BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c121395_g1_i1 len=113 path=[91:0-112]

Length=113
                                                                      Score     E

ref|XP_003594727.1|  Pectinesterase                                   55.8    9e-08   
ref|XP_004486539.1|  PREDICTED: probable pectinesterase 67-like       55.8    9e-08   
ref|XP_007226857.1|  hypothetical protein PRUPE_ppa017141mg           54.7    2e-07   
emb|CDO98756.1|  unnamed protein product                              54.3    3e-07   
ref|XP_010259708.1|  PREDICTED: probable pectinesterase 67            54.3    3e-07   
gb|KCW61296.1|  hypothetical protein EUGRSUZ_H04048                   53.9    4e-07   
ref|XP_010027105.1|  PREDICTED: probable pectinesterase 67            53.9    4e-07   
ref|XP_010242349.1|  PREDICTED: mitochondrial Rho GTPase 1-like       54.3    5e-07   
ref|XP_003533150.1|  PREDICTED: probable pectinesterase 67-like       53.1    8e-07   
gb|ACU23222.1|  unknown                                               53.1    8e-07   Glycine max [soybeans]
ref|XP_008223370.1|  PREDICTED: probable pectinesterase 67            53.1    8e-07   
ref|XP_004134506.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...  53.1    8e-07   
ref|XP_010268104.1|  PREDICTED: probable pectinesterase 67            52.8    1e-06   
ref|XP_008438961.1|  PREDICTED: probable pectinesterase 67            52.8    1e-06   
ref|XP_004173405.1|  PREDICTED: probable pectinesterase 67-like       52.8    1e-06   
ref|XP_009372133.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...  52.4    1e-06   
ref|XP_009336347.1|  PREDICTED: probable pectinesterase 67            52.4    1e-06   
ref|XP_008390573.1|  PREDICTED: probable pectinesterase 67            52.4    1e-06   
ref|XP_008340594.1|  PREDICTED: probable pectinesterase 67            52.4    1e-06   
ref|XP_008781333.1|  PREDICTED: probable pectinesterase 67            52.4    1e-06   
gb|EPS72014.1|  hypothetical protein M569_02744                       52.0    2e-06   
gb|KEH37247.1|  pectinesterase                                        52.0    2e-06   
ref|XP_004295071.1|  PREDICTED: probable pectinesterase 67-like       51.2    3e-06   
gb|KDO71950.1|  hypothetical protein CISIN_1g046043mg                 50.8    4e-06   
ref|XP_009791585.1|  PREDICTED: probable pectinesterase 67            50.8    4e-06   
ref|XP_009602465.1|  PREDICTED: probable pectinesterase 67            50.8    5e-06   
ref|XP_006488988.1|  PREDICTED: probable pectinesterase 67-like       50.8    5e-06   
ref|XP_006419374.1|  hypothetical protein CICLE_v10006909mg           50.8    5e-06   
ref|XP_007035816.1|  Pectin lyase-like superfamily protein isoform 2  50.4    7e-06   
ref|XP_007035815.1|  Pectin lyase-like superfamily protein isoform 1  50.4    8e-06   
gb|EYU29668.1|  hypothetical protein MIMGU_mgv1a011615mg              49.7    9e-06   
ref|XP_006658906.1|  PREDICTED: probable pectinesterase 68-like       48.9    1e-05   
ref|XP_011100823.1|  PREDICTED: probable pectinesterase 67            50.1    1e-05   
gb|KHF99581.1|  putative pectinesterase 67 -like protein              50.1    1e-05   
emb|CAN70978.1|  hypothetical protein VITISV_034766                   50.1    1e-05   Vitis vinifera
ref|XP_002272939.1|  PREDICTED: probable pectinesterase 67            49.7    1e-05   Vitis vinifera
gb|KFK40921.1|  hypothetical protein AALP_AA2G060700                  49.3    2e-05   
ref|XP_006299552.1|  hypothetical protein CARUB_v10015726mg           49.3    2e-05   
ref|XP_010487578.1|  PREDICTED: probable pectinesterase 67            49.3    2e-05   
ref|XP_009135518.1|  PREDICTED: probable pectinesterase 67            49.3    2e-05   
emb|CDX95886.1|  BnaC05g36370D                                        49.3    2e-05   
ref|XP_010504935.1|  PREDICTED: probable pectinesterase 67            49.3    2e-05   
emb|CDX92113.1|  BnaA05g22940D                                        49.3    2e-05   
ref|XP_002885186.1|  pectinesterase family protein                    49.3    2e-05   
ref|NP_188331.1|  putative pectinesterase                             49.3    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006406773.1|  hypothetical protein EUTSA_v10021065mg           49.3    2e-05   
ref|XP_009387848.1|  PREDICTED: probable pectinesterase 67            48.9    2e-05   
ref|XP_010921450.1|  PREDICTED: probable pectinesterase 67            48.9    2e-05   
ref|XP_006830090.1|  hypothetical protein AMTR_s00123p00050980        48.9    2e-05   
ref|XP_010465735.1|  PREDICTED: probable pectinesterase 67            48.9    3e-05   
ref|XP_006649973.1|  PREDICTED: probable pectinesterase 67-like       48.5    4e-05   
gb|EAZ26679.1|  hypothetical protein OsJ_10583                        47.4    6e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002523016.1|  Pectinesterase-2 precursor, putative             47.8    7e-05   Ricinus communis
ref|XP_011027955.1|  PREDICTED: probable pectinesterase 67            47.8    7e-05   
ref|XP_002311381.2|  hypothetical protein POPTR_0008s10440g           47.8    7e-05   Populus trichocarpa [western balsam poplar]
ref|NP_001049912.1|  Os03g0309400                                     47.4    8e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010548999.1|  PREDICTED: probable pectinesterase 67            47.4    9e-05   
ref|XP_010671738.1|  PREDICTED: probable pectinesterase 67            47.4    1e-04   
tpg|DAA59111.1|  TPA: hypothetical protein ZEAMMB73_544391            45.8    2e-04   
emb|CDX75901.1|  BnaC03g39840D                                        46.2    2e-04   
ref|XP_009412865.1|  PREDICTED: probable pectinesterase 66            45.1    2e-04   
ref|XP_011073789.1|  PREDICTED: probable pectinesterase 29            46.2    2e-04   
ref|XP_009146044.1|  PREDICTED: probable pectinesterase 67            46.2    2e-04   
gb|EYU32660.1|  hypothetical protein MIMGU_mgv1a009526mg              45.4    4e-04   
emb|CDM87103.1|  unnamed protein product                              45.4    4e-04   
gb|EMS61713.1|  putative pectinesterase 67                            45.1    4e-04   
ref|XP_009397166.1|  PREDICTED: pectinesterase-like                   45.4    5e-04   
ref|XP_009412866.1|  PREDICTED: putative pectinesterase 10            45.1    5e-04   
gb|KEH19057.1|  pectinesterase                                        44.3    9e-04   
ref|XP_006658052.1|  PREDICTED: probable pectinesterase 29-like       44.3    9e-04   
ref|NP_001146436.1|  uncharacterized protein LOC100280019 precursor   44.3    0.001   Zea mays [maize]
ref|XP_011041876.1|  PREDICTED: probable pectinesterase 29            44.3    0.001   
ref|XP_002457946.1|  hypothetical protein SORBIDRAFT_03g022950        44.3    0.001   Sorghum bicolor [broomcorn]
gb|KDP27907.1|  hypothetical protein JCGZ_18987                       44.3    0.001   



>ref|XP_003594727.1| Pectinesterase [Medicago truncatula]
 gb|AES64978.1| pectinesterase [Medicago truncatula]
Length=350

 Score = 55.8 bits (133),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           F+SVQAAID +P GNSNWVI+H++KGVYR+ V+
Sbjct  66  FKSVQAAIDSIPEGNSNWVIVHIRKGVYREKVH  98



>ref|XP_004486539.1| PREDICTED: probable pectinesterase 67-like [Cicer arietinum]
Length=349

 Score = 55.8 bits (133),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           F+SVQAAID +P GNSNWVI+H++KGVYR+ V+
Sbjct  65  FKSVQAAIDSIPEGNSNWVIVHIRKGVYREKVH  97



>ref|XP_007226857.1| hypothetical protein PRUPE_ppa017141mg [Prunus persica]
 gb|EMJ28056.1| hypothetical protein PRUPE_ppa017141mg [Prunus persica]
Length=345

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSV  96
           F+SVQAAID VP GNS W+IIHV+KGVYR+ V
Sbjct  60  FKSVQAAIDSVPEGNSKWIIIHVRKGVYREKV  91



>emb|CDO98756.1| unnamed protein product [Coffea canephora]
Length=348

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           F+++QAAID VP GNSNW IIHV+KGVYR+ V+
Sbjct  64  FRTIQAAIDAVPEGNSNWTIIHVRKGVYREKVH  96



>ref|XP_010259708.1| PREDICTED: probable pectinesterase 67 [Nelumbo nucifera]
Length=355

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           F+S+QAAID VP GNS W+IIH++KGVYR+ V+
Sbjct  67  FKSIQAAIDSVPEGNSEWIIIHIRKGVYREKVH  99



>gb|KCW61296.1| hypothetical protein EUGRSUZ_H04048 [Eucalyptus grandis]
Length=353

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  1    FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
            F+SVQAA+D VP GNS WVIIHV+KGVYR+ V+
Sbjct  69   FKSVQAAVDSVPSGNSKWVIIHVRKGVYREKVH  101



>ref|XP_010027105.1| PREDICTED: probable pectinesterase 67 [Eucalyptus grandis]
Length=346

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           F+SVQAA+D VP GNS WVIIHV+KGVYR+ V+
Sbjct  62  FKSVQAAVDSVPSGNSKWVIIHVRKGVYREKVH  94



>ref|XP_010242349.1| PREDICTED: mitochondrial Rho GTPase 1-like [Nelumbo nucifera]
Length=628

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVY  84
           FQSVQAAI+FVP GNS W+IIHV+KG Y
Sbjct  12  FQSVQAAINFVPEGNSQWIIIHVRKGEY  39



>ref|XP_003533150.1| PREDICTED: probable pectinesterase 67-like [Glycine max]
 gb|KHN12864.1| Putative pectinesterase 67 [Glycine soja]
Length=346

 Score = 53.1 bits (126),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           F+S+QAAID +P GNS WVI+HV+KG+YR+ V+
Sbjct  62  FKSIQAAIDSIPEGNSKWVIVHVRKGIYREKVH  94



>gb|ACU23222.1| unknown [Glycine max]
Length=346

 Score = 53.1 bits (126),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           F+S+QAAID +P GNS WVI+HV+KG+YR+ V+
Sbjct  62  FKSIQAAIDSIPEGNSKWVIVHVRKGIYREKVH  94



>ref|XP_008223370.1| PREDICTED: probable pectinesterase 67 [Prunus mume]
Length=345

 Score = 53.1 bits (126),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSV  96
           F+SVQAAID VP GN+ W+IIHV+KGVYR+ V
Sbjct  60  FKSVQAAIDSVPEGNNKWIIIHVRKGVYREKV  91



>ref|XP_004134506.1| PREDICTED: LOW QUALITY PROTEIN: probable pectinesterase 67-like 
[Cucumis sativus]
Length=332

 Score = 53.1 bits (126),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           F+S+QAA+D VP GNS W+IIHV+KG+YR+ V+
Sbjct  66  FKSIQAAVDSVPEGNSQWMIIHVRKGIYREKVH  98



>ref|XP_010268104.1| PREDICTED: probable pectinesterase 67 [Nelumbo nucifera]
Length=346

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSV  96
           FQSVQAAID VP GNS W+I+HV+KG YR+ +
Sbjct  61  FQSVQAAIDSVPEGNSQWIIVHVRKGEYREKI  92



>ref|XP_008438961.1| PREDICTED: probable pectinesterase 67 [Cucumis melo]
Length=350

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           F+S+QAA+D VP GNS W+IIHV+KG+YR+ V+
Sbjct  66  FKSIQAAVDSVPEGNSQWMIIHVRKGIYREKVH  98



>ref|XP_004173405.1| PREDICTED: probable pectinesterase 67-like [Cucumis sativus]
 gb|KGN57171.1| hypothetical protein Csa_3G166360 [Cucumis sativus]
Length=350

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           F+S+QAA+D VP GNS W+IIHV+KG+YR+ V+
Sbjct  66  FKSIQAAVDSVPEGNSQWMIIHVRKGIYREKVH  98



>ref|XP_009372133.1| PREDICTED: LOW QUALITY PROTEIN: probable pectinesterase 67 [Pyrus 
x bretschneideri]
Length=345

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSV  96
           F SVQAAID VP GN  W+IIHV+KGVYR+ V
Sbjct  60  FTSVQAAIDAVPEGNKQWIIIHVRKGVYREKV  91



>ref|XP_009336347.1| PREDICTED: probable pectinesterase 67 [Pyrus x bretschneideri]
Length=345

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSV  96
           F SVQAAID VP GN  W+IIHV+KGVYR+ V
Sbjct  60  FTSVQAAIDAVPEGNKQWIIIHVRKGVYREKV  91



>ref|XP_008390573.1| PREDICTED: probable pectinesterase 67 [Malus domestica]
Length=345

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSV  96
           F SVQAAID VP GN  W+IIHV+KGVYR+ V
Sbjct  60  FTSVQAAIDAVPEGNKQWIIIHVRKGVYREKV  91



>ref|XP_008340594.1| PREDICTED: probable pectinesterase 67 [Malus domestica]
Length=345

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSV  96
           F SVQAAID VP GN  W+IIHV+KGVYR+ V
Sbjct  60  FTSVQAAIDAVPEGNKQWIIIHVRKGVYREKV  91



>ref|XP_008781333.1| PREDICTED: probable pectinesterase 67 [Phoenix dactylifera]
Length=348

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSV  96
           FQSVQAAID VP GNS W+IIH++ G+YR+ V
Sbjct  63  FQSVQAAIDAVPDGNSQWIIIHLRAGIYREKV  94



>gb|EPS72014.1| hypothetical protein M569_02744, partial [Genlisea aurea]
Length=291

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSV  96
           F+SVQAAID VP GNS W +IH++KGVYR+ V
Sbjct  27  FESVQAAIDQVPEGNSEWFVIHLRKGVYREKV  58



>gb|KEH37247.1| pectinesterase [Medicago truncatula]
Length=340

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           F SVQAAID +P+GNSNWVI+H++KGV+ + V+
Sbjct  65  FTSVQAAIDSIPKGNSNWVIVHIRKGVHEEKVH  97



>ref|XP_004295071.1| PREDICTED: probable pectinesterase 67-like [Fragaria vesca subsp. 
vesca]
Length=348

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           F+S+QAAID VP GN+ WVIIHV++GVYR+ V+
Sbjct  63  FKSIQAAIDSVPAGNNQWVIIHVRQGVYREKVH  95



>gb|KDO71950.1| hypothetical protein CISIN_1g046043mg, partial [Citrus sinensis]
Length=316

 Score = 50.8 bits (120),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSV  96
           F+S+Q AI+ VP+GN NW+IIHV+KGVYR+ V
Sbjct  32  FKSIQDAINAVPKGNPNWIIIHVRKGVYREKV  63



>ref|XP_009791585.1| PREDICTED: probable pectinesterase 67 [Nicotiana sylvestris]
Length=340

 Score = 50.8 bits (120),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           F+SVQAAI+ VP GNS+W+IIHV+KG YR+ V+
Sbjct  55  FKSVQAAINSVPDGNSDWIIIHVRKGTYREKVH  87



>ref|XP_009602465.1| PREDICTED: probable pectinesterase 67 [Nicotiana tomentosiformis]
Length=341

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           F+SVQAAI+ VP GNS+W+IIHV+KG YR+ V+
Sbjct  56  FKSVQAAINSVPDGNSDWIIIHVRKGTYREKVH  88



>ref|XP_006488988.1| PREDICTED: probable pectinesterase 67-like [Citrus sinensis]
Length=351

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSV  96
           F+S+Q AI+ VP+GN NW+IIHV+KGVYR+ V
Sbjct  67  FKSIQDAINAVPKGNPNWIIIHVRKGVYREKV  98



>ref|XP_006419374.1| hypothetical protein CICLE_v10006909mg [Citrus clementina]
 gb|ESR32614.1| hypothetical protein CICLE_v10006909mg [Citrus clementina]
Length=351

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSV  96
           F+S+Q AI+ VP+GN NW+IIHV+KGVYR+ V
Sbjct  67  FKSIQDAINAVPKGNPNWIIIHVRKGVYREKV  98



>ref|XP_007035816.1| Pectin lyase-like superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY06742.1| Pectin lyase-like superfamily protein isoform 2 [Theobroma cacao]
Length=337

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           F SVQ AI+ VP+GNS WVIIH++KGVYR+ V+
Sbjct  53  FTSVQEAINSVPKGNSQWVIIHLRKGVYREKVH  85



>ref|XP_007035815.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY06741.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
Length=410

 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  1    FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
            F SVQ AI+ VP+GNS WVIIH++KGVYR+ V+
Sbjct  126  FTSVQEAINSVPKGNSQWVIIHLRKGVYREKVH  158



>gb|EYU29668.1| hypothetical protein MIMGU_mgv1a011615mg [Erythranthe guttata]
Length=276

 Score = 49.7 bits (117),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           F+SVQAAI++VP  NS W++IH++KGVYR+ V 
Sbjct  55  FKSVQAAINYVPNRNSKWIVIHIRKGVYREKVT  87



>ref|XP_006658906.1| PREDICTED: probable pectinesterase 68-like [Oryza brachyantha]
Length=208

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSV  96
           F++VQAA+DFVP GN  W+ IHVK+G YR+ V
Sbjct  52  FRTVQAAVDFVPDGNRKWIRIHVKEGSYREKV  83



>ref|XP_011100823.1| PREDICTED: probable pectinesterase 67 [Sesamum indicum]
Length=356

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSV  96
           F+ VQAA+D VP GNSNW++IH+ KGVYR+ V
Sbjct  57  FKFVQAAVDHVPDGNSNWIVIHLIKGVYREKV  88



>gb|KHF99581.1| putative pectinesterase 67 -like protein [Gossypium arboreum]
 gb|KHG11251.1| putative pectinesterase 67 -like protein [Gossypium arboreum]
Length=342

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           + S+Q AI+ VP+GNS WVIIHVKKG+YR+ V+
Sbjct  58  YTSIQEAINAVPKGNSKWVIIHVKKGIYREKVH  90



>emb|CAN70978.1| hypothetical protein VITISV_034766 [Vitis vinifera]
Length=350

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           F SVQAAID VP GN  W IIH++KGVY++ V+
Sbjct  66  FTSVQAAIDSVPEGNGKWTIIHIRKGVYKEKVH  98



>ref|XP_002272939.1| PREDICTED: probable pectinesterase 67 [Vitis vinifera]
 emb|CBI22874.3| unnamed protein product [Vitis vinifera]
Length=348

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           F SVQAAID VP GN  W IIH++KGVY++ V+
Sbjct  64  FTSVQAAIDSVPEGNGKWTIIHIRKGVYKEKVH  96



>gb|KFK40921.1| hypothetical protein AALP_AA2G060700 [Arabis alpina]
Length=344

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           + SVQ AID VP GNSNW+I+HV+KG+Y++ V+
Sbjct  56  YTSVQKAIDAVPVGNSNWIIVHVRKGIYKERVH  88



>ref|XP_006299552.1| hypothetical protein CARUB_v10015726mg [Capsella rubella]
 gb|EOA32450.1| hypothetical protein CARUB_v10015726mg [Capsella rubella]
Length=344

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           + SVQ AID VP GNSNW+I+HV+KG+Y++ V+
Sbjct  56  YTSVQKAIDAVPVGNSNWIIVHVRKGIYKERVH  88



>ref|XP_010487578.1| PREDICTED: probable pectinesterase 67 [Camelina sativa]
Length=344

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           + SVQ AID VP GNSNW+I+HV+KG+Y++ V+
Sbjct  56  YTSVQKAIDAVPVGNSNWIIVHVRKGIYKERVH  88



>ref|XP_009135518.1| PREDICTED: probable pectinesterase 67 [Brassica rapa]
 emb|CDX82380.1| BnaA03g34410D [Brassica napus]
Length=344

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           + SVQ AID VP GNSNW+I+HV+KG+Y++ V+
Sbjct  56  YTSVQKAIDAVPVGNSNWIIVHVRKGIYKERVH  88



>emb|CDX95886.1| BnaC05g36370D [Brassica napus]
Length=344

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           + SVQ AID VP GNSNW+I+HV+KG+Y++ V+
Sbjct  56  YTSVQKAIDAVPVGNSNWIIVHVRKGIYKERVH  88



>ref|XP_010504935.1| PREDICTED: probable pectinesterase 67 [Camelina sativa]
Length=344

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           + SVQ AID VP GNSNW+I+HV+KG+Y++ V+
Sbjct  56  YTSVQKAIDAVPVGNSNWIIVHVRKGIYKERVH  88



>emb|CDX92113.1| BnaA05g22940D [Brassica napus]
Length=344

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           + SVQ AID VP GNSNW+I+HV+KG+Y++ V+
Sbjct  56  YTSVQKAIDAVPVGNSNWIIVHVRKGIYKERVH  88



>ref|XP_002885186.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61445.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=344

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           + SVQ AID VP GNSNW+I+HV+KG+Y++ V+
Sbjct  56  YTSVQKAIDAVPVGNSNWIIVHVRKGIYKERVH  88



>ref|NP_188331.1| putative pectinesterase [Arabidopsis thaliana]
 sp|Q9LSP1.1|PME67_ARATH RecName: Full=Probable pectinesterase 67; Short=PE 67; AltName: 
Full=Pectin methylesterase 67; Short=AtPME67; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA94984.1| pectinesterase-like protein [Arabidopsis thaliana]
 gb|AAM62454.1| pectinesterase, putative [Arabidopsis thaliana]
 dbj|BAC42976.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAO64105.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AEE75899.1| putative pectinesterase [Arabidopsis thaliana]
Length=344

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           + SVQ AID VP GNSNW+I+HV+KG+Y++ V+
Sbjct  56  YTSVQKAIDAVPVGNSNWIIVHVRKGIYKERVH  88



>ref|XP_006406773.1| hypothetical protein EUTSA_v10021065mg [Eutrema salsugineum]
 gb|ESQ48226.1| hypothetical protein EUTSA_v10021065mg [Eutrema salsugineum]
Length=344

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           + SVQ AID VP GNSNW+I+HV+KG+Y++ V+
Sbjct  56  YTSVQKAIDAVPVGNSNWIIVHVRKGIYKERVH  88



>ref|XP_009387848.1| PREDICTED: probable pectinesterase 67 [Musa acuminata subsp. 
malaccensis]
Length=339

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSV  96
           F++VQAA+D VP GNS+W+I+H + G+YR+ V
Sbjct  55  FKTVQAAVDAVPMGNSDWIIVHCRSGIYREKV  86



>ref|XP_010921450.1| PREDICTED: probable pectinesterase 67 [Elaeis guineensis]
Length=339

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSV  96
           F+SVQAAI+ VP GNS W+IIH++ G+YR+ V
Sbjct  54  FKSVQAAINAVPDGNSQWIIIHIRAGIYREKV  85



>ref|XP_006830090.1| hypothetical protein AMTR_s00123p00050980 [Amborella trichopoda]
 gb|ERM97506.1| hypothetical protein AMTR_s00123p00050980 [Amborella trichopoda]
Length=379

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  1    FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSV  96
            F+SVQ A+D VP GNS+WV IHV+ GVYR+ V
Sbjct  92   FKSVQEAVDSVPEGNSDWVTIHVRAGVYREKV  123



>ref|XP_010465735.1| PREDICTED: probable pectinesterase 67 [Camelina sativa]
Length=344

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           + SVQ AID VP GNSNW+I+HV+KG+Y++ V+
Sbjct  56  YTSVQKAIDDVPVGNSNWIIVHVRKGIYKERVH  88



>ref|XP_006649973.1| PREDICTED: probable pectinesterase 67-like [Oryza brachyantha]
Length=347

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSV  96
           F++VQAAID VP GN+ WVI+H++ G+YR+ V
Sbjct  61  FKTVQAAIDAVPVGNAEWVIVHLRSGIYREKV  92



>gb|EAZ26679.1| hypothetical protein OsJ_10583 [Oryza sativa Japonica Group]
Length=296

 Score = 47.4 bits (111),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSV  96
           F++VQ+AID VP GN+ WVI+H++ G+YR+ V
Sbjct  61  FKTVQSAIDAVPVGNTEWVIVHLRSGIYREKV  92



>ref|XP_002523016.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF39358.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=350

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           F S+Q AI+ VP+ NS W+IIHV+KGVYR+ V+
Sbjct  67  FTSIQEAINAVPQNNSKWIIIHVRKGVYREKVH  99



>ref|XP_011027955.1| PREDICTED: probable pectinesterase 67 [Populus euphratica]
Length=352

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           F SVQ AI+ VP+ NS W+IIH++KGVYR+ V+
Sbjct  68  FTSVQEAINAVPKNNSQWIIIHLRKGVYREKVH  100



>ref|XP_002311381.2| hypothetical protein POPTR_0008s10440g [Populus trichocarpa]
 gb|EEE88748.2| hypothetical protein POPTR_0008s10440g [Populus trichocarpa]
Length=352

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           F SVQ AI+ VP+ NS W+IIH++KGVYR+ V+
Sbjct  68  FTSVQEAINAVPKNNSQWIIIHLRKGVYREKVH  100



>ref|NP_001049912.1| Os03g0309400 [Oryza sativa Japonica Group]
 gb|AAQ20039.2| putative pectinesterase [Oryza sativa Indica Group]
 gb|ABF95560.1| Pectinesterase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11826.1| Os03g0309400 [Oryza sativa Japonica Group]
 gb|EAY89724.1| hypothetical protein OsI_11262 [Oryza sativa Indica Group]
 dbj|BAG94743.1| unnamed protein product [Oryza sativa Japonica Group]
Length=345

 Score = 47.4 bits (111),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSV  96
           F++VQ+AID VP GN+ WVI+H++ G+YR+ V
Sbjct  61  FKTVQSAIDAVPVGNTEWVIVHLRSGIYREKV  92



>ref|XP_010548999.1| PREDICTED: probable pectinesterase 67 [Tarenaya hassleriana]
Length=349

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           + S+Q AID VP GN  W+I+HV+KG+YR+ V+
Sbjct  60  YTSIQQAIDAVPHGNPGWIIVHVRKGIYRERVH  92



>ref|XP_010671738.1| PREDICTED: probable pectinesterase 67 [Beta vulgaris subsp. vulgaris]
Length=350

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           +++VQ+AI+ VP GN NW++IH++KG+YR+ V+
Sbjct  65  YKTVQSAINAVPDGNPNWILIHLRKGIYREKVH  97



>tpg|DAA59111.1| TPA: hypothetical protein ZEAMMB73_544391 [Zea mays]
Length=219

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSV  96
           F++VQ+AID VP GN+ WVI+H++ G++R  V
Sbjct  62  FKTVQSAIDAVPAGNAEWVIVHLRSGLHRGKV  93



>emb|CDX75901.1| BnaC03g39840D [Brassica napus]
Length=344

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           + SVQ AID VP  NSNW+I+HV+KG+Y++ V+
Sbjct  56  YTSVQKAIDAVPVDNSNWIIVHVRKGIYKERVH  88



>ref|XP_009412865.1| PREDICTED: probable pectinesterase 66 [Musa acuminata subsp. 
malaccensis]
Length=197

 Score = 45.1 bits (105),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           F+S+Q AID VP  N+NW  IHV  GVYR+ VN
Sbjct  41  FKSIQQAIDSVPDNNNNWTKIHVASGVYREKVN  73



>ref|XP_011073789.1| PREDICTED: probable pectinesterase 29 [Sesamum indicum]
Length=330

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSV  96
           F ++QAAIDFVP  N  W  IH+K+G+YR+ V
Sbjct  43  FTTIQAAIDFVPAYNQRWTCIHIKRGLYREQV  74



>ref|XP_009146044.1| PREDICTED: probable pectinesterase 67 [Brassica rapa]
Length=344

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           + SVQ AID VP GNSNW+I+HV+KG+ ++ V+
Sbjct  56  YTSVQKAIDAVPVGNSNWIIVHVRKGICKERVH  88



>gb|EYU32660.1| hypothetical protein MIMGU_mgv1a009526mg [Erythranthe guttata]
Length=339

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSV  96
           F +VQAAID VP  N  W  IH+KKGVYR+ V
Sbjct  45  FTTVQAAIDSVPSYNKRWTCIHIKKGVYREKV  76



>emb|CDM87103.1| unnamed protein product [Triticum aestivum]
Length=363

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  1    FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSV  96
            F+++Q+AID VP GNS WV++H++ GVY + V
Sbjct  78   FKTIQSAIDAVPDGNSEWVVVHLRAGVYTEKV  109



>gb|EMS61713.1| putative pectinesterase 67 [Triticum urartu]
Length=304

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSV  96
           F+++Q+AID VP GN+ WV++H++ GVY + V
Sbjct  58  FKTIQSAIDAVPEGNTEWVVVHLRAGVYAEKV  89



>ref|XP_009397166.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=553

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/33 (58%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  1    FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
            F++VQAA+D VP GN N  +I+VKKGVY+++V+
Sbjct  253  FKTVQAAVDSVPNGNKNRYVIYVKKGVYKENVS  285



>ref|XP_009412866.1| PREDICTED: putative pectinesterase 10 [Musa acuminata subsp. 
malaccensis]
Length=326

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           F+S+Q AID VP  N+NW  IHV  GVYR+ VN
Sbjct  41  FKSIQQAIDSVPDNNNNWTKIHVAAGVYREKVN  73



>gb|KEH19057.1| pectinesterase [Medicago truncatula]
Length=331

 Score = 44.3 bits (103),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSV  96
           FQ++Q+AID VP GNS W+ I +  GVYR+ +
Sbjct  43  FQTIQSAIDSVPDGNSQWIHIQISPGVYREQI  74



>ref|XP_006658052.1| PREDICTED: probable pectinesterase 29-like [Oryza brachyantha]
Length=297

 Score = 44.3 bits (103),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           F+SVQ+A++FVP GN  W+ IHVK G Y++ V 
Sbjct  47  FRSVQSAVNFVPDGNREWIRIHVKAGSYKEKVT  79



>ref|NP_001146436.1| uncharacterized protein LOC100280019 precursor [Zea mays]
 gb|ACL53972.1| unknown [Zea mays]
 tpg|DAA59110.1| TPA: hypothetical protein ZEAMMB73_544391 [Zea mays]
Length=346

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSV  96
           F++VQ+AID VP GN+ WVI+H++ G++R  V
Sbjct  62  FKTVQSAIDAVPAGNAEWVIVHLRSGLHRGKV  93



>ref|XP_011041876.1| PREDICTED: probable pectinesterase 29 [Populus euphratica]
Length=334

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSV  96
           F S+Q+AID +P  N NWV IHV+ G YR+ V
Sbjct  56  FSSIQSAIDSIPSDNKNWVCIHVRAGTYREKV  87



>ref|XP_002457946.1| hypothetical protein SORBIDRAFT_03g022950 [Sorghum bicolor]
 gb|EES03066.1| hypothetical protein SORBIDRAFT_03g022950 [Sorghum bicolor]
Length=346

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSV  96
           F++VQ+AID VP GN+ W+I+H++ G++R  V
Sbjct  62  FKTVQSAIDAVPAGNTEWIIVHLRSGLHRGKV  93



>gb|KDP27907.1| hypothetical protein JCGZ_18987 [Jatropha curcas]
Length=351

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   FQSVQAAIDFVPRGNSNWVIIHVKKGVYRKSVN  99
           F S+Q AI+ VP  N  W+IIHV+KGVYR+ V+
Sbjct  68  FTSIQEAINAVPVNNDKWIIIHVRKGVYREKVH  100



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 522694794284