  WK+RV+ WK +QEK
Sbjct  131   VSGELSTGSPDRFSVGSTGVYGGIKSTIGIADTSREFGSPKLGNIAWKERVDGWKMKQEK  190

Query  545   --------RGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPYRIVIVFRL  700
                     R    R  D     D  DD  L  +ARQPL RK+PI SS ++PYR+VI  RL
Sbjct  191   NVVPASITRPPSERGGDIDATTDVIDDSLLNDEARQPLSRKVPIPSSKLNPYRMVIALRL  250

Query  701   IILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRF  880
             ++L  FFH+RI  P  +A+PLWL+SVICEIWF +SWILDQFPKW PINRETYLDRLSLR+
Sbjct  251   VVLGIFFHYRITNPVNNAYPLWLVSVICEIWFAISWILDQFPKWLPINRETYLDRLSLRY  310

Query  881   ERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASML  1060
             +R  EGE + LA VD++VSTVDP+KEPP++TANT+LSI+AVDYPVDKV+CYVSDDGA+ML
Sbjct  311   DR--EGEPSQLAAVDIFVSTVDPMKEPPLVTANTILSIMAVDYPVDKVACYVSDDGAAML  368

Query  1061  LFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYE  1240
              F+ L+ETAEFA+ WVPFCKKY IEPRAPE YFS+KIDYLKDKV P+FVK+RRAMKR+YE
Sbjct  369   TFEALSETAEFAKMWVPFCKKYDIEPRAPECYFSQKIDYLKDKVHPSFVKDRRAMKRKYE  428

Query  1241  EYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPK  1420
             E+K+R+N LVAKAQK PEEGWVMQDG PWPGNNTRDHPGMIQ++LG  G LD EG ELP+
Sbjct  429   EFKIRINVLVAKAQKVPEEGWVMQDGIPWPGNNTRDHPGMIQIFLGQSGGLDSEGNELPR  488

Query  1421  LVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             LVYVSREKRPG++HHKKAGAMNALVRVSAVLTN PF+LNLDCDHY
Sbjct  489   LVYVSREKRPGFEHHKKAGAMNALVRVSAVLTNGPFLLNLDCDHY  533



>ref|XP_004501313.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Cicer arietinum]
Length=1082

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/549 (57%), Positives = 390/549 (71%), Gaps = 50/549 (9%)
 Frame = +2

Query  53    HAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQC  232
             H +     + ++  + ++C+IC D +G+    +VFVAC ECGFPVC+PCY+YER +GN+ 
Sbjct  22    HDSSDSGPKPLKNLNGQICQICNDNVGLTATSDVFVACNECGFPVCRPCYEYERKDGNKS  81

Query  233   CPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHP--------------------  352
             CP C TRYKRH+G PRV GDDE+    +   +    + +                     
Sbjct  82    CPQCKTRYKRHRGSPRVEGDDEEDDVDDIENEFNYAQGNSKARRQWEDELSSSSRRDYQQ  141

Query  353   --PLSENGDYHNNQLP------HHNTTNSAAFQPTAAPGSVGGKD--------LEDEQKE  484
               PL  NG   + ++P          T S    P+    S+   D        + D  K+
Sbjct  142   PIPLLTNGQTMSGEIPCATPDTQSVRTTSGPLGPSEKVHSLPYIDPRQPVPVRIVDPSKD  201

Query  485   VFS----NAEWKDRVEKWKTRQEKR--GLVTRFdddkg------gadnedddFLMADARQ  628
             + S    N +WK+RVE WK + EK    +  R+ + KG         N ++  ++ DARQ
Sbjct  202   LNSYGLGNVDWKERVEGWKLKHEKNMVQMTGRYSEGKGGGDIEGTGSNGEELQMVDDARQ  261

Query  629   PLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSW  808
             PL R +PISSS ++PYR+VIV RLIIL FF  +R+  P  DA+PLWL SVICEIWF LSW
Sbjct  262   PLSRIVPISSSQLTPYRVVIVLRLIILGFFLQYRVTHPVKDAYPLWLTSVICEIWFALSW  321

Query  809   ILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVL  988
             ILDQFPKWSPINRETYLDRL++R++RDGE  +  LAPVDV+VSTVDPLKEPP++TANTVL
Sbjct  322   ILDQFPKWSPINRETYLDRLAIRYDRDGEPSQ--LAPVDVFVSTVDPLKEPPLVTANTVL  379

Query  989   SILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEK  1168
             SILAVDYPVDKVSCYVSDDG++ML F+ L+ETAEFA++WVPFCKK+ IEPRAPEFYF++K
Sbjct  380   SILAVDYPVDKVSCYVSDDGSAMLTFEALSETAEFAKKWVPFCKKHNIEPRAPEFYFAQK  439

Query  1169  IDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRD  1348
             IDYLKDK+QP+FVKERR+MKR YEE+KV++NA VAKAQK PEEGW M+DGTPWPGNN RD
Sbjct  440   IDYLKDKIQPSFVKERRSMKRAYEEFKVQINAHVAKAQKTPEEGWTMEDGTPWPGNNPRD  499

Query  1349  HPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPF  1528
             HPGMIQV+LG  G LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  +
Sbjct  500   HPGMIQVFLGHSGGLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAY  559

Query  1529  MLNLDCDHY  1555
             +LN+DCDHY
Sbjct  560   ILNVDCDHY  568



>ref|XP_003526416.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Glycine max]
Length=1084

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/550 (56%), Positives = 389/550 (71%), Gaps = 51/550 (9%)
 Frame = +2

Query  53    HAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQC  232
             H +     + ++  + ++C+IC D +G+   G+VFVAC EC FPVC+PCY+YER +GNQ 
Sbjct  22    HDSSDSGSKPLKSLNGQICQICGDTVGLTATGDVFVACNECAFPVCRPCYEYERKDGNQS  81

Query  233   CPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHP--------------------  352
             CP C TRYKRH+G PRV GD+++    +   +    +                       
Sbjct  82    CPQCKTRYKRHRGSPRVEGDEDEDDSDDIENEFNYAQGKAKARRQWEDDADLSSSSRRES  141

Query  353   ----PLSENGDYHNNQLP------HHNTTNSAAFQPTAAPGSVGGKD--------LEDEQ  478
                 PL  NG   + ++P          T S    P+    S+   D        + D  
Sbjct  142   QQPIPLLTNGQTMSGEIPCATPDTQSVRTTSGPLGPSEKVHSLPYVDPRQPVPVRIVDPS  201

Query  479   KEVFS----NAEWKDRVEKWKTRQEKR--GLVTRFdd-----dkggadnedddFLMADAR  625
             K++ S    N +WK+RVE WK +QEK    +  R+ +      +G   N ++  ++ DAR
Sbjct  202   KDLNSYGLGNVDWKERVEGWKLKQEKNMVQMTGRYTEGKGGDVEGTGSNGEELQMVDDAR  261

Query  626   QPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLS  805
             QP+ R +PI SS ++PYR+VI+ RLIIL FF  +R+  P  DA+PLWL SVICEIWF LS
Sbjct  262   QPMSRVVPIPSSQLTPYRVVIILRLIILGFFLQYRVTHPVKDAYPLWLTSVICEIWFALS  321

Query  806   WILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTV  985
             W+LDQFPKWSPINRETYL+RL+LR++R  EGE + L PVDV+VSTVDPLKEPP++TANTV
Sbjct  322   WLLDQFPKWSPINRETYLERLALRYDR--EGEPSQLDPVDVFVSTVDPLKEPPLVTANTV  379

Query  986   LSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSE  1165
             LSIL+VDYPVDKVSCYVSDDG++ML F+ L+ETAEFA++WVPFCKK+ IEPRAPEFYF++
Sbjct  380   LSILSVDYPVDKVSCYVSDDGSAMLTFEALSETAEFAKKWVPFCKKHNIEPRAPEFYFAQ  439

Query  1166  KIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTR  1345
             KIDYLKDK+QP+FVKERRAMKREYEE+KVR+NALVAKAQK PEEGW MQDGT WPGNN R
Sbjct  440   KIDYLKDKIQPSFVKERRAMKREYEEFKVRINALVAKAQKMPEEGWTMQDGTAWPGNNPR  499

Query  1346  DHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAP  1525
             DHPGMIQV+LG  G LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  
Sbjct  500   DHPGMIQVFLGHSGGLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGA  559

Query  1526  FMLNLDCDHY  1555
             ++LN+DCDHY
Sbjct  560   YLLNVDCDHY  569



>gb|ABI78958.1| cellulose synthase 5 [Physcomitrella patens]
Length=1081

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/553 (57%), Positives = 386/553 (70%), Gaps = 65/553 (12%)
 Frame = +2

Query  62    DHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPH  241
             DH+  + + + + + C+IC D++GV  +GE+FVAC ECGFPVC+PC++YER EGNQ CP 
Sbjct  23    DHEGPKPLSQVNSQFCQICGDDVGVTVDGELFVACFECGFPVCRPCFEYERKEGNQSCPQ  82

Query  242   CNTRYKRHKGCPRVVGddedhfegedfeqefeTKN------------HPPLSENGDYHNN  385
             C +RY R KG PRV GD+E+    +   +                  H  +S  G+Y +N
Sbjct  83    CKSRYNRQKGSPRVPGDEEEDDTDDLENEFALEMGQLDEQNVTDAMLHGHMSYGGNYDHN  142

Query  386   QLPHHNTTNSAAFQPTAAPGSVGGKDLEDEQKEV--------------------------  487
                 H T       P    G +G  DL+D+   +                          
Sbjct  143   LPNLHQTPQF----PLLTDGKMG--DLDDDSHAIVLPPPMNGGKRVHPLPYIESNLPVQA  196

Query  488   -------------FSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadnedddF----LMA  616
                          + +  WKDRVE WK RQEK  ++T       G D + D+     +M 
Sbjct  197   RPMDPTKDLAAYGYGSVAWKDRVESWKMRQEK--MMTEGSHHHKGGDMDGDNGPDLPIMD  254

Query  617   DARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWF  796
             +ARQPL RK+PISS+ I+PYR++IV RL++L FFF +RIL P   A+ +WL SVICEIWF
Sbjct  255   EARQPLSRKVPISSARINPYRMLIVIRLVVLAFFFRYRILNPVEGAYGMWLTSVICEIWF  314

Query  797   GLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITA  976
              +SWILDQFPKW PINRETYLDRLSLR+E+  EGE + L  VD++VSTVDP+KEPP++TA
Sbjct  315   AISWILDQFPKWLPINRETYLDRLSLRYEK--EGEPSQLEHVDIFVSTVDPMKEPPLVTA  372

Query  977   NTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFY  1156
             NT+LSILAVDYPVDKVSCY+SDDGA+ML F+ ++ET+EFAR+WVPFCKK+ IEPRAPE Y
Sbjct  373   NTILSILAVDYPVDKVSCYLSDDGAAMLTFECISETSEFARKWVPFCKKFSIEPRAPEMY  432

Query  1157  FSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGN  1336
             F++KIDYLKDKVQPTFVKERRAMKREYEE+KVRVNALVAKAQK PEEGW MQDGTPW GN
Sbjct  433   FAQKIDYLKDKVQPTFVKERRAMKREYEEFKVRVNALVAKAQKVPEEGWTMQDGTPWLGN  492

Query  1337  NTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLT  1516
             N+RDHPGMIQV+LG  G  D +G ELP+LVYVSREKRPG+ HHKKAGAMNALVRVSAVLT
Sbjct  493   NSRDHPGMIQVFLGHSGGHDTDGNELPRLVYVSREKRPGFNHHKKAGAMNALVRVSAVLT  552

Query  1517  NAPFMLNLDCDHY  1555
             NAP+ LNLDCDHY
Sbjct  553   NAPYFLNLDCDHY  565



>ref|XP_006826669.1| hypothetical protein AMTR_s00137p00043990 [Amborella trichopoda]
 gb|ERM93906.1| hypothetical protein AMTR_s00137p00043990 [Amborella trichopoda]
Length=1047

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/561 (57%), Positives = 382/561 (68%), Gaps = 64/561 (11%)
 Frame = +2

Query  23    AALFTGGSH-------LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGF  181
             +A    GSH       +H   H+E + ++    ++C IC DEIGV   GE+FVAC ECGF
Sbjct  4     SAGLVAGSHNRNELVVIHG--HEEPKPLKALDGQVCEICGDEIGVTAEGELFVACNECGF  61

Query  182   PVCKPCYQYERSEGNQCCPHCNTRY--------------------------------KRH  265
             PVC+PCY+YER EG Q CP C TRY                                KR 
Sbjct  62    PVCRPCYEYERREGTQLCPQCKTRYKRLKGSPRVEGDEDEEDIDDIEHEFSLEDEQSKRQ  121

Query  266   KGCPRVVGddedhfegedfeqefeTKNHP----PLSENGDYHNNQ--LPHHNTTNSAAFQ  427
                  ++     +  G D E    + +HP    P++      + +  LPHH    S+  +
Sbjct  122   HLAEAMLHGKMSYGRGVDEEASQTSHHHPEIPHPITARSRPVSGEFPLPHHADQGSSLHK  181

Query  428   -----PTAAPGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadn  592
                  P + PG     D  D  +E     EW+DR++ WK++Q   G            D 
Sbjct  182   RVHPYPVSEPGGSARFDGWDANRE--GGGEWRDRMDDWKSKQGLLG--------PDPNDL  231

Query  593   edddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLI  772
             + D  ++ +ARQPL RK+PI+SS ++PYR+VIV RL IL  F  +RIL P +DA  LWL 
Sbjct  232   DPDMPIVDEARQPLSRKVPIASSKVNPYRMVIVARLFILAIFLRYRILNPVHDAIGLWLT  291

Query  773   SVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPL  952
             SV CEIWF  SWILDQFPKW PI+RETYLDRLSLR+ER  EGE + L+PVD++VSTVDPL
Sbjct  292   SVTCEIWFAFSWILDQFPKWFPIDRETYLDRLSLRYER--EGEPSMLSPVDIFVSTVDPL  349

Query  953   KEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCI  1132
             KEPP++TANTVLSILAVDYPVDK+SCYVSDDGASML F+ L+ETAEFAR+WVPFCKK+ I
Sbjct  350   KEPPLVTANTVLSILAVDYPVDKISCYVSDDGASMLTFEALSETAEFARKWVPFCKKFAI  409

Query  1133  EPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQ  1312
             EPRAPE YFS KIDYLKDKVQPTFVKERRAMKREYEE+KVR+NA+VAKA K P EGW+MQ
Sbjct  410   EPRAPEMYFSLKIDYLKDKVQPTFVKERRAMKREYEEFKVRINAMVAKAVKVPPEGWIMQ  469

Query  1313  DGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNAL  1492
             DGTPWPGNNTRDHPGMIQV+LG  G LD EG ELP+LVYVSREKRPG+ HHKKAGAMNAL
Sbjct  470   DGTPWPGNNTRDHPGMIQVFLGHSGGLDAEGNELPRLVYVSREKRPGFHHHKKAGAMNAL  529

Query  1493  VRVSAVLTNAPFMLNLDCDHY  1555
             VRVSAVLTNAPFMLNLDCDHY
Sbjct  530   VRVSAVLTNAPFMLNLDCDHY  550



>gb|KCW81421.1| hypothetical protein EUGRSUZ_C02801 [Eucalyptus grandis]
Length=1085

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/538 (59%), Positives = 386/538 (72%), Gaps = 58/538 (11%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             ++C+IC D +G+  +G+VFVAC EC FPVC+PCY+YER +GNQ CP C +RYKRHKG PR
Sbjct  37    QICQICGDTVGLTASGDVFVACNECAFPVCRPCYEYERKDGNQSCPQCKSRYKRHKGSPR  96

Query  281   VVGddedhfegedfeqefeTKNHP-------------------------PLSENGDYHNN  385
             V GDD++    +   +    +                            PL  NG   + 
Sbjct  97    VDGDDDEDEVDDLENEFNYAQGTSAARQQWQGEDPDLSSSSRHESRHPIPLLTNGQPMSG  156

Query  386   QLPHHNTTNSAAFQPTAAPGSVGGKDLE----------------DEQKEV----FSNAEW  505
             ++P   + +S + + T+ P     K +                 D  K++      N +W
Sbjct  157   EIPCA-SIDSQSVRTTSGPLGPSDKHVHSLPYVDPRQPVPVRIVDPSKDLNTYGLGNVDW  215

Query  506   KDRVEKWKTRQEKRGLVTRF-------dddkggadnedddFLMAD-ARQPLWRKLPISSS  661
             K+RVE WK +QEK   +T+         +D  G  +  ++  MAD ARQP+ R +PISSS
Sbjct  216   KERVEGWKLKQEKN--MTQMPNKYHEGKNDIEGTGSNGEELQMADDARQPMSRVVPISSS  273

Query  662   LISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPI  841
              ++PYR+VI+ RLIIL FF  +R+  P  DA+PLWL SVICEIWF LSW+LDQFPKWSPI
Sbjct  274   HLTPYRVVIILRLIILGFFLQYRVTHPVKDAYPLWLTSVICEIWFALSWLLDQFPKWSPI  333

Query  842   NRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDK  1021
             NRETYLDRL+LR +R  EGE + LAPVDV+VSTVDPLKEPP+ITANTVLSILAVDYPVDK
Sbjct  334   NRETYLDRLALRHDR--EGEPSQLAPVDVFVSTVDPLKEPPLITANTVLSILAVDYPVDK  391

Query  1022  VSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPT  1201
             VSCYVSDDG++ML F+ L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK+QP+
Sbjct  392   VSCYVSDDGSAMLTFEALSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKDKIQPS  451

Query  1202  FVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGS  1381
             FVKERRAMKREYEE+KVR+NALVAKAQK PEEGW MQDGT WPGNN RDHPGMIQV+LG 
Sbjct  452   FVKERRAMKREYEEFKVRINALVAKAQKMPEEGWTMQDGTAWPGNNPRDHPGMIQVFLGH  511

Query  1382  EGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
              G LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  512   SGGLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  569



>ref|XP_006400279.1| hypothetical protein EUTSA_v10012538mg [Eutrema salsugineum]
 gb|ESQ41732.1| hypothetical protein EUTSA_v10012538mg [Eutrema salsugineum]
Length=1041

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/555 (57%), Positives = 387/555 (70%), Gaps = 59/555 (11%)
 Frame = +2

Query  23    AALFTGGSH-----LHAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPV  187
             +A    GSH     +   +H+E + ++    + C IC D+IG+  +G++FVAC ECGFP 
Sbjct  4     SAGLVAGSHNRNELVVIHNHEEPKPLKNLDGQFCEICGDQIGLTVDGDLFVACNECGFPA  63

Query  188   CKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNH------  349
             C+PCY+YER EG Q CP C TRYKR +G PRV GD+++    +   +      H      
Sbjct  64    CRPCYEYERREGTQNCPQCKTRYKRLRGSPRVEGDEDEEDIDDIEYEFNIEDEHEKQKQS  123

Query  350   --------------PPLSENGDYHNNQLPHHNTTNSAAF------------QPTAA----  439
                           P   ENG +       H+   S  F             P++     
Sbjct  124   AEAMAYGKMSYGRGPEDDENGRFPPVIAGGHSRHVSGEFPVGGGYGNGEHGMPSSLHKRV  183

Query  440   ---PGSVGGKDLEDEQKEVFSNAEWKDRVEKWKTRQEKRGLVTRFdddkggadnedddFL  610
                P S  G +  D++KE      W++R++ WK +Q   G            D++ +  +
Sbjct  184   HPYPSSEAGSERWDDKKE----GGWRERMDDWKLQQGNLG---------QEPDDDPEMGM  230

Query  611   MADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEI  790
             + +ARQPL RK+PI+SS I+PYR+VIV RL+IL  F  +R+L P +DA  LWL SVICEI
Sbjct  231   IDEARQPLSRKVPIASSKINPYRMVIVARLVILAVFLRYRLLNPVHDALGLWLTSVICEI  290

Query  791   WFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPII  970
             WF +SWILDQFPKW PI+RETYLDRLSLR+ER  EGE N LAPVDV+VSTVDP+KEPP++
Sbjct  291   WFAVSWILDQFPKWFPIDRETYLDRLSLRYER--EGEPNMLAPVDVFVSTVDPMKEPPLV  348

Query  971   TANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPE  1150
             TANTVLSILA+DYPV+K+SCYVSDDGASML FD+L+ETAEFAR+WVPFCKK+ IEPRAPE
Sbjct  349   TANTVLSILAMDYPVEKISCYVSDDGASMLTFDSLSETAEFARKWVPFCKKFSIEPRAPE  408

Query  1151  FYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWP  1330
              YF+ KIDYLKDKVQPTFVKERRAMKREYEE+KVR+NALVAKA K P EGW+M DGTPWP
Sbjct  409   MYFTLKIDYLKDKVQPTFVKERRAMKREYEEFKVRINALVAKASKVPLEGWIMPDGTPWP  468

Query  1331  GNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAV  1510
             GNNT+DHPGMIQV+LG  G  DVEG ELP+LVYVSREKRPG+QHHKKAGAMNALVRV+ V
Sbjct  469   GNNTKDHPGMIQVFLGHSGGFDVEGHELPRLVYVSREKRPGFQHHKKAGAMNALVRVAGV  528

Query  1511  LTNAPFMLNLDCDHY  1555
             LTNAPFMLNLDCDHY
Sbjct  529   LTNAPFMLNLDCDHY  543



>gb|KHN07088.1| Cellulose synthase A catalytic subunit 1 [UDP-forming] [Glycine 
soja]
Length=1084

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/550 (56%), Positives = 388/550 (71%), Gaps = 51/550 (9%)
 Frame = +2

Query  53    HAADHDERREVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQC  232
             H +     + ++  + ++C+IC D +G+   G+VFVAC EC FPVC+PCY+YER +GNQ 
Sbjct  22    HDSSDSGSKPLKSLNGQICQICGDTVGLTATGDVFVACNECAFPVCRPCYEYERKDGNQS  81

Query  233   CPHCNTRYKRHKGCPRVVGddedhfegedfeqefeTKNHP--------------------  352
             CP C TRYKRH+G PRV GD+++    +   +    +                       
Sbjct  82    CPQCKTRYKRHRGSPRVEGDEDEDDSDDIENEFNYAQGKAKARRQWEDDADLSSSSRRES  141

Query  353   ----PLSENGDYHNNQLP------HHNTTNSAAFQPTAAPGSVGGKD--------LEDEQ  478
                 PL  NG   + ++P          T S    P+    S+   D        + D  
Sbjct  142   QQPIPLLTNGQTMSGEIPCATPDTQSVRTTSGPLGPSEKVHSLPYVDPRQPVPVRIVDPS  201

Query  479   KEV----FSNAEWKDRVEKWKTRQEKR--GLVTRFdd-----dkggadnedddFLMADAR  625
             K++      N +WK+RVE WK +QEK    +  R+ +      +G   N ++  ++ DAR
Sbjct  202   KDLNSYGLGNVDWKERVEGWKLKQEKNMVQMTGRYTEGKGGDVEGTGSNGEELQMVDDAR  261

Query  626   QPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLS  805
             QP+ R +PI SS ++PYR+VI+ RLIIL FF  +R+  P  DA+PLWL SVICEIWF LS
Sbjct  262   QPMSRVVPIPSSQLTPYRVVIILRLIILGFFLQYRVTHPVKDAYPLWLTSVICEIWFALS  321

Query  806   WILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTV  985
             W+LDQFPKWSPINRETYL+RL+LR++R  EGE + L PVDV+VSTVDPLKEPP++TANTV
Sbjct  322   WLLDQFPKWSPINRETYLERLALRYDR--EGEPSQLDPVDVFVSTVDPLKEPPLVTANTV  379

Query  986   LSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSE  1165
             LSIL+VDYPVDKVSCYVSDDG++ML F+ L+ETAEFA++WVPFCKK+ IEPRAPEFYF++
Sbjct  380   LSILSVDYPVDKVSCYVSDDGSAMLTFEALSETAEFAKKWVPFCKKHNIEPRAPEFYFAQ  439

Query  1166  KIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTR  1345
             KIDYLKDK+QP+FVKERRAMKREYEE+KVR+NALVAKAQK PEEGW MQDGT WPGNN R
Sbjct  440   KIDYLKDKIQPSFVKERRAMKREYEEFKVRINALVAKAQKMPEEGWTMQDGTAWPGNNPR  499

Query  1346  DHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAP  1525
             DHPGMIQV+LG  G LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  
Sbjct  500   DHPGMIQVFLGHSGGLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGA  559

Query  1526  FMLNLDCDHY  1555
             ++LN+DCDHY
Sbjct  560   YLLNVDCDHY  569



>ref|XP_007220288.1| hypothetical protein PRUPE_ppa000593mg [Prunus persica]
 gb|EMJ21487.1| hypothetical protein PRUPE_ppa000593mg [Prunus persica]
Length=1082

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/562 (56%), Positives = 380/562 (68%), Gaps = 75/562 (13%)
 Frame = +2

Query  77    REVERESQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRY  256
             + V+    ++C+IC D +G   +GE F+AC  C FPVC+PCY+YER +GNQ CP C TRY
Sbjct  10    KPVKSLGGQVCQICGDNVGKTADGEPFIACDVCAFPVCRPCYEYERKDGNQSCPQCKTRY  69

Query  257   KRHKGCPRVVGddedhfegedfeq------------------------------------  328
             KRHKG P ++GD E+  + +D                                       
Sbjct  70    KRHKGSPAILGDREEDGDADDGTSDFNYTSENQNEKQKIAERMLSWHMTYGRGEDIGAPN  129

Query  329   --efeTKNHPPLSENGDYHNNQLPHHNTTNSAAFQPTAAPGSVGGKD-------------  463
               +  + NH PL  NG   + +L    +  S      A+PG   GK              
Sbjct  130   YDKEVSHNHIPLLTNGQEVSGEL----SAASPERLSMASPGIGAGKRAHPIPYASDVNQS  185

Query  464   ----LEDEQKEVFS----NAEWKDRVEKWKTRQEKRGLVTRFdddkg----------gad  589
                 + D  +E  S    N  WK+RV+ WK +QEK  +                      
Sbjct  186   PNIRVVDPVREFGSPGIGNVAWKERVDGWKMKQEKNVIPMSTGQATSERGGGDIDARSDV  245

Query  590   nedddFLMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWL  769
               DD  L  +ARQPL RK+ I SS I+PYR+VIV RL+ILC F H+R+  P  +A+ LWL
Sbjct  246   IVDDSLLNDEARQPLSRKVSIPSSRINPYRMVIVLRLVILCIFLHYRLTNPVPNAYALWL  305

Query  770   ISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDP  949
             ISVICEIWF +SWILDQFPKW P+NRETYLDRLSLR++R  EGE + LA VD++VSTVDP
Sbjct  306   ISVICEIWFAISWILDQFPKWLPVNRETYLDRLSLRYDR--EGEPSQLAAVDIFVSTVDP  363

Query  950   LKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYC  1129
             LKEPP++TANTVLSILAVDYPVDKVSCYVSDDGA+ML F+ L+ET+EFAR+WVPFCKKY 
Sbjct  364   LKEPPMVTANTVLSILAVDYPVDKVSCYVSDDGAAMLTFEALSETSEFARKWVPFCKKYA  423

Query  1130  IEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVM  1309
             IEPRAPE+YF++KIDYLKDKVQP+FVK+RRAMKREYEE+KVRVN LVAKA K PEEGW+M
Sbjct  424   IEPRAPEWYFTQKIDYLKDKVQPSFVKDRRAMKREYEEFKVRVNGLVAKATKIPEEGWIM  483

Query  1310  QDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNA  1489
             QDGTPWPGNNTRDHPGMIQV+LG  G LD +G ELP+LVYVSREKRPG+QHHKKAGAMNA
Sbjct  484   QDGTPWPGNNTRDHPGMIQVFLGQSGGLDADGNELPRLVYVSREKRPGFQHHKKAGAMNA  543

Query  1490  LVRVSAVLTNAPFMLNLDCDHY  1555
             LVRVSAVLTN PF+LNLDCDHY
Sbjct  544   LVRVSAVLTNGPFLLNLDCDHY  565



>ref|XP_006483337.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
isoform X1 [Citrus sinensis]
Length=1102

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/536 (58%), Positives = 383/536 (71%), Gaps = 54/536 (10%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             + C+IC D +G+   G++FVAC EC FPVC+PCY+YER +G Q CP C TRYKRHKG PR
Sbjct  54    QTCQICGDNVGLTAMGDIFVACNECAFPVCRPCYEYERKDGTQSCPQCKTRYKRHKGSPR  113

Query  281   VVGddedhfegedfeqefeTKNHP-------------------------PLSENGDYHNN  385
             V GDDE+    +   +    + +                          PL  NG   + 
Sbjct  114   VEGDDEEDDIDDLENEFNYAQGNSKARRQWQGEDLELSASSRHESQQPIPLLTNGQSVSG  173

Query  386   QLPHHNTTNSAAFQPTAAPGSVGGKDLE----------------DEQKEV----FSNAEW  505
             ++P   T ++ + + T+ P     +++                 D  K++      N +W
Sbjct  174   EIPCA-TPDTQSVRTTSGPLGPSERNVHSSPYTDPRQPVPVRIVDPSKDLNSYGLGNVDW  232

Query  506   KDRVEKWKTRQEKR-----GLVTRFdddkggadnedddFLMAD-ARQPLWRKLPISSSLI  667
             K+RVE WK +QEK      G  +    D  G  +  ++  MAD ARQPL R +PI SS +
Sbjct  233   KERVEGWKLKQEKNMMQVTGKYSEGKGDIEGTGSNGEELQMADDARQPLSRVVPIPSSHL  292

Query  668   SPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINR  847
             +PYR+VI+ RLIIL FF  +R+  P  DA+PLWL SVICEIWF LSW+LDQFPKW P+NR
Sbjct  293   TPYRVVIILRLIILGFFLQYRVTHPVKDAYPLWLTSVICEIWFALSWLLDQFPKWYPVNR  352

Query  848   ETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVS  1027
             ETYLDRL+LR++R  EGE + LAPVD++VSTVDPLKEPP++TANTVLSILAVDYPVDKVS
Sbjct  353   ETYLDRLALRYDR--EGEPSQLAPVDIFVSTVDPLKEPPLVTANTVLSILAVDYPVDKVS  410

Query  1028  CYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFV  1207
             CYVSDDG++ML F+ L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK+QP+FV
Sbjct  411   CYVSDDGSAMLTFEALSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKDKIQPSFV  470

Query  1208  KERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEG  1387
             KERRAMKREYEE+KVR+NALVAKAQK PEEGW MQDGTPWPGNN RDHPGMIQV+LG  G
Sbjct  471   KERRAMKREYEEFKVRINALVAKAQKMPEEGWTMQDGTPWPGNNPRDHPGMIQVFLGRSG  530

Query  1388  ALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
              LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  531   GLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  586



>ref|XP_011039709.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Populus euphratica]
Length=1097

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/547 (58%), Positives = 386/547 (71%), Gaps = 64/547 (12%)
 Frame = +2

Query  101   KMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPR  280
             + C+IC D +GV ENG+ FVAC EC FPVC+PCY+YER +G Q CP C TRY+RHKG PR
Sbjct  37    QTCQICGDNVGVTENGDFFVACNECAFPVCRPCYEYERKDGTQSCPQCKTRYRRHKGSPR  96

Query  281   V---------------------VGddedhfegedfeqefeTKNHP---PLSENGDYHNNQ  388
             V                     +G     ++GED E    +++     PL  NG   + +
Sbjct  97    VDGDEDEDDVDDLENEFNYAQGIGKARHQWQGEDIELSSSSRHESQPIPLLTNGQPVSGE  156

Query  389   LP------HHNTTNSAAFQP------TAAPGSVGGKDLE----------------DEQKE  484
             +P          T S    P      T+ P     +++                 D  K+
Sbjct  157   IPCATPDNQSVRTTSGPLGPAXXXXTTSGPLGTAERNVNSSPYIDPRQPVPVRIVDPSKD  216

Query  485   VFS----NAEWKDRVEKWKTRQEKR--GLVTRF---dddkggadnedddFLMA-DARQPL  634
             + S    N +WK+RVE WK +Q+K    +  R+     D  G  +  D+  MA DARQPL
Sbjct  217   LNSYGLGNVDWKERVEGWKLKQDKNIMQMTNRYPEGKGDIEGTGSNGDELQMADDARQPL  276

Query  635   WRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWIL  814
              R +PISSS ++PYR+VI+ RLIIL FF  +R+  P  DA+ LWL SVICE+WF LSW+L
Sbjct  277   SRVVPISSSHLTPYRVVIILRLIILGFFLQYRVTHPVKDAYGLWLTSVICEVWFALSWLL  336

Query  815   DQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSI  994
             DQFPKW PINRETYLDRL+LR++RDGE  +  LAP+D++VSTVDP+KEPPI+TANTVLSI
Sbjct  337   DQFPKWMPINRETYLDRLALRYDRDGEPSQ--LAPIDIFVSTVDPMKEPPIVTANTVLSI  394

Query  995   LAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKID  1174
             LAVDYPVDKVSCYVSDDG++ML F+ L+ETAEFAR+WVPFCKK+ IEPRAPEFYFS+KID
Sbjct  395   LAVDYPVDKVSCYVSDDGSAMLTFEALSETAEFARKWVPFCKKHNIEPRAPEFYFSQKID  454

Query  1175  YLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHP  1354
             YLKDK+QP+FVKERRAMKREYEE+KVR+NALVAKAQK PEEGW MQDGTPWPGNN RDHP
Sbjct  455   YLKDKIQPSFVKERRAMKREYEEFKVRINALVAKAQKMPEEGWTMQDGTPWPGNNPRDHP  514

Query  1355  GMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFML  1534
             GMIQV+LG  G LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++L
Sbjct  515   GMIQVFLGHSGGLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLL  574

Query  1535  NLDCDHY  1555
             N+DCDHY
Sbjct  575   NVDCDHY  581



>ref|XP_009389939.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Musa acuminata subsp. malaccensis]
Length=1078

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/525 (59%), Positives = 378/525 (72%), Gaps = 44/525 (8%)
 Frame = +2

Query  107   CRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRV-  283
             C+IC D +G+ ++G++FVAC EC FPVC+ CY+YER EGN+ CP C TRYKRHKG PRV 
Sbjct  39    CQICGDTVGLSDSGDLFVACNECAFPVCRACYEYERKEGNKSCPQCKTRYKRHKGSPRVD  98

Query  284   -----------------------VGddedhfegedfeqefeTKNHPPLSE-----NGDYH  379
                                     G         +      +  H P        +G   
Sbjct  99    GDDEEEDVDDLDNEFNCRQGNVEAGHTWQLQGQAEDVDLSSSFRHEPQHRIPYLTSGQQV  158

Query  380   NNQLP------HHNTTNSAAFQPTAAPGSVGGKD-LEDEQKEVFSNAEWKDRVEKWKTRQ  538
             + ++P      H   + S+ +   + P  V   D  +D       + +WK+RVE WK +Q
Sbjct  159   SGEVPDATPDRHSIRSPSSGYVDPSLPVPVRIVDPSKDLNSYGLGSVDWKERVEGWKLKQ  218

Query  539   EKRGL--VTRFdddkggadnedddF----LMADARQPLWRKLPISSSLISPYRIVIVFRL  700
             +K  +    +++D KG  +    +     ++ DARQPL R +PI SS ++ YR+VI+ RL
Sbjct  219   DKTIMHVTNKYNDGKGDMEGTGSNGEDLQMVDDARQPLSRIVPIPSSQLNLYRVVIILRL  278

Query  701   IILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRF  880
             IILCFFF +R+  P +DA+PLWL SVICEIWF LSW+LDQFPKW PINRETYLDRL+LR+
Sbjct  279   IILCFFFQYRVTHPVHDAYPLWLTSVICEIWFALSWLLDQFPKWYPINRETYLDRLALRY  338

Query  881   ERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASML  1060
             +R  EGE + LAPVDV+VSTVDPLKEPP+ITANTVLSILAVDYPVDKVSCYVSDDG++ML
Sbjct  339   DR--EGEPSQLAPVDVFVSTVDPLKEPPLITANTVLSILAVDYPVDKVSCYVSDDGSAML  396

Query  1061  LFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYE  1240
              F+ L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK+QP+FVKERRAMKREYE
Sbjct  397   TFEALSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKDKIQPSFVKERRAMKREYE  456

Query  1241  EYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPK  1420
             E+KVR+NALVAKAQK PEEGW MQDGTPWPGNN RDHPGMIQV+LG  G LD +G ELP+
Sbjct  457   EFKVRINALVAKAQKTPEEGWTMQDGTPWPGNNPRDHPGMIQVFLGHSGGLDTDGNELPR  516

Query  1421  LVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  517   LVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  561



>ref|XP_010932185.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming] [Elaeis guineensis]
Length=1090

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/569 (56%), Positives = 390/569 (69%), Gaps = 62/569 (11%)
 Frame = +2

Query  23    AALFTGGSHLHAADHDERRE-------VERESQKMCRICRDEIGVVENGEVFVACRECGF  181
             +A    GSH        RRE       +++ S ++C+IC D++G+  +GE+FVAC EC F
Sbjct  4     SAGLVAGSHNRNELVVIRREGESGPKPLQQLSGQICQICGDDVGLTTDGELFVACNECAF  63

Query  182   PVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVVGddedhfegedfeqefeT-------  340
             P+C+ CY+YER EGNQ CP C TR+KR KGC RV GD+E+    +   +   T       
Sbjct  64    PICRTCYEYERREGNQVCPQCKTRFKRLKGCARVAGDEEEDDIDDLENEFNFTGGDKQDM  123

Query  341   --------KNHPPLSENGDYHNNQLPHHN-----TTNSA----------AFQPTAAPGSV  451
                     + H      GD    Q+ H        TN            A  P+   G  
Sbjct  124   QYMAEAMLQGHMSYGRGGDVDMPQVVHTMPQVPLLTNGQMVDDIPPEQHALVPSFMGG--  181

Query  452   GGKDLE----------------DEQKEV----FSNAEWKDRVEKWKTRQEKRGLVTRFdd  571
             GGK +                 D  K++    + +  WK+R+E WK +QEK         
Sbjct  182   GGKRIHPLPFADPNLPVQPRSMDPSKDLAAYGYGSVAWKERMESWKQKQEKMHARNDNGG  241

Query  572   dkggadnedddF-LMADARQPLWRKLPISSSLISPYRIVIVFRLIILCFFFHFRILTPAY  748
                  D +  D  LM +ARQPL RKLPI SS I+PYR++I+ RL++L FFFH+R++ P  
Sbjct  242   KDWDNDGDGPDLPLMDEARQPLSRKLPIPSSQINPYRMIIIIRLVVLGFFFHYRVMNPTP  301

Query  749   DAFPLWLISVICEIWFGLSWILDQFPKWSPINRETYLDRLSLRFERDGEGERNTLAPVDV  928
             DA+PLWLISVICEIWF +SWILDQFPKW PI RETYLDRLSLR+E+  EG+ + LA VD+
Sbjct  302   DAYPLWLISVICEIWFAISWILDQFPKWIPIERETYLDRLSLRYEK--EGQPSQLAAVDI  359

Query  929   YVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYVSDDGASMLLFDTLAETAEFARRWV  1108
             +VSTVDPLKEPP++TANTVLSILAVDYPV KVSCYVSDDGA+ML F+ L+ET+EFA++WV
Sbjct  360   FVSTVDPLKEPPLVTANTVLSILAVDYPVQKVSCYVSDDGAAMLTFEALSETSEFAKKWV  419

Query  1109  PFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKERRAMKREYEEYKVRVNALVAKAQKK  1288
             PFCKK+ IEPRAPE+YF +KIDYLKDKV P+FVKERRAMKREYEE+KVR+NALVAKAQK 
Sbjct  420   PFCKKFNIEPRAPEWYFQQKIDYLKDKVLPSFVKERRAMKREYEEFKVRINALVAKAQKV  479

Query  1289  PEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALDVEGKELPKLVYVSREKRPGYQHHK  1468
             PEEGW MQDGTPWPGNN RDHPGMIQV+LG  G  D EG ELP+LVYVSREKRPG+ HHK
Sbjct  480   PEEGWTMQDGTPWPGNNVRDHPGMIQVFLGQSGGHDTEGNELPRLVYVSREKRPGFNHHK  539

Query  1469  KAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             KAGAMNALVRVSAVLTNAP++LNLDCDHY
Sbjct  540   KAGAMNALVRVSAVLTNAPYLLNLDCDHY  568



>ref|XP_004136343.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Cucumis sativus]
 ref|XP_004169170.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Cucumis sativus]
Length=1081

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/537 (58%), Positives = 387/537 (72%), Gaps = 53/537 (10%)
 Frame = +2

Query  95    SQKMCRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGC  274
             + + C+IC D +G+  +G+VFVAC EC FPVC+PCY+YER +GNQ CP C TRYKRHKG 
Sbjct  35    NSQTCQICGDTVGLTASGDVFVACNECAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGS  94

Query  275   PR-------------------VVGddedhfegedfeqefeT----KNHP-PLSENGDYHN  382
             PR                   V G  +   +    + E  T    ++ P PL  NG   +
Sbjct  95    PRVDGDDDEDDVDDIENEFNYVQGSSKTKRQWHGEDAELSTSARHESQPIPLLTNGQSVS  154

Query  383   NQLPHHNTTNSAAFQPTAAPGSVGGKDLE----------------DEQKEVFS----NAE  502
              ++P   T ++ + + T+ P     K ++                D  K++ S    N +
Sbjct  155   GEIPCA-TPDNQSVRTTSGPLGPPEKHMQSHPYVDPRQPVPVRIVDPSKDLNSYGLGNVD  213

Query  503   WKDRVEKWKTRQEKRGL-----VTRFdddkggadnedddFLMAD-ARQPLWRKLPISSSL  664
             WK+RVE WK +QEK  +      T    D  G  +  ++  MAD ARQPL R +PI SS 
Sbjct  214   WKERVEGWKLKQEKNMMQMTSRYTEGKGDMEGTGSNGEELQMADDARQPLSRVVPIPSSH  273

Query  665   ISPYRIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPIN  844
             ++PYR+VI+ RLIIL FF  +R+  P  DA+PLWL SVICE+WF LSW+LDQFPKWSP+N
Sbjct  274   LTPYRVVIILRLIILGFFLQYRLTHPVKDAYPLWLTSVICEVWFALSWLLDQFPKWSPVN  333

Query  845   RETYLDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKV  1024
             RET+L+RL+LR++R  EGE + LAPVDV+VSTVDPLKEPP++TANTVLSIL+VDYPVDKV
Sbjct  334   RETFLERLALRYDR--EGEPSQLAPVDVFVSTVDPLKEPPLVTANTVLSILSVDYPVDKV  391

Query  1025  SCYVSDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTF  1204
             SCYVSDDG++ML F+ L+ETAEFAR+WVPFCKK+ IEPRAPEFYF++KIDYLKDK++P+F
Sbjct  392   SCYVSDDGSAMLTFEALSETAEFARKWVPFCKKHNIEPRAPEFYFAQKIDYLKDKIKPSF  451

Query  1205  VKERRAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSE  1384
             VKERRAMKREYEE+KVR+NALVAKAQK PEEGW MQDGT WPGNN RDHPGMIQV+LG  
Sbjct  452   VKERRAMKREYEEFKVRINALVAKAQKMPEEGWTMQDGTAWPGNNPRDHPGMIQVFLGHS  511

Query  1385  GALDVEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             G LD +G ELP+LVYVSREKRPG+QHHKKAGAMNAL+RVSAVLTN  ++LN+DCDHY
Sbjct  512   GGLDTDGNELPRLVYVSREKRPGFQHHKKAGAMNALIRVSAVLTNGAYLLNVDCDHY  568



>ref|XP_008670082.1| PREDICTED: probable cellulose synthase A catalytic subunit 6 
[UDP-forming] isoform X1 [Zea mays]
 tpg|DAA39780.1| TPA: hypothetical protein ZEAMMB73_877148 [Zea mays]
Length=790

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/533 (58%), Positives = 373/533 (70%), Gaps = 53/533 (10%)
 Frame = +2

Query  107   CRICRDEIGVVENGEVFVACRECGFPVCKPCYQYERSEGNQCCPHCNTRYKRHKGCPRVV  286
             C+IC DE+GV  +GE FVAC EC FPVC+ CY+YER EG+Q CP C TRYKR KGCPRV 
Sbjct  42    CQICGDEVGVGFDGEPFVACNECAFPVCRACYEYERREGSQACPQCRTRYKRLKGCPRVA  101

Query  287   Gddedhfege-----------------dfeqefeTKNHPPLSENGDYH------------  379
             GD+E+    +                  +  E   +        GD H            
Sbjct  102   GDEEEDGVDDLEGEFGLQDGAGHEDDPQYVAESMLRAQMSYGRGGDAHPDFNPVPNVPLL  161

Query  380   -NNQLPHHNTTNSAAFQPTAAPGSVGGKDLE----------------DEQKEV----FSN  496
              N Q+         A  P+      GGK +                 D  K++    + +
Sbjct  162   TNGQMVDDIPPEQHALVPSYMGSGGGGKRIHPLPFADSNLPVQPRSMDPSKDLAAYGYGS  221

Query  497   AEWKDRVEKWKTRQEKRGLVTRFdddkggadnedddFLMADARQPLWRKLPISSSLISPY  676
               WK+R+E WK +QE+   V R +       +  D  LM +ARQPL RK+PISSS I+PY
Sbjct  222   VAWKERMEGWKQKQERLQHV-RSEGGGDWDGDNADLPLMDEARQPLSRKVPISSSRINPY  280

Query  677   RIVIVFRLIILCFFFHFRILTPAYDAFPLWLISVICEIWFGLSWILDQFPKWSPINRETY  856
             R++IV RL++L FFFH+R++ PA DAF LWLISVICEIWF +SWILDQFPKW PI RETY
Sbjct  281   RMIIVIRLVVLGFFFHYRVMHPAKDAFALWLISVICEIWFAMSWILDQFPKWLPIERETY  340

Query  857   LDRLSLRFERDGEGERNTLAPVDVYVSTVDPLKEPPIITANTVLSILAVDYPVDKVSCYV  1036
             LDRLSLRF  D EG+ + LAP+D +VSTVDP KEPP++TANTVLSIL+VDYPV+KVSCYV
Sbjct  341   LDRLSLRF--DKEGQPSQLAPIDFFVSTVDPTKEPPLVTANTVLSILSVDYPVEKVSCYV  398

Query  1037  SDDGASMLLFDTLAETAEFARRWVPFCKKYCIEPRAPEFYFSEKIDYLKDKVQPTFVKER  1216
             SDDGA+ML F+ L+ET+EFA++WVPF KK+ IEPRAPE+YF +KIDYLKDKV  +FV+ER
Sbjct  399   SDDGAAMLTFEALSETSEFAKKWVPFSKKFNIEPRAPEWYFQQKIDYLKDKVAASFVRER  458

Query  1217  RAMKREYEEYKVRVNALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSEGALD  1396
             RAMKREYEE+KVR+NALVAKAQK PEEGW MQDG+ WPGNN RDHPGMIQV+LG  G  D
Sbjct  459   RAMKREYEEFKVRINALVAKAQKVPEEGWTMQDGSLWPGNNVRDHPGMIQVFLGQSGGRD  518

Query  1397  VEGKELPKLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPFMLNLDCDHY  1555
             VEG ELP+LVYVSREKRPGY HHKKAGAMNALVRVSAVL+NAP++LNLDCDHY
Sbjct  519   VEGNELPRLVYVSREKRPGYNHHKKAGAMNALVRVSAVLSNAPYLLNLDCDHY  571



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4306464265376