BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1211_g1_i1 len=1116 path=[1094:0-504 1599:505-1115]

Length=1116
                                                                      Score     E

ref|XP_009588605.1|  PREDICTED: fasciclin-like arabinogalactan pr...    212   2e-62   
ref|XP_009773188.1|  PREDICTED: fasciclin-like arabinogalactan pr...    210   8e-62   
ref|XP_006348836.1|  PREDICTED: fasciclin-like arabinogalactan pr...    197   8e-57   
ref|XP_004243392.1|  PREDICTED: fasciclin-like arabinogalactan pr...    191   1e-54   
gb|ABR68799.1|  fasciclin-like arabinogalactan protein 1                172   3e-47   Gossypium hirsutum [American cotton]
ref|XP_011100234.1|  PREDICTED: fasciclin-like arabinogalactan pr...    168   8e-46   
gb|ABV27475.1|  fasciclin-like arabinogalactan protein 4                168   9e-46   Gossypium hirsutum [American cotton]
gb|EYU28950.1|  hypothetical protein MIMGU_mgv1a021394mg                165   2e-44   
emb|CDP15882.1|  unnamed protein product                                162   2e-43   
gb|EPS63702.1|  hypothetical protein M569_11081                         158   1e-42   
ref|XP_006469071.1|  PREDICTED: fasciclin-like arabinogalactan pr...    159   2e-42   
ref|XP_010522581.1|  PREDICTED: fasciclin-like arabinogalactan pr...    159   3e-42   
ref|XP_010415601.1|  PREDICTED: fasciclin-like arabinogalactan pr...    158   5e-42   
gb|EYU28951.1|  hypothetical protein MIMGU_mgv1a012619mg                158   6e-42   
ref|XP_010489025.1|  PREDICTED: fasciclin-like arabinogalactan pr...    157   1e-41   
ref|XP_010467804.1|  PREDICTED: fasciclin-like arabinogalactan pr...    156   4e-41   
ref|XP_003540384.1|  PREDICTED: uncharacterized LOC100500293            156   4e-41   
gb|KDO49564.1|  hypothetical protein CISIN_1g025959mg                   155   8e-41   
ref|XP_002277788.1|  PREDICTED: fasciclin-like arabinogalactan pr...    155   9e-41   Vitis vinifera
ref|XP_006446719.1|  hypothetical protein CICLE_v10016407mg             154   2e-40   
emb|CAN83422.1|  hypothetical protein VITISV_000403                     154   2e-40   Vitis vinifera
ref|XP_004287337.1|  PREDICTED: fasciclin-like arabinogalactan pr...    154   2e-40   
emb|CDY22308.1|  BnaA06g36300D                                          153   5e-40   
ref|NP_001238356.1|  uncharacterized protein LOC100527846 precursor     152   8e-40   
gb|KDP24065.1|  hypothetical protein JCGZ_25722                         152   8e-40   
gb|KHN36673.1|  Fasciclin-like arabinogalactan protein 6                152   9e-40   
ref|XP_009101735.1|  PREDICTED: fasciclin-like arabinogalactan pr...    151   2e-39   
ref|NP_565475.1|  fasciclin-like arabinogalactan protein 6              151   3e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008242761.1|  PREDICTED: fasciclin-like arabinogalactan pr...    151   3e-39   
emb|CDX94756.1|  BnaC07g17650D                                          150   4e-39   
ref|XP_007043716.1|  Fasciclin-like arabinogalactan protein 9           149   5e-39   
ref|XP_007203478.1|  hypothetical protein PRUPE_ppa022313mg             150   7e-39   
ref|XP_006408977.1|  hypothetical protein EUTSA_v10002226mg             149   9e-39   
ref|XP_002884207.1|  hypothetical protein ARALYDRAFT_480881             149   1e-38   
ref|XP_006299820.1|  hypothetical protein CARUB_v10016021mg             149   2e-38   
gb|AFK41457.1|  unknown                                                 148   3e-38   
ref|XP_009113940.1|  PREDICTED: fasciclin-like arabinogalactan pr...    148   4e-38   
ref|XP_002517840.1|  conserved hypothetical protein                     147   6e-38   Ricinus communis
ref|XP_009368837.1|  PREDICTED: fasciclin-like arabinogalactan pr...    146   2e-37   
emb|CDY18192.1|  BnaC05g02150D                                          146   2e-37   
ref|XP_010482678.1|  PREDICTED: fasciclin-like arabinogalactan pr...    146   2e-37   
ref|XP_006381469.1|  fasciclin-like AGP 13 family protein               145   2e-37   
ref|XP_007149797.1|  hypothetical protein PHAVU_005G099500g             146   2e-37   
ref|XP_010540894.1|  PREDICTED: fasciclin-like arabinogalactan pr...    146   3e-37   
emb|CDY13122.1|  BnaA09g16950D                                          145   3e-37   
ref|XP_010093970.1|  hypothetical protein L484_010536                   145   4e-37   
gb|KEH39201.1|  fasciclin-like arabinogalactan protein                  145   4e-37   
ref|XP_008367860.1|  PREDICTED: LOW QUALITY PROTEIN: fasciclin-li...    145   4e-37   
ref|XP_009119354.1|  PREDICTED: fasciclin-like arabinogalactan pr...    145   6e-37   
ref|XP_011048566.1|  PREDICTED: fasciclin-like arabinogalactan pr...    144   8e-37   
gb|KFK42730.1|  hypothetical protein AALP_AA1G032300                    144   8e-37   
gb|ABK78690.1|  unknown                                                 144   9e-37   Brassica rapa
ref|XP_010475017.1|  PREDICTED: fasciclin-like arabinogalactan pr...    144   2e-36   
ref|XP_002519547.1|  conserved hypothetical protein                     143   3e-36   Ricinus communis
gb|AAT37956.1|  fasciclin-like AGP 13                                   142   3e-36   Populus tremula x Populus alba [gray poplar]
ref|XP_010245565.1|  PREDICTED: fasciclin-like arabinogalactan pr...    143   3e-36   
ref|XP_010457404.1|  PREDICTED: fasciclin-like arabinogalactan pr...    142   4e-36   
ref|XP_006403136.1|  hypothetical protein EUTSA_v10003262mg             142   5e-36   
ref|NP_199226.1|  fasciclin-like arabinogalactan protein 13             142   5e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004493964.1|  PREDICTED: fasciclin-like arabinogalactan pr...    142   6e-36   
ref|XP_006281682.1|  hypothetical protein CARUB_v10027821mg             142   6e-36   
ref|XP_008798339.1|  PREDICTED: fasciclin-like arabinogalactan pr...    142   7e-36   
gb|AFK39439.1|  unknown                                                 142   8e-36   
gb|KDP29103.1|  hypothetical protein JCGZ_16492                         141   1e-35   
ref|XP_006304423.1|  hypothetical protein CARUB_v10011002mg             141   1e-35   
gb|KFK31663.1|  hypothetical protein AALP_AA6G142700                    141   2e-35   
ref|XP_010494416.1|  PREDICTED: fasciclin-like arabinogalactan pr...    141   2e-35   
ref|XP_002865383.1|  hypothetical protein ARALYDRAFT_494579             140   2e-35   
ref|XP_004241271.1|  PREDICTED: fasciclin-like arabinogalactan pr...    140   2e-35   
gb|EPS63113.1|  hypothetical protein M569_11675                         138   3e-35   
ref|XP_006418194.1|  hypothetical protein EUTSA_v10008582mg             140   3e-35   
ref|XP_002323464.1|  fasciclin-like AGP 13 family protein               140   3e-35   Populus trichocarpa [western balsam poplar]
ref|XP_006480613.1|  PREDICTED: fasciclin-like arabinogalactan pr...    139   7e-35   
ref|XP_006428804.1|  hypothetical protein CICLE_v10012588mg             139   8e-35   
ref|XP_010919222.1|  PREDICTED: fasciclin-like arabinogalactan pr...    139   8e-35   
emb|CAN60933.1|  hypothetical protein VITISV_022591                     138   8e-35   Vitis vinifera
ref|XP_004487189.1|  PREDICTED: fasciclin-like arabinogalactan pr...    140   9e-35   
ref|XP_002892185.1|  hypothetical protein ARALYDRAFT_470362             139   1e-34   
ref|XP_010684113.1|  PREDICTED: fasciclin-like arabinogalactan pr...    138   1e-34   
ref|XP_002285068.1|  PREDICTED: fasciclin-like arabinogalactan pr...    138   1e-34   Vitis vinifera
ref|XP_011015335.1|  PREDICTED: fasciclin-like arabinogalactan pr...    137   2e-34   
gb|AAT37954.1|  fasciclin-like AGP 11                                   137   2e-34   Populus tremula x Populus alba [gray poplar]
gb|AAN60339.1|  unknown                                                 138   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010441925.1|  PREDICTED: fasciclin-like arabinogalactan pr...    137   3e-34   
ref|XP_010424800.1|  PREDICTED: fasciclin-like arabinogalactan pr...    137   4e-34   
ref|XP_006398764.1|  hypothetical protein EUTSA_v10015384mg             136   7e-34   
ref|XP_010490785.1|  PREDICTED: fasciclin-like arabinogalactan pr...    136   8e-34   
ref|XP_010452179.1|  PREDICTED: fasciclin-like arabinogalactan pr...    136   8e-34   
ref|XP_010260346.1|  PREDICTED: fasciclin-like arabinogalactan pr...    137   8e-34   
ref|XP_010920871.1|  PREDICTED: fasciclin-like arabinogalactan pr...    136   8e-34   
ref|NP_563692.1|  fasciclin-like arabinogalactan protein 9              136   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010924403.1|  PREDICTED: fasciclin-like arabinogalactan pr...    136   1e-33   
ref|XP_009406930.1|  PREDICTED: fasciclin-like arabinogalactan pr...    136   1e-33   
ref|XP_010253626.1|  PREDICTED: fasciclin-like arabinogalactan pr...    135   1e-33   
ref|XP_006286413.1|  hypothetical protein CARUB_v10002835mg             135   1e-33   
ref|XP_002873077.1|  hypothetical protein ARALYDRAFT_487087             135   1e-33   
ref|XP_010689776.1|  PREDICTED: fasciclin-like arabinogalactan pr...    135   2e-33   
ref|XP_008793344.1|  PREDICTED: fasciclin-like arabinogalactan pr...    135   2e-33   
ref|XP_008243923.1|  PREDICTED: fasciclin-like arabinogalactan pr...    134   3e-33   
ref|XP_010937843.1|  PREDICTED: fasciclin-like arabinogalactan pr...    134   4e-33   
gb|AAM62616.1|  arabinogalactan protein-like                            134   4e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004969482.1|  PREDICTED: fasciclin-like arabinogalactan pr...    134   4e-33   
ref|NP_001130967.1|  uncharacterized protein LOC100192072 precursor     134   5e-33   Zea mays [maize]
ref|NP_195937.1|  fasciclin-like arabinogalactan protein 11             134   5e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006376379.1|  hypothetical protein POPTR_0013s12490g             134   5e-33   
gb|EPS62200.1|  hypothetical protein M569_12593                         131   5e-33   
gb|AFK36413.1|  unknown                                                 134   6e-33   
ref|XP_003625615.1|  Fasciclin-like arabinogalactan protein             134   6e-33   
ref|XP_009402376.1|  PREDICTED: fasciclin-like arabinogalactan pr...    134   6e-33   
emb|CDY44345.1|  BnaC02g03320D                                          134   6e-33   
ref|XP_008449261.1|  PREDICTED: fasciclin-like arabinogalactan pr...    134   6e-33   
ref|XP_009125482.1|  PREDICTED: fasciclin-like arabinogalactan pr...    134   7e-33   
ref|XP_007204927.1|  hypothetical protein PRUPE_ppa023999mg             134   7e-33   
ref|XP_009342757.1|  PREDICTED: fasciclin-like arabinogalactan pr...    134   8e-33   
ref|XP_008350366.1|  PREDICTED: fasciclin-like arabinogalactan pr...    133   1e-32   
ref|XP_009786976.1|  PREDICTED: fasciclin-like arabinogalactan pr...    133   1e-32   
ref|XP_008789092.1|  PREDICTED: fasciclin-like arabinogalactan pr...    133   1e-32   
ref|XP_010558264.1|  PREDICTED: fasciclin-like arabinogalactan pr...    133   1e-32   
emb|CDP07130.1|  unnamed protein product                                133   1e-32   
gb|AGN92421.1|  putative fasciclin-like arabinogalactan protein 1       132   2e-32   
ref|XP_009620250.1|  PREDICTED: fasciclin-like arabinogalactan pr...    132   2e-32   
ref|XP_006340150.1|  PREDICTED: fasciclin-like arabinogalactan pr...    132   2e-32   
gb|EYU18853.1|  hypothetical protein MIMGU_mgv1a026916mg                132   2e-32   
emb|CAI99883.1|  putative cell surface adhesion protein                 132   2e-32   Zinnia violacea [garden zinnia]
gb|KFK24763.1|  hypothetical protein AALP_AA8G021900                    132   2e-32   
ref|XP_007027300.1|  FASCICLIN-like arabinogalactan-protein 11, p...    132   2e-32   
ref|XP_009130731.1|  PREDICTED: fasciclin-like arabinogalactan pr...    132   2e-32   
ref|XP_009760303.1|  PREDICTED: fasciclin-like arabinogalactan pr...    132   2e-32   
ref|XP_011089317.1|  PREDICTED: fasciclin-like arabinogalactan pr...    132   3e-32   
ref|NP_001043814.1|  Os01g0668100                                       131   5e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009421475.1|  PREDICTED: fasciclin-like arabinogalactan pr...    131   5e-32   
emb|CDX80855.1|  BnaC03g01090D                                          131   7e-32   
ref|XP_004143241.1|  PREDICTED: fasciclin-like arabinogalactan pr...    130   8e-32   
gb|ABV27477.1|  fasciclin-like arabinogalactan protein 6                130   8e-32   Gossypium hirsutum [American cotton]
emb|CDY11242.1|  BnaA03g00780D                                          130   8e-32   
ref|XP_003567900.1|  PREDICTED: fasciclin-like arabinogalactan pr...    130   9e-32   
ref|XP_004243817.1|  PREDICTED: fasciclin-like arabinogalactan pr...    130   1e-31   
gb|AFK43105.1|  unknown                                                 130   1e-31   
ref|XP_002440247.1|  hypothetical protein SORBIDRAFT_09g028480          130   1e-31   Sorghum bicolor [broomcorn]
ref|XP_009769903.1|  PREDICTED: fasciclin-like arabinogalactan pr...    130   1e-31   
ref|XP_008798234.1|  PREDICTED: fasciclin-like arabinogalactan pr...    130   1e-31   
ref|XP_008783124.1|  PREDICTED: fasciclin-like arabinogalactan pr...    131   2e-31   
ref|XP_010052360.1|  PREDICTED: fasciclin-like arabinogalactan pr...    130   2e-31   
ref|XP_003538216.1|  PREDICTED: fasciclin-like arabinogalactan pr...    130   2e-31   
ref|XP_006826651.1|  hypothetical protein AMTR_s00393p00013250          129   2e-31   
ref|XP_009377418.1|  PREDICTED: fasciclin-like arabinogalactan pr...    129   3e-31   
ref|XP_003606417.1|  Fasciclin-like arabinogalactan protein             130   3e-31   
ref|XP_006591618.1|  PREDICTED: fasciclin-like arabinogalactan pr...    130   5e-31   
ref|XP_006361812.1|  PREDICTED: fasciclin-like arabinogalactan pr...    128   5e-31   
ref|XP_009404414.1|  PREDICTED: fasciclin-like arabinogalactan pr...    130   6e-31   
ref|XP_010916030.1|  PREDICTED: fasciclin-like arabinogalactan pr...    129   6e-31   
ref|XP_004246666.1|  PREDICTED: fasciclin-like arabinogalactan pr...    128   7e-31   
ref|XP_004304418.1|  PREDICTED: fasciclin-like arabinogalactan pr...    128   7e-31   
ref|XP_004505977.1|  PREDICTED: fasciclin-like arabinogalactan pr...    128   7e-31   
ref|XP_011002659.1|  PREDICTED: fasciclin-like arabinogalactan pr...    128   8e-31   
ref|XP_010104108.1|  hypothetical protein L484_014391                   128   1e-30   
ref|XP_007132229.1|  hypothetical protein PHAVU_011G076900g             129   1e-30   
gb|ACZ67174.1|  fasciclin and related adhesion glycoprotein             127   1e-30   Populus deltoides
gb|KHN32072.1|  Fasciclin-like arabinogalactan protein 11               128   1e-30   
ref|XP_009630866.1|  PREDICTED: fasciclin-like arabinogalactan pr...    127   1e-30   
gb|ACJ85305.1|  unknown                                                 127   1e-30   Medicago truncatula
ref|XP_003538053.1|  PREDICTED: fasciclin-like arabinogalactan pr...    128   1e-30   
ref|XP_002458287.1|  hypothetical protein SORBIDRAFT_03g030690          127   1e-30   Sorghum bicolor [broomcorn]
dbj|BAD61084.1|  putative arabinogalactan protein                       128   2e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003606412.1|  Fasciclin-like arabinogalactan protein             128   2e-30   
gb|AAO92753.1|  arabinogalactan protein                                 127   2e-30   Gossypium hirsutum [American cotton]
gb|AFK46797.1|  unknown                                                 128   2e-30   
gb|ADE62309.1|  fasciclin-like arabinogalactan protein                  127   2e-30   
ref|XP_009612445.1|  PREDICTED: fasciclin-like arabinogalactan pr...    127   2e-30   
gb|ABR68797.1|  arabinogalactan protein 2                               127   2e-30   Gossypium hirsutum [American cotton]
gb|KHN38782.1|  Fasciclin-like arabinogalactan protein 11               128   2e-30   
ref|XP_004961219.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   2e-30   
gb|KHN05735.1|  Fasciclin-like arabinogalactan protein 11               127   2e-30   
ref|XP_010046692.1|  PREDICTED: fasciclin-like arabinogalactan pr...    127   2e-30   
gb|AFK41879.1|  unknown                                                 127   3e-30   
dbj|BAB08198.1|  unnamed protein product                                127   3e-30   Oryza sativa Japonica Group [Japonica rice]
gb|AFK36056.1|  unknown                                                 126   3e-30   
ref|XP_010232123.1|  PREDICTED: fasciclin-like arabinogalactan pr...    126   3e-30   
gb|ACU15329.1|  unknown                                                 124   3e-30   Glycine max [soybeans]
ref|XP_003606406.1|  Fasciclin-like arabinogalactan protein             126   3e-30   
ref|XP_004246667.1|  PREDICTED: fasciclin-like arabinogalactan pr...    126   3e-30   
ref|XP_009630865.1|  PREDICTED: fasciclin-like arabinogalactan pr...    126   4e-30   
emb|CAN62433.1|  hypothetical protein VITISV_022135                     126   4e-30   Vitis vinifera
gb|ABB97042.1|  unknown                                                 126   4e-30   Brassica rapa
gb|EAY72628.1|  hypothetical protein OsI_00494                          126   4e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_002325592.1|  fasciclin-like arabinogalactan-protein 9           126   5e-30   Populus trichocarpa [western balsam poplar]
ref|XP_009131912.1|  PREDICTED: fasciclin-like arabinogalactan pr...    126   5e-30   
ref|XP_003539725.1|  PREDICTED: fasciclin-like arabinogalactan pr...    127   5e-30   
emb|CDY67775.1|  BnaCnng56350D                                          125   5e-30   
ref|XP_007132200.1|  hypothetical protein PHAVU_011G074500g             126   6e-30   
ref|XP_002455162.1|  hypothetical protein SORBIDRAFT_03g005280          126   6e-30   Sorghum bicolor [broomcorn]
ref|XP_007132237.1|  hypothetical protein PHAVU_011G077700g             127   6e-30   
ref|XP_002280829.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   8e-30   Vitis vinifera
ref|XP_009769904.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   8e-30   
gb|ABS50664.1|  fasciclin-like arabinogalactan protein                  125   9e-30   Eucalyptus grandis [rose gum]
gb|KHN32074.1|  Fasciclin-like arabinogalactan protein 11               125   9e-30   
ref|XP_003539723.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   1e-29   
ref|XP_007132234.1|  hypothetical protein PHAVU_011G077400g             125   1e-29   
gb|ACZ67172.1|  fasciclin and related adhesion glycoprotein             124   1e-29   Populus nigra [black poplar]
ref|XP_004148768.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   1e-29   
ref|XP_004505974.1|  PREDICTED: fasciclin-like arabinogalactan pr...    126   1e-29   
ref|XP_008463798.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   1e-29   
ref|XP_007132231.1|  hypothetical protein PHAVU_011G077100g             125   1e-29   
ref|XP_007132216.1|  hypothetical protein PHAVU_011G076000g             126   1e-29   
ref|XP_010107552.1|  hypothetical protein L484_024406                   125   1e-29   
ref|XP_007132209.1|  hypothetical protein PHAVU_011G075300g             125   2e-29   
ref|XP_011041714.1|  PREDICTED: fasciclin-like arabinogalactan pr...    124   2e-29   
ref|XP_007015428.1|  FASCICLIN-like arabinogalactan-protein 11          124   2e-29   
ref|XP_003539724.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   2e-29   
gb|ACU18837.1|  unknown                                                 125   2e-29   Glycine max [soybeans]
ref|XP_003538217.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   2e-29   
ref|XP_008455488.1|  PREDICTED: fasciclin-like arabinogalactan pr...    124   2e-29   
ref|XP_002321841.1|  fasciclin-like AGP 15 family protein               124   2e-29   Populus trichocarpa [western balsam poplar]
ref|XP_003539213.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   2e-29   
gb|KHN39526.1|  Fasciclin-like arabinogalactan protein 11               125   2e-29   
ref|XP_003539728.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   2e-29   
ref|XP_003546043.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   2e-29   
gb|KDO73213.1|  hypothetical protein CISIN_1g025798mg                   124   3e-29   
ref|XP_007132197.1|  hypothetical protein PHAVU_011G074200g             125   3e-29   
ref|XP_002532604.1|  conserved hypothetical protein                     124   3e-29   Ricinus communis
ref|XP_006488128.1|  PREDICTED: fasciclin-like arabinogalactan pr...    124   3e-29   
ref|XP_006361822.1|  PREDICTED: fasciclin-like arabinogalactan pr...    124   3e-29   
ref|XP_007132199.1|  hypothetical protein PHAVU_011G074400g             124   4e-29   
gb|ABR68798.1|  arabinogalactan protein 3                               124   4e-29   Gossypium hirsutum [American cotton]
gb|KHN05734.1|  Fasciclin-like arabinogalactan protein 11               124   4e-29   
gb|KHG08221.1|  Fasciclin-like arabinogalactan protein 12               124   5e-29   
ref|XP_002532603.1|  conserved hypothetical protein                     124   5e-29   Ricinus communis
ref|XP_002275538.1|  PREDICTED: fasciclin-like arabinogalactan pr...    123   5e-29   Vitis vinifera
gb|KHN39525.1|  Fasciclin-like arabinogalactan protein 11               124   5e-29   
ref|XP_010446221.1|  PREDICTED: fasciclin-like arabinogalactan pr...    123   5e-29   
ref|XP_004505975.1|  PREDICTED: fasciclin-like arabinogalactan pr...    123   5e-29   
gb|KDP44078.1|  hypothetical protein JCGZ_05545                         124   5e-29   
gb|ACU17607.1|  unknown                                                 124   6e-29   Glycine max [soybeans]
gb|AAT37958.1|  fasciclin-like AGP 15                                   122   7e-29   Populus tremula x Populus alba [gray poplar]
ref|NP_001235903.1|  uncharacterized protein LOC100500034 precursor     122   7e-29   
ref|XP_006424604.1|  hypothetical protein CICLE_v10028988mg             123   8e-29   
ref|XP_004505973.1|  PREDICTED: fasciclin-like arabinogalactan pr...    124   9e-29   
gb|ADE62307.1|  fasciclin-like arabinogalactan protein                  123   9e-29   
gb|KHN05732.1|  Beta-galactosidase 8                                    125   9e-29   
ref|XP_003540183.1|  PREDICTED: fasciclin-like arabinogalactan pr...    122   9e-29   
ref|XP_003539718.1|  PREDICTED: fasciclin-like arabinogalactan pr...    123   1e-28   
gb|KHN32070.1|  Fasciclin-like arabinogalactan protein 11               123   1e-28   
gb|KHN32077.1|  Fasciclin-like arabinogalactan protein 11               123   1e-28   
ref|XP_010483697.1|  PREDICTED: fasciclin-like arabinogalactan pr...    122   1e-28   
ref|NP_001174524.1|  Os05g0563550                                       122   1e-28   
ref|XP_002317778.1|  fasciclin-like AGP 15 family protein               122   1e-28   Populus trichocarpa [western balsam poplar]
ref|XP_010043729.1|  PREDICTED: fasciclin-like arabinogalactan pr...    122   1e-28   
gb|AAT37950.1|  fasciclin-like AGP 7                                    122   1e-28   Populus tremula x Populus alba [gray poplar]
gb|KCW85724.1|  hypothetical protein EUGRSUZ_B02486                     123   1e-28   
ref|XP_006655019.1|  PREDICTED: fasciclin-like arabinogalactan pr...    121   1e-28   
ref|XP_003538218.1|  PREDICTED: fasciclin-like arabinogalactan pr...    123   1e-28   
ref|XP_002532605.1|  conserved hypothetical protein                     122   1e-28   Ricinus communis
ref|XP_003539722.2|  PREDICTED: fasciclin-like arabinogalactan pr...    123   1e-28   
ref|XP_003606125.1|  Fasciclin-like arabinogalactan protein             123   1e-28   
ref|XP_003539721.1|  PREDICTED: fasciclin-like arabinogalactan pr...    122   1e-28   
ref|XP_007132232.1|  hypothetical protein PHAVU_011G077200g             122   1e-28   
ref|XP_003539726.1|  PREDICTED: fasciclin-like arabinogalactan pr...    123   2e-28   
gb|ABR17950.1|  unknown                                                 122   2e-28   Picea sitchensis
gb|AAK95321.1|AF410335_1  AT5g60490/muf9_140                            121   2e-28   Arabidopsis thaliana [mouse-ear cress]
gb|ACU18940.1|  unknown                                                 121   2e-28   Glycine max [soybeans]
ref|XP_011094679.1|  PREDICTED: fasciclin-like arabinogalactan pr...    121   2e-28   
ref|XP_004505972.1|  PREDICTED: fasciclin-like arabinogalactan pr...    122   2e-28   
ref|XP_002866383.1|  hypothetical protein ARALYDRAFT_496195             121   2e-28   
ref|XP_006843643.1|  hypothetical protein AMTR_s00007p00166710          121   2e-28   
ref|XP_006400843.1|  hypothetical protein EUTSA_v10014491mg             121   2e-28   
ref|XP_006645522.1|  PREDICTED: fasciclin-like arabinogalactan pr...    123   2e-28   
gb|AAM62683.1|  arabinogalactan protein-like                            121   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200857.1|  fasciclin-like arabinogalactan protein 12             121   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007132210.1|  hypothetical protein PHAVU_011G075400g             122   2e-28   
gb|AFK36882.1|  unknown                                                 122   3e-28   
gb|KHN32073.1|  Fasciclin-like arabinogalactan protein 11               121   3e-28   
ref|NP_001240023.1|  uncharacterized protein LOC100791112 precursor     121   3e-28   
ref|XP_003535643.1|  PREDICTED: fasciclin-like arabinogalactan pr...    122   3e-28   
gb|KHN39527.1|  Fasciclin-like arabinogalactan protein 12               122   3e-28   
gb|KHN38777.1|  Fasciclin-like arabinogalactan protein 11               122   3e-28   
ref|XP_002317779.1|  fasciclin-like AGP 15 family protein               121   3e-28   Populus trichocarpa [western balsam poplar]
ref|XP_011014336.1|  PREDICTED: fasciclin-like arabinogalactan pr...    121   3e-28   
ref|XP_002313520.2|  fasciclin-like AGP 15 family protein               121   3e-28   Populus trichocarpa [western balsam poplar]
ref|XP_011025076.1|  PREDICTED: fasciclin-like arabinogalactan pr...    122   3e-28   
gb|EEE64696.1|  hypothetical protein OsJ_19551                          122   3e-28   
ref|XP_007152044.1|  hypothetical protein PHAVU_004G097000g             122   3e-28   
gb|ACU23556.1|  unknown                                                 122   4e-28   
ref|XP_003538212.1|  PREDICTED: fasciclin-like arabinogalactan pr...    122   4e-28   
gb|AAT37953.1|  fasciclin-like AGP 10                                   121   4e-28   
gb|KDP44073.1|  hypothetical protein JCGZ_05540                         120   4e-28   
ref|XP_004251119.1|  PREDICTED: fasciclin-like arabinogalactan pr...    120   4e-28   
gb|KFK27578.1|  hypothetical protein AALP_AA8G402100                    120   5e-28   
ref|XP_009405666.1|  PREDICTED: fasciclin-like arabinogalactan pr...    120   6e-28   
gb|ACJ85480.1|  unknown                                                 120   6e-28   
dbj|BAJ94967.1|  predicted protein                                      120   6e-28   
gb|EYU38532.1|  hypothetical protein MIMGU_mgv1a012755mg                120   7e-28   
gb|KDP44080.1|  hypothetical protein JCGZ_05547                         120   7e-28   
gb|EMT22225.1|  hypothetical protein F775_32785                         120   8e-28   
gb|ABI95404.1|  fasciclin-like protein FLA14                            119   8e-28   
ref|XP_007132230.1|  hypothetical protein PHAVU_011G077000g             120   9e-28   
gb|AAT07658.1|  putative arabinogalactan protein                        120   9e-28   
ref|NP_001054735.1|  Os05g0163300                                       120   1e-27   
gb|ABV27478.1|  fasciclin-like arabinogalactan protein 7                119   1e-27   
ref|XP_004487128.1|  PREDICTED: fasciclin-like arabinogalactan pr...    119   1e-27   
ref|XP_009614928.1|  PREDICTED: fasciclin-like arabinogalactan pr...    119   1e-27   
ref|XP_010520362.1|  PREDICTED: fasciclin-like arabinogalactan pr...    119   2e-27   
ref|XP_006339076.1|  PREDICTED: fasciclin-like arabinogalactan pr...    119   2e-27   
gb|ABI95403.1|  fasciclin-like protein FLA13                            119   2e-27   
ref|XP_004144519.1|  PREDICTED: fasciclin-like arabinogalactan pr...    119   2e-27   
ref|XP_004487130.1|  PREDICTED: fasciclin-like arabinogalactan pr...    120   2e-27   
ref|XP_007152043.1|  hypothetical protein PHAVU_004G096900g             119   2e-27   
ref|XP_004163432.1|  PREDICTED: fasciclin-like arabinogalactan pr...    119   2e-27   
gb|AAD56235.1|AF183809_1  arabinogalactan protein Pop14A9               118   2e-27   
gb|AAA74420.1|  arabinogalactan-like protein                            119   2e-27   
ref|XP_003597212.1|  Fasciclin-like arabinogalactan protein             120   2e-27   
ref|XP_006279682.1|  hypothetical protein CARUB_v10026995mg             118   3e-27   
gb|ABI95402.1|  fasciclin-like protein FLA12                            119   3e-27   
gb|EMT20397.1|  hypothetical protein F775_29110                         119   3e-27   
gb|ACU18441.1|  unknown                                                 117   4e-27   
ref|XP_004485932.1|  PREDICTED: fasciclin-like arabinogalactan pr...    119   4e-27   
ref|XP_004968272.1|  PREDICTED: fasciclin-like arabinogalactan pr...    118   4e-27   
gb|AFK35566.1|  unknown                                                 117   4e-27   
gb|AAT37957.1|  fasciclin-like AGP 14                                   117   4e-27   
ref|XP_002318877.1|  fasciclin-like AGP 15 family protein               117   4e-27   
ref|XP_003521385.1|  PREDICTED: fasciclin-like arabinogalactan pr...    117   4e-27   
ref|XP_002532601.1|  conserved hypothetical protein                     117   5e-27   
ref|XP_011029966.1|  PREDICTED: fasciclin-like arabinogalactan pr...    117   5e-27   
ref|XP_006591149.1|  PREDICTED: fasciclin-like arabinogalactan pr...    118   5e-27   
ref|XP_002532608.1|  conserved hypothetical protein                     118   5e-27   
ref|XP_002321998.2|  hypothetical protein POPTR_0015s01560g             117   5e-27   
ref|XP_006365737.1|  PREDICTED: fasciclin-like arabinogalactan pr...    117   6e-27   
ref|XP_011006038.1|  PREDICTED: fasciclin-like arabinogalactan pr...    119   6e-27   
ref|XP_006604571.1|  PREDICTED: fasciclin-like arabinogalactan pr...    117   8e-27   
gb|KDP44079.1|  hypothetical protein JCGZ_05546                         117   9e-27   
ref|XP_009771219.1|  PREDICTED: fasciclin-like arabinogalactan pr...    117   1e-26   
ref|XP_003565205.1|  PREDICTED: fasciclin-like arabinogalactan pr...    117   1e-26   
ref|XP_002298676.2|  fasciclin-like AGP 15 family protein               116   1e-26   
gb|KHN21528.1|  Fasciclin-like arabinogalactan protein 11               116   1e-26   
ref|XP_003521389.1|  PREDICTED: fasciclin-like arabinogalactan pr...    116   1e-26   
ref|XP_011003630.1|  PREDICTED: fasciclin-like arabinogalactan pr...    116   2e-26   
ref|XP_003593817.1|  Fasciclin-like arabinogalactan protein             117   2e-26   
ref|XP_011044383.1|  PREDICTED: fasciclin-like arabinogalactan pr...    116   2e-26   
gb|KHN09493.1|  Fasciclin-like arabinogalactan protein 11               116   2e-26   
ref|XP_009335061.1|  PREDICTED: fasciclin-like arabinogalactan pr...    116   2e-26   
gb|KDP44072.1|  hypothetical protein JCGZ_05539                         115   2e-26   
ref|XP_006594988.1|  PREDICTED: fasciclin-like arabinogalactan pr...    116   2e-26   
ref|XP_010032011.1|  PREDICTED: fasciclin-like arabinogalactan pr...    115   3e-26   
ref|XP_002313519.2|  fasciclin-like AGP 15 family protein               115   3e-26   
ref|NP_001046645.1|  Os02g0308400                                       115   4e-26   
emb|CDM81544.1|  unnamed protein product                                115   4e-26   
gb|ABI95408.1|  fasciclin-like protein FLA18                            115   4e-26   
ref|XP_010535593.1|  PREDICTED: fasciclin-like arabinogalactan pr...    115   5e-26   
gb|EAY85536.1|  hypothetical protein OsI_06909                          115   5e-26   
gb|KCW88820.1|  hypothetical protein EUGRSUZ_A01158                     114   5e-26   
ref|XP_010034295.1|  PREDICTED: fasciclin-like arabinogalactan pr...    114   5e-26   
ref|XP_007207834.1|  hypothetical protein PRUPE_ppa023379mg             115   5e-26   
ref|XP_007162741.1|  hypothetical protein PHAVU_001G176400g             115   5e-26   
ref|XP_011040871.1|  PREDICTED: fasciclin-like arabinogalactan pr...    114   6e-26   
gb|AFK33714.1|  unknown                                                 115   6e-26   
ref|XP_008225462.1|  PREDICTED: fasciclin-like arabinogalactan pr...    115   7e-26   
gb|AES67461.2|  fasciclin domain protein                                115   7e-26   
gb|ABS50663.1|  fasciclin-like arabinogalactan protein                  114   8e-26   
ref|XP_010653564.1|  PREDICTED: fasciclin-like arabinogalactan pr...    115   8e-26   
emb|CDP06732.1|  unnamed protein product                                114   1e-25   
ref|XP_003597210.1|  Fasciclin-like arabinogalactan protein             115   1e-25   
gb|AAT37952.1|  fasciclin-like AGP 9                                    114   1e-25   
gb|KDP44077.1|  hypothetical protein JCGZ_05544                         114   1e-25   
ref|XP_007159487.1|  hypothetical protein PHAVU_002G241600g             117   1e-25   
gb|KHN06429.1|  Fasciclin-like arabinogalactan protein 12               113   1e-25   
ref|XP_011044381.1|  PREDICTED: fasciclin-like arabinogalactan pr...    114   1e-25   
gb|AES64069.2|  fasciclin domain protein                                114   2e-25   
ref|XP_003593818.1|  Fasciclin-like arabinogalactan protein             115   2e-25   
gb|ACJ84960.1|  unknown                                                 114   3e-25   
ref|XP_002442056.1|  hypothetical protein SORBIDRAFT_08g008370          113   3e-25   
gb|AFK38800.1|  unknown                                                 113   3e-25   
gb|ACF85943.1|  unknown                                                 113   3e-25   
ref|XP_008225450.1|  PREDICTED: fasciclin-like arabinogalactan pr...    113   3e-25   
gb|ABR68796.1|  arabinogalactan protein 4                               112   3e-25   
ref|XP_006384898.1|  hypothetical protein POPTR_0004s22030g             112   4e-25   
ref|NP_001151382.1|  fasciclin-like arabinogalactan protein 8 pre...    112   4e-25   
ref|XP_004952331.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   5e-25   
ref|XP_007207878.1|  hypothetical protein PRUPE_ppa021321mg             112   5e-25   
ref|XP_003539114.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   5e-25   
ref|XP_004487129.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   5e-25   
gb|ADE62308.1|  fasciclin-like arabinogalactan protein                  112   6e-25   
ref|XP_003629841.1|  Fasciclin-like arabinogalactan protein             113   6e-25   
ref|XP_003629840.1|  Fasciclin-like arabinogalactan protein             114   6e-25   
ref|XP_006647201.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   6e-25   
ref|XP_006591575.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   6e-25   
ref|NP_001239620.1|  uncharacterized protein LOC100796929 precursor     112   6e-25   
ref|XP_003547182.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   7e-25   
gb|KDP44081.1|  hypothetical protein JCGZ_05548                         111   7e-25   
gb|EMT07885.1|  hypothetical protein F775_09011                         112   7e-25   
ref|XP_004295018.1|  PREDICTED: fasciclin-like arabinogalactan pr...    111   7e-25   
gb|KHN28640.1|  Fasciclin-like arabinogalactan protein 11               111   8e-25   
ref|XP_010104103.1|  hypothetical protein L484_014386                   112   8e-25   
ref|XP_010104101.1|  hypothetical protein L484_014384                   112   9e-25   
gb|ABI95407.1|  fasciclin-like protein FLA17                            111   9e-25   
gb|KDP44074.1|  hypothetical protein JCGZ_05541                         112   9e-25   
ref|XP_003566509.2|  PREDICTED: fasciclin-like arabinogalactan pr...    111   1e-24   
ref|XP_009389411.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   1e-24   
ref|XP_003629839.1|  Fasciclin-like arabinogalactan protein             112   1e-24   
gb|AFK42840.1|  unknown                                                 111   1e-24   
ref|XP_008225441.1|  PREDICTED: fasciclin-like arabinogalactan pr...    111   1e-24   
emb|CDX88761.1|  BnaA03g08880D                                          111   1e-24   
ref|NP_001151132.1|  fasciclin-like arabinogalactan protein 7 pre...    111   1e-24   
gb|KDP44076.1|  hypothetical protein JCGZ_05543                         111   1e-24   
ref|XP_003597211.1|  Fasciclin-like arabinogalactan protein             111   2e-24   
gb|AFK45477.1|  unknown                                                 112   2e-24   
ref|XP_010653559.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   2e-24   
ref|XP_011040874.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   2e-24   
ref|XP_002532611.1|  conserved hypothetical protein                     110   2e-24   
ref|XP_002532612.1|  conserved hypothetical protein                     110   2e-24   
gb|AAT37951.1|  fasciclin-like AGP 8                                    110   2e-24   
gb|ABV27476.1|  fasciclin-like arabinogalactan protein 5                110   2e-24   
ref|XP_007206667.1|  hypothetical protein PRUPE_ppa022851mg             110   2e-24   
ref|XP_002463075.1|  hypothetical protein SORBIDRAFT_02g037310          110   2e-24   
ref|XP_007208544.1|  hypothetical protein PRUPE_ppa024648mg             110   3e-24   
emb|CAN80892.1|  hypothetical protein VITISV_031814                     110   3e-24   
ref|XP_007132201.1|  hypothetical protein PHAVU_011G074600g             110   3e-24   
ref|XP_003532766.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   3e-24   
ref|XP_003593816.1|  Fasciclin-like arabinogalactan protein             110   3e-24   
gb|KDO73214.1|  hypothetical protein CISIN_1g042775mg                   108   3e-24   
ref|XP_003532767.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   4e-24   
ref|XP_007207073.1|  hypothetical protein PRUPE_ppa026177mg             110   4e-24   
ref|XP_008385295.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   4e-24   
gb|KHN48027.1|  Fasciclin-like arabinogalactan protein 12               110   4e-24   
gb|ABI95406.1|  fasciclin-like protein FLA16                            109   4e-24   
gb|AFK48635.1|  unknown                                                 110   4e-24   
gb|ACF85666.1|  unknown                                                 109   4e-24   
gb|AFK46710.1|  unknown                                                 110   5e-24   
gb|AFK42841.1|  unknown                                                 110   5e-24   
ref|XP_006488127.1|  PREDICTED: fasciclin-like arabinogalactan pr...    109   5e-24   
ref|XP_006424603.1|  hypothetical protein CICLE_v10029172mg             108   6e-24   
ref|XP_010104104.1|  hypothetical protein L484_014387                   110   6e-24   
gb|KHN48026.1|  Fasciclin-like arabinogalactan protein 11               109   7e-24   
ref|XP_010456482.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   7e-24   
ref|XP_007208580.1|  hypothetical protein PRUPE_ppa023283mg             109   8e-24   
gb|AFK42899.1|  unknown                                                 108   9e-24   
ref|XP_010104098.1|  hypothetical protein L484_014381                   109   9e-24   
emb|CAN80893.1|  hypothetical protein VITISV_031815                     108   1e-23   
ref|XP_010101250.1|  hypothetical protein L484_000577                   108   1e-23   
ref|XP_008225430.1|  PREDICTED: fasciclin-like arabinogalactan pr...    109   1e-23   
ref|XP_002275791.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   1e-23   
ref|XP_002275816.2|  PREDICTED: fasciclin-like arabinogalactan pr...    107   1e-23   
emb|CAN80894.1|  hypothetical protein VITISV_031816                     107   1e-23   
ref|XP_002440662.1|  hypothetical protein SORBIDRAFT_09g004750          108   1e-23   
ref|XP_002532609.1|  conserved hypothetical protein                     108   1e-23   
emb|CBI32719.3|  unnamed protein product                                108   1e-23   
ref|XP_010653711.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   2e-23   
ref|XP_010104099.1|  hypothetical protein L484_014382                   108   2e-23   
ref|XP_010104107.1|  hypothetical protein L484_014390                   108   2e-23   
ref|XP_004504276.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   3e-23   
ref|XP_008225421.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   3e-23   
ref|XP_010653562.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   3e-23   
ref|XP_010104102.1|  hypothetical protein L484_014385                   107   5e-23   
ref|XP_008363505.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   5e-23   
ref|XP_009338258.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   5e-23   
ref|XP_007148000.1|  hypothetical protein PHAVU_006G172100g             107   6e-23   
ref|XP_010253006.1|  PREDICTED: fasciclin-like arabinogalactan pr...    106   6e-23   
ref|XP_004504275.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   7e-23   
ref|XP_007132203.1|  hypothetical protein PHAVU_011G0747000g            104   1e-22   
ref|XP_007148001.1|  hypothetical protein PHAVU_006G172200g             105   1e-22   
ref|XP_010104105.1|  hypothetical protein L484_014388                   106   1e-22   
ref|XP_006655588.1|  PREDICTED: fasciclin-like arabinogalactan pr...    105   1e-22   
ref|XP_006648571.1|  PREDICTED: fasciclin-like arabinogalactan pr...    105   1e-22   
ref|XP_007159488.1|  hypothetical protein PHAVU_002G241700g             105   1e-22   
ref|XP_002280565.2|  PREDICTED: fasciclin-like arabinogalactan pr...    105   2e-22   
ref|XP_010456492.1|  PREDICTED: fasciclin-like arabinogalactan pr...    104   2e-22   
emb|CAN80889.1|  hypothetical protein VITISV_031811                     104   2e-22   
ref|XP_006595403.1|  PREDICTED: fasciclin-like arabinogalactan pr...    104   2e-22   
ref|XP_006376544.1|  hypothetical protein POPTR_0013s14780g             104   2e-22   
ref|XP_002532610.1|  conserved hypothetical protein                     105   2e-22   
ref|XP_008344850.1|  PREDICTED: fasciclin-like arabinogalactan pr...    105   2e-22   
gb|AAT37945.1|  fasciclin-like AGP 2                                    104   2e-22   
gb|AES88608.2|  fasciclin domain protein                                105   2e-22   
ref|XP_003606411.1|  Fasciclin-like arabinogalactan protein             104   2e-22   
ref|XP_002275883.3|  PREDICTED: fasciclin-like arabinogalactan pr...    104   3e-22   
ref|XP_002532600.1|  conserved hypothetical protein                     103   3e-22   
ref|XP_002318983.1|  fasciclin-like AGP 15 family protein               104   3e-22   
ref|XP_010653555.1|  PREDICTED: fasciclin-like arabinogalactan pr...    104   3e-22   
ref|XP_008664451.1|  PREDICTED: fasciclin-like arabinogalactan pr...    104   3e-22   
ref|XP_004977117.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   4e-22   
ref|XP_007132211.1|  hypothetical protein PHAVU_011G075500g             103   4e-22   
ref|NP_001056328.1|  Os05g0563600                                       103   4e-22   
ref|XP_002532606.1|  conserved hypothetical protein                     103   5e-22   
ref|XP_010270121.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   6e-22   
ref|XP_003565918.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   7e-22   
ref|XP_010653558.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   7e-22   
gb|AAT37947.1|  fasciclin-like AGP 4                                    103   8e-22   
ref|XP_003532768.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   8e-22   
ref|XP_009338259.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   8e-22   
ref|XP_003524211.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   8e-22   
ref|XP_011023709.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   9e-22   
ref|XP_011020991.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   1e-21   
emb|CBI32721.3|  unnamed protein product                                102   1e-21   
emb|CAN80891.1|  hypothetical protein VITISV_031813                     103   1e-21   
ref|XP_011020993.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   1e-21   
gb|EYU22635.1|  hypothetical protein MIMGU_mgv1a024657mg                100   1e-21   
ref|XP_002319946.1|  fasciclin-like AGP 15 family protein               102   1e-21   
ref|XP_008379726.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   1e-21   
ref|XP_008229843.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   1e-21   
ref|XP_010653563.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   1e-21   
ref|XP_004243536.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   2e-21   
ref|XP_011020992.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   2e-21   



>ref|XP_009588605.1| PREDICTED: fasciclin-like arabinogalactan protein 9 [Nicotiana 
tomentosiformis]
Length=251

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 126/260 (48%), Positives = 165/260 (63%), Gaps = 21/260 (8%)
 Frame = -1

Query  1002  LLHLSVPLI------LIFLLFPHQIHTQpattapppssstTWPVDIIDILKTGKQFNIFV  841
             +   S+PLI      L F+LFP QI  Q  T   P  +    P+DI  ILK   Q+N F+
Sbjct  1     MAQRSLPLIFLSLIPLFFILFP-QIQAQSPTAPAPAPT---GPIDIFAILKKPGQYNTFI  56

Query  840   KFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNKLSDQQKVRLIQFHILP  661
             KFL+    +G QI+ Q+  S  G++V A  D+AFT+LP GTLNKL+DQQKV+LIQ+H+LP
Sbjct  57    KFLNET-QVGMQINNQVNNSNQGMTVFAPSDNAFTNLPGGTLNKLNDQQKVQLIQYHVLP  115

Query  660   KFYSLDDLETASNPVETLAGGE----FVLNFTGSNGQVNVTSGVVQTQVSNIMRKNFPLA  493
             KFYS DDL+T SNPV T A G+    F LNFTG N QVNV+SG V+T + N +RK+ PLA
Sbjct  116   KFYSFDDLQTVSNPVRTQATGQKGEPFGLNFTGQNNQVNVSSGAVETNIYNAIRKDPPLA  175

Query  492   VYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSPADEPSPAANGEPNSAGR  313
             VYQ+DKVL+PLEFT    P+  N   P+  +A +  ++ + + A  PSPA    PN A R
Sbjct  176   VYQLDKVLIPLEFTDAKTPSSDNAPAPSNDSAKS-GSTADKTKAKVPSPA----PNGAKR  230

Query  312   MSQFGLGLAPAAVVLFCMGV  253
             ++    GL  + V LFCMG 
Sbjct  231   INVGAFGLV-SGVFLFCMGA  249



>ref|XP_009773188.1| PREDICTED: fasciclin-like arabinogalactan protein 9 [Nicotiana 
sylvestris]
Length=247

 Score =   210 bits (534),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 126/257 (49%), Positives = 165/257 (64%), Gaps = 16/257 (6%)
 Frame = -1

Query  1011  ISTLLHLSVPLILIFLLFPHQIHTQpattapppssstTWPVDIIDILKTGKQFNIFVKFL  832
             ++ L+ LS+ + L FLLFP QI  Q  T   P  +    P+DI  ILK   Q+N F+KFL
Sbjct  1     MAQLIFLSL-IPLFFLLFP-QIQAQSPTAPAPAPT---GPIDIFAILKKAGQYNTFIKFL  55

Query  831   DTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNKLSDQQKVRLIQFHILPKFY  652
             +    +G QI+ Q+  S  G++V A  D+AFT+LP GTLNKL+DQQKV+LIQ+HILPKFY
Sbjct  56    NET-QVGMQINNQVNNSNQGMTVFAPSDNAFTNLPGGTLNKLNDQQKVQLIQYHILPKFY  114

Query  651   SLDDLETASNPVETLAGGE----FVLNFTGSNGQVNVTSGVVQTQVSNIMRKNFPLAVYQ  484
             S DDL+T SNPV T A G+    F LNFTG N QVNV+SG V+T + N +RK  PLAVYQ
Sbjct  115   SFDDLQTVSNPVRTQATGQKGEPFGLNFTGQNNQVNVSSGAVETNIYNAIRKEPPLAVYQ  174

Query  483   IDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSPADEPSPAANGEPNSAGRMSQ  304
             +DKVL+PL FT    P+  N   P   +A +  ++ + + A EPSPA    PN A +++ 
Sbjct  175   LDKVLIPLAFTDAKTPSSDNAPAPTDDSAKS-GSTADKTKAKEPSPA----PNGAKKINV  229

Query  303   FGLGLAPAAVVLFCMGV  253
                GL  + V LFCMG 
Sbjct  230   GVFGLI-SGVFLFCMGA  245



>ref|XP_006348836.1| PREDICTED: fasciclin-like arabinogalactan protein 9-like [Solanum 
tuberosum]
Length=249

 Score =   197 bits (501),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 145/219 (66%), Gaps = 11/219 (5%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P+DI  ILK   Q+N F+KFL+ +  +G QI+ Q+  S  G++VLA  D+AF +LPSGTL
Sbjct  37   PIDIFAILKKEGQYNTFIKFLNES-QVGNQINNQVNNSNQGMTVLAPSDNAFNNLPSGTL  95

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGG----EFVLNFTGSNGQVNVTS  547
            N+L+DQQKV+LI  H++PKFY+ DDL+T SNPV T A G     F LNFTG+N QVNV+S
Sbjct  96   NQLNDQQKVQLILNHVIPKFYTFDDLQTVSNPVRTQATGPKGEPFGLNFTGNNNQVNVSS  155

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHS  367
            G V T + N +RKN PLAVYQ+DKVL+P EFT    P+  +   P   A A    S + +
Sbjct  156  GSVVTNIYNAIRKNPPLAVYQLDKVLVPSEFTDPKAPSSDDAPAP---AKAKNGTSADKT  212

Query  366  PADEPSPAANGEPNSAGRMSQFGLGLAPAAVVLFCMGVF  250
             ADEPSPA++ +PN A R+S   LGL      +F MG  
Sbjct  213  TADEPSPASSTKPNDAKRISGGILGL---ICGVFLMGTL  248



>ref|XP_004243392.1| PREDICTED: fasciclin-like arabinogalactan protein 9 [Solanum 
lycopersicum]
Length=247

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 141/208 (68%), Gaps = 14/208 (7%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P+DI  ILK   Q+N F+KFL+ +  +G QI+ Q+  S  G++VLA  D+AF +LPSGTL
Sbjct  37   PIDIFAILKKEGQYNTFIKFLNES-QVGNQINNQVNNSNQGMTVLAPSDNAFNNLPSGTL  95

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGG----EFVLNFTGSNGQVNVTS  547
            N+L+DQQKV+LI  H++PKFY+ DDL+T SNPV T A G     F LNFTGSN QVNV+S
Sbjct  96   NQLNDQQKVQLILNHVIPKFYTFDDLQTVSNPVRTQATGPKGEPFGLNFTGSNNQVNVSS  155

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKN--SKE  373
            G V T + N +RK+ PLAV+Q+DKVL+P +FT  +          +  A   PKN  S +
Sbjct  156  GSVVTNIYNAIRKDPPLAVFQLDKVLVPSQFTDPSS-------DDDAPAPTKPKNGTSND  208

Query  372  HSPADEPSPAANGEPNSAGRMSQFGLGL  289
             + ADEPSPA+N +PN A R+S   LGL
Sbjct  209  KTTADEPSPASNTKPNDAKRISGGILGL  236



>gb|ABR68799.1| fasciclin-like arabinogalactan protein 1 [Gossypium hirsutum]
Length=244

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 103/246 (42%), Positives = 144/246 (59%), Gaps = 11/246 (4%)
 Frame = -1

Query  993  LSVPLILIFLLFPHQIHTQpattapppssstTWPVDIIDILKTGKQFNIFVKFLDTANHL  814
            LS  L+ +FL+F   +  Q A    P       P++   IL    Q+  F++ L     +
Sbjct  7    LSPILLSLFLVFICGVSAQTAPAPAPS-----GPLNFTGILDKNGQYTYFLQLL-AQTQV  60

Query  813  GKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNKLSDQQKVRLIQFHILPKFYSLDDLE  634
            G Q+ TQ+ T+T+G +V A  D+AF +L  GT+N L  QQKV+L+ +H++PK+YSL+DL+
Sbjct  61   GSQVQTQLKTTTEGFTVFAPTDNAFNNLKPGTVNNLDPQQKVQLVLYHVIPKYYSLNDLQ  120

Query  633  TASNPVETLAGGEFVLNFTGSNGQVNVTSGVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
              SNPV T AG +F LN TG N QVNV+SGVV+TQ++N + +  PLA+YQ DKVLLP EF
Sbjct  121  FVSNPVRTQAGQDFGLNVTGLNNQVNVSSGVVETQINNALYQKKPLAIYQADKVLLPEEF  180

Query  453  TSKARPTLGNKGRPNKTAAAAPKNSKEHSPADEPSPAANGEPNSAGRMSQFGLGLAPAAV  274
                 P         K++  +  NS+  + ADEP+ A N    SAGR    GLG     +
Sbjct  181  FEAKSPAAAPSPATKKSSTGSKSNSRASATADEPASADNS--GSAGR--NMGLGFV-VGL  235

Query  273  VLFCMG  256
             L CMG
Sbjct  236  ALACMG  241



>ref|XP_011100234.1| PREDICTED: fasciclin-like arabinogalactan protein 13 [Sesamum 
indicum]
Length=247

 Score =   168 bits (426),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 95/219 (43%), Positives = 132/219 (60%), Gaps = 16/219 (7%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P+++  IL+   Q+N F++ L+     G QI+ Q+  S DG+++ A  D+AF +LP+GTL
Sbjct  40   PINVTAILEKAGQYNFFIRLLNET-QAGNQINNQVNNSHDGMTLFAPTDNAFNNLPTGTL  98

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA----GGEFVLNFTGSNGQVNVTS  547
            N L++QQ V+L+ +HI PKFYSLD L T SNPV TLA    GG F LNFTG   QVNV++
Sbjct  99   NNLTNQQHVQLVLYHICPKFYSLDSLLTVSNPVRTLASGQDGGVFGLNFTGQANQVNVST  158

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHS  367
            G+V+  + N +RK+FPLAVYQ+DKVLLP EF     P          ++ AA   +K   
Sbjct  159  GIVEVPLYNALRKDFPLAVYQVDKVLLPEEFYKAKAPAASPPAADGSSSPAADGGAK---  215

Query  366  PADEPSPAANGEPNSAGRMSQFGLGLAPAAVVLFCMGVF  250
                 +P+     N +GRMS  GLGL     +  CM + 
Sbjct  216  -----APSTGNPGNGSGRMS-VGLGLVSG--IWLCMALL  246



>gb|ABV27475.1| fasciclin-like arabinogalactan protein 4 [Gossypium hirsutum]
Length=244

 Score =   168 bits (425),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 101/246 (41%), Positives = 143/246 (58%), Gaps = 11/246 (4%)
 Frame = -1

Query  993  LSVPLILIFLLFPHQIHTQpattapppssstTWPVDIIDILKTGKQFNIFVKFLDTANHL  814
            LS  L+ +FL+F   +  Q A    P       P++   IL    Q+  F++ L     +
Sbjct  7    LSPILLSLFLVFICGVSAQTAPAPAPS-----GPLNFTGILDKNGQYTYFLQLL-AQTQV  60

Query  813  GKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNKLSDQQKVRLIQFHILPKFYSLDDLE  634
            G Q+ TQ+ T+T+G +V A  D+AF +L  GT+N L  QQKV+L+ +H++PK+YSL+DL+
Sbjct  61   GSQVQTQLKTTTEGFTVFAPTDNAFNNLKPGTVNNLDPQQKVQLVLYHVIPKYYSLNDLQ  120

Query  633  TASNPVETLAGGEFVLNFTGSNGQVNVTSGVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
              SNPV T AG +F LN TG N QVNV+SGVV+TQ++N + +  PLA+YQ DKVLLP EF
Sbjct  121  FVSNPVRTQAGEDFGLNVTGLNNQVNVSSGVVETQINNALYQKKPLAIYQADKVLLPEEF  180

Query  453  TSKARPTLGNKGRPNKTAAAAPKNSKEHSPADEPSPAANGEPNSAGRMSQFGLGLAPAAV  274
                 P         K++  +  NS+  + ADEP+ A N    S GR    GLG     +
Sbjct  181  FEAKSPAAAPSPATKKSSTGSKSNSRASATADEPASADNS--GSTGR--NMGLGFV-VGL  235

Query  273  VLFCMG  256
             L C+G
Sbjct  236  ALACIG  241



>gb|EYU28950.1| hypothetical protein MIMGU_mgv1a021394mg [Erythranthe guttata]
Length=267

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 99/249 (40%), Positives = 138/249 (55%), Gaps = 52/249 (21%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P++I  IL+   Q+  F++ L+       QI+ Q+  S DG++V A  D+AF +LP G+L
Sbjct  36   PINITAILEKASQYTTFIRLLNET-QAANQINNQVNNSQDGMTVFAPTDNAFNNLPPGSL  94

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE----FVLNFTGSNGQVNVTS  547
            NKL++QQ+V+L+ +HI PK+YSL+ L T SNPV T A G+    F LNFTG   QVNV++
Sbjct  95   NKLTNQQQVQLVLYHICPKYYSLESLLTVSNPVRTQASGQDNQVFGLNFTGQGNQVNVST  154

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF-----------------------------  454
            GVV+  + N +RK+ PLAVYQ+DKVLLP+EF                             
Sbjct  155  GVVEVPIYNALRKDPPLAVYQVDKVLLPIEFFPQQSKSKAPAPSPPPSGGGGGGAAAKPP  214

Query  453  -TSKARPTLGNKGRPNKTAAAAPKNSKEHSPADEPSPAANGEPNSAGRMSQFGLGLAPAA  277
             TS + P+       N TAA AP  +          PA N   N +G MS  GLGL  + 
Sbjct  215  STSTSNPST------NVTAAKAPSTND---------PATNNPGNGSGEMS-VGLGLV-SG  257

Query  276  VVLFCMGVF  250
            ++L CMG+ 
Sbjct  258  IILLCMGLL  266



>emb|CDP15882.1| unnamed protein product [Coffea canephora]
Length=249

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/227 (42%), Positives = 130/227 (57%), Gaps = 28/227 (12%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P++   IL     F+  ++ LD     G QID Q+  S DG+++LA  D+AF +LP+G L
Sbjct  38   PINTTGILDKAGGFSTLIRLLDET-QAGNQIDNQLNNSHDGMTLLAPTDNAFQNLPAGAL  96

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA----GGEFVLNFTG--SNGQVNV  553
            NKLSDQQKV+LIQ+H++PK+Y+L  L+T SNPV T A    GG F LNFTG  +  QVNV
Sbjct  97   NKLSDQQKVQLIQYHVIPKYYTLTSLQTVSNPVRTEASGQDGGVFGLNFTGQTNQNQVNV  156

Query  552  TSGVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPK----  385
            +SG V T + N++R  FPLA+YQ+DKV+ P+EF              N++ A+AP     
Sbjct  157  SSGTVNTPIYNVVRGKFPLAIYQLDKVMWPMEF--------------NESKASAPVSSPP  202

Query  384  --NSKEHSPADEPSPAANGEPNSAGRMSQFGLGLAPAAVVLFCMGVF  250
              NS      D  + A      S  +    GL L  + + L CMGV 
Sbjct  203  TLNSTRSGSGDGNTTAETPSTKSDAKSMTVGLSLI-SGLWLLCMGVL  248



>gb|EPS63702.1| hypothetical protein M569_11081, partial [Genlisea aurea]
Length=180

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 107/150 (71%), Gaps = 5/150 (3%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            VDII IL    Q+  F++ L+    +  QID Q  TS DG++V AA D AF +LP+GTLN
Sbjct  32   VDIIGILHKAGQYAFFIRLLNQT-QIANQIDNQAETSADGMTVFAATDDAFRNLPAGTLN  90

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE----FVLNFTGSNGQVNVTSG  544
             LS Q++++L+Q+HI PKFY+LD+L+T SNPV T A G+    F LNF+    QVN+++G
Sbjct  91   NLSFQRQIQLLQYHICPKFYTLDELQTVSNPVRTEASGQDGQVFGLNFSADANQVNLSTG  150

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            VVQ  ++N +  NFPLAV+++DKVLLPLEF
Sbjct  151  VVQVSINNAVEDNFPLAVFEVDKVLLPLEF  180



>ref|XP_006469071.1| PREDICTED: fasciclin-like arabinogalactan protein 13-like [Citrus 
sinensis]
Length=245

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/217 (43%), Positives = 132/217 (61%), Gaps = 9/217 (4%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            PV++  IL    QF  F+K L  +  +  QI +QI +S++G++V A  D+AF +L  G L
Sbjct  35   PVNLTGILDKNGQFTTFIKLL-ISTQVANQIQSQINSSSEGMTVFAPTDNAFNNLEKGLL  93

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGEFV--LNFTGSNGQVNVTSGV  541
            N L +Q++V+L+ +H+  KFY   DL   SNPV TLA G+ V  LNFTG   QVNV+SGV
Sbjct  94   NNLDNQKQVQLVLYHVTSKFYRQSDLLLVSNPVRTLASGQDVWGLNFTGQGNQVNVSSGV  153

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSPA  361
            V+T ++N++R+NFPLAVYQ+DKVLLP E ++   P+        K+   +   +K+   A
Sbjct  154  VETPINNVLRQNFPLAVYQVDKVLLPEELSAAKSPSAAPAPEGKKSTEGS---NKKVPAA  210

Query  360  DEPSPAANGEPNSAGRMSQFGLGLAPAAVVLFCMGVF  250
             EP+PA   +   AG     GLG   A + L CMGV 
Sbjct  211  SEPAPA--DDNTGAGARLNAGLGFV-AGLALLCMGVL  244



>ref|XP_010522581.1| PREDICTED: fasciclin-like arabinogalactan protein 9 [Tarenaya 
hassleriana]
Length=247

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 93/221 (42%), Positives = 139/221 (63%), Gaps = 15/221 (7%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            V++  IL+ G QF+ F+  L+T   +G Q++ Q+ +S+DG++V A  D+AF +L  GTLN
Sbjct  34   VNLTAILEKGGQFSSFIHLLNTT-QVGNQVNIQLNSSSDGMTVFAPTDNAFQNLKPGTLN  92

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA----GGEFVLNFTGSNGQVNVTSG  544
             LS + +VRLI +H+ PK+Y+LDDL + SNPV T A    GG + LNFTG   QVNV++G
Sbjct  93   HLSIEDQVRLILYHVTPKYYTLDDLLSVSNPVRTQASGRDGGVYGLNFTGQGNQVNVSTG  152

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSK--EH  370
            VV+T+++N +R+  PLAVY +D+VLLP E          NK + +  AA+APK+S   + 
Sbjct  153  VVETRINNALRQQMPLAVYVVDQVLLPDEMFGD------NKNKTSPPAASAPKSSSTGDA  206

Query  369  SPADEPSPA-ANGEPNSAGRMSQFGLGLAPAAVVLFCMGVF  250
            +   EP     + E + +G M    LG A   VV+ C+ +F
Sbjct  207  NATGEPKKTPKSSEKSGSGEMKNGRLGFALGLVVV-CLKLF  246



>ref|XP_010415601.1| PREDICTED: fasciclin-like arabinogalactan protein 6 [Camelina 
sativa]
Length=248

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 92/220 (42%), Positives = 133/220 (60%), Gaps = 17/220 (8%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P+++  IL++G QF  F++ L+T   +G Q+  Q+ +S  G+++ A  D+AF +L  GTL
Sbjct  36   PINLTAILESGHQFTTFMRLLNTT-QVGFQVSVQLNSSDQGMTIFAPTDNAFNNLKPGTL  94

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA----GGEFVLNFTGS--NGQVNV  553
            N L+ QQ+++L+ +HI+PK+YSL DL  ASNPV T A    GG F LNFTG   + QVNV
Sbjct  95   NGLTYQQQIQLMLYHIIPKYYSLSDLLLASNPVRTQATGQEGGVFGLNFTGEAQSNQVNV  154

Query  552  TSGVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKE  373
            ++GVV+T+++N +R+ FPLA+Y +DKVLLP E         G K  P  T A APK+   
Sbjct  155  STGVVETRINNALRQQFPLAIYVVDKVLLPEEL-------FGTKTTP--TGAPAPKSITS  205

Query  372  HSPADEPSPAANGEPNSAGRMSQFGLGLAPAAVVLFCMGV  253
               AD PS       +S   + +  LG+     V FC  V
Sbjct  206  SPDADSPSVVDEEHKSSGSNVKRTSLGVV-LGFVWFCCSV  244



>gb|EYU28951.1| hypothetical protein MIMGU_mgv1a012619mg [Erythranthe guttata]
Length=245

 Score =   158 bits (399),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 91/219 (42%), Positives = 134/219 (61%), Gaps = 13/219 (6%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P++I  IL+   Q+  F++ L+       QI+ Q+  S DG++V A  D+AF +LP GTL
Sbjct  34   PINITAILEKANQYTTFIRLLNET-QAANQINNQVNNSHDGMTVFAPTDNAFNNLPPGTL  92

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE----FVLNFTGSNGQVNVTS  547
            NKL++QQ+V+L+ +HI PKFYSL+ L T SNPV T A G+    F LNFTG   QVNV++
Sbjct  93   NKLTNQQQVQLVLYHICPKFYSLESLLTVSNPVRTQASGQDNQVFGLNFTGQGNQVNVST  152

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHS  367
            G+V+  + N +RK+ PLAVYQ+DKVL+P EF+    P        + + +AA       +
Sbjct  153  GIVEVPIYNALRKDPPLAVYQVDKVLIPKEFSEPKPPAASPPPNGDGSGSAAKDGGAAKA  212

Query  366  PADEPSPAANGEPNSAGRMSQFGLGLAPAAVVLFCMGVF  250
            P+   SP      N +G+M+  G GL  + ++L CMG+ 
Sbjct  213  PSTS-SPG-----NGSGKMN-VGFGLV-SGILLLCMGLL  243



>ref|XP_010489025.1| PREDICTED: fasciclin-like arabinogalactan protein 6 [Camelina 
sativa]
Length=250

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 96/221 (43%), Positives = 135/221 (61%), Gaps = 20/221 (9%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P+++  IL+TG QF  F++ L+T   +G Q+  Q+ +S  G+++ A  D+AF +L  GTL
Sbjct  36   PINLTAILETGHQFTTFMRLLNTT-QVGFQVSVQLNSSDQGMTIFAPTDNAFNNLKPGTL  94

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA----GGEFVLNFTG--SNGQVNV  553
            N L+ QQ+++L+ +HI+PK+YSL DL  ASNPV T A    GG F LNFTG   + QVNV
Sbjct  95   NGLTYQQQIQLMLYHIIPKYYSLSDLLLASNPVRTQATGQEGGVFGLNFTGQAQSNQVNV  154

Query  552  TSGVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKE  373
            ++GVV+T++SN +R+ FPL +Y +DKVLLP E         G K  P  T A APK    
Sbjct  155  STGVVETRISNALRQQFPLGIYVVDKVLLPEEL-------FGTKNTP--TGAPAPKPITS  205

Query  372  HSPADEPSPAANGEPNSAG-RMSQFGLGLAPAAVVLFCMGV  253
               AD  SPA + E  S+G  + +  LG+     V FC  V
Sbjct  206  SPDAD--SPAVDEEHKSSGSSVKRTSLGVV-LGFVWFCCSV  243



>ref|XP_010467804.1| PREDICTED: fasciclin-like arabinogalactan protein 6 [Camelina 
sativa]
Length=253

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 95/218 (44%), Positives = 136/218 (62%), Gaps = 20/218 (9%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P++   +L+TG QF  F++ L+T   +G Q+  Q+ +S  G+++ A  D+AF +L  GTL
Sbjct  36   PINFTAVLETGHQFTTFMRLLNTT-QVGFQVSVQLNSSDQGMTIFALTDNAFNNLKPGTL  94

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA----GGEFVLNFTG--SNGQVNV  553
            N L+ QQ+++L+ +HI+PK+YSL DL  ASNPV T A    GG F LNFTG   + QVNV
Sbjct  95   NGLTYQQQIQLMLYHIIPKYYSLSDLLLASNPVRTQATGQEGGVFGLNFTGQAQSNQVNV  154

Query  552  TSGVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKE  373
            ++GVV+T+++N +R+ FPLA+Y +DKVLLP E         G K  P  T A APK S  
Sbjct  155  STGVVETRINNALRQQFPLAIYVVDKVLLPEEL-------FGTKTTP--TGAPAPK-SIT  204

Query  372  HSPADEPSPAANGEPNSAG-RMSQFGLGLAPAAVVLFC  262
             SP D  SPA + E  S+G  + +  LG+     + FC
Sbjct  205  SSP-DADSPAVDKEHKSSGSNVKRTSLGVV-LGFIWFC  240



>ref|XP_003540384.1| PREDICTED: uncharacterized LOC100500293 [Glycine max]
 gb|KHN27918.1| Fasciclin-like arabinogalactan protein 9 [Glycine soja]
Length=250

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 98/231 (42%), Positives = 136/231 (59%), Gaps = 34/231 (15%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            V++  IL+ G Q+   +K L     L  QI++Q+ +++ G ++ A  D+AF SL  G LN
Sbjct  36   VNLTAILEKGGQYTTLMKLLKDTQQL-TQIESQLKSNSQGFTLFAPTDNAFQSLKPGALN  94

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNG-QVNVTSG  544
            KLSD QKV+LI FH+ PK+Y++ DL T SNPV T A    G + LNFTG  G QVN+++G
Sbjct  95   KLSDDQKVKLILFHVTPKYYTISDLLTVSNPVRTQATEKEGTWGLNFTGQGGNQVNISTG  154

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEF--TSKARPTLGNKGRPNKTAAAAPKNSKE-  373
            VVQTQ++N +R+ FPLAVYQ+DKVLLPLE   T+K R +         +AA +PK SK  
Sbjct  155  VVQTQLNNPLREKFPLAVYQVDKVLLPLELFGTTKTRAS---------SAAPSPKGSKST  205

Query  372  ----------HSPADEPSPAANGEPNSAGRMSQFGLGLAPAAVVLFCMGVF  250
                       +P+D P      + N+A  M+  G GL    +   CMG  
Sbjct  206  PEIPSVGKAGSAPSDSPK-----DTNAANGMN-VGFGLV-LGLGFICMGAL  249



>gb|KDO49564.1| hypothetical protein CISIN_1g025959mg [Citrus sinensis]
Length=245

 Score =   155 bits (391),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 91/217 (42%), Positives = 134/217 (62%), Gaps = 9/217 (4%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            PV++  IL    QF  F+K L  +  +  QI +QI +S++G++V A  D+AF +L  G L
Sbjct  35   PVNLTGILDKNGQFTTFIKLL-ISTQVANQIQSQINSSSEGMTVFAPTDNAFNNLEKGLL  93

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGEFV--LNFTGSNGQVNVTSGV  541
            N L +Q++V+L+ +H+  KFY   DL   SNPV TLA G+ V  LNFTG   QVNV+SGV
Sbjct  94   NNLDNQKQVQLVLYHVTSKFYRQSDLLLVSNPVRTLASGQDVWGLNFTGQGNQVNVSSGV  153

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSPA  361
            V+T +++++R+NFPLAVYQ+DKVLLP E ++   P+        K    +   +K+   A
Sbjct  154  VETPINSVLRQNFPLAVYQVDKVLLPEELSAAKSPSAAPAPEGKKPTEGS---NKKVPAA  210

Query  360  DEPSPAANGEPNSAGRMSQFGLGLAPAAVVLFCMGVF  250
             EP+P A+ +  + GR++  GLG     + L CMGV 
Sbjct  211  SEPAP-ADDKTGAGGRLNA-GLGFV-VGLALLCMGVL  244



>ref|XP_002277788.1| PREDICTED: fasciclin-like arabinogalactan protein 13 [Vitis vinifera]
 emb|CBI21911.3| unnamed protein product [Vitis vinifera]
Length=251

 Score =   155 bits (391),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 95/219 (43%), Positives = 133/219 (61%), Gaps = 12/219 (5%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            +++  IL    QF  F++ L T   +G QI  Q+ +ST+G++V A  D+AF++L  GTLN
Sbjct  39   LNLTGILDKNGQFKTFIRLLATT-QIGDQIKNQLKSSTEGMTVFAPTDNAFSNLKPGTLN  97

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA----GGEFVLNFTGSNGQVNVTSG  544
             LSDQ++V+LI +H+L KFYSL+ L T SNPV T A    GG F LNFTG   QVNV++G
Sbjct  98   ALSDQEQVQLILYHVLSKFYSLETLLTVSNPVRTQATGQDGGIFGLNFTGEGNQVNVSTG  157

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSP  364
            +++TQV+N++R   PLAVYQ+DKVLLPLE      P       P   A A    +     
Sbjct  158  IIETQVNNVLRGESPLAVYQVDKVLLPLELFGAKPPA-----LPPPPAKAPSSATNATVI  212

Query  363  ADEPSPAANGEPNSAGRMSQ-FGLGLAPAAVVLFCMGVF  250
            A+EPS +A+ + + +G   +  G G A   + L CMG  
Sbjct  213  AEEPSASASEKSDPSGSGGRNVGYGFA-VGLGLMCMGAL  250



>ref|XP_006446719.1| hypothetical protein CICLE_v10016407mg [Citrus clementina]
 gb|ESR59959.1| hypothetical protein CICLE_v10016407mg [Citrus clementina]
Length=247

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 134/216 (62%), Gaps = 9/216 (4%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            V++  IL    QF  F+K L  +  +  QI +QI +S++G++V A  D+AF +L  G LN
Sbjct  38   VNLTGILDKNGQFTTFIKLL-ISTQVANQIQSQINSSSEGMTVFAPTDNAFNNLEKGLLN  96

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGEFV--LNFTGSNGQVNVTSGVV  538
             L +Q++V+L+ +H+  KFY   DL   SNPV TLA G+ V  LNFTG   QVNV+SGVV
Sbjct  97   NLDNQKQVQLVLYHVTSKFYRQSDLLLVSNPVRTLASGQDVWGLNFTGQGNQVNVSSGVV  156

Query  537  QTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSPAD  358
            +T +++++R+NFPLAVYQ+DKVLLP E ++   P+        K    +   +K+   A 
Sbjct  157  ETPINSVLRQNFPLAVYQVDKVLLPEELSAAKSPSAAPAPEGKKPTEGS---NKKVPAAS  213

Query  357  EPSPAANGEPNSAGRMSQFGLGLAPAAVVLFCMGVF  250
            EP+P A+ +  + GR++  GLG   A + L CMGV 
Sbjct  214  EPAP-ADDKTGAGGRLNA-GLGFV-AGLALLCMGVL  246



>emb|CAN83422.1| hypothetical protein VITISV_000403 [Vitis vinifera]
Length=251

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 95/221 (43%), Positives = 135/221 (61%), Gaps = 16/221 (7%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            +++  IL    QF  F++ L T   +G QI  Q+ +ST+G++V A  D+AF++L  GTLN
Sbjct  39   LNLTGILDKNGQFKTFIRLLATT-QIGDQIKNQLKSSTEGMTVFAPTDNAFSNLKPGTLN  97

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA----GGEFVLNFTGSNGQVNVTSG  544
             LSDQ++V+LI +H+L KFYSL+ L T SNPV T A    GG F LNFTG   QVNV++G
Sbjct  98   ALSDQEQVQLILYHVLSKFYSLETLLTVSNPVRTQATGQDGGIFGLNFTGEGNQVNVSTG  157

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSP  364
            +++TQV+N++R   PLAVYQ+DKVLLPLE         G K        A   +S  ++ 
Sbjct  158  IIETQVNNVLRGESPLAVYQVDKVLLPLEL-------FGAKPPALPPPPAKAPSSAXNAT  210

Query  363  --ADEPSPAANGEPNSAGRMSQ-FGLGLAPAAVVLFCMGVF  250
              A+EPS +A+ + + +G   +  G G A   + L CMG  
Sbjct  211  VIAEEPSASASEKSDPSGSGGRNVGYGXA-VGLGLMCMGAL  250



>ref|XP_004287337.1| PREDICTED: fasciclin-like arabinogalactan protein 6-like [Fragaria 
vesca subsp. vesca]
Length=246

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 94/224 (42%), Positives = 134/224 (60%), Gaps = 25/224 (11%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P++   IL    Q+  F++ L +   +  QI +Q+ ++T+G++V A  D+AFT+L +GTL
Sbjct  35   PLNFTGILDKAGQYTTFLRLL-SQTQVATQIQSQLNSTTEGLTVFAPTDNAFTNLKAGTL  93

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA-----GGEFVLNFTGSNG-QVNV  553
            N LS +Q+V+L+ +H+LPK+Y+L  L T SNPV T +     GG + LNFTGS G QVNV
Sbjct  94   NDLSSEQQVQLVLYHVLPKYYTLASLLTVSNPVRTQSSSQNGGGSYGLNFTGSGGNQVNV  153

Query  552  TSGVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPK---N  382
            +SG V TQ++N +R+ FPLAVYQIDKVLLP +  ++A P          TAA  P    N
Sbjct  154  SSGAVTTQINNALRQQFPLAVYQIDKVLLPNDMFAEASPA--------PTAAKTPAGSTN  205

Query  381  SKEHSPADEPSP--AANGEPNSAGRMSQFGLGLAPAAVVLFCMG  256
            + + + A EPS    +     + G      LGLA     LF MG
Sbjct  206  TTKGTVAAEPSTDGTSGSSKTTVGSFVGLALGLA-----LFFMG  244



>emb|CDY22308.1| BnaA06g36300D [Brassica napus]
Length=244

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 100/252 (40%), Positives = 148/252 (59%), Gaps = 20/252 (8%)
 Frame = -1

Query  999  LHLSV-PLILIFLLFPHQIHTQpattapppssstTWPVDIIDILKTGKQFNIFVKFLDTA  823
            +HL++ PL+++  +F   + T+       P+     P +I  IL+ G QF  F+  L+T 
Sbjct  4    IHLTLAPLLILAAVF---LSTEITAQPAAPAPGPAAPTNITAILEKGGQFATFIHLLNTT  60

Query  822  NHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNKLSDQQKVRLIQFHILPKFYSLD  643
              +G QI+ Q+ +S++G++V A  D+AF +L  GTLNKLS + +V+LI +H+ PKFY+LD
Sbjct  61   -RVGDQINIQVNSSSEGMTVFAPTDNAFQNLKPGTLNKLSYEDQVKLILYHVSPKFYTLD  119

Query  642  DLETASNPVETLAGGE----FVLNFTGSNGQVNVTSGVVQTQVSNIMRKNFPLAVYQIDK  475
            DL + SNPV T A G     + LNFT    QVNV++G V+T+VSN +RK  PLAVY +D 
Sbjct  120  DLLSVSNPVRTQASGRDGAVYGLNFTSQGNQVNVSTGFVETRVSNALRKERPLAVYVVDM  179

Query  474  VLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSPADEPSPAANGEPNSAGRMSQFGL  295
            VLLP E   +      NK  P   AA  PK++      D+    A  + + +G M + GL
Sbjct  180  VLLPEEMFGE------NKVSP---AAPGPKSNSPDVSDDQEKAGAPSDKSGSGEM-KAGL  229

Query  294  GLAPAAVVLFCM  259
            GLA   +V  C+
Sbjct  230  GLA-LGLVFLCL  240



>ref|NP_001238356.1| uncharacterized protein LOC100527846 precursor [Glycine max]
 gb|ACU17039.1| unknown [Glycine max]
Length=250

 Score =   152 bits (385),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 92/219 (42%), Positives = 131/219 (60%), Gaps = 14/219 (6%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            V++  IL+ G Q+   +K L     L  QI++Q+ +++ G ++ A  D+AF SL  G LN
Sbjct  34   VNLTAILEKGGQYTTLIKLLKDTQQL-TQIESQLKSNSQGFTLFAPTDNAFQSLKPGALN  92

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA---GGEFVLNFTGSNG-QVNVTSG  544
             LSD +KV+LI FH+ PK+Y++ DL T SNPV T A    G + LNFTG  G QVN+++G
Sbjct  93   DLSDDKKVKLILFHVTPKYYTISDLLTVSNPVRTQATEEEGAWGLNFTGQGGNQVNISTG  152

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSP  364
            VVQTQ++N +R+ FPLAVYQ+DKVLLPLE     + T  ++    K + + P+       
Sbjct  153  VVQTQLNNALREKFPLAVYQVDKVLLPLELFGTTKTTHSSEAPSPKGSKSTPEIPSVGKA  212

Query  363  ADEPSPAANGEPNSA--GRMSQFGL--GLAPAAVVLFCM  259
               PSP  + +  +A  GR   FGL  GLA     L C+
Sbjct  213  GGAPSPHGDKKDTNAANGRNVAFGLVVGLA-----LICI  246



>gb|KDP24065.1| hypothetical protein JCGZ_25722 [Jatropha curcas]
Length=249

 Score =   152 bits (385),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 95/220 (43%), Positives = 140/220 (64%), Gaps = 12/220 (5%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            V++  IL    QF  F++ L T+  +  QI+ QI +ST+G+++ A  D+AF +L +GTLN
Sbjct  35   VNLTGILAKYSQFTTFIRLL-TSTQVANQIENQINSSTEGMTLFAPTDNAFNNLKAGTLN  93

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE----FVLNFTGSNGQVNVTSG  544
             L+ QQ+++LI +H+LPKFY+L +L   SNPV TLA G+    F LNFTG + QVNV+SG
Sbjct  94   GLTQQQQLQLILYHVLPKFYTLSNLLLVSNPVRTLATGQDGSVFGLNFTGQSNQVNVSSG  153

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSP  364
            VV+TQ++N +R++FPLAVYQ+DKVLLP E       T      P  T+  +P  SK ++ 
Sbjct  154  VVETQINNALRQDFPLAVYQVDKVLLPEELFGDKTST----AAPAPTSKTSPGGSKNNTV  209

Query  363  ADEPSPAAN--GEPNSAGRMSQFGLGLAPAAVVLFCMGVF  250
               PS A +  G+ ++ G+ S+   G A   +  FCMG+ 
Sbjct  210  VGSPSLADDSPGDSSNDGKRSEVAFGFA-VGLGFFCMGIL  248



>gb|KHN36673.1| Fasciclin-like arabinogalactan protein 6 [Glycine soja]
Length=250

 Score =   152 bits (385),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 92/219 (42%), Positives = 131/219 (60%), Gaps = 14/219 (6%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            V++  IL+ G Q+   +K L     L  QI++Q+ +++ G ++ A  D+AF SL  G LN
Sbjct  34   VNLTAILEKGGQYTTLIKLLKDTQQL-TQIESQLKSNSQGFTLFAPTDNAFQSLKPGALN  92

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNG-QVNVTSG  544
             LSD +KV+LI FH+ PK+Y++ DL T SNPV T A    G + LNFTG  G QVN+++G
Sbjct  93   DLSDDKKVKLILFHVTPKYYTISDLLTVSNPVRTQATEEEGTWGLNFTGQGGNQVNISTG  152

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSP  364
            VVQTQ++N +R+ FPLAVYQ+DKVLLPLE     + T  ++    K + + P+       
Sbjct  153  VVQTQLNNALREKFPLAVYQVDKVLLPLELFGTTKTTHSSEAPSPKGSKSTPEIPSVGKA  212

Query  363  ADEPSPAANGEPNSA--GRMSQFGL--GLAPAAVVLFCM  259
               PSP  + +  +A  GR   FGL  GLA     L C+
Sbjct  213  GGAPSPHGDKKDTNAANGRNVAFGLVVGLA-----LICI  246



>ref|XP_009101735.1| PREDICTED: fasciclin-like arabinogalactan protein 13 [Brassica 
rapa]
Length=244

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/214 (43%), Positives = 129/214 (60%), Gaps = 16/214 (7%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNK  709
            +I  IL+ G QF  F+  L+T   +G QI+ Q+ +S++G++V A  D+AF +L  GTLNK
Sbjct  39   NITAILEKGGQFATFIHLLNTT-RVGDQINIQVNSSSEGMTVFAPTDNAFQNLKPGTLNK  97

Query  708  LSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE----FVLNFTGSNGQVNVTSGV  541
            LS   +V+LI +H+ PKFY+LDDL + SNPV T A G     + LNFT    QVNV++G 
Sbjct  98   LSYDDQVKLILYHVSPKFYTLDDLLSVSNPVRTQASGRDGAVYGLNFTSQGNQVNVSTGF  157

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSPA  361
            V+T+VSN +RK  PLAVY +D VLLP E   +      NK  P   AA  PK++      
Sbjct  158  VETRVSNALRKERPLAVYVVDMVLLPEEMFGE------NKVSP---AAPGPKSNSPDVSD  208

Query  360  DEPSPAANGEPNSAGRMSQFGLGLAPAAVVLFCM  259
            D+    A  + + +G M + GLGLA   +V  C+
Sbjct  209  DQEKAGAPSDKSGSGEM-KAGLGLA-LGLVFLCL  240



>ref|NP_565475.1| fasciclin-like arabinogalactan protein 6 [Arabidopsis thaliana]
 sp|Q9SIL7.2|FLA6_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 6; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAK20859.1|AF333972_1 fasciclin-like arabinogalactan-protein 6 [Arabidopsis thaliana]
 gb|AAD25652.2| putative surface protein [Arabidopsis thaliana]
 gb|AEC07022.1| fasciclin-like arabinogalactan protein 6 [Arabidopsis thaliana]
Length=247

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 98/221 (44%), Positives = 137/221 (62%), Gaps = 20/221 (9%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P+++  IL+ G QF   ++ L+T   +G Q+  Q+ +S  G+++ A  D+AF  L  GTL
Sbjct  36   PINLTAILEAGHQFTTLIQLLNT-TQVGFQVSVQLNSSDQGMTIFAPTDNAFNKLKPGTL  94

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA----GGEFVLNFTG--SNGQVNV  553
            N L+ QQ+++L+ +HI+PK+YSL DL  ASNPV T A    GG F LNFTG   + QVNV
Sbjct  95   NSLTYQQQIQLMLYHIIPKYYSLSDLLLASNPVRTQATGQDGGVFGLNFTGQAQSNQVNV  154

Query  552  TSGVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKE  373
            ++GVV+T+++N +R+ FPLAVY +D VLLP E         G K  P  T A APK+S  
Sbjct  155  STGVVETRINNALRQQFPLAVYVVDSVLLPEEL-------FGTKTTP--TGAPAPKSSTS  205

Query  372  HSPADEPSPAANGEPNSAG-RMSQFGLGLAPAAVVLFCMGV  253
             S AD  SPAA+ E  SAG  + +  LG+   +  LFC  V
Sbjct  206  SSDAD--SPAADDEHKSAGSSVKRTSLGIV-VSFALFCCSV  243



>ref|XP_008242761.1| PREDICTED: fasciclin-like arabinogalactan protein 13 [Prunus 
mume]
Length=249

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/191 (45%), Positives = 118/191 (62%), Gaps = 16/191 (8%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P++   IL    Q+  F++ L     +  QI  Q+ +ST+G++V A  D+AFTSL +GTL
Sbjct  36   PLNFTGILDKNGQYTTFIRLL-IQTQVASQITNQLNSSTEGLTVFAPTDNAFTSLKAGTL  94

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA----GGEFVLNFTGSNGQVNVTS  547
            N L  QQ+V ++ +H+LPK+Y+L  L T SNPV T A    GG + LNFTGS  QVNV+S
Sbjct  95   NNLRTQQQVAVVLYHVLPKYYTLTSLLTVSNPVRTQATGQDGGAYGLNFTGSGNQVNVSS  154

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF--------TSKARPTLGNKGRPNKT---A  400
            GVV+TQ++N +R+ FPLAVYQ+DKVLLP +               T  + G  N+T   A
Sbjct  155  GVVETQINNALRQQFPLAVYQVDKVLLPNDLFGAKAPASAPPPAKTHSSSGSSNETATKA  214

Query  399  AAAPKNSKEHS  367
            A++P NS   S
Sbjct  215  ASSPDNSDAGS  225



>emb|CDX94756.1| BnaC07g17650D [Brassica napus]
Length=244

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 92/214 (43%), Positives = 129/214 (60%), Gaps = 16/214 (7%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNK  709
            +I  IL+ G QF  F+  L+T   +G QI+ Q+ +S++G++V A  D+AF +L  GTLNK
Sbjct  39   NITAILEKGGQFATFIHLLNTT-RVGNQINIQVNSSSEGMTVFAPTDNAFQNLKPGTLNK  97

Query  708  LSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE----FVLNFTGSNGQVNVTSGV  541
            LS   +V+LI +H+ PKFY+LDDL + SNPV T A G     + LNFT    QVNV++G 
Sbjct  98   LSYDDQVKLILYHVSPKFYTLDDLLSVSNPVRTQASGRDGAVYGLNFTSQGNQVNVSTGF  157

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSPA  361
            V+T+VSN +RK  PLAVY +D VLLP E   +      NK  P   AA  PK++      
Sbjct  158  VETRVSNALRKERPLAVYVVDMVLLPEEMFGE------NKVSP---AAPGPKSNSPDVSD  208

Query  360  DEPSPAANGEPNSAGRMSQFGLGLAPAAVVLFCM  259
            D+    A  + + +G M + GLGLA   +V  C+
Sbjct  209  DQEKAGAPSDKSGSGEM-KAGLGLA-LGLVFVCL  240



>ref|XP_007043716.1| Fasciclin-like arabinogalactan protein 9 [Theobroma cacao]
 gb|EOX99547.1| Fasciclin-like arabinogalactan protein 9 [Theobroma cacao]
Length=208

 Score =   149 bits (376),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 92/222 (41%), Positives = 134/222 (60%), Gaps = 36/222 (16%)
 Frame = -1

Query  990  SVPLIL--IFLLFPHQIHTQpattapppssstTWPVDIIDILKTGKQFNIFVKFLDTANH  817
            S+PL L  +FLLF     T  A     P+++   P++   IL+   Q+  F++ L   + 
Sbjct  8    SIPLTLSALFLLF-----TSTALAQTAPAAAPPGPLNFTGILEKNGQYTYFLRLL-AKSQ  61

Query  816  LGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNKLSDQQKVRLIQFHILPKFYSLDDL  637
            +G QI  Q+ ++T+G +VLA  D+AF +L +GT+N L +Q+KV+L+ FH+LPK+YSL+DL
Sbjct  62   VGSQIQNQLNSTTEGFTVLAPTDNAFNNLKAGTINSLDEQKKVQLVLFHVLPKYYSLNDL  121

Query  636  ETASNPVETLA----GGEFVLNFTGSNGQVNVTSGVVQTQVSNIMRKNFPLAVYQIDKVL  469
            +  SNPV T A    GG + LNFTG N QVNV++GVV+TQ++N + +  PLA+YQ+DKVL
Sbjct  122  QFVSNPVRTQATGQDGGVYGLNFTGQNNQVNVSTGVVETQINNALTQQKPLAIYQVDKVL  181

Query  468  LPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSPADEPSPA  343
            LP EF                         +  SPA+ PSPA
Sbjct  182  LPAEFF------------------------EVKSPAEAPSPA  199



>ref|XP_007203478.1| hypothetical protein PRUPE_ppa022313mg [Prunus persica]
 gb|EMJ04677.1| hypothetical protein PRUPE_ppa022313mg [Prunus persica]
Length=249

 Score =   150 bits (378),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 83/190 (44%), Positives = 121/190 (64%), Gaps = 15/190 (8%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P++   IL    Q+  F++ L     +  QI  Q+ +S++G++V A  D+AFTSL +GTL
Sbjct  36   PLNFTGILDKNGQYTTFIRLL-IQTQVASQITNQLNSSSEGLTVFAPTDNAFTSLKAGTL  94

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA----GGEFVLNFTGSNGQVNVTS  547
            N L+ QQ+V L+ +H+LPK+Y++  L T SNPV T A    GG + LNFTGS  QVNV+S
Sbjct  95   NTLTTQQQVALVLYHVLPKYYTITSLLTVSNPVRTQATGQDGGAYGLNFTGSGNQVNVSS  154

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF-------TSKARPTLGNKGRPNKTA---A  397
            GVV+TQ++N +R+ FPLAVYQ+DKVLLP +        ++       + G  N+TA   A
Sbjct  155  GVVETQINNALRQQFPLAVYQVDKVLLPNDLFGAKAPASAPPPAKTPSSGSSNETATKTA  214

Query  396  AAPKNSKEHS  367
            ++P NS+  S
Sbjct  215  SSPDNSEAGS  224



>ref|XP_006408977.1| hypothetical protein EUTSA_v10002226mg [Eutrema salsugineum]
 gb|ESQ50430.1| hypothetical protein EUTSA_v10002226mg [Eutrema salsugineum]
Length=248

 Score =   149 bits (377),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 95/225 (42%), Positives = 136/225 (60%), Gaps = 24/225 (11%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            PV++  +L++G QF  F++ L+T   +G Q+  Q+ +S  G++V A  D+AF +L  GTL
Sbjct  36   PVNLTAVLESGHQFTTFIRLLNTT-QVGFQVSVQLNSSDQGMTVFAPTDNAFNNLKPGTL  94

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA----GGEFVLNFTGSN--GQVNV  553
            N L+ Q++++LI +HI+PK+Y L DL  ASNPV T A    GG F LNFTG     +VN+
Sbjct  95   NSLTYQRQIQLILYHIIPKYYPLSDLLLASNPVRTQATGQEGGVFGLNFTGQGQINEVNI  154

Query  552  TSGVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPK---N  382
            ++GVV+T+++NI+R+ FPL+VY +DKVLLP E         G K     T A APK   +
Sbjct  155  STGVVETRITNILRQKFPLSVYVVDKVLLPEEL-------FGTKTT-TPTGAPAPKTLPS  206

Query  381  SKEHSPA-DEPSPAANGEPNSAGRMSQFGLGLAPAAVVLFCMGVF  250
            S   SPA DE    + G  +S  R S+ G+ L  A    FC  V 
Sbjct  207  SDADSPAIDEDDHKSAG--SSVKRTSRLGIVLGCA---WFCCSVM  246



>ref|XP_002884207.1| hypothetical protein ARALYDRAFT_480881 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60466.1| hypothetical protein ARALYDRAFT_480881 [Arabidopsis lyrata subsp. 
lyrata]
Length=247

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 96/221 (43%), Positives = 136/221 (62%), Gaps = 20/221 (9%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P+++  IL+TG QF   ++ L+T   +G Q+  Q+ +S  G+++ A  D+AF +L  GTL
Sbjct  36   PINLTAILETGHQFTTLIRLLNTT-QVGFQVSVQLNSSDQGMTIFAPTDNAFNNLKPGTL  94

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA----GGEFVLNFTG--SNGQVNV  553
            N L+ QQ+++L+ +HI+PK+YSL DL  ASNP+ T A    GG F LNFTG   + QVNV
Sbjct  95   NSLTYQQQIQLMLYHIIPKYYSLSDLLLASNPIRTQATGYEGGVFGLNFTGQAQSNQVNV  154

Query  552  TSGVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKE  373
            ++GVV+T+++N +R+ FPLAVY +D VLLP E         G K  P  T A APK++  
Sbjct  155  STGVVETRINNALRQQFPLAVYVVDSVLLPEEL-------FGTKTTP--TGAPAPKSTTS  205

Query  372  HSPADEPSPAANGEPNSAG-RMSQFGLGLAPAAVVLFCMGV  253
             S AD  SPA + E  SAG  M +  L +      LFC  V
Sbjct  206  SSDAD--SPAGDDEHKSAGSSMKKTSLRIV-LGFALFCCSV  243



>ref|XP_006299820.1| hypothetical protein CARUB_v10016021mg [Capsella rubella]
 gb|EOA32718.1| hypothetical protein CARUB_v10016021mg [Capsella rubella]
Length=246

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 91/221 (41%), Positives = 136/221 (62%), Gaps = 26/221 (12%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            +++  IL++G QF  F++ L+T   +G Q+  Q+ +S  G+++ A  D+AF +L  GTLN
Sbjct  38   INLTAILESGHQFTTFIRLLNTT-QVGFQVSVQLNSSDQGMTIFAPTDNAFNNLKPGTLN  96

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA----GGEFVLNFTG--SNGQVNVT  550
             L+ QQ+++L+ +HI+PK+YSL DL  ASNP+ T A    GG + LNFTG   N QVNV+
Sbjct  97   GLTYQQQIQLMLYHIIPKYYSLSDLLLASNPIRTQATGHEGGVYGLNFTGQAQNNQVNVS  156

Query  549  SGVVQTQVSNIMRKNFPLAVYQIDKVLLPLE-FTSKARPTLGNKGRPNKTAAAAPKNSKE  373
            +GVV+T+++N +R+ FPLAVY +DKVLLP E F +K  PT            A    S  
Sbjct  157  TGVVETRINNALRQQFPLAVYVVDKVLLPEELFGTKTTPT-----------GAPSPKSTP  205

Query  372  HSPADEPSPAANGEPN----SAGRMSQFGLGLAPAAVVLFC  262
             S +D  SPA + + +    S+ +M+  G+ L  A   LFC
Sbjct  206  SSTSDADSPAVDDDEHKSSGSSAKMTSLGVILGFA---LFC  243



>gb|AFK41457.1| unknown [Medicago truncatula]
Length=249

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 92/219 (42%), Positives = 130/219 (59%), Gaps = 10/219 (5%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P++I  I +   Q+N  ++ L+    L +       TS +G ++ A  D+AF +LPSG +
Sbjct  36   PINITTIFEKAGQYNFLIRLLNETQQLTQIQTQLNSTS-EGFTIFAPTDNAFQNLPSGAI  94

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE---FVLNFTGSNGQVNVTSG  544
            N LSDQQKV+LI +H+ PK+YSL D  T SNPV T A G+   + L+FT    QVNV++G
Sbjct  95   NDLSDQQKVQLILYHVTPKYYSLSDFLTVSNPVRTQASGKEGNWGLHFTSQGNQVNVSTG  154

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSP  364
            VV   ++N +R+ FPLAVYQ+DKVLLP E      P+     + +KT +  P +S     
Sbjct  155  VVTVPINNALRQQFPLAVYQLDKVLLPFELFGAKSPSSSPAPKSSKTPSKTPSSSDVE--  212

Query  363  ADEPSPAANGEPNS-AGRMSQFGLGLAPAAVVLFCMGVF  250
             D PSPA++ + +S AGR   FG     A + L CMGVF
Sbjct  213  GDAPSPASSKKDDSAAGRNVGFGF---VAGLGLICMGVF  248



>ref|XP_009113940.1| PREDICTED: fasciclin-like arabinogalactan protein 13 [Brassica 
rapa]
Length=249

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 87/215 (40%), Positives = 130/215 (60%), Gaps = 12/215 (6%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            ++I  IL+ G QF  F++ L+T   +G QI+ Q+ +S++G++V A  D+AF +L  GTLN
Sbjct  38   INITAILEKGGQFVTFIRLLNTT-QIGNQINIQVNSSSEGMTVFAPTDNAFQNLKPGTLN  96

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE-----FVLNFTGSNGQVNVTS  547
            KLS   +V+LI +H+ PKFY++DDL + SNPV T A G      + LNFTG   QVNV++
Sbjct  97   KLSPDDQVKLILYHVSPKFYTMDDLLSVSNPVRTQATGRDGGAVYGLNFTGQGNQVNVST  156

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHS  367
            G+++T+VSN +RK  PLAVY +D VLLP E   K + +       +K+ A +  +     
Sbjct  157  GIIETRVSNALRKERPLAVYVVDMVLLPEEMFGKHKISPVAPSPKSKSPAVSDDSDDSSK  216

Query  366  PADEPSPAANGEPNSAGRMSQFGLGLAPAAVVLFC  262
             A  PS     E + +G M + GLG     V+L+ 
Sbjct  217  KAAVPS-----EKSGSGEM-KVGLGFGLGLVMLYL  245



>ref|XP_002517840.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44358.1| conserved hypothetical protein [Ricinus communis]
Length=246

 Score =   147 bits (372),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 91/218 (42%), Positives = 132/218 (61%), Gaps = 12/218 (6%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P+++  IL    QF  F++ L T+  +  Q++ Q+ ++T+G +V A  D+AF +L +GTL
Sbjct  35   PLNVTGILDKNGQFTTFIRLL-TSTQVATQLENQLNSTTEGFTVFAPTDNAFNNLKAGTL  93

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA----GGEFVLNFTGSNGQVNVTS  547
            N LS QQ+V+L+  HI PKFY+L +L    NPV T A    GG F LNFTG   QVNV++
Sbjct  94   NDLSTQQQVQLVLAHITPKFYTLSNLLLVPNPVRTQATGQDGGVFGLNFTGQANQVNVST  153

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHS  367
            G+V+TQ++N +R+ FPLA+YQ+DKVLLP E     +P   +   P KT++    +SK  +
Sbjct  154  GIVETQINNAIRQQFPLALYQVDKVLLPEELFG-VKPPTASPAPPAKTSSGG--SSKNDT  210

Query  366  PADEPSPAANGEPNSAGRMSQFGLGLAPAAVVLFCMGV  253
             A EPS     +  S G  +   LG     + L CMGV
Sbjct  211  VASEPSSD---KGTSGGVRTNVALGFV-IGLGLACMGV  244



>ref|XP_009368837.1| PREDICTED: fasciclin-like arabinogalactan protein 13 [Pyrus x 
bretschneideri]
Length=247

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 106/151 (70%), Gaps = 5/151 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P+++  +L    Q++ F++ L  +  +  QI  Q+ +ST+G++V A  D+AF +L +GTL
Sbjct  37   PLNLTGLLDKNGQYSTFIRLL-ISTQVANQITNQLNSSTEGLTVFAPTDNAFDNLKAGTL  95

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA----GGEFVLNFTGSNGQVNVTS  547
            N L  QQ+V L+ +H+LPK+Y+L  L T SNPV T A    GG + LNFTGS  QVNV++
Sbjct  96   NNLDTQQQVSLVLYHVLPKYYTLASLLTVSNPVRTQATGQDGGAYGLNFTGSGNQVNVST  155

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            G+V+TQ++N +R+ FPLAVYQ+DKVLLP + 
Sbjct  156  GIVETQINNALRQQFPLAVYQVDKVLLPSDL  186



>emb|CDY18192.1| BnaC05g02150D [Brassica napus]
Length=250

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/218 (39%), Positives = 131/218 (60%), Gaps = 16/218 (7%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            +++  IL+ G QF  F+  L     +G+Q++TQ+ +S++G++V A  D+AF +L +GTLN
Sbjct  38   INLTAILEKGGQFTTFIHLLKIT-QVGEQVNTQVNSSSEGMTVFAPTDNAFQNLKAGTLN  96

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE----FVLNFTGSNGQVNVTSG  544
            KLS  ++V+LI +H+ PKFY+LDDL + SNPV T A G     + LNFTG   QVNV++G
Sbjct  97   KLSADEQVKLILYHVSPKFYTLDDLLSVSNPVRTQASGRDNGVYGLNFTGEANQVNVSTG  156

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSP  364
             V+T+VSN +R   PLAVY +D VLLP E   + + +       + T   +  ++K +S 
Sbjct  157  YVETRVSNALRTQRPLAVYVVDMVLLPGEMFGEHKLSPIAPAPKSPTTGVSDDDTKSNST  216

Query  363  ADEPSPA---ANGEPNSAGRMSQFGLGLAPAAVVLFCM  259
                +PA   A+GE     R +  G G     +V+ C+
Sbjct  217  KKAAAPADKSASGE-----RRAGLGFGF---GLVVLCL  246



>ref|XP_010482678.1| PREDICTED: fasciclin-like arabinogalactan protein 9 [Camelina 
sativa]
Length=247

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/217 (39%), Positives = 128/217 (59%), Gaps = 17/217 (8%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            +++  IL+ G QF+ F+  L+    +G Q++ Q+ +S++G++V A  D+AF +L  GTLN
Sbjct  38   INLTAILEKGGQFSTFIHLLNIT-QIGSQVNIQLNSSSEGMTVFAPTDNAFQNLKPGTLN  96

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE----FVLNFTGSNGQVNVTSG  544
            KLS  ++V+LI +H+ PKFYS+DDL + SNPV T A G     + LN TG   Q+NV++G
Sbjct  97   KLSSDEQVKLILYHVSPKFYSMDDLLSVSNPVRTQASGRDNGVYGLNITGQTNQINVSTG  156

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSP  364
             V+T++SN +R+  PLAVY +D VLLP E   + + +           A APK S     
Sbjct  157  YVETRISNALRQQRPLAVYVVDMVLLPGEMFGEHKLS---------PIAPAPKKSPSSEV  207

Query  363  ADEPSPAANGEPN--SAGRMSQFGLGLAPAAVVLFCM  259
            +D+ +  A   P+  S     + GLG     VVL CM
Sbjct  208  SDDTTKKAAASPSEKSGSGEKKVGLGFGLGLVVL-CM  243



>ref|XP_006381469.1| fasciclin-like AGP 13 family protein [Populus trichocarpa]
 gb|ERP59266.1| fasciclin-like AGP 13 family protein [Populus trichocarpa]
Length=227

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 112/184 (61%), Gaps = 6/184 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P +I  IL+   QF   ++ + +      QI+TQ+  S  G++V A PD+AFT+L +GTL
Sbjct  34   PTNITAILEKAGQFTTLIRLMKSTQE-ADQINTQLNNSNQGLTVFAPPDNAFTNLKAGTL  92

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N LSDQQKV+L+QFHI+P F+S+   +T SNP+ T AG    GEF LN T S  QVN+T+
Sbjct  93   NSLSDQQKVQLVQFHIIPNFFSMSSFQTVSNPLRTQAGNSADGEFPLNVTTSGNQVNITT  152

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTA-AAAPKNSKEH  370
            GV    V+N +  +  L VYQ+D+VLLPL+    A        +P+K   A AP  SKE 
Sbjct  153  GVNTATVANTIFTDGQLVVYQVDQVLLPLDLFGTAAAPAPAPSKPDKDVPAKAPAGSKED  212

Query  369  SPAD  358
            +  D
Sbjct  213  ASVD  216



>ref|XP_007149797.1| hypothetical protein PHAVU_005G099500g [Phaseolus vulgaris]
 gb|ESW21791.1| hypothetical protein PHAVU_005G099500g [Phaseolus vulgaris]
Length=247

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 91/217 (42%), Positives = 131/217 (60%), Gaps = 9/217 (4%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            VD++ IL+ G Q+   ++ L+ +  L  QI +Q+ +++ G ++ A  D+AF +L SG LN
Sbjct  36   VDLVAILQKGGQYTTLIRLLNDSQQL-IQIQSQLKSNSQGFTLFAPTDNAFQNLKSGALN  94

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTSGV  541
             LSD+QKV+LI +H+ PK+YSL DL T SNPV T A    G + LNFTG   QVNV+SGV
Sbjct  95   HLSDEQKVQLILYHVTPKYYSLADLLTVSNPVRTQASGSDGSWGLNFTGQGNQVNVSSGV  154

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSPA  361
            V+TQV+N +R+ FPLAVYQ+DKVLLP E   +  P         K+  ++P+ +      
Sbjct  155  VETQVNNALRQQFPLAVYQVDKVLLPEELFGEKSPAA----PSPKSPKSSPETTTVGKAG  210

Query  360  DEPSPAANGEPNSAGRMSQFGLGLAPAAVVLFCMGVF  250
              PSP+  G+ ++       G G+    V L CMG  
Sbjct  211  GAPSPSGEGQKDNGAAERNMGFGVI-LGVGLICMGAL  246



>ref|XP_010540894.1| PREDICTED: fasciclin-like arabinogalactan protein 6 [Tarenaya 
hassleriana]
Length=260

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 89/227 (39%), Positives = 134/227 (59%), Gaps = 21/227 (9%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            +++  IL+ G +++ F+  L+ A  +  Q+  Q+ +S  GV+V A  ++ FT+L  GTLN
Sbjct  41   INLTAILEKGSEYSTFIHLLN-ATQVSVQVSIQLNSSNQGVTVFAPTNNGFTNLKPGTLN  99

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA----GGEFVLNFTGSNGQVNVTSG  544
             LS+QQ+++L+ +HI+PK+YS+ DL + SNPV TLA     G+F LNFTG + QVN+++G
Sbjct  100  GLSNQQQIQLMLYHIIPKYYSMSDLISVSNPVRTLATGQDSGDFRLNFTGQSNQVNISTG  159

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLE-FTSKARPTLGNKGRPNKTAAAAPKNSKEH-  370
            VV   V+N +R++FPLAVY +++VLLP + F S    T      P  TA A  K+  +H 
Sbjct  160  VVLAHVNNALRQHFPLAVYMMEQVLLPQDMFGSPPPETKAPSASP--TAPAPEKSPSDHA  217

Query  369  -SPADEPSPAANGEPN------SAGRMSQFGLGLAPAAVVLFCMGVF  250
             SP  +  PAA+ EP                LGLA      FC G+ 
Sbjct  218  DSPDSDEPPAASEEPESGSGGRGTTTGFGLVLGLA-----WFCFGLL  259



>emb|CDY13122.1| BnaA09g16950D [Brassica napus]
Length=250

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 89/223 (40%), Positives = 129/223 (58%), Gaps = 27/223 (12%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            ++I  IL+ G QF  F++ L+T   +G QI+ Q+ +S++G++V A  D+AF +L  G LN
Sbjct  38   INITAILEKGGQFVTFIRLLNTT-QIGNQINIQVNSSSEGMTVFAPTDNAFQNLKPGALN  96

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE-----FVLNFTGSNGQVNVTS  547
            KLS   +V+LI +H+ PKFY++DDL + SNPV T A G      + LNFTG   QVNV++
Sbjct  97   KLSPDDQVKLILYHVSPKFYTMDDLLSVSNPVRTQATGRDGGAVYGLNFTGQGNQVNVST  156

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHS  367
            G+++T+VSN +RK  PLAVY +D VLLP E   K           +K +  AP + K  S
Sbjct  157  GIIETRVSNALRKERPLAVYVVDMVLLPEEMFGK-----------HKISPVAP-SPKSKS  204

Query  366  PA--------DEPSPAANGEPNSAGRMSQFGLGLAPAAVVLFC  262
            PA             A   E + +G M + GLG     V+L+ 
Sbjct  205  PAVSDDSSDDSSKKAAVPSEKSGSGEM-KVGLGFGLGLVMLYL  246



>ref|XP_010093970.1| hypothetical protein L484_010536 [Morus notabilis]
 gb|EXB54957.1| hypothetical protein L484_010536 [Morus notabilis]
Length=243

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 86/215 (40%), Positives = 130/215 (60%), Gaps = 8/215 (4%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            PV++  IL  G Q+   ++ L +   +  QI+ Q+ +S +G++V A  D+AF +L +GTL
Sbjct  36   PVNLTAILVKGGQYTTLLRLL-SETQVDNQIENQLNSSKEGMTVFAPTDNAFNNLKAGTL  94

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGEFVLNFTGSNGQVNVTSGVVQ  535
            N LS + +V+LI +H+LPK+YSL++L+T SNPV T +  +  LNFTG   QVNV++G+V+
Sbjct  95   NGLSREDQVQLILYHVLPKYYSLENLQTVSNPVRTQSSNDG-LNFTGQGHQVNVSTGIVE  153

Query  534  TQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSPADE  355
            TQV+N +R+ FPLAVYQ+D VLLP        P        +  A +A   +K  + A  
Sbjct  154  TQVNNALREEFPLAVYQVDAVLLPEGLFGAKAPASAPPPAKSTPADSASDKAKTKAAA--  211

Query  354  PSPAANGEPNSAGRMSQFGLGLAPAAVVLFCMGVF  250
              P+A      + + +  GLGL  A +VL CM V 
Sbjct  212  --PSAKDSTGDSNKRN-VGLGLV-AGLVLVCMEVL  242



>gb|KEH39201.1| fasciclin-like arabinogalactan protein [Medicago truncatula]
Length=249

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 91/219 (42%), Positives = 129/219 (59%), Gaps = 10/219 (5%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P++I  I +   Q+N  ++ L+    L +       TS +G ++ A  D+AF +LPSG +
Sbjct  36   PINITTIFEKAGQYNFLIRLLNETQQLTQIQTQLNSTS-EGFTIFAPTDNAFQNLPSGAI  94

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE---FVLNFTGSNGQVNVTSG  544
            N LSDQQKV+LI +H+ PK+YSL D  T SNPV T A G+   + L+FT    QVNV++G
Sbjct  95   NDLSDQQKVQLILYHVTPKYYSLSDFLTVSNPVRTQASGKEGNWGLHFTSQGNQVNVSTG  154

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSP  364
            VV   ++N +R+ FPLAVYQ+DKVLLP E      P+     + +KT +  P +S     
Sbjct  155  VVTVPINNALRQQFPLAVYQLDKVLLPSELFGAKSPSSSPAPKSSKTPSKTPSSSDVE--  212

Query  363  ADEPSPAANGEPNS-AGRMSQFGLGLAPAAVVLFCMGVF  250
             D PSPA++ + +S AGR   FG     A + L CMGV 
Sbjct  213  GDAPSPASSKKDDSAAGRNVGFGF---VAGLGLICMGVL  248



>ref|XP_008367860.1| PREDICTED: LOW QUALITY PROTEIN: fasciclin-like arabinogalactan 
protein 9, partial [Malus domestica]
Length=244

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 105/151 (70%), Gaps = 5/151 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P++   +L    Q++ F++ L  +  +  QI  Q+ +ST+G++V A  D+AF +L +GTL
Sbjct  34   PLNFTGLLDKNGQYSTFIRLL-ISTQVANQITNQLNSSTEGLTVFAPTDNAFDNLKAGTL  92

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA----GGEFVLNFTGSNGQVNVTS  547
            N L  QQ+V L+ +H+LPK+Y+L  L T SNPV T A    GG + LNFTGS  QVNV++
Sbjct  93   NSLDTQQQVALVLYHVLPKYYTLASLLTVSNPVRTQATGQDGGTYGLNFTGSGNQVNVST  152

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            G+V+TQ++N +R+ FPLAVYQ+DKVLLP + 
Sbjct  153  GIVETQINNALRQQFPLAVYQVDKVLLPYDL  183



>ref|XP_009119354.1| PREDICTED: fasciclin-like arabinogalactan protein 9 [Brassica 
rapa]
 emb|CDX89859.1| BnaA10g02230D [Brassica napus]
Length=250

 Score =   145 bits (365),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 85/215 (40%), Positives = 128/215 (60%), Gaps = 10/215 (5%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            +++  IL+ G QF  F+  L     +G+Q++ Q+ +S++G++V A  D+AF +L +GTLN
Sbjct  38   INLTAILEKGGQFTTFIHLLKI-TQVGEQVNIQVNSSSEGMTVFAPTDNAFQNLKAGTLN  96

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE----FVLNFTGSNGQVNVTSG  544
            KLS  ++V+LI +H+ PKFY+LDDL + SNPV T A G     + LNFTG   QVNV++G
Sbjct  97   KLSADEQVKLILYHVSPKFYTLDDLLSVSNPVRTQASGRDNGVYGLNFTGEANQVNVSTG  156

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSP  364
             V+T+VSN +R   PLAVY +D VLLP E   + + +       + T   +  ++K +S 
Sbjct  157  YVETRVSNALRSQRPLAVYVVDMVLLPGEMFGEHKLSPIAPAPKSPTTGVSDDDTKSNSS  216

Query  363  ADEPSPAANGEPNSAGRMSQFGLGLAPAAVVLFCM  259
                +PA      SA    + GLG     VVL C+
Sbjct  217  KKAAAPA----DKSASGERRVGLGFGFGLVVL-CL  246



>ref|XP_011048566.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Populus 
euphratica]
Length=239

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 112/185 (61%), Gaps = 6/185 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P +I  IL+   QF   ++ + +   +  QI+TQ+  S  G++V A PD+AFT+L +G L
Sbjct  34   PTNITAILEKAGQFTTLIRLMKST-QVADQINTQLNNSNQGLTVFAPPDNAFTNLKAGAL  92

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N LSDQQKV+L+QFHI+P F S+ + +T SNP+ T AG    GEF LN T S  QVN+T+
Sbjct  93   NSLSDQQKVQLVQFHIIPNFLSMSNFQTVSNPLRTQAGNSADGEFPLNVTTSGNQVNITT  152

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTA-AAAPKNSKEH  370
            GV    V+N +  +  L VYQ+D+VLLPL+    A        +P+K   A AP  SKE 
Sbjct  153  GVNTATVANTIFTDGQLVVYQVDQVLLPLDLFGTAAAPAPAPSKPDKDVPAKAPAGSKED  212

Query  369  SPADE  355
            +  D 
Sbjct  213  ASVDS  217



>gb|KFK42730.1| hypothetical protein AALP_AA1G032300 [Arabis alpina]
Length=247

 Score =   144 bits (364),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 86/218 (39%), Positives = 127/218 (58%), Gaps = 19/218 (9%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            +++  IL+ G QF  F+  L+    +G Q++ Q+ +S++G++V A  D+AF +L  GTLN
Sbjct  38   INLTAILEKGGQFTTFIHLLNIT-QVGAQVNIQVNSSSEGMTVFAPTDNAFQNLKPGTLN  96

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE----FVLNFTGSNGQVNVTSG  544
            KLS  ++V+LI +H+ PKFYS+DDL + SNPV T A G     + LNFTG+  QVNV++G
Sbjct  97   KLSSDEQVKLILYHVSPKFYSMDDLLSVSNPVRTQASGRDNGIYGLNFTGTANQVNVSTG  156

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSP  364
             V+T+VSN +R   PLAVY +D VLLP E   +      +K  P   A  +P +      
Sbjct  157  YVETRVSNALRDKRPLAVYVVDMVLLPGEMFGE------HKLSPVAPAPKSPASGVSDDD  210

Query  363  ADEPSPAANGEPNSAGRMS---QFGLGLAPAAVVLFCM  259
                  AA  + + +G M     FGLGL     V+ C+
Sbjct  211  KSTKKAAAPSDKSGSGEMKVGLGFGLGL-----VVMCL  243



>gb|ABK78690.1| unknown [Brassica rapa]
Length=250

 Score =   144 bits (363),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 85/215 (40%), Positives = 128/215 (60%), Gaps = 10/215 (5%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            +++  IL+ G QFN F+  L     +G+Q++ Q+ +S++G++V A  D+AF +L +GTLN
Sbjct  38   INLTAILEKGGQFNTFIHLLKII-QVGEQVNIQVNSSSEGMTVFAPTDNAFQNLKAGTLN  96

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE----FVLNFTGSNGQVNVTSG  544
            KLS  ++V+LI +H+ PK Y+LDDL + SNPV T A G     + LNFTG   QVNV++G
Sbjct  97   KLSADEQVKLILYHVSPKLYTLDDLLSVSNPVRTQASGRDNGVYGLNFTGEANQVNVSTG  156

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSP  364
             V+T+VSN +R   PLAVY +D VLLP E   + + +       + T   +  ++K +S 
Sbjct  157  YVETRVSNALRSQRPLAVYVVDMVLLPGEMFGEHKLSPIAPAPKSPTTGVSDDDTKSNSS  216

Query  363  ADEPSPAANGEPNSAGRMSQFGLGLAPAAVVLFCM  259
                +PA      SA    + GLG     VVL C+
Sbjct  217  KKAAAPA----DKSASGERRVGLGFGFGLVVL-CL  246



>ref|XP_010475017.1| PREDICTED: fasciclin-like arabinogalactan protein 9 [Camelina 
sativa]
Length=248

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/218 (40%), Positives = 129/218 (59%), Gaps = 18/218 (8%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            +++  IL+ G QF+ F+  L+    +G Q++ QI +S++G++V A  D+AF +L  GTLN
Sbjct  38   INLTAILEKGGQFSTFIHLLNIT-QIGSQVNIQINSSSEGMTVFAPTDNAFQNLKPGTLN  96

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE----FVLNFTGSNGQVNVTSG  544
            KLS  ++V+LI +H+ PKFYS+DDL + SNPV T A G     + LN TG   Q+NV++G
Sbjct  97   KLSSDEQVKLILYHVSPKFYSMDDLLSVSNPVRTQASGRDNGVYGLNITGQTNQINVSTG  156

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSP  364
             V+T++SN +R+  PLAVY +D VLLP E   +      +K  P    A APK S     
Sbjct  157  YVETRISNALRQQRPLAVYVVDMVLLPGEMFGE------HKLSP---IAPAPKKSTSSEV  207

Query  363  ADEPS---PAANGEPNSAGRMSQFGLGLAPAAVVLFCM  259
            +D+ +    AA+    S     + GLG     VVL C+
Sbjct  208  SDDTTTKKAAASPSEKSGSGEKKVGLGFGLGLVVL-CL  244



>ref|XP_002519547.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42961.1| conserved hypothetical protein [Ricinus communis]
Length=241

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 111/191 (58%), Gaps = 7/191 (4%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P +I  IL+   QF  F+K + +      QI+TQ+  S  G++V A PD+AF +L +GTL
Sbjct  35   PTNITAILEKAGQFTTFIKLMMSTQE-ASQINTQLNNSNQGLTVFAPPDNAFANLKAGTL  93

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N L+DQ+KV+L+QFHILP F S+   +T SNP+ T AG    GEF LN T S  QVNVT+
Sbjct  94   NSLTDQEKVQLMQFHILPTFISMSQFQTVSNPLRTQAGNSANGEFPLNVTTSGNQVNVTT  153

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKT--AAAAPKNSKE  373
            GV    V+N +  +  LAVYQ+DKVLLPL+  S           P K     A    + +
Sbjct  154  GVDTATVANTIYTDGSLAVYQVDKVLLPLDLFSSPAAPAPAPSEPKKVIQGKAPAATTAD  213

Query  372  HSPADEPSPAA  340
             +PAD  S  A
Sbjct  214  VTPADSSSATA  224



>gb|AAT37956.1| fasciclin-like AGP 13 [Populus tremula x Populus alba]
Length=239

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 110/184 (60%), Gaps = 6/184 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P +I  IL+   QF   ++ + +      QI+TQ+  S  G++V A PD+AF +L +G L
Sbjct  34   PTNITAILEKAGQFTTLIRLMKSTQE-ADQINTQLNNSNQGLTVFAPPDNAFANLKAGAL  92

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N LSDQQKV+L+QFHI+P F S+   +T SNP+ T AG    GEF LN T S  QVN+T+
Sbjct  93   NSLSDQQKVQLVQFHIIPNFLSMSSFQTVSNPLRTQAGNSADGEFPLNVTTSGNQVNITT  152

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTA-AAAPKNSKEH  370
            GV    V+N +  +  L VYQ+D+VLLPL+    A        +P+K   A AP  SKE 
Sbjct  153  GVNTATVANTIFTDGQLVVYQVDQVLLPLDLFGTAAAPAPAPSKPDKDVPAKAPAGSKED  212

Query  369  SPAD  358
            + AD
Sbjct  213  ASAD  216



>ref|XP_010245565.1| PREDICTED: fasciclin-like arabinogalactan protein 13 [Nelumbo 
nucifera]
Length=253

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 93/221 (42%), Positives = 134/221 (61%), Gaps = 18/221 (8%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            +++  IL  G Q+  F++ L +   +  QI+ Q+ +ST G++V A  D+AF++L +GTLN
Sbjct  39   INLTAILDKGGQYTTFIRLLGSTQVI-NQIENQLNSSTQGLTVFAPTDNAFSNLKAGTLN  97

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA---GGEFVLNFTGSNGQVNVTSGV  541
             LS Q +  LI +H+LP++ S+   +T SNPV T A   GG   LNFT S  QVNV++G+
Sbjct  98   GLSAQDQSELILYHVLPQYQSMVSFQTISNPVRTQAGSEGGSLGLNFTSSGNQVNVSTGL  157

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLE-FTSKARPTLGNKGRPNKTAAAAPKNSKEHSP  364
            V TQV+N +R++ PLAVYQIDKVLLP E F  K++ +     +P+KT + A  N  + SP
Sbjct  158  VNTQVNNALRQDPPLAVYQIDKVLLPPELFGVKSKAS---APQPSKTPSDASSN--KTSP  212

Query  363  ADEPSPAANGEPNSAGRMS-----QFGLGLAPAAVVLFCMG  256
            A   S A    P+SA   S       GLGL    + L C+G
Sbjct  213  ATVASSAKG--PSSADESSGSNGLTVGLGLV-VGIGLMCLG  250



>ref|XP_010457404.1| PREDICTED: fasciclin-like arabinogalactan protein 9 [Camelina 
sativa]
Length=248

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/218 (39%), Positives = 128/218 (59%), Gaps = 18/218 (8%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            +++  IL+ G QF+ F+  L+    +G Q++ Q+ +S++G++V A  D+AF +L  GTLN
Sbjct  38   INLTAILEKGGQFSTFIHLLNIT-QIGSQVNIQLNSSSEGMTVFAPTDNAFQNLKPGTLN  96

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE----FVLNFTGSNGQVNVTSG  544
            KLS  ++V+LI +H+ PKFYS+DDL + SNPV T A G     + LN TG   Q+NV++G
Sbjct  97   KLSSDEQVKLILYHVSPKFYSMDDLLSVSNPVRTQASGRDNGVYGLNITGQTNQINVSTG  156

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSP  364
             V+T++SN +R+  PLAVY +D VLLP E   + + +           A APK S     
Sbjct  157  YVETRISNALRQQRPLAVYVVDMVLLPGEMFGEHKLS---------PIAPAPKKSTSSEV  207

Query  363  ADEPS---PAANGEPNSAGRMSQFGLGLAPAAVVLFCM  259
            +D+ +    AA+    S     + GLG     VVL C+
Sbjct  208  SDDTTTKKAAASPSEKSGSGEKKVGLGFGLGLVVL-CL  244



>ref|XP_006403136.1| hypothetical protein EUTSA_v10003262mg [Eutrema salsugineum]
 gb|ESQ44589.1| hypothetical protein EUTSA_v10003262mg [Eutrema salsugineum]
Length=254

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 121/199 (61%), Gaps = 10/199 (5%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            +++  IL+ G QF  F + L+T   +G QI+ Q+ +S++G++V A  D+AF +L  GTLN
Sbjct  42   INVTAILEKGGQFVTFTRLLNTT-QIGNQINIQVNSSSEGMTVFAPTDNAFQNLKPGTLN  100

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE-----FVLNFTGSNGQVNVTS  547
            KLS   +V+LI +H+ PKFY+LDDL + SNPV T A G      + LNFTG   QVNV++
Sbjct  101  KLSPDDQVKLILYHVSPKFYTLDDLLSVSNPVRTQASGRDAGAIYGLNFTGQGNQVNVST  160

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHS  367
            GV++T+VSN + K  PLAVY +D VLLP E   + + +    G  +K+   +  +  E S
Sbjct  161  GVIETRVSNALSKERPLAVYVVDMVLLPEEMFGERKISPVAPGPKSKSPGVSDDSEDESS  220

Query  366  PADEPSPAANGEPNSAGRM  310
                   AA  E + +G M
Sbjct  221  ----KKAAAPSEKSGSGEM  235



>ref|NP_199226.1| fasciclin-like arabinogalactan protein 13 [Arabidopsis thaliana]
 sp|Q9FFH6.1|FLA13_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 13; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAB10980.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL25613.1| AT5g44130/MLN1_5 [Arabidopsis thaliana]
 gb|AAM19981.1| AT5g44130/MLN1_5 [Arabidopsis thaliana]
 gb|AAN60268.1| unknown [Arabidopsis thaliana]
 gb|AED95065.1| fasciclin-like arabinogalactan protein 13 [Arabidopsis thaliana]
Length=247

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 119/192 (62%), Gaps = 18/192 (9%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            ++I  IL+ G QF   ++ L+T   +G QI+ QI +S++G++VLA  D+AF +L  GTLN
Sbjct  35   INITAILEKGGQFVTLIRLLNTT-QIGNQINIQINSSSEGMTVLAPTDNAFQNLKPGTLN  93

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA-----GGEFVLNFTGSNGQVNVTS  547
            KLS   +V+LI +H+ PKFY+L+DL + SNPV T A     GG + LNFTG   QVNV++
Sbjct  94   KLSPDDQVKLILYHVSPKFYTLEDLLSVSNPVRTQASGRDVGGVYGLNFTGQGNQVNVST  153

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKAR------------PTLGNKGRPNKT  403
            GVV+T++S  +R+  PLAVY +D VLLP E   + +            P + +    +K 
Sbjct  154  GVVETRLSTSLRQERPLAVYVVDMVLLPEEMFGERKISPMAPPPKSKSPDVSDDSESSKK  213

Query  402  AAAAPKNSKEHS  367
            AAA  ++ K  S
Sbjct  214  AAAPSESEKSGS  225



>ref|XP_004493964.1| PREDICTED: fasciclin-like arabinogalactan protein 11-like [Cicer 
arietinum]
Length=253

 Score =   142 bits (358),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 113/187 (60%), Gaps = 12/187 (6%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P +I  IL+   QF  F+K L  A  +  +ID+Q+  S  G+++ A  D+AF+SL SGTL
Sbjct  38   PTNITKILEKAGQFTTFMKLLK-ATQVSDRIDSQLNNSNQGLTIFAPTDNAFSSLKSGTL  96

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N +S Q +++L+QFHILP  Y++   +TASNP+ T AG    GE+ LN T S  QVNVT+
Sbjct  97   NSISTQNQLQLLQFHILPTLYTISQFQTASNPLHTQAGNSDDGEYPLNVTTSGNQVNVTT  156

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAP-KNSKEH  370
            GV+ T VSN +  +  LAVYQ+DKVLLP+       PT         T A AP K+ K  
Sbjct  157  GVIDTTVSNTIYSDNQLAVYQVDKVLLPMALFGSVAPTAA------PTEAPAPSKSEKRV  210

Query  369  SPADEPS  349
              +D P+
Sbjct  211  RSSDAPA  217



>ref|XP_006281682.1| hypothetical protein CARUB_v10027821mg [Capsella rubella]
 gb|EOA14580.1| hypothetical protein CARUB_v10027821mg [Capsella rubella]
Length=254

 Score =   142 bits (358),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 81/193 (42%), Positives = 118/193 (61%), Gaps = 19/193 (10%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            ++I  IL+ G QF  F++ L+T   +G QI+ QI +S++G++VLA  D+AF +L  GTLN
Sbjct  41   INITAILEKGGQFVTFIRLLNTT-QIGSQINIQINSSSEGMTVLAPTDNAFQNLKPGTLN  99

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA-----GGEFVLNFTGSNGQVNVTS  547
            KLS   +V+LI +H+ PK+Y+L+DL + SNPV T A     GG + LNFTG   QVNV++
Sbjct  100  KLSPDDQVKLILYHVSPKYYTLEDLLSVSNPVRTQASGRDVGGVYGLNFTGQGNQVNVST  159

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKAR-------------PTLGNKGRPNK  406
            G+V+T++S  +R+  PLAVY +D VLLP E   + +             P + +    N 
Sbjct  160  GIVETRLSTSLRQQRPLAVYVVDMVLLPEEMFGERKISPVAPPPKKSKSPDVSDDLDTNS  219

Query  405  TAAAAPKNSKEHS  367
            T  AAP   K  S
Sbjct  220  TKKAAPPTEKSGS  232



>ref|XP_008798339.1| PREDICTED: fasciclin-like arabinogalactan protein 9 [Phoenix 
dactylifera]
Length=246

 Score =   142 bits (357),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 123/208 (59%), Gaps = 15/208 (7%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            V++  +L+ G Q+NIF++ L  A  + +QI++Q+  S +G++V A  D+AF SL SGTLN
Sbjct  39   VNLTAVLEKGGQYNIFIRLLR-ATQVEQQINSQLNNSFNGLTVFAPTDNAFNSLQSGTLN  97

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE---FVLNFTGSNGQVNVTSGV  541
             LS Q++V L+ +H+LP++YSL   +T SNPV T A G    + LN T +  Q N+++GV
Sbjct  98   SLSQQEQVALVLYHVLPRYYSLSMFQTTSNPVRTQASGSNGVYTLNVTSTTSQANISTGV  157

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSPA  361
            V   V+N ++ +FPLAVY ++KVLLP +         G K      A A  K  K   P+
Sbjct  158  VDAPVTNTLKSDFPLAVYSVEKVLLPYDL-------FGAKPPAPALAPAKDKPGKADGPS  210

Query  360  DE----PSPAANGEPNSAGRMSQFGLGL  289
             E    PS A + +   AGR    GLGL
Sbjct  211  AEAESNPSAAVSLKRRGAGRSFVVGLGL  238



>gb|AFK39439.1| unknown [Medicago truncatula]
Length=249

 Score =   142 bits (357),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 90/219 (41%), Positives = 128/219 (58%), Gaps = 10/219 (5%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P++I  I +   Q+N  ++ L+    L +       TS +G ++ A  D+AF +LPS  +
Sbjct  36   PINITTIFEKAGQYNFLIRLLNETQQLTQIQTQLNSTS-EGFTIFAPTDNAFQNLPSEAI  94

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE---FVLNFTGSNGQVNVTSG  544
            N LSDQQKV+LI +H+ PK+YSL D  T SNPV T A G+   + L+FT    QVNV++G
Sbjct  95   NDLSDQQKVQLILYHVTPKYYSLSDFLTVSNPVRTQASGKEGNWGLHFTSQGNQVNVSTG  154

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSP  364
            VV   ++N +R+ FPLAVYQ+DKVLLP E      P+     + +KT +  P +S     
Sbjct  155  VVTVPINNALRQQFPLAVYQLDKVLLPSELFGAKSPSSSPAPKSSKTPSKTPSSSDVER-  213

Query  363  ADEPSPAANGEPNS-AGRMSQFGLGLAPAAVVLFCMGVF  250
             D PSPA++ + +S AGR   FG     A + L CMGV 
Sbjct  214  -DAPSPASSKKDDSAAGRNVGFGFV---AGLGLICMGVL  248



>gb|KDP29103.1| hypothetical protein JCGZ_16492 [Jatropha curcas]
Length=241

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 89/220 (40%), Positives = 124/220 (56%), Gaps = 14/220 (6%)
 Frame = -1

Query  981  LILIFLLFPHQIHTQpattapppssstTWPVDIIDILKTGKQFNIFVKFLDTANHLGKQI  802
            L LIF+L+    + Q  + AP        P +I  IL+   QF  F+K + +      QI
Sbjct  11   LFLIFILYSSASYAQNPSPAPS------GPTNITAILEKAGQFTTFIKLMKSTQE-ADQI  63

Query  801  DTQIITSTDGVSVLAAPDSAFTSLPSGTLNKLSDQQKVRLIQFHILPKFYSLDDLETASN  622
            +TQ+  S  G++V A PD+AF +L  GTLN L+DQ KV+L+QFHILP F ++   +T SN
Sbjct  64   NTQLNNSNQGLTVFAPPDNAFANLKPGTLNSLTDQGKVQLVQFHILPSFIAMSQFQTVSN  123

Query  621  PVETLAG----GEFVLNFTGSNGQVNVTSGVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            P+ T AG    GEF LN T S  QVNVT+GV    V+N +  +  LAVYQ+D+VLLPL+ 
Sbjct  124  PLRTQAGNSANGEFPLNVTTSGNQVNVTTGVDTATVANTIYTDGSLAVYQVDQVLLPLDL  183

Query  453  TSKARPTLGNKGRPNK-TAAAAPKNSK--EHSPADEPSPA  343
                        +P++ T   +P   K  + SPAD  + A
Sbjct  184  FGAPAAPAPAPSKPDEDTPVKSPAAGKTSDDSPADSSAAA  223



>ref|XP_006304423.1| hypothetical protein CARUB_v10011002mg [Capsella rubella]
 gb|EOA37321.1| hypothetical protein CARUB_v10011002mg [Capsella rubella]
Length=248

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/218 (39%), Positives = 128/218 (59%), Gaps = 18/218 (8%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            +++  IL+ G QF  F+  L+    +G Q++ Q+ +S++G++V A  D+AF +L  GTLN
Sbjct  38   INLTAILEKGGQFTTFIHLLNIT-QIGSQVNIQLNSSSEGMTVFAPTDNAFQNLKPGTLN  96

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE----FVLNFTGSNGQVNVTSG  544
            KLS  ++V+LI +H+ PK+YS+DDL + SNPV T A G     + LN TG   Q+NV++G
Sbjct  97   KLSSDEQVKLILYHVSPKYYSMDDLLSVSNPVRTQASGRDNGVYGLNITGQTNQINVSTG  156

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSP  364
             V+T++SN +R+  PLAVY +D VLLP E   + + +           A APK S     
Sbjct  157  YVETRISNALRQQRPLAVYVVDMVLLPGEMFGEHKLS---------PIAPAPKKSPSSGV  207

Query  363  ADEPS---PAANGEPNSAGRMSQFGLGLAPAAVVLFCM  259
            +D+ S    AA+    S+    + GLG     VVL C+
Sbjct  208  SDDESTKKAAASPSDKSSSGEKKTGLGFGLGLVVL-CL  244



>gb|KFK31663.1| hypothetical protein AALP_AA6G142700 [Arabis alpina]
Length=250

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 86/229 (38%), Positives = 126/229 (55%), Gaps = 35/229 (15%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            ++I  IL+ G QF   ++ L+T   +G QI+ QI +ST+G+++ A  D+AF +L  GTLN
Sbjct  35   INITAILEKGGQFVTLIRLLNTT-QIGSQINIQINSSTEGMTIFAPTDNAFQNLKPGTLN  93

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE-----FVLNFTGSNGQVNVTS  547
            KLS   +V+LI +H+ PKFY+LDDL + SNPV T A G      + LNFTG   QVNV++
Sbjct  94   KLSSDDQVKLILYHVSPKFYTLDDLLSVSNPVRTQASGRDRGTVYGLNFTGQGNQVNVST  153

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKAR-------------PTLGNKGRPNK  406
            G+++T+VS  +R   PLAVY +D VLLP E   + +             P + +     +
Sbjct  154  GMIETRVSTALRPERPLAVYVVDMVLLPEEMFGERKIVPVPAPSPQAKSPDVSDDVDSTR  213

Query  405  TAAAAPKNSKEHSPADEPSPAANGEPNSAGRMSQFGLGLAPAAVVLFCM  259
             AAA  + + E S + E                 FGLGL     V+ C+
Sbjct  214  KAAAPTRPTSERSGSGEMKVGLG-----------FGLGL-----VMLCL  246



>ref|XP_010494416.1| PREDICTED: fasciclin-like arabinogalactan protein 13 [Camelina 
sativa]
Length=251

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 109/159 (69%), Gaps = 8/159 (5%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            ++I  IL+ G QF  F++ L+T   +G QI+ Q+ +S++G++VLA  D+AF +L  GTLN
Sbjct  40   INITAILEKGGQFVTFIRLLNTT-QIGSQINIQLNSSSEGMTVLAPTDNAFQNLKPGTLN  98

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA-----GGEFVLNFTGSNGQVNVTS  547
            KLS   +V+LI +H+ PKFY+L+DL + SNPV T A     GG + LNFTG   QVNV++
Sbjct  99   KLSPDDQVKLILYHVSPKFYTLEDLLSVSNPVRTQASGRDVGGVYGLNFTGQGNQVNVST  158

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF--TSKARP  436
            G+V+T++S  +R+  PLAVY +D VLLP E     KA P
Sbjct  159  GIVETRLSTSLRQERPLAVYVVDMVLLPEEMFGERKASP  197



>ref|XP_002865383.1| hypothetical protein ARALYDRAFT_494579 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41642.1| hypothetical protein ARALYDRAFT_494579 [Arabidopsis lyrata subsp. 
lyrata]
Length=247

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 106/151 (70%), Gaps = 6/151 (4%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            ++I  IL+ G QF   ++ L+T   +G QI+ QI +S++G++VLA  D+AF +L  GTLN
Sbjct  35   INITAILEKGGQFVTLIRLLNTT-QIGNQINIQINSSSEGMTVLAPTDNAFQNLKPGTLN  93

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETL-----AGGEFVLNFTGSNGQVNVTS  547
            KLS + +V+LI +H+ PKFY+L+DL + SNPV T      AGG + LNFTG   QVNV++
Sbjct  94   KLSPEDQVKLILYHVSPKFYTLEDLLSVSNPVSTQASGRDAGGVYGLNFTGQGNQVNVST  153

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            G+V+T++S  +R+  PLAVY +D VLLP E 
Sbjct  154  GIVETRLSTSLRQERPLAVYVVDMVLLPEEM  184



>ref|XP_004241271.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Solanum 
lycopersicum]
Length=249

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 113/192 (59%), Gaps = 13/192 (7%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P +I  IL+   QF  F++ L T    G QI+TQ+  S  G++V A  D+AF+SL +GTL
Sbjct  36   PTNITKILEKAGQFTTFIRLLGT-TQAGDQINTQLNNSKQGMTVFAPTDNAFSSLKAGTL  94

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N LS Q++V+L+QFH+LP F S+   +T SNP+ T AG    G+F LN T S  QVNV++
Sbjct  95   NSLSSQEQVQLVQFHVLPSFISVSQFQTVSNPLRTQAGDTSPGDFPLNVTTSGNQVNVST  154

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKT--------AAAA  391
            G+V   V N +  +  LAVYQ+DKVL PL   +   P    +    +T        AA +
Sbjct  155  GIVDATVGNTIYTDGELAVYQVDKVLQPLSIFASPSPATAPEPATTETSNLKKKSPAALS  214

Query  390  PKNSKEHSPADE  355
            P +  + +PAD+
Sbjct  215  PSSGSDDTPADK  226



>gb|EPS63113.1| hypothetical protein M569_11675, partial [Genlisea aurea]
Length=167

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 97/150 (65%), Gaps = 4/150 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            PV++  IL+   QF + ++ L T   +G QIDTQ+  S  G+++ A  D AF +L  GTL
Sbjct  6    PVNVTAILEKAGQFGVLIRLLQTT-KVGDQIDTQLGNSNQGLTIFAPSDGAFANLKPGTL  64

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTSG  544
            N  +DQQKV LIQFH+LP ++S    +TAS+P+ T AG   G F LN T +  QVN+T+G
Sbjct  65   NSFTDQQKVELIQFHVLPSYFSASQFQTASDPLRTQAGGSQGSFPLNVTATGNQVNITTG  124

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            V    V+N +  +  LAVYQ+D+VLLPL F
Sbjct  125  VTNATVANTIYDDGNLAVYQVDQVLLPLSF  154



>ref|XP_006418194.1| hypothetical protein EUTSA_v10008582mg [Eutrema salsugineum]
 gb|ESQ36547.1| hypothetical protein EUTSA_v10008582mg [Eutrema salsugineum]
Length=248

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 123/215 (57%), Gaps = 12/215 (6%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            +++  IL+ G QF  F+  L+    +G Q++ Q+ +S++G++V A  D+AF +L  GTLN
Sbjct  38   INLTAILEKGGQFTTFIHLLNIT-QVGSQVNIQVNSSSEGMTVFAPTDNAFQNLKPGTLN  96

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE----FVLNFTGSNGQVNVTSG  544
            KLS  ++V+LI +H+ PKFYSLDDL + SNPV T A G     + LNFTG   QVNV++G
Sbjct  97   KLSADEQVKLILYHVSPKFYSLDDLLSVSNPVRTQASGRDNGVYGLNFTGQANQVNVSTG  156

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSP  364
             V+T+VSN +R+  PLAVY +D VLLP E   +      +K  P   A  +P +      
Sbjct  157  YVETRVSNPLRQQRPLAVYVVDMVLLPGEMFGE------HKLSPVAPAPKSPSSGVSDDS  210

Query  363  ADEPSPAANGEPNSAGRMSQFGLGLAPAAVVLFCM  259
                  AA+    S     + GLG     +V  C+
Sbjct  211  NSTKKAAASPADKSGSCERKVGLGFV-LGLVFLCL  244



>ref|XP_002323464.1| fasciclin-like AGP 13 family protein [Populus trichocarpa]
 gb|ABK92660.1| unknown [Populus trichocarpa]
 gb|EEF05225.1| fasciclin-like AGP 13 family protein [Populus trichocarpa]
Length=239

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 108/185 (58%), Gaps = 6/185 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P +I  IL    QF   ++ L +      QI+TQ+  S  G++V A  D++F +L +GTL
Sbjct  34   PTNITAILAKAGQFTTLIRLLKSTQE-ADQINTQLNNSNQGLTVFAPTDNSFANLKAGTL  92

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N LSDQQKV+L+QFHILP F S+ + +T SNP+ T AG    GEF LN T S  QVN+T+
Sbjct  93   NSLSDQQKVQLVQFHILPNFLSMSNFQTVSNPLRTQAGNSADGEFPLNVTTSGNQVNITT  152

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTA-AAAPKNSKEH  370
            GV    V+N +  +  L VYQ+D+VLLPL+    A        +P K   A AP  SKE 
Sbjct  153  GVNTATVANTIYTDGQLVVYQVDQVLLPLDLFGTAPAPAPAPSKPEKDVPAKAPAGSKED  212

Query  369  SPADE  355
            +  D 
Sbjct  213  ASVDS  217



>ref|XP_006480613.1| PREDICTED: fasciclin-like arabinogalactan protein 11-like [Citrus 
sinensis]
 gb|KDO44237.1| hypothetical protein CISIN_1g026047mg [Citrus sinensis]
Length=244

 Score =   139 bits (350),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 113/187 (60%), Gaps = 12/187 (6%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P +I  IL+ G QF  F++ L+       QI+TQ+  S  G++V A  D+AF +L SGT+
Sbjct  34   PPNITAILEKGGQFTSFIRLLENTQQ-DDQINTQLNNSNQGLTVFAPTDNAFANLKSGTI  92

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N LSDQQKV+L+QFHILP   S    +TASNP+ T AG    GEF LN T S  QVN+T+
Sbjct  93   NSLSDQQKVQLVQFHILPTSMSTSQFQTASNPLRTQAGNSNDGEFPLNVTTSGNQVNLTT  152

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLE-FTSKA---RPTLGNKGRPNKTAAAAPKNS  379
            GV +  V+N +     LAVYQ+D+VLLPL+ F S+A    P+   K  P    AA PK S
Sbjct  153  GVNEATVANTVFSGSNLAVYQVDQVLLPLDLFGSQAPAPAPSTPEKDVP---VAATPKGS  209

Query  378  KEHSPAD  358
               +  D
Sbjct  210  STDASVD  216



>ref|XP_006428804.1| hypothetical protein CICLE_v10012588mg [Citrus clementina]
 gb|ESR42044.1| hypothetical protein CICLE_v10012588mg [Citrus clementina]
Length=244

 Score =   139 bits (350),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 113/187 (60%), Gaps = 12/187 (6%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P +I  IL+ G QF  F++ L+       QI+TQ+  S  G++V A  D+AF +L SGT+
Sbjct  34   PPNITAILEKGGQFTSFIRLLENTQQ-DDQINTQLNNSNQGLTVFAPTDNAFANLKSGTI  92

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N LSDQQKV+L+QFHILP   S    +TASNP+ T AG    GEF LN T S  QVN+T+
Sbjct  93   NSLSDQQKVQLVQFHILPTSMSTSQFQTASNPLRTQAGNSNDGEFPLNVTTSGNQVNLTT  152

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLE-FTSKA---RPTLGNKGRPNKTAAAAPKNS  379
            GV +  V+N +     LAVYQ+D+VLLPL+ F S+A    P+   K  P    AA PK S
Sbjct  153  GVNEATVANTVFSGSNLAVYQVDQVLLPLDLFGSQAPAPAPSTPEKDVP---VAATPKGS  209

Query  378  KEHSPAD  358
               +  D
Sbjct  210  STDASVD  216



>ref|XP_010919222.1| PREDICTED: fasciclin-like arabinogalactan protein 9 [Elaeis guineensis]
Length=253

 Score =   139 bits (350),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 103/150 (69%), Gaps = 4/150 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P+++  +L+ G Q+   ++ L T   + +Q+++Q+  S +G++V A  D+AF SL +GTL
Sbjct  33   PLNLTAVLEKGGQYTTLIRLLRTT-QVEQQVNSQLNNSFNGLTVFAPTDNAFNSLKAGTL  91

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTSG  544
            N LS Q++V L+ FH+LP+FYSL   ET SNPV+T A    G + +N T +  QVN+++G
Sbjct  92   NGLSQQEQVALVLFHVLPRFYSLSSFETTSNPVQTQASSNNGVYTVNITSTTSQVNISTG  151

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            VV T V+N +R +FPLAVY IDKVLLP + 
Sbjct  152  VVSTPVTNTLRSDFPLAVYSIDKVLLPYDL  181



>emb|CAN60933.1| hypothetical protein VITISV_022591 [Vitis vinifera]
Length=214

 Score =   138 bits (347),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 100/150 (67%), Gaps = 5/150 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P +I  IL+   Q+ I ++ +     +  QI+TQ+  S  G++V A  D+AF++L +GTL
Sbjct  18   PTNITQILEKAGQYTILIRLMK-GTQVADQINTQLXNSNQGLTVFAPTDNAFSTLKAGTL  76

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N L+DQQKV+LIQFH++P F S+   +T SNP+ T AG    GEF LN T S  QVNV++
Sbjct  77   NSLTDQQKVQLIQFHVVPNFLSISQFQTVSNPLRTQAGNSNNGEFPLNVTTSGNQVNVST  136

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLE  457
            G+V   V+N +  +  LAVYQ+DKVLLPL+
Sbjct  137  GIVDATVANTVYTDNQLAVYQVDKVLLPLD  166



>ref|XP_004487189.1| PREDICTED: fasciclin-like arabinogalactan protein 13-like [Cicer 
arietinum]
Length=279

 Score =   140 bits (352),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 81/218 (37%), Positives = 118/218 (54%), Gaps = 12/218 (6%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P++I  IL+   Q+   ++ L     L +       TS DG ++ A  D+AF +L SG +
Sbjct  70   PINITSILEKAGQYTYLIRLLKETQQLIQIQSQLNSTS-DGFTIFAPTDNAFQNLKSGAI  128

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTSG  544
            N L+D+QKV+LI +H+ PK+YSL DL T SNPV T A    G + LNFT    QVN++SG
Sbjct  129  NDLTDEQKVKLILYHVTPKYYSLSDLLTVSNPVRTQASDSEGSWGLNFTSQGNQVNISSG  188

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSP  364
            VV T ++N +R+ FPLA+YQ+DKVLLPL+         G K   +  +  A +       
Sbjct  189  VVTTSINNALRQQFPLAIYQLDKVLLPLQL-------FGTKSPSSSPSPKASETRNTTVK  241

Query  363  ADEPSPAANGEPNSAGRMSQFGLGLAPAAVVLFCMGVF  250
             D PSP+ +   ++       G G     + + CM V 
Sbjct  242  GDAPSPSKSSLKDNGVAGKNVGFGFV-VGLCVICMRVL  278



>ref|XP_002892185.1| hypothetical protein ARALYDRAFT_470362 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68444.1| hypothetical protein ARALYDRAFT_470362 [Arabidopsis lyrata subsp. 
lyrata]
Length=247

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 85/218 (39%), Positives = 128/218 (59%), Gaps = 19/218 (9%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            +++  IL+ G QF  F+  L+    +G Q++ Q+ +S++G++V A  D+AF +L  GTLN
Sbjct  38   INLTAILEKGGQFTTFIHLLNIT-QVGSQVNIQVNSSSEGMTVFAPTDNAFQNLKPGTLN  96

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE----FVLNFTGSNGQVNVTSG  544
            +L+  ++V+LI +H+ PKFYS+DDL + SNPV T A G     + LNFTG   Q+NV++G
Sbjct  97   QLTPDEQVKLILYHVSPKFYSMDDLLSVSNPVRTQASGRDNGVYGLNFTGQTNQINVSTG  156

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSP  364
             V+T+VSN +R+  PLAVY +D VLLP E   + + +           A APK SK    
Sbjct  157  YVETRVSNALRQQRPLAVYVVDMVLLPGEMFGEHKLS---------PIAPAPK-SKSGGV  206

Query  363  ADEPS---PAANGEPNSAGRMSQFGLGLAPAAVVLFCM  259
            +D+      AA+    S     + GLG     VVL C+
Sbjct  207  SDDSGSTKKAASPSDKSGSGEKKVGLGFGLGLVVL-CL  243



>ref|XP_010684113.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Beta vulgaris 
subsp. vulgaris]
Length=247

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 100/149 (67%), Gaps = 5/149 (3%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNK  709
            ++  IL    QF +F++ L +      QI+ Q+  S  G+++ A PD++F++L SG LN 
Sbjct  39   NVTAILSKAGQFTMFIRLLQSTQE-ADQINNQLNNSNSGLTIFAPPDNSFSNLKSGLLNS  97

Query  708  LSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTSGV  541
            LSDQQKV+L+QFH+LP + S  + +TASNP+ T AG    GE+ LN T S  QVN+T+GV
Sbjct  98   LSDQQKVQLVQFHVLPNYISQSEFQTASNPLRTQAGNSNDGEYPLNITTSGNQVNITTGV  157

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            V T VSN +  +  LAVYQ+D+VLLPL F
Sbjct  158  VNTTVSNSLYSDGQLAVYQVDQVLLPLAF  186



>ref|XP_002285068.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Vitis vinifera]
Length=244

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 100/151 (66%), Gaps = 5/151 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P +I  IL+   Q+ I ++ +     +  QI+TQ+  S  G++V A  D+AF++L +GTL
Sbjct  34   PTNITQILEKAGQYTILIRLMK-GTQVADQINTQLNNSNQGLTVFAPTDNAFSTLKAGTL  92

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N L+DQQKV+LIQFH++P F S+   +T SNP+ T AG    GEF LN T S  QVNV++
Sbjct  93   NSLTDQQKVQLIQFHVVPNFLSISQFQTVSNPLRTQAGNSNNGEFPLNVTTSGNQVNVST  152

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            G+V   V+N +  +  LAVYQ+DKVLLPL+ 
Sbjct  153  GIVDATVANTVYTDNQLAVYQVDKVLLPLDI  183



>ref|XP_011015335.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Populus 
euphratica]
Length=238

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 110/185 (59%), Gaps = 10/185 (5%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P +I  IL    QF   ++ L +      QI+TQ+  S  G++V A  D++F +L +GTL
Sbjct  35   PTNITAILAKAGQFTTLIRLLKSTQE-ADQINTQLNNSNQGLTVFAPTDNSFANLKAGTL  93

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N LSDQQKV+L+QFHILP F S+ + +T SNP+ T AG    GEF LN T S  QVN+T+
Sbjct  94   NSLSDQQKVQLVQFHILPNFLSMSNFQTVSNPLRTQAGNSADGEFPLNVTTSGNQVNITT  153

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLE-FTSKARPTLGNKGRPNKTA-AAAPKNSKE  373
            GV    V+N +  +  L VYQ+D+VLLPL+ F +   P      +P K   A AP  SKE
Sbjct  154  GVDTATVANTIYTDGQLVVYQVDQVLLPLDLFGTAPAPA---PSKPEKDVPAKAPAGSKE  210

Query  372  HSPAD  358
             +  D
Sbjct  211  DASVD  215



>gb|AAT37954.1| fasciclin-like AGP 11 [Populus tremula x Populus alba]
Length=238

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 110/185 (59%), Gaps = 10/185 (5%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P +I  IL    QF   ++ L +      QI+TQ+  S  G++V A  D++F +L +GTL
Sbjct  35   PTNITAILAKAGQFTTLIRLLKSTQE-ADQINTQLNNSNQGLTVFAPTDNSFANLKAGTL  93

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N LSDQQKV+L+QFHILP F S+ + +T SNP+ T AG    GEF LN T S  QVN+T+
Sbjct  94   NSLSDQQKVQLVQFHILPNFLSMSNFQTVSNPLRTQAGNSADGEFPLNVTTSGNQVNITT  153

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLE-FTSKARPTLGNKGRPNKTA-AAAPKNSKE  373
            GV    V+N +  +  L VYQ+D+VLLPL+ F +   P      +P K   A AP  SKE
Sbjct  154  GVDTATVANTIYTDGQLVVYQVDQVLLPLDLFGTAPAPA---PSKPEKDVPAKAPAGSKE  210

Query  372  HSPAD  358
             +  D
Sbjct  211  DASVD  215



>gb|AAN60339.1| unknown [Arabidopsis thaliana]
Length=247

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 83/218 (38%), Positives = 126/218 (58%), Gaps = 17/218 (8%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P+++  IL+ G QF  F+  L+    +G Q++ Q+ +S++G++V A  D+AF +L  GTL
Sbjct  37   PINLTAILEKGGQFTTFIHLLNIT-QVGSQVNIQVNSSSEGMTVFAPTDNAFQNLKPGTL  95

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE----FVLNFTGSNGQVNVTS  547
            N+LS   +V+LI +H+ PK+YS+DDL + SNPV T A G     + LNFTG   Q+NV++
Sbjct  96   NQLSPDDQVKLILYHVSPKYYSMDDLLSVSNPVRTQASGRDNGVYGLNFTGQTNQINVST  155

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHS  367
            G V+T++SN +R+  PLAVY +D VLLP E   + + +           A APK+     
Sbjct  156  GYVETRISNSLRQQRPLAVYVVDMVLLPGEMFGEHKLS---------PIAPAPKSKSGGV  206

Query  366  PADEPS--PAANGEPNSAGRMSQFGLGLAPAAVVLFCM  259
              D  S   AA+    S     + GLG     +VL C+
Sbjct  207  TDDSGSTKKAASPSDKSGSGEKKVGLGFGLGLIVL-CL  243



>ref|XP_010441925.1| PREDICTED: fasciclin-like arabinogalactan protein 13 [Camelina 
sativa]
Length=251

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 111/174 (64%), Gaps = 15/174 (9%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            ++I  IL+ G QF  F++ L+T   +G QI+ Q+ +S++G++VLA  D+AF +L  GTLN
Sbjct  40   INITAILEKGGQFVTFIRLLNTT-QIGSQINIQLNSSSEGMTVLAPTDNAFQNLKPGTLN  98

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA-----GGEFVLNFTGSNGQVNVTS  547
            KLS   +V+LI +H+ PK+Y+L+DL + SNPV T A     GG + LNFTG   QV V++
Sbjct  99   KLSPDDQVKLILYHVSPKYYTLEDLLSVSNPVRTQASGRDVGGVYGLNFTGQGNQVKVST  158

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPK  385
            GVV+T++S  +R+  PLAVY +D VLLP E   +         R     A APK
Sbjct  159  GVVETRLSTSLRQERPLAVYVVDMVLLPEEMFGE---------RKTSPVAPAPK  203



>ref|XP_010424800.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Camelina 
sativa]
Length=243

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 105/159 (66%), Gaps = 7/159 (4%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQI-ITSTDGVSVLAAPDSAFTSLPSGT  718
            P +I  IL+   QF +F++ L  +     QI+TQ+  +S++G++V A  D+AF SL SGT
Sbjct  35   PTNITAILEKAGQFTLFIRLLK-STQASDQINTQLNSSSSNGLTVFAPTDNAFNSLKSGT  93

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVT  550
            LN LSDQQKV+L+QFH+LP   ++   +T SNP+ T AG    G+F LN T S  QVN+T
Sbjct  94   LNSLSDQQKVQLVQFHVLPTLLTMPQFQTVSNPIRTQAGDGQNGKFPLNITSSGNQVNIT  153

Query  549  SGVVQTQVSNIMRKNFPLAVYQIDKVLLPLE-FTSKARP  436
            +GVV   V+N +  +  LAVYQ+D+VLLPL  F S A P
Sbjct  154  TGVVSATVANSVYSDKQLAVYQVDQVLLPLAMFGSSAAP  192



>ref|XP_006398764.1| hypothetical protein EUTSA_v10015384mg [Eutrema salsugineum]
 gb|ESQ40217.1| hypothetical protein EUTSA_v10015384mg [Eutrema salsugineum]
Length=243

 Score =   136 bits (342),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 105/159 (66%), Gaps = 7/159 (4%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQI-ITSTDGVSVLAAPDSAFTSLPSGT  718
            P +I  +L+   QF +F++ L +      QI+TQI  +S+ G++V A  D+AF+SL SGT
Sbjct  34   PTNITAVLEKAGQFTMFIRLLKS-TQAADQINTQINSSSSQGLTVFAPTDNAFSSLKSGT  92

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVT  550
            LN LSDQQKV+L+QFH+LP   ++   +T SNP+ T AG    G+F LN T S  QVN+T
Sbjct  93   LNSLSDQQKVQLVQFHVLPTLLTMPQFQTVSNPLRTQAGDGQNGKFPLNITSSGNQVNIT  152

Query  549  SGVVQTQVSNIMRKNFPLAVYQIDKVLLPLE-FTSKARP  436
            +GVV   V+N +  +  LAVYQ+D+VLLPL  F S + P
Sbjct  153  TGVVSATVANSVYSDKQLAVYQVDQVLLPLAMFGSSSAP  191



>ref|XP_010490785.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Camelina 
sativa]
Length=246

 Score =   136 bits (343),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 105/159 (66%), Gaps = 7/159 (4%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQI-ITSTDGVSVLAAPDSAFTSLPSGT  718
            P +I  IL+   QF +F++ L +      QI+TQ+  +S++G++V A  D+AF SL SGT
Sbjct  34   PTNITAILEKAGQFTLFIRLLKST-QASDQINTQLNSSSSNGLTVFAPTDNAFNSLKSGT  92

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVT  550
            LN LSDQQKV+L+QFH+LP   ++   +T SNP+ T AG    G+F LN T S  QVN+T
Sbjct  93   LNSLSDQQKVQLVQFHVLPTLLTMPQFQTVSNPLRTQAGDGQNGKFPLNITSSGNQVNIT  152

Query  549  SGVVQTQVSNIMRKNFPLAVYQIDKVLLPLE-FTSKARP  436
            +GVV   V+N +  +  LAVYQ+D+VLLPL  F S A P
Sbjct  153  TGVVSATVANSVYSDKQLAVYQVDQVLLPLAMFGSSAAP  191



>ref|XP_010452179.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Camelina 
sativa]
Length=247

 Score =   136 bits (343),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 105/159 (66%), Gaps = 7/159 (4%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQI-ITSTDGVSVLAAPDSAFTSLPSGT  718
            P +I  IL+   QF +F++ L +      QI+TQ+  +S++G++V A  D+AF SL SGT
Sbjct  35   PTNITAILEKAGQFTMFIRLLKST-QASDQINTQLNSSSSNGLTVFAPTDNAFNSLKSGT  93

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVT  550
            LN LSDQQKV+L+QFH+LP   ++   +T SNP+ T AG    G+F LN T S  QVN+T
Sbjct  94   LNSLSDQQKVQLVQFHVLPTLLTMPQFQTVSNPLRTQAGDGQKGKFPLNITSSGNQVNIT  153

Query  549  SGVVQTQVSNIMRKNFPLAVYQIDKVLLPLE-FTSKARP  436
            +GVV   V+N +  +  LAVYQ+D+VLLPL  F S A P
Sbjct  154  TGVVSATVANSVYSDKQLAVYQVDQVLLPLAMFGSSAAP  192



>ref|XP_010260346.1| PREDICTED: fasciclin-like arabinogalactan protein 13 [Nelumbo 
nucifera]
Length=282

 Score =   137 bits (345),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 103/151 (68%), Gaps = 5/151 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            PV++  IL+ G Q+  F++ L  + H+  QI+ Q+ TST G++V A  D+A  SL +GTL
Sbjct  67   PVNLTAILEKGGQYTKFIRLL-ASTHVIDQIENQLNTSTQGLTVFAPTDNAIDSLSAGTL  125

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE---FVLNFTG-SNGQVNVTS  547
            N LS Q +  L+ +H+LP++ SL   +T SNPV T AGG+     LNFT  +N QVNV++
Sbjct  126  NGLSQQDQSALVLYHVLPQYQSLTSFQTISNPVRTQAGGQSGSLTLNFTSIANNQVNVST  185

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            G+VQTQ SN +R + PLAVYQ+DKVLLP E 
Sbjct  186  GMVQTQFSNALRDSPPLAVYQVDKVLLPPEL  216



>ref|XP_010920871.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Elaeis 
guineensis]
Length=245

 Score =   136 bits (342),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 97/148 (66%), Gaps = 5/148 (3%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNK  709
            +I  IL+   QF  F++ L +   +  QI+ Q+  S  G++V A PD+AF+SL SGTLN 
Sbjct  36   NITKILEKAGQFTTFIRLLKST-KVDDQINNQLNNSNTGLTVFAPPDNAFSSLASGTLNS  94

Query  708  LSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTSGV  541
            L+DQQKV LIQFH+LP F S+   +T SNP+ T AG    G F LN T     VN+T+G+
Sbjct  95   LTDQQKVELIQFHVLPSFISMSQFQTVSNPLRTNAGDAYNGRFPLNVTTIGNGVNITTGI  154

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLE  457
            V T VSN +  +  LAVYQ+DKVLLPL+
Sbjct  155  VNTTVSNSIYSDNQLAVYQVDKVLLPLD  182



>ref|NP_563692.1| fasciclin-like arabinogalactan protein 9 [Arabidopsis thaliana]
 sp|Q9ZWA8.1|FLA9_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 9; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAK20861.1|AF333974_1 fasciclin-like arabinogalactan-protein 9 [Arabidopsis thaliana]
 gb|AAD10681.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM65486.1| putative surface protein [Arabidopsis thaliana]
 dbj|BAE99074.1| predicted GPI-anchored protein [Arabidopsis thaliana]
 gb|ACE95181.1| At1g03870 [Arabidopsis thaliana]
 gb|AEE27627.1| fasciclin-like arabinogalactan protein 9 [Arabidopsis thaliana]
Length=247

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/217 (38%), Positives = 125/217 (58%), Gaps = 17/217 (8%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            +++  IL+ G QF  F+  L+    +G Q++ Q+ +S++G++V A  D+AF +L  GTLN
Sbjct  38   INLTAILEKGGQFTTFIHLLNIT-QVGSQVNIQVNSSSEGMTVFAPTDNAFQNLKPGTLN  96

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE----FVLNFTGSNGQVNVTSG  544
            +LS   +V+LI +H+ PK+YS+DDL + SNPV T A G     + LNFTG   Q+NV++G
Sbjct  97   QLSPDDQVKLILYHVSPKYYSMDDLLSVSNPVRTQASGRDNGVYGLNFTGQTNQINVSTG  156

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSP  364
             V+T++SN +R+  PLAVY +D VLLP E   + + +           A APK+      
Sbjct  157  YVETRISNSLRQQRPLAVYVVDMVLLPGEMFGEHKLS---------PIAPAPKSKSGGVT  207

Query  363  ADEPS--PAANGEPNSAGRMSQFGLGLAPAAVVLFCM  259
             D  S   AA+    S     + GLG     +VL C+
Sbjct  208  DDSGSTKKAASPSDKSGSGEKKVGLGFGLGLIVL-CL  243



>ref|XP_010924403.1| PREDICTED: fasciclin-like arabinogalactan protein 9 [Elaeis guineensis]
Length=245

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 81/216 (38%), Positives = 126/216 (58%), Gaps = 18/216 (8%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNK  709
            ++  +L+ G Q+N  ++ L  A  + +QI++Q+  S +G++V A  D+AF +L +GTLN 
Sbjct  39   NLTAVLEKGGQYNTLIRLLR-ATQVEQQINSQLNNSFNGLTVFAPTDNAFNTLKAGTLNS  97

Query  708  LSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA----GGEFVLNFTGSNGQVNVTSGV  541
            LS QQ+V L+ +H+LP++YSL   +T SNPV T A    GG + +N T +  Q NV++GV
Sbjct  98   LSQQQQVALVLYHVLPRYYSLSTFQTTSNPVRTQASGSNGGVYTINVTSTPSQANVSTGV  157

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSPA  361
            V T +SN ++ +FPLAVY +D+VLLP E         G K      A    K  K     
Sbjct  158  VDTPISNTLKSDFPLAVYSVDRVLLPYEL-------FGAKPPAPAPAPEKEKPGKS----  206

Query  360  DEPSPAANGEPNSAGRMSQFGLGLAPAAVVLFCMGV  253
             + SP A+G P++A  +   G G +    V++ MG+
Sbjct  207  -DRSPTADG-PSAAVGLKGRGAGWSFVVGVVWVMGI  240



>ref|XP_009406930.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Musa acuminata 
subsp. malaccensis]
Length=267

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 94/270 (35%), Positives = 140/270 (52%), Gaps = 23/270 (9%)
 Frame = -1

Query  1047  SSYPMAQTRAIFISTLLHLSVPLILIFLL-FPHQIHTQpattapppssstTWPVDIIDIL  871
             S YP+   R     T+ H +  + L+FL+ F      Q A +  P       P +I  +L
Sbjct  9     SPYPIFLKRKEATETMQHFTCAITLLFLVQFIVVTSAQLAESPAPAG-----PPNITAVL  63

Query  870   KTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNKLSDQQK  691
             +   +F  F++ L +  H+G QI+ Q+  S +G+++ A  DSAF+SLPSGT+N L+DQQ+
Sbjct  64    EKAGEFGTFIRLLKST-HVGDQINNQLNNSVNGITIFAPTDSAFSSLPSGTMNSLTDQQQ  122

Query  690   VRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTSGVVQTQVS  523
             V LIQFH LP   S+   +T SNPV T AG    G + LN T     VN+T+G+V T ++
Sbjct  123   VALIQFHELPYIVSISQFQTISNPVRTQAGDVNNGRYPLNVTTIGNSVNITTGIVNTSIA  182

Query  522   NIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSPADEPSPA  343
             + +  +  LAVY++D+VLLPLE      P        +K         KE S A+ PS  
Sbjct  183   STVYSDSQLAVYKLDQVLLPLEIFGPPAPAAAPAPNKSK--------KKESSIAESPS--  232

Query  342   ANGEPNSAGRMSQFGLGLAPAAVVLFCMGV  253
               G  +S+G  +   L       ++F   V
Sbjct  233   --GTSDSSGATAAVNLKCTYEGGIVFAAAV  260



>ref|XP_010253626.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Nelumbo 
nucifera]
Length=243

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 100/151 (66%), Gaps = 5/151 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P +I  IL+   QF   ++ L +   +  QI+ Q+  S  G+++ A  D+AF++L SGTL
Sbjct  34   PTNITAILEKAGQFTTLIRLLKST-QMADQINQQLNNSNQGITLFAPTDNAFSNLKSGTL  92

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N L+DQQKV+L+QFH+LP F S+   +T SNP+ T AG    G+F LN T +  QVN+T+
Sbjct  93   NSLTDQQKVQLVQFHVLPSFISVSQFQTVSNPLRTQAGNSNNGQFPLNVTTTGNQVNITT  152

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            GVV T V+N +  +  LAVYQ+D+VLLPL+ 
Sbjct  153  GVVNTTVANTIYTDNQLAVYQVDQVLLPLQL  183



>ref|XP_006286413.1| hypothetical protein CARUB_v10002835mg [Capsella rubella]
 gb|EOA19311.1| hypothetical protein CARUB_v10002835mg [Capsella rubella]
Length=246

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 108/168 (64%), Gaps = 8/168 (5%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQI-ITSTDGVSVLAAPDSAFTSLPSGT  718
            P +I  IL+   QF +F++ L +      QI+TQ+  +S++G++V A  D+AF SL SGT
Sbjct  34   PTNITAILEKAGQFTLFIRLLKST-QASDQINTQLNSSSSNGLTVFAPTDNAFNSLKSGT  92

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVT  550
            LN LSDQQKV+L+QFH+LP   ++   +T SNP+ T AG    G+F LN T S  QVN+T
Sbjct  93   LNSLSDQQKVQLVQFHVLPTLLTMPQFQTVSNPLRTQAGDGQNGKFPLNITSSGNQVNIT  152

Query  549  SGVVQTQVSNIMRKNFPLAVYQIDKVLLPLE-FTSKARPTLG-NKGRP  412
            +GVV   V+N +  +  LAVYQ+D+VLLPL  F S A P     KG P
Sbjct  153  TGVVSATVANSVYSDKQLAVYQVDQVLLPLAMFGSSAAPAPAPEKGGP  200



>ref|XP_002873077.1| hypothetical protein ARALYDRAFT_487087 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49336.1| hypothetical protein ARALYDRAFT_487087 [Arabidopsis lyrata subsp. 
lyrata]
Length=246

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 105/159 (66%), Gaps = 7/159 (4%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQI-ITSTDGVSVLAAPDSAFTSLPSGT  718
            P +I  IL+   QF +F++ L +      QI+TQ+  +S++G++V A  D+AF SL SGT
Sbjct  34   PTNITAILEKAGQFTLFIRLLKST-QASDQINTQLNSSSSNGLTVFAPTDNAFNSLKSGT  92

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVT  550
            LN LSDQQKV+L+QFH+LP   ++   +T SNP+ T AG    G+F LN T S  QVN+T
Sbjct  93   LNSLSDQQKVQLVQFHVLPTLITMPQFQTVSNPLRTQAGDGQNGKFPLNITSSGNQVNIT  152

Query  549  SGVVQTQVSNIMRKNFPLAVYQIDKVLLPLE-FTSKARP  436
            +GVV   V+N +  +  LAVYQ+D+VLLPL  F S A P
Sbjct  153  TGVVSATVANSVYSDKQLAVYQVDQVLLPLAMFGSSAAP  191



>ref|XP_010689776.1| PREDICTED: fasciclin-like arabinogalactan protein 13 [Beta vulgaris 
subsp. vulgaris]
Length=252

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 83/204 (41%), Positives = 124/204 (61%), Gaps = 13/204 (6%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            +++  IL+   Q+  F++ L  +  +  QI  Q+ TST+G++V A  D+AF +L  GTLN
Sbjct  37   LNLTAILEKASQYTTFMRLL-ASTQVDNQIANQVNTSTEGMTVFAPTDNAFQNLKPGTLN  95

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE----FVLNFTG-SNGQVNVTS  547
             LS Q++V+L+ +H+LPKFY+ ++ ET SNPV T A G+    F LN     N QVNV++
Sbjct  96   GLSVQEQVQLVLYHVLPKFYNFENFETVSNPVRTQATGQDGEPFGLNIVSIGNRQVNVST  155

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHS  367
            G+V  Q++N +R+ FPLAVYQ+D VLLP E      P    K  P K++A    +SK   
Sbjct  156  GIVTVQLNNALRERFPLAVYQVDMVLLPKELFGAKSP----KSAP-KSSAPKSDDSKSDD  210

Query  366  PADEPSPAANGEPNSAGRMSQFGL  295
             AD P+ AA+ +     R + +GL
Sbjct  211  KADGPATAASADAEE--RNAGYGL  232



>ref|XP_008793344.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Phoenix 
dactylifera]
Length=246

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 98/148 (66%), Gaps = 5/148 (3%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNK  709
            +I  IL+   QF  F++ + +   +  QI+ Q+  S  G++V A PD+AF+SL +GTLN 
Sbjct  38   NITKILEKAGQFTTFIRLIKST-KVSDQINNQLNNSDSGLTVFAPPDNAFSSLSAGTLNS  96

Query  708  LSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTSGV  541
            L+DQQKV L+QFH+LP F S+ + +T SNP+ T AG    G F LN T     VN+T+G+
Sbjct  97   LTDQQKVELLQFHVLPSFISMTEFQTVSNPLRTQAGDANNGRFALNVTTVGNGVNITTGI  156

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLE  457
            V T VSN +  +  LAVYQ++KVLLPL+
Sbjct  157  VNTTVSNTIYSDNQLAVYQVEKVLLPLD  184



>ref|XP_008243923.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Prunus 
mume]
Length=245

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 99/148 (67%), Gaps = 5/148 (3%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNK  709
            ++  +L+   QF   +K L +   +  QIDTQ+ TS  G+++ A  D+AF+SL SGTLN 
Sbjct  36   NVTAVLEKAGQFTTLIKLLKST-RMADQIDTQLSTSNQGITLFAPTDNAFSSLKSGTLNS  94

Query  708  LSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTSGV  541
            +S+QQK+ L+QFH+LP FYS+   +T SNP+ T AG    G+F LN T +  QVN+T+GV
Sbjct  95   ISEQQKLALMQFHVLPNFYSVSQFQTVSNPLHTQAGNSNDGQFPLNVTTAGNQVNITTGV  154

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLE  457
            V   V+N +  +  LAVY++D+VLLPL 
Sbjct  155  VNATVANTIFTDNQLAVYEVDQVLLPLN  182



>ref|XP_010937843.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Elaeis 
guineensis]
Length=243

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 97/149 (65%), Gaps = 5/149 (3%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNK  709
            +I  IL+   QF   ++ L +   +G QI+ Q+  S  G++V A  D+AF+SL SGTLN 
Sbjct  35   NITKILEKAGQFTTLIRLLKST-QVGDQINNQLNDSNSGLTVFAPTDNAFSSLSSGTLNS  93

Query  708  LSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTSGV  541
            L+DQQKV LIQFH+LP F S+   +T SNP+ T AG    G+F LN T +   VN+T+G+
Sbjct  94   LTDQQKVALIQFHVLPSFISMSQFQTVSNPLRTQAGDVTNGQFPLNVTTAGNTVNITTGI  153

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
              T VSN +  +  LAVYQ+D+VLLPLE 
Sbjct  154  DNTTVSNTIYSDNQLAVYQVDQVLLPLEI  182



>gb|AAM62616.1| arabinogalactan protein-like [Arabidopsis thaliana]
Length=246

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 104/159 (65%), Gaps = 7/159 (4%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQI-ITSTDGVSVLAAPDSAFTSLPSGT  718
            P +I  IL+   QF +F++ L +      QI+TQ+  +S++G++V A  D+AF SL SGT
Sbjct  34   PTNITAILEKAGQFTLFIRLLKS-TQASDQINTQLNSSSSNGLTVFAPTDNAFNSLKSGT  92

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVT  550
            LN LSDQQKV+L+QFH+LP   ++   +T SNP+ T AG    G+F LN T S  QVN+T
Sbjct  93   LNSLSDQQKVQLVQFHVLPTLITMPQFQTVSNPLRTQAGDGQNGKFPLNITSSGNQVNIT  152

Query  549  SGVVQTQVSNIMRKNFPLAVYQIDKVLLPLE-FTSKARP  436
            +GVV   V+N +  +  LAVYQ+D+VLLPL  F S   P
Sbjct  153  TGVVSATVANSVYSDKQLAVYQVDQVLLPLAMFGSSVAP  191



>ref|XP_004969482.1| PREDICTED: fasciclin-like arabinogalactan protein 11-like [Setaria 
italica]
Length=249

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 79/199 (40%), Positives = 114/199 (57%), Gaps = 14/199 (7%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANH---LGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGT  718
            ++  IL+ G Q+  F++ +        L  Q+++       G +V A  D+AF +L  GT
Sbjct  37   NVTAILEKGGQYTTFMRLMKETQQDTQLNSQLNSSFGNGGSGYTVFAPTDNAFNNLKPGT  96

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE---FVLNFTG-SNGQVNVT  550
            LN L+ QQ+V L+Q H+LP+FYS+D  +TASNPV T A G    + LN T  +N QVNV+
Sbjct  97   LNSLTQQQQVSLVQGHVLPQFYSMDSFQTASNPVRTQASGRDGPYTLNITSDTNNQVNVS  156

Query  549  SGVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF---TSKARPTLGNKGRPNK----TAAAA  391
            SGVV  ++SN +  N PLAVY +DKVLLP+E     + A     ++G+P K     AA+ 
Sbjct  157  SGVVDVRISNALYSNKPLAVYSVDKVLLPMELFGAKAPAAAPTASEGKPKKGGSSDAASG  216

Query  390  PKNSKEHSPADEPSPAANG  334
            P  S + +P    S  A G
Sbjct  217  PAGSDDSAPTGAASARAVG  235



>ref|NP_001130967.1| uncharacterized protein LOC100192072 precursor [Zea mays]
 gb|ACF79374.1| unknown [Zea mays]
 tpg|DAA58200.1| TPA: hypothetical protein ZEAMMB73_687790 [Zea mays]
Length=249

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 84/225 (37%), Positives = 122/225 (54%), Gaps = 24/225 (11%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANH---LGKQIDTQIITSTDGVSVLAAPDSAFTSLPS  724
            P ++  IL+ G QF +F++ +        L  Q+++   +S  G +V A  D+AF +L  
Sbjct  35   PPNVTAILEKGGQFTMFMRLMKETQQDTQLNSQLNSSYASSGGGYTVFAPTDNAFNNLKP  94

Query  723  GTLNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE---FVLNFTGS-NGQVN  556
            GTLN L+ QQ+V L+Q H+LP+FYS+D  +TASNPV T A G    + LN T + N QVN
Sbjct  95   GTLNSLTQQQQVALVQGHVLPQFYSMDSFQTASNPVRTQASGRDGPYTLNITATANNQVN  154

Query  555  VTSGVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF---TSKARPTLGNKGRPNKTAAAAPK  385
            V+SGV +  ++N +    PLAVY +DKVLLPLE     + A     ++G+P         
Sbjct  155  VSSGVAEVTINNALSAVKPLAVYSVDKVLLPLELFGAKAPAAAPAASQGKP---------  205

Query  384  NSKEHSPADEPSPAANGE---PNSAGRMSQFGLGLAPAAVVLFCM  259
              K+   +D PS +A  +   P  A      G   A  A VL C+
Sbjct  206  --KKGGSSDAPSGSAGSDDAAPTGAAGARVVGWSFAGLAAVLGCL  248



>ref|NP_195937.1| fasciclin-like arabinogalactan protein 11 [Arabidopsis thaliana]
 sp|Q8LEJ6.2|FLA11_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 11; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAK25893.1|AF360183_1 putative arabinogalactan protein [Arabidopsis thaliana]
 emb|CAB86084.1| arabinogalactan protein-like [Arabidopsis thaliana]
 dbj|BAB08377.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK64076.1| putative arabinogalactan protein [Arabidopsis thaliana]
 gb|AED90563.1| fasciclin-like arabinogalactan protein 11 [Arabidopsis thaliana]
Length=246

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 104/159 (65%), Gaps = 7/159 (4%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQI-ITSTDGVSVLAAPDSAFTSLPSGT  718
            P +I  IL+   QF +F++ L +      QI+TQ+  +S++G++V A  D+AF SL SGT
Sbjct  34   PTNITAILEKAGQFTLFIRLLKS-TQASDQINTQLNSSSSNGLTVFAPTDNAFNSLKSGT  92

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVT  550
            LN LSDQQKV+L+QFH+LP   ++   +T SNP+ T AG    G+F LN T S  QVN+T
Sbjct  93   LNSLSDQQKVQLVQFHVLPTLITMPQFQTVSNPLRTQAGDGQNGKFPLNITSSGNQVNIT  152

Query  549  SGVVQTQVSNIMRKNFPLAVYQIDKVLLPLE-FTSKARP  436
            +GVV   V+N +  +  LAVYQ+D+VLLPL  F S   P
Sbjct  153  TGVVSATVANSVYSDKQLAVYQVDQVLLPLAMFGSSVAP  191



>ref|XP_006376379.1| hypothetical protein POPTR_0013s12490g [Populus trichocarpa]
 gb|ERP54176.1| hypothetical protein POPTR_0013s12490g [Populus trichocarpa]
Length=238

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 103/147 (70%), Gaps = 4/147 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            PV+   +L  G QF   ++ L+    L  QI+ Q+ +S++G+++ A  D+AF +L +G L
Sbjct  35   PVNFTAVLVKGGQFATLIRLLNNTQTL-NQIENQLNSSSEGMTIFAPTDNAFNNLKAGAL  93

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE---FVLNFTGSNGQVNVTSG  544
            N L+ Q++V+L+Q+H LPKFY++ +L   SNPV T A G+   + LNFTG + QVNV++G
Sbjct  94   NGLNQQEQVQLLQYHTLPKFYTMSNLLLVSNPVPTQASGQDGVWGLNFTGQSNQVNVSTG  153

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLP  463
            +V+ Q++N +R++ PLAVY +DKVLLP
Sbjct  154  LVEVQINNALRQDSPLAVYPVDKVLLP  180



>gb|EPS62200.1| hypothetical protein M569_12593, partial [Genlisea aurea]
Length=165

 Score =   131 bits (330),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 93/148 (63%), Gaps = 5/148 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P ++  IL+   QF   V+       +G QI+TQ+  S  GV++ A  D+AF++L +GTL
Sbjct  4    PTNVTGILEKAGQFTTLVRLFRIT-QIGDQINTQLNNSNQGVTIFAPTDAAFSALSAGTL  62

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N LSDQQKV LIQFH+LP F S+   +T SNP+ T AG    GEF LN T    QVN+++
Sbjct  63   NSLSDQQKVSLIQFHVLPSFVSIPQFQTVSNPLRTQAGDTAAGEFPLNVTAVGNQVNIST  122

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLP  463
            GV    + N +  +  LAVYQIDKVLLP
Sbjct  123  GVDSASIGNTIYTDGQLAVYQIDKVLLP  150



>gb|AFK36413.1| unknown [Medicago truncatula]
 gb|AES81833.2| fasciclin-like arabinogalactan protein [Medicago truncatula]
Length=256

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 101/151 (67%), Gaps = 5/151 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P++I  +L+   QF  F+K L  A  +  +I++Q+  S  G+++ A  D+AF+SL SGTL
Sbjct  38   PLNITKVLEKAGQFTTFIKLLK-ATQVSDRINSQLNNSNQGLTIFAPTDNAFSSLKSGTL  96

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N +S Q +++L+QFHILP  Y++   +TASNP+ T AG    GE+ LN T S  QVNVT+
Sbjct  97   NSISTQNQLQLLQFHILPTLYTISQFQTASNPLHTQAGNSDDGEYPLNVTTSGNQVNVTT  156

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            GV+ T VSN +  +  LAVYQ+D+VLLP+  
Sbjct  157  GVIDTTVSNTIYSDNQLAVYQVDQVLLPMAL  187



>ref|XP_003625615.1| Fasciclin-like arabinogalactan protein [Medicago truncatula]
Length=258

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 101/151 (67%), Gaps = 5/151 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P++I  +L+   QF  F+K L  A  +  +I++Q+  S  G+++ A  D+AF+SL SGTL
Sbjct  38   PLNITKVLEKAGQFTTFIKLLK-ATQVSDRINSQLNNSNQGLTIFAPTDNAFSSLKSGTL  96

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N +S Q +++L+QFHILP  Y++   +TASNP+ T AG    GE+ LN T S  QVNVT+
Sbjct  97   NSISTQNQLQLLQFHILPTLYTISQFQTASNPLHTQAGNSDDGEYPLNVTTSGNQVNVTT  156

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            GV+ T VSN +  +  LAVYQ+D+VLLP+  
Sbjct  157  GVIDTTVSNTIYSDNQLAVYQVDQVLLPMAL  187



>ref|XP_009402376.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Musa acuminata 
subsp. malaccensis]
Length=265

 Score =   134 bits (338),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 87/220 (40%), Positives = 120/220 (55%), Gaps = 18/220 (8%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P +I  I++   Q+   ++ L +   +G QI+ Q+  S  G+++ A  D+AF+SLPSGTL
Sbjct  51   PTNITAIMEKAGQYGTLIRLLKS-TQVGDQINNQLNNSNTGLTIFAPTDNAFSSLPSGTL  109

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N L+DQQKV LIQFHILP   S    +T SNPV T AG    G + LN T    QVN+++
Sbjct  110  NSLTDQQKVALIQFHILPTVISASQFQTVSNPVRTQAGDASNGRYPLNVTTMGTQVNLST  169

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHS  367
            GVV   ++N +  +  LAVYQ+D+VLLPLE         G        A A  K  K   
Sbjct  170  GVVDATIANTIYSDSKLAVYQVDQVLLPLEI-------FGPPAPAAAPAPAEAKKQKPSP  222

Query  366  PADEPS-PAANGEPNSAG-----RMSQFGLGLAPAAVVLF  265
             A+ PS P+ +    SAG       S  G+  A AA+ L+
Sbjct  223  VAEGPSTPSTDATDASAGVNLSRSASGGGVMFAAAAIWLW  262



>emb|CDY44345.1| BnaC02g03320D [Brassica napus]
Length=243

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 118/208 (57%), Gaps = 19/208 (9%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQI-ITSTDGVSVLAAPDSAFTSLPSGT  718
            P +I  +L+   Q+ +F++ L +      QI+TQ+  +S+ G++V A  D+AF+SL SGT
Sbjct  34   PTNITAVLEKAGQYTMFIRLLKS-TQAADQINTQLNSSSSQGLTVFAPTDNAFSSLKSGT  92

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVT  550
            LN LSDQQKV+L+QFH+LP   ++   +T SNP+ T AG    G+F LN T S  QVN+T
Sbjct  93   LNSLSDQQKVQLVQFHVLPTLLTMPQFQTVSNPLRTQAGDGQNGKFPLNITSSGNQVNIT  152

Query  549  SGVVQTQVSNIMRKNFPLAVYQIDKVLLPLE-FTSKARPTLGNKGRPNKTAAAAPKNSKE  373
            +GVV   V+N +  +  LAVYQ+D+VLLPL  F S + P            A AP+    
Sbjct  153  TGVVSATVANSVYSDKQLAVYQVDQVLLPLAMFGSSSAP------------APAPEKGGL  200

Query  372  HSPADEPSPAANGEPNSAGRMSQFGLGL  289
             S    PS    G+   +    +   GL
Sbjct  201  VSKGSAPSGDDGGDSTDSSDTERIRYGL  228



>ref|XP_008449261.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Cucumis 
melo]
Length=248

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 86/227 (38%), Positives = 126/227 (56%), Gaps = 16/227 (7%)
 Frame = -1

Query  987  VPLILIFLLFPHQIHTQpattapppssstTWPVDIIDILKTGKQFNIFVKFLDTANHLGK  808
            +   LI LLF   +  Q      P       P +I  IL+ G QF+ F+K L +      
Sbjct  8    ISFFLISLLFSESVSAQSTQPPGPS-----GPTNISAILEKGGQFSTFIKLLKSTQQ-SD  61

Query  807  QIDTQIITSTDG--VSVLAAPDSAFTSLPSGTLNKLSDQQKVRLIQFHILPKFYSLDDLE  634
            QI+ Q+  S  G  ++V A PD+AF++L  GTLN LSDQQKV+L+Q+H++P F S+   +
Sbjct  62   QINNQLNNSNQGQGLTVFAPPDNAFSNLKPGTLNSLSDQQKVQLVQYHVVPTFISMSQFQ  121

Query  633  TASNPVETLAG----GEFVLNFTGSNGQVNVTSGVVQTQVSNIMRKNFPLAVYQIDKVLL  466
            T SNP+ T AG    G+F LN T S  QVN+T+GV    V+N +  +  LAVYQ+DKVLL
Sbjct  122  TVSNPLRTQAGNSNAGQFPLNVTTSGSQVNLTTGVDDAVVANTIYTDGQLAVYQVDKVLL  181

Query  465  PLEFTSKARPTLGNKGRPNK--TAAAAPKNSKEHSPADE--PSPAAN  337
            P++             +P K  + + AP  + + + +D+   +PA N
Sbjct  182  PVDLFGTVAAPAPAPSKPVKAVSGSDAPAGASKDTSSDDTGAAPAMN  228



>ref|XP_009125482.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Brassica 
rapa]
 emb|CDY62902.1| BnaAnng18460D [Brassica napus]
Length=243

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 118/208 (57%), Gaps = 19/208 (9%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQI-ITSTDGVSVLAAPDSAFTSLPSGT  718
            P +I  +L+   Q+ +F++ L +      QI+TQ+  +S+ G++V A  D+AF+SL SGT
Sbjct  34   PTNITAVLEKAGQYTMFIRLLKS-TQAADQINTQLNSSSSQGLTVFAPTDNAFSSLKSGT  92

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVT  550
            LN LSDQQKV+L+QFH+LP   ++   +T SNP+ T AG    G+F LN T S  QVN+T
Sbjct  93   LNSLSDQQKVQLVQFHVLPTLLTMPQFQTVSNPLRTQAGDGQNGKFPLNITSSGNQVNIT  152

Query  549  SGVVQTQVSNIMRKNFPLAVYQIDKVLLPLE-FTSKARPTLGNKGRPNKTAAAAPKNSKE  373
            +GVV   V+N +  +  LAVYQ+D+VLLPL  F S + P            A AP+    
Sbjct  153  TGVVSATVANSVYSDKQLAVYQVDQVLLPLAMFGSSSAP------------APAPEKGGL  200

Query  372  HSPADEPSPAANGEPNSAGRMSQFGLGL  289
             S    PS    G+   +    +   GL
Sbjct  201  VSKGSAPSGDDGGDSTDSSDTERIRYGL  228



>ref|XP_007204927.1| hypothetical protein PRUPE_ppa023999mg [Prunus persica]
 gb|EMJ06126.1| hypothetical protein PRUPE_ppa023999mg [Prunus persica]
Length=245

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 99/148 (67%), Gaps = 5/148 (3%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNK  709
            ++  IL+   QF   +K L +   +  QIDTQ+ TS  G+++ A  D+AF+SL SGTLN 
Sbjct  36   NVTAILEKAGQFTTLIKLLKST-RMADQIDTQLSTSNQGITLFAPTDNAFSSLKSGTLNS  94

Query  708  LSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTSGV  541
            +S+QQK+ L+QFH+LP F+S+   +T SNP+ T AG    G+F LN T +  QVN+T+GV
Sbjct  95   ISEQQKLALMQFHVLPNFFSVSQFQTVSNPLHTQAGNSNDGQFPLNVTTAGNQVNITTGV  154

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLE  457
            V   V+N +  +  LAVY++D+VLLPL 
Sbjct  155  VNATVANTIFTDNQLAVYEVDQVLLPLN  182



>ref|XP_009342757.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Pyrus x 
bretschneideri]
Length=246

 Score =   134 bits (336),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 99/147 (67%), Gaps = 5/147 (3%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNK  709
            ++  +L+   QF   +K L  +  +  QI+TQ+ TS  G+++ A  D+AF+SL +GTLN 
Sbjct  36   NVTAVLEKAGQFTTLIKLLK-STKMADQINTQLSTSNQGMTIFAPTDNAFSSLKAGTLNS  94

Query  708  LSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTSGV  541
            +S+QQK++L+QFH+LP FYS    +T SNP+ T AG    G+F LN T S  QVN+T+GV
Sbjct  95   ISEQQKLQLVQFHVLPSFYSAAQFQTVSNPLHTQAGNTDDGQFPLNVTTSGNQVNITTGV  154

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPL  460
            V   V+N +  +  LAVYQ+D+VLLPL
Sbjct  155  VNASVANTIFTDSQLAVYQVDQVLLPL  181



>ref|XP_008350366.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Malus domestica]
Length=246

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 99/147 (67%), Gaps = 5/147 (3%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNK  709
            ++  +L+   QF   +K L  +  +  QI+TQ+ TS  G+++ A  D+AF+SL +GTLN 
Sbjct  36   NVTAVLEKAGQFTTLIKLLK-STKMADQINTQLSTSNQGMTLFAPTDNAFSSLKAGTLNS  94

Query  708  LSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTSGV  541
            +S+QQK++L+QFH+LP FYS    +T SNP+ T AG    G+F LN T S  QVN+T+GV
Sbjct  95   ISEQQKLQLVQFHVLPSFYSAAQFQTVSNPLHTQAGNTDDGQFPLNVTTSGNQVNITTGV  154

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPL  460
            V   V+N +  +  LAVYQ+D+VLLPL
Sbjct  155  VNAAVANTIFTDSQLAVYQVDQVLLPL  181



>ref|XP_009786976.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Nicotiana 
sylvestris]
Length=247

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 110/189 (58%), Gaps = 10/189 (5%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P +I  IL+   QF   ++ +     +G QI+TQ+  S  G++V A  D+AF++L SGT+
Sbjct  35   PTNITKILEKAGQFTTLIRLMKVT-QVGDQINTQLNNSNQGMTVFAPTDNAFSNLKSGTI  93

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N LS QQ+V+L+QFH+LP F S+   +T SNP+ T AG    GEF LN T S  QVNV++
Sbjct  94   NSLSAQQQVQLVQFHVLPNFISMTQFQTVSNPLRTQAGDASPGEFPLNVTTSGNQVNVST  153

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF-----TSKARPTLGNKGRPNKTAAAAPKN  382
            GV    V+N +  +  LAVYQ+DKVL PL        + A      K +    AA +P +
Sbjct  154  GVDDATVANTIYTDGQLAVYQVDKVLQPLSIFAAPAPAMAPAPASLKSKRKSPAALSPSS  213

Query  381  SKEHSPADE  355
              + SP D+
Sbjct  214  GNDDSPVDD  222



>ref|XP_008789092.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Phoenix 
dactylifera]
Length=241

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 107/184 (58%), Gaps = 14/184 (8%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNK  709
            +I  IL+   QF  F++ L +   +G QI+ Q+  S  G++V A  D+AF+SL +G LN 
Sbjct  35   NITKILEKAGQFTTFMRLLKST-QVGDQINQQLNNSNSGLTVFAPSDNAFSSLSAGILNS  93

Query  708  LSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTSGV  541
            L+DQQKV LIQFH+LP F S    +T SNP+ T AG    G+F LN T +   VN+T+G+
Sbjct  94   LTDQQKVALIQFHVLPSFISTTQFQTVSNPLRTQAGDVNNGQFPLNVTTTGNTVNITTGI  153

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSPA  361
            V T VSN +  +  LAVYQ+D+VLLPL+      P           A + PK  K    A
Sbjct  154  VNTTVSNTIYSDNQLAVYQVDQVLLPLDIFGPHAP---------APAPSIPKKKKAAPIA  204

Query  360  DEPS  349
            + PS
Sbjct  205  EGPS  208



>ref|XP_010558264.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Tarenaya 
hassleriana]
Length=243

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 101/152 (66%), Gaps = 6/152 (4%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTD-GVSVLAAPDSAFTSLPSGT  718
            P +I  +L+   QF  F++ L +      QI+TQ+ +S++ G++V A  D+AF SL SGT
Sbjct  28   PTNITAVLEKAGQFTTFMRLLKST-QAADQINTQLNSSSNQGLTVFAPTDNAFNSLKSGT  86

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVT  550
            LN LSDQQKV+L+QFH+LP   ++   +T SNP+ T AG    G+F LN T S  QVN+T
Sbjct  87   LNSLSDQQKVQLVQFHVLPTLLTMSQFQTVSNPLRTQAGDGQNGKFPLNITSSGNQVNIT  146

Query  549  SGVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            +GVVQ  V+N +  +  L+VYQ+D+VLLPL  
Sbjct  147  TGVVQATVANTIYSDKQLSVYQVDQVLLPLAL  178



>emb|CDP07130.1| unnamed protein product [Coffea canephora]
Length=244

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/210 (38%), Positives = 114/210 (54%), Gaps = 11/210 (5%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNK  709
            +I  IL+   QF   ++ +     +  QI+ Q+  + +G+++ A  DSAF+SL SGTLN 
Sbjct  38   NITKILEKAGQFTTLIRLM-RITQISDQINGQLNDTNNGITIFAPADSAFSSLKSGTLNS  96

Query  708  LSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTSGVV  538
            L+DQQKV+LIQFHI+P F S    +T SNPV T AG     F LN T S  QVNV++GV 
Sbjct  97   LTDQQKVQLIQFHIIPSFISATQFQTVSNPVRTQAGDSSARFPLNVTTSGSQVNVSTGVD  156

Query  537  QTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSPAD  358
               V+N +  +  LAVYQ+DKVLLPL          G        A  + ++ K+ S AD
Sbjct  157  DATVANTIYTDNQLAVYQVDKVLLPLSL-------FGAPAPALAPAPTSGEDKKKKSAAD  209

Query  357  EPSPAANGEPNSAGRMSQFGLGLAPAAVVL  268
             P+   +   + A  +   G+ +   A + 
Sbjct  210  TPTSGDDTPSSDASGLRVHGMAVCFGAAIF  239



>gb|AGN92421.1| putative fasciclin-like arabinogalactan protein 1, partial [Centaurium 
erythraea]
Length=224

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 95/151 (63%), Gaps = 5/151 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P +I  IL+   QF  F++ +     +  QID Q+  S  G++V A  DSAF++L +GTL
Sbjct  15   PTNITKILEKAGQFTTFIRLMK-LTQVATQIDGQLNNSNSGLTVFAPTDSAFSALQAGTL  73

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N L+DQQKV L+QFHI+P F S+   +T SNP+ T AG    GEF LN T    QVNV++
Sbjct  74   NSLTDQQKVALVQFHIVPSFLSMSQFQTVSNPLRTQAGGTNNGEFPLNVTTXGNQVNVST  133

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            GV  T VS  +  +  LA+YQ+DKVLLPL  
Sbjct  134  GVDTTTVSGSVYSDNQLAIYQVDKVLLPLSM  164



>ref|XP_009620250.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Nicotiana 
tomentosiformis]
Length=248

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 96/150 (64%), Gaps = 5/150 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P +I  IL+   QF  F++ L T    G QI+TQ+  S  G++V A  D+AF+SL +GTL
Sbjct  36   PTNITKILEKAGQFTTFIRLLKTT-QAGDQINTQLNNSNQGMTVFAPTDNAFSSLKAGTL  94

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N LS QQ+V L+QFH+LP F S+   +T SNP+ T AG    G+F LN T    QVNV++
Sbjct  95   NSLSSQQQVSLVQFHLLPNFISISQFQTVSNPLRTQAGDTGPGDFPLNVTTLGNQVNVST  154

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLE  457
            G+V   V+N +  +  LAVYQ+DKVL PL 
Sbjct  155  GIVDATVANTIYTDGELAVYQVDKVLQPLN  184



>ref|XP_006340150.1| PREDICTED: fasciclin-like arabinogalactan protein 11-like [Solanum 
tuberosum]
Length=238

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 112/191 (59%), Gaps = 14/191 (7%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P +I  IL+   QF   ++ +  +  +  QI+TQ+  S  G++V A  D+AF+SL SGT+
Sbjct  27   PTNITQILEKAGQFTTLIRLMKVS-QVSDQINTQLNNSNQGMTVFAPTDNAFSSLKSGTI  85

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N LS QQ+V+L+QFH+LP F S+   +T SNP+ T AG    G+F LN T S  QVNV++
Sbjct  86   NSLSAQQQVQLVQFHVLPNFISMSQFQTISNPLRTQAGDATPGDFPLNVTTSGNQVNVST  145

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF-------TSKARPTLGNKGRPNKTAAAAP  388
            GV    VSN +  +  LAVYQ+DKVL P+          + A  TL  KG+    A  +P
Sbjct  146  GVDDATVSNTIYTDGQLAVYQVDKVLQPMSIFAAPSPAVAPAPATLKPKGK--SPAGLSP  203

Query  387  KNSKEHSPADE  355
             +  + SPAD 
Sbjct  204  TSGNDDSPADN  214



>gb|EYU18853.1| hypothetical protein MIMGU_mgv1a026916mg [Erythranthe guttata]
Length=236

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 95/151 (63%), Gaps = 5/151 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P +I  IL+   Q+   ++       +  QI+TQ+  S  G++V A  D+AF++LP+GTL
Sbjct  24   PTNITKILEKAGQYTTLIRLCKI-TQICDQINTQLNNSNQGLTVFAPTDNAFSNLPAGTL  82

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N L+DQQKV L+QFHILP F S+   +T SNP+ T AG    G F LN T S  QVNV++
Sbjct  83   NSLTDQQKVSLVQFHILPAFLSMSQFQTVSNPLRTQAGDSAAGAFPLNVTTSGSQVNVST  142

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            GV    V+N +  +  LAVYQ+DKVLLPL  
Sbjct  143  GVNDATVANTVYSDNQLAVYQVDKVLLPLSL  173



>emb|CAI99883.1| putative cell surface adhesion protein [Zinnia violacea]
Length=252

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 97/151 (64%), Gaps = 5/151 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P +I  IL+   QF   ++ +  A  LG QI+TQ+  S  G++V A  D+AF+SL  GTL
Sbjct  41   PTNITKILEKAGQFTTLIRLMK-ATQLGDQINTQLNNSNQGMTVFAPTDNAFSSLKPGTL  99

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N LSDQ KV L+QFH++P + +   L+T SNP+ T AG     +F LN T +  QVNV++
Sbjct  100  NSLSDQDKVSLLQFHVVPTYLTTSQLQTVSNPLRTQAGDTASNKFPLNVTAAGNQVNVST  159

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            GVV T VSN +  +  LAVYQ+DKVLLP+  
Sbjct  160  GVVDTPVSNSIYTDGTLAVYQVDKVLLPMSL  190



>gb|KFK24763.1| hypothetical protein AALP_AA8G021900 [Arabis alpina]
Length=247

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 101/150 (67%), Gaps = 6/150 (4%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQI-ITSTDGVSVLAAPDSAFTSLPSGT  718
            P +I  +L+   Q+ +F++ L  +     QI+TQ+  +S+ G++V A  D+AF+SL SGT
Sbjct  34   PTNITAVLEKAGQYTLFIRLLK-STQASDQINTQLNSSSSQGLTVFAPTDNAFSSLKSGT  92

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVT  550
            LN LSDQQKV+L+QFH+LP   ++   +T SNP+ T AG    G+F LN T S  QVN+T
Sbjct  93   LNSLSDQQKVQLVQFHVLPTLLTMPQFQTVSNPLRTQAGDGQNGQFPLNITSSGNQVNIT  152

Query  549  SGVVQTQVSNIMRKNFPLAVYQIDKVLLPL  460
            +GVV   V+N +  +  LAVYQ+D+VLLPL
Sbjct  153  TGVVSATVANSVYSDKQLAVYQVDQVLLPL  182



>ref|XP_007027300.1| FASCICLIN-like arabinogalactan-protein 11, putative [Theobroma 
cacao]
 gb|EOY07802.1| FASCICLIN-like arabinogalactan-protein 11, putative [Theobroma 
cacao]
Length=247

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 86/220 (39%), Positives = 122/220 (55%), Gaps = 21/220 (10%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS--TDGVSVLAAPDSAFTSLPSGTL  715
            +I  IL+ G QF  F++ L  A  +  Q++ Q+ T    DG+++ A  D+AF+SL  GTL
Sbjct  35   NITSILEKGGQFTTFIRLLK-ATQVADQLNNQLSTPDPNDGLTIFAPSDNAFSSLNPGTL  93

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N LSD++K++L+QFHILP   S    +TASNP+ T AG    G F LN T S  QVN+T+
Sbjct  94   NTLSDREKLQLVQFHILPTLMSTTQFQTASNPLRTQAGDVKSGRFPLNVTASGNQVNITT  153

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTA-AAAPKNSKEH  370
            GVV T V+N +  +  +AVYQ+D+VLLPL+             +P K    + PK S   
Sbjct  154  GVVNTTVANTVFSDRRIAVYQVDQVLLPLQIFGTTPAPAPAPAKPEKDVPVSTPKASTGD  213

Query  369  SPADEPSPAANGEPNSAGRMSQFGLGLAPAAVVLFCMGVF  250
            + A           NS+G +    L L P A+V F   +F
Sbjct  214  AGA-----------NSSGAIR--NLKLHPMAMVSFQFALF  240



>ref|XP_009130731.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Brassica 
rapa]
Length=243

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 101/150 (67%), Gaps = 6/150 (4%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQI-ITSTDGVSVLAAPDSAFTSLPSGT  718
            P +I  +L+   Q+ +F++ L  +     QI+TQ+  +S+ G++V A  D+AF+SL SGT
Sbjct  34   PTNITAVLEKAGQYTMFIRLLK-STQAADQINTQLNSSSSQGLTVFAPTDNAFSSLKSGT  92

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVT  550
            LN LSDQQKV+L+QFH+LP   ++   +T SNP+ T AG    G+F LN T S  QVN+T
Sbjct  93   LNSLSDQQKVQLVQFHVLPTLLTMPQFQTVSNPLRTQAGDGQSGKFPLNITSSGNQVNIT  152

Query  549  SGVVQTQVSNIMRKNFPLAVYQIDKVLLPL  460
            +GVV   V+N +  +  LAVYQ+D+VLLPL
Sbjct  153  TGVVSATVANSVYSDKQLAVYQVDQVLLPL  182



>ref|XP_009760303.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Nicotiana 
sylvestris]
Length=250

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 96/150 (64%), Gaps = 5/150 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P +I  IL+   QF  F++ L T    G QI+TQ+  S  G++V A  D+AF+SL +GTL
Sbjct  36   PTNITKILEKAGQFTTFIRLLKTT-QAGDQINTQLNNSKQGMTVFAPTDNAFSSLKAGTL  94

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N LS QQ+V L+QFH+LP F S+   +T SNP+ T AG    G+F LN T    QVNV++
Sbjct  95   NSLSSQQQVSLVQFHLLPNFISISQFQTVSNPLRTQAGDTSPGDFPLNVTTLGNQVNVST  154

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLE  457
            G+V   V+N +  +  LAVYQ+DKVL PL 
Sbjct  155  GIVDATVANTIYTDGELAVYQVDKVLQPLS  184



>ref|XP_011089317.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Sesamum 
indicum]
Length=248

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 98/151 (65%), Gaps = 5/151 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P +I  IL+   QF   ++       +G QI+TQ+  S  G+++ A  D+AF+SL +GTL
Sbjct  36   PTNITKILEKAGQFTTLIRLFQIT-QVGDQINTQLNNSNQGLTLFAPTDNAFSSLQAGTL  94

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N LSDQQKV L+QFHILP F S+   +T SNP+ T AG    GE+ LN T ++ QVN+++
Sbjct  95   NSLSDQQKVSLVQFHILPTFLSMSQFQTVSNPLRTQAGDSAAGEYPLNVTTASNQVNIST  154

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            GV    V+N +  +  LAVYQ+DKVLLPL+ 
Sbjct  155  GVDDATVANTIYTDGQLAVYQVDKVLLPLKI  185



>ref|NP_001043814.1| Os01g0668100 [Oryza sativa Japonica Group]
 dbj|BAD73656.1| arabinogalactan protein-like [Oryza sativa Japonica Group]
 dbj|BAD73684.1| arabinogalactan protein-like [Oryza sativa Japonica Group]
 dbj|BAF05728.1| Os01g0668100 [Oryza sativa Japonica Group]
 gb|EAY75309.1| hypothetical protein OsI_03200 [Oryza sativa Indica Group]
 dbj|BAG97310.1| unnamed protein product [Oryza sativa Japonica Group]
Length=247

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 82/217 (38%), Positives = 119/217 (55%), Gaps = 14/217 (6%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS--TDGVSVLAAPDSAFTSLPSGTL  715
            ++  +L+ G Q+  F++ +        Q+++Q+  S   +G +V A  D+AF +L  GTL
Sbjct  37   NVTAVLEKGGQYTTFIRLMKETQQ-DTQLNSQLNNSFNGNGYTVFAPTDNAFNNLKPGTL  95

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE---FVLNFTG-SNGQVNVTS  547
            N L+ QQ+V L+Q H+LP+FYS+D  +TASNPV T A G    + LN T  +N  VNV++
Sbjct  96   NSLTQQQQVALVQGHVLPQFYSMDSFQTASNPVRTQASGTDGPYTLNITSTTNNNVNVST  155

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLE-FTSKARPTLGNKGRPNKTAAAAPKNSKEH  370
            GVV+  V+N +    PLAVY +DKVLLP E F  KA             + A PK     
Sbjct  156  GVVEVTVTNALSAVKPLAVYSVDKVLLPFELFGVKAPAAA------PTASTAKPKKGGST  209

Query  369  SPADEPSPAANGEPNSAGRMSQFGLGLAPAAVVLFCM  259
              A  P+ A + EP  A      G G+A  A V+ C+
Sbjct  210  EAASGPAGAEDAEPTGAASARAVGWGVAGLAAVVGCL  246



>ref|XP_009421475.1| PREDICTED: fasciclin-like arabinogalactan protein 13 [Musa acuminata 
subsp. malaccensis]
Length=249

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 81/225 (36%), Positives = 133/225 (59%), Gaps = 27/225 (12%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P+++  IL+ G Q+  F++ L     +G+QI++Q+  S +G+++    D+AF++L +GTL
Sbjct  37   PLNLTGILEKGGQYGTFLRLLR-ETQVGEQIESQLNNSFNGLTIFVPTDNAFSNLKAGTL  95

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE---FVLNFTGSNGQVNVTSG  544
            N L+ Q++V L+ +H+LP++YS    ET SNPV T A G    + +N T ++ QVNV++G
Sbjct  96   NSLTTQEQVSLVLYHVLPRYYSPTTFETTSNPVNTQASGRSGVYTVNITSTSNQVNVSTG  155

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLE-FTSKARPTLGNKGRPNKTAAAAPKNSKEHS  367
            V +T ++  +   FPLAV+ +DKVLLP E F +K   +         + AA P   K+ +
Sbjct  156  VNETPINTNLYLEFPLAVFSVDKVLLPAELFGAKPPASS-------PSPAATPVKPKKSA  208

Query  366  P-ADEPSPAANGEPNSAGRMSQ-------FGLGLAPAAVVLFCMG  256
            P AD PS +A+  P++A R  +        G+GLA       C+G
Sbjct  209  PAADGPSASADTAPSAATRKGRSVERVLLLGIGLA-------CVG  246



>emb|CDX80855.1| BnaC03g01090D [Brassica napus]
Length=243

 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 101/150 (67%), Gaps = 6/150 (4%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQI-ITSTDGVSVLAAPDSAFTSLPSGT  718
            P +I  +L+   Q+ +F++ L  +     QI+TQ+  +S+ G++V A  D+AF+SL SGT
Sbjct  34   PTNITAVLEKAGQYTMFIRLLK-STQAADQINTQLNSSSSQGLTVFAPTDNAFSSLKSGT  92

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVT  550
            LN LSDQQKV+L+QFH+LP   ++   +T SNP+ T AG    G+F LN T S  QVN+T
Sbjct  93   LNSLSDQQKVQLVQFHVLPTLLTMPQFQTVSNPLRTQAGDGQNGKFPLNITSSGNQVNIT  152

Query  549  SGVVQTQVSNIMRKNFPLAVYQIDKVLLPL  460
            +GVV   V+N +  +  +AVYQ+D+VLLPL
Sbjct  153  TGVVSATVANSVYSDKQIAVYQVDQVLLPL  182



>ref|XP_004143241.1| PREDICTED: fasciclin-like arabinogalactan protein 11-like [Cucumis 
sativus]
 ref|XP_004156302.1| PREDICTED: fasciclin-like arabinogalactan protein 11-like [Cucumis 
sativus]
 gb|KGN48139.1| hypothetical protein Csa_6G445040 [Cucumis sativus]
Length=248

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 84/223 (38%), Positives = 120/223 (54%), Gaps = 14/223 (6%)
 Frame = -1

Query  987  VPLILIFLLFPHQIHTQpattapppssstTWPVDIIDILKTGKQFNIFVKFLDTANHLGK  808
            +   LI LLF   I  Q              P +I  IL+   QF+   K L +      
Sbjct  8    ISFFLISLLFSKSISAQSTQPPGFS-----GPTNISAILEKAGQFSTMNKLLKSTQQ-SD  61

Query  807  QIDTQIITSTDG--VSVLAAPDSAFTSLPSGTLNKLSDQQKVRLIQFHILPKFYSLDDLE  634
            QI+ Q+  S  G  ++V A PD+AF++L  GTLN LSDQQKV+L+Q+H++P F S+   +
Sbjct  62   QINNQLNNSNQGQGLTVFAPPDNAFSNLKPGTLNSLSDQQKVQLVQYHVVPTFISMSQFQ  121

Query  633  TASNPVETLAG----GEFVLNFTGSNGQVNVTSGVVQTQVSNIMRKNFPLAVYQIDKVLL  466
            T SNP+ T AG    G+F LN T S  QVN+T+GVV   V+N +  +  LAVYQ+DKVLL
Sbjct  122  TVSNPLRTQAGNSNAGQFPLNVTTSGSQVNLTTGVVDAVVANTIYTDGQLAVYQVDKVLL  181

Query  465  PLEFTSKARPTLGNKGRPNK--TAAAAPKNSKEHSPADEPSPA  343
            P++             +P K  + A AP  + + + +D+   A
Sbjct  182  PVDLFGTVAAPAPAPSKPVKAVSGADAPAGASKDTSSDDSGAA  224



>gb|ABV27477.1| fasciclin-like arabinogalactan protein 6 [Gossypium hirsutum]
Length=241

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 96/150 (64%), Gaps = 7/150 (5%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS--TDGVSVLAAPDSAFTSLPSGTL  715
            +I  IL+ G QF  F+K L  A  +  Q++ Q+ T    DG++V A  D+AF+ L  GTL
Sbjct  32   NITSILEKGGQFTTFIKLLK-ATQVADQLNNQLSTPDPNDGITVFAPSDNAFSGLKPGTL  90

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA----GGEFVLNFTGSNGQVNVTS  547
            N LSDQ+K++L+QFHILP   S    +TASNP+ T A    GG+F LN T    QVNVT+
Sbjct  91   NSLSDQEKLQLVQFHILPTLMSTSQFQTASNPLRTQAGDVKGGKFPLNVTAEGNQVNVTT  150

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLE  457
            GVV   V N +  +  +AVYQ+DKVLLPLE
Sbjct  151  GVVNATVENSVFSDRRIAVYQVDKVLLPLE  180



>emb|CDY11242.1| BnaA03g00780D [Brassica napus]
Length=243

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 100/150 (67%), Gaps = 6/150 (4%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQI-ITSTDGVSVLAAPDSAFTSLPSGT  718
            P +I  +L+   Q+ +F++ L +      QI+TQ+  +S+ G++V A  D+AF+SL SGT
Sbjct  34   PTNITAVLEKAGQYTMFIRLLKS-TQAADQINTQLNSSSSQGLTVFAPTDNAFSSLKSGT  92

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVT  550
            LN LSDQQKV+L+QFH+LP   ++   +T SNP+ T AG    G+F LN T S  Q N+T
Sbjct  93   LNSLSDQQKVQLVQFHVLPTLLTMPQFQTVSNPLRTQAGDGQNGKFPLNITSSGNQANIT  152

Query  549  SGVVQTQVSNIMRKNFPLAVYQIDKVLLPL  460
            +GVV   V+N +  +  LAVYQ+D+VLLPL
Sbjct  153  TGVVSATVANSVYSDKQLAVYQVDQVLLPL  182



>ref|XP_003567900.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Brachypodium 
distachyon]
Length=245

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 110/188 (59%), Gaps = 9/188 (5%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNK  709
            ++  +L    Q+  F++ + +      Q+++Q+  S  G +V A  D+AF SL +GTLN 
Sbjct  39   NVTAVLDKAGQYTKFMRLMKSTQQ-DTQLNSQLNGSDTGFTVFAPTDNAFDSLKAGTLNS  97

Query  708  LSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE---FVLNFTG-SNGQVNVTSGV  541
            LS Q++V L+Q HI+P F+S++  ETASNPV T A G    + +N T  SNGQVNV++G+
Sbjct  98   LSQQEQVSLVQAHIVPAFFSMESFETASNPVRTQASGADGPYTVNVTATSNGQVNVSTGL  157

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLEF----TSKARPTLGNKGRPNKTAAAAPKNSKE  373
            V T V   +RK  PLAVY +DKVLLP +        + P    K  P K  A AP   ++
Sbjct  158  VSTMVGTALRKEKPLAVYSVDKVLLPYDLFGPKPPASAPPAPGKKAPAKGGAKAPAGEED  217

Query  372  HSPADEPS  349
             +PA + S
Sbjct  218  SAPASKAS  225



>ref|XP_004243817.1| PREDICTED: fasciclin-like arabinogalactan protein 9 [Solanum 
lycopersicum]
Length=250

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 89/226 (39%), Positives = 129/226 (57%), Gaps = 27/226 (12%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            VD+  IL+ G ++N F+KFL     +G +I+ +   S+DGV+VLA  D+AF +L    +N
Sbjct  35   VDVYHILEGGGEYNTFIKFL-KETKVGDRINYKA-NSSDGVTVLAPTDNAFKNL----IN  88

Query  711  KLSDQQKV--RLIQFHILPKFYSLDDLETASNPVETLAGGE----FVLNFTGSNGQVNVT  550
             +SD +    +LI +H++ KFY  D+L+T  NPVETLA GE      LNFTG   Q+NV+
Sbjct  89   SISDDEHKLQQLINYHVISKFYEFDELQTVHNPVETLATGEDNEPLGLNFTGKKNQLNVS  148

Query  549  SGVVQTQVSNIMRKNF------PLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAP  388
            SG V   V+N+  K        PLAVY++DKVL+P EF     P+  +   P K A    
Sbjct  149  SGYV---VTNVYEKAISISTDPPLAVYKLDKVLVPSEFIDPKSPSSNDAPAPAK-AKNGT  204

Query  387  KNSKEHSPADEPSP--AANGEPNSAGRMSQFGLGLAPAAVVLFCMG  256
             +  E +  D+PSP  AA  +PN A R++   +G+      +F MG
Sbjct  205  SDDDEITADDKPSPITAAATKPNDAKRIN---VGILCLISCVFLMG  247



>gb|AFK43105.1| unknown [Lotus japonicus]
Length=248

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 98/247 (40%), Positives = 138/247 (56%), Gaps = 36/247 (15%)
 Frame = -1

Query  999  LHLSVPLILIFL----LFPHQIHTQpattapppssstTWPVDIIDILKTGKQFNIFVKFL  832
            +  S PL LI L    LF  +I  Q    AP        PV++  IL+   Q+   ++ L
Sbjct  1    MAFSKPLALILLTFLSLFASKIQAQAPAPAPSG------PVNLTAILEKAGQYTTLIRLL  54

Query  831  DTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNKLSDQQKVRLIQFHILPKFY  652
              +  L  QI++Q+ ++T G ++ A  D+AF +L SG +N L+D QKV+LI +H+ PK+Y
Sbjct  55   KESQQL-TQIESQLNSTTQGFTLFAPTDNAFQNLKSGAINDLTDDQKVKLILYHVTPKYY  113

Query  651  SLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTSGVVQTQVSNIMRKNFPLAVYQI  481
            SL DL+T SNPV T A    G + LNF G   QVNVT+GVV T ++N +R+ FPLA+YQ+
Sbjct  114  SLSDLQTVSNPVRTQASEKEGSWGLNFKGQGNQVNVTTGVVTTSINNDLRQQFPLAIYQV  173

Query  480  DKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSPADE----------PSPAANGE  331
            D+VLLPLE                  ++A    S E +P+DE          PSPAA+ +
Sbjct  174  DRVLLPLELFGAK-----------SPSSAPSPKSSETTPSDETPSSGKKGGAPSPAASQK  222

Query  330  PNS-AGR  313
             N  AGR
Sbjct  223  DNGVAGR  229



>ref|XP_002440247.1| hypothetical protein SORBIDRAFT_09g028480 [Sorghum bicolor]
 gb|EES18677.1| hypothetical protein SORBIDRAFT_09g028480 [Sorghum bicolor]
Length=245

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 96/147 (65%), Gaps = 6/147 (4%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGTLN  712
            ++  IL+ G Q+  F++ + +      Q+++Q+  S   G +V A  D+AF SL  GTLN
Sbjct  32   NVTAILEKGGQYTTFIRLMKSTQQ-DTQLNSQLNNSFGSGYTVFAPTDNAFASLKPGTLN  90

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE---FVLNFTG-SNGQVNVTSG  544
            KLS Q++V L+QFH+LP+FYSLD  ETASNPV T A G    + LN T  SN QVNV++G
Sbjct  91   KLSQQEQVSLVQFHVLPQFYSLDSFETASNPVRTQASGSDGPYTLNITADSNSQVNVSTG  150

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLP  463
            VV T++   +R   PLAVY +D VLLP
Sbjct  151  VVATRLGTALRATQPLAVYSVDTVLLP  177



>ref|XP_009769903.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Nicotiana 
sylvestris]
Length=239

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 96/150 (64%), Gaps = 5/150 (3%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            +++  IL    Q + F++ L     L  +I +Q+  S +G+++    D+AF S+ +GTLN
Sbjct  33   LNVTKILDKAGQCSTFIRLLQNTQQL-NEITSQLNNSNNGITMFVPTDNAFLSMKAGTLN  91

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGG----EFVLNFTGSNGQVNVTSG  544
              +DQQK  LIQFHILP +YSL   +TASNP+ T AGG    EF +N T +   VN+T+G
Sbjct  92   SFTDQQKAELIQFHILPTYYSLTQFQTASNPLRTQAGGTSNREFPINITTTGSSVNITTG  151

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            +V   VSN +  +  LA+YQ+D+VLLPL+F
Sbjct  152  IVNASVSNTIYTDNQLAIYQVDQVLLPLKF  181



>ref|XP_008798234.1| PREDICTED: fasciclin-like arabinogalactan protein 9 [Phoenix 
dactylifera]
Length=254

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/200 (38%), Positives = 116/200 (58%), Gaps = 16/200 (8%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P+++  +L+ G Q+N+ ++ L     + +QI++Q+  S +G++V A  D+AF+SL +GTL
Sbjct  37   PLNLTAVLEKGGQYNMLIRLLR-GTQVEQQINSQLNNSFNGLTVFAPTDNAFSSLEAGTL  95

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE---FVLNFTGSNGQVNVTSG  544
            N L+ QQ+V L+ +H+L ++YSL   +T SNPV+T A G    + LN T +  QVN+++G
Sbjct  96   NSLNQQQQVALVLYHVLSRYYSLSSFQTTSNPVQTQASGSNGVYTLNITSTTSQVNISTG  155

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEF-----TSKARPTLGNKGRPNKTAAAAPKNS  379
            VV T ++N +   FPLAVY ++KVLLP         + A      K   N     APK  
Sbjct  156  VVDTLITNTLTSYFPLAVYSVEKVLLPYGLFGAKPPATAPAPAKEKPGKNDNTPTAPK--  213

Query  378  KEHSPADEPSPAANGEPNSA  319
                 AD PS      P+SA
Sbjct  214  -----ADGPSADVGSSPSSA  228



>ref|XP_008783124.1| PREDICTED: fasciclin-like arabinogalactan protein 6 [Phoenix 
dactylifera]
Length=287

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 98/151 (65%), Gaps = 5/151 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P+ +  IL+   Q+   ++ L     +G+Q+ +Q+  S DG+++ A  D+AF+SL SG L
Sbjct  76   PLSLTAILEKSGQYTTLLRLLKV-TQVGEQVQSQLNNSYDGLTIFAPTDNAFSSLKSGAL  134

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE----FVLNFTGSNGQVNVTS  547
            N L+ Q++V L+ +H+LP++YSL   +TASNPV T A G     + +N T S+ Q NV++
Sbjct  135  NSLNPQEQVSLVLYHVLPRYYSLTTFQTASNPVRTQASGSNGAVYTVNVTTSSNQANVST  194

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            GV +T +SN +   FPLAVY IDKVLLP + 
Sbjct  195  GVDETPISNALYSEFPLAVYSIDKVLLPYDL  225



>ref|XP_010052360.1| PREDICTED: fasciclin-like arabinogalactan protein 13 [Eucalyptus 
grandis]
 gb|KCW89588.1| hypothetical protein EUGRSUZ_A01871 [Eucalyptus grandis]
Length=249

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 125/215 (58%), Gaps = 18/215 (8%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNK  709
            ++  IL    Q+  F++ L T   +  QI+ Q+ TST+G++V A  D+AF +L +GT+N 
Sbjct  46   NLTGILDKNGQYTSFIRLLTTT-QVANQIENQLNTSTEGLTVFAPTDNAFNNLKAGTIND  104

Query  708  LSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGEFV-LNFTGSNGQVNVTSGVVQT  532
            LS++Q+V+L+  H+ PK+YSL   ++ SNPV T   G F  LNF+    QVNV++G+V+T
Sbjct  105  LSNEQQVQLVLNHVAPKYYSLLSFQSVSNPVRT--QGNFAGLNFSSQGNQVNVSTGMVET  162

Query  531  QVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPK---NSKEHSPA  361
             ++N + +  PLAVYQ+DKVLLP        P L     P  +  AAPK   +S   + A
Sbjct  163  PINNALYQQSPLAVYQVDKVLLP--------PELFEAPAPASSTPAAPKSSSSSNSTTSA  214

Query  360  DEPSPAANGEPNSAGRMSQFGLGLAPAAVVLFCMG  256
              PS A N    ++G+ S   LG     V + CMG
Sbjct  215  KAPS-AENSNSGASGK-SNMWLGFV-VGVGMMCMG  246



>ref|XP_003538216.1| PREDICTED: fasciclin-like arabinogalactan protein 12-like [Glycine 
max]
Length=295

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/225 (37%), Positives = 131/225 (58%), Gaps = 20/225 (9%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGTL  715
            VDI+ IL+  K FNI ++ + T   L  Q++ Q++T+ + G+++LA  DS+F+ L +G L
Sbjct  72   VDIVGILRKAKSFNILIRLMKT-TQLINQLNAQLLTTKSGGITILAPDDSSFSELKAGFL  130

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTSG  544
            N LSD QK+ L+QFH++  + S  + +T +NPV TLAG   G+  LN     G VN+++G
Sbjct  131  NSLSDGQKLELLQFHVISDYVSSSNFDTLTNPVRTLAGAKPGKVELNVISYGGSVNISTG  190

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKAR-----PTLGNKGRPNKTAAAAPKNS  379
             V T ++ I+  +  LA+Y++ KVLLP++F   A+     P+L  +  P+  AA APK  
Sbjct  191  EVNTTITGIIYTDKHLALYKVGKVLLPMDFFVVAKAPAKAPSLAPE--PSSDAAKAPKAD  248

Query  378  KEHSPADEPSPAANGEPNSA--------GRMSQFGLGLAPAAVVL  268
            K+ S + + S   + E NS         G+    GLGLA  A  +
Sbjct  249  KDESSSSDSSQVNSAEQNSGTAKMISVYGKWVSIGLGLALVATTM  293



>ref|XP_006826651.1| hypothetical protein AMTR_s00393p00013250 [Amborella trichopoda]
 gb|ERM93888.1| hypothetical protein AMTR_s00393p00013250 [Amborella trichopoda]
Length=237

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 102/173 (59%), Gaps = 7/173 (4%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P ++  IL    QF + ++ L +   +  QI   +  S  G+++ A  D+AF SLP GTL
Sbjct  26   PPNVTGILSRAGQFTVLIRLLQST-QVANQITNTLNNSNQGLTLFAPTDNAFNSLPPGTL  84

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVET----LAGGEFVLNFT--GSNGQVNV  553
            N LS Q +V LI +H+LP+FYSL   +T SNPV T    + GG++ LN T   S+ QVNV
Sbjct  85   NSLSQQDQVTLILYHVLPQFYSLQGFQTLSNPVRTQASGMGGGQYTLNVTTVASSMQVNV  144

Query  552  TSGVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAA  394
            T+G+V T ++N +    PLAVY++DKVLLPL+      PT   +     TA A
Sbjct  145  TTGLVTTPIANSINVTSPLAVYEVDKVLLPLDMFGVKPPTGAPQAAETPTAGA  197



>ref|XP_009377418.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Pyrus x 
bretschneideri]
Length=241

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/199 (38%), Positives = 112/199 (56%), Gaps = 3/199 (2%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNK  709
            ++  +L+   QF   +K L +   +  QI+TQ+ TS  G+++ A  D+AF+SL +GTLN 
Sbjct  36   NVTAVLEKAGQFTTLIKLLKS-TKMDDQINTQLSTSNQGITIFAPTDNAFSSLKAGTLNS  94

Query  708  LSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGEFVLNFTGSNGQVNVTSGVVQTQ  529
            +S+QQK++L+QFHILP FYS    +T SNP+ T AG    LN T S   VN+T+GVV   
Sbjct  95   ISEQQKLQLVQFHILPSFYSAAQFQTVSNPLHTQAGNS-PLNVTTSGNLVNITTGVVNAT  153

Query  528  VSNIMRKNFPLAVYQIDKVLLPLE-FTSKARPTLGNKGRPNKTAAAAPKNSKEHSPADEP  352
            V+N +  +  LAVY++D+VLLPL  F   A     +K       A +P  S +     + 
Sbjct  154  VANTIFTDSQLAVYEVDQVLLPLSIFGPAAPAPAPSKSETKVKGADSPSGSSDRGSTADS  213

Query  351  SPAANGEPNSAGRMSQFGL  295
            S A   E +     +  G+
Sbjct  214  STAMGLEQHGIAEAASVGI  232



>ref|XP_003606417.1| Fasciclin-like arabinogalactan protein [Medicago truncatula]
 gb|AES88614.1| fasciclin-like arabinogalactan protein [Medicago truncatula]
Length=292

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 115/184 (63%), Gaps = 12/184 (7%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQII-TSTDGVSVLAAPDSAFTSLPSGTL  715
            VDI+ IL+  K FN+F++ + T   L  Q+++Q++ T T G+++LA  DSAF+ L +G L
Sbjct  72   VDIVGILRKAKAFNVFIRLMKT-TQLINQLNSQLLATKTGGLTILAPDDSAFSGLKAGFL  130

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTSG  544
            N LSD QK+ L+QFH++  + S  + +T +NPV TLAG   G+  LN     G VN+++G
Sbjct  131  NSLSDGQKLELLQFHVISDYVSSSNFDTLTNPVRTLAGDKPGKVELNVVSYGGSVNISTG  190

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSP  364
             V T ++ I+  +  LA+Y++ KVLLP++F S A+        P K  + AP+ S + + 
Sbjct  191  EVNTTINGIVYTDKRLAIYKVGKVLLPMDFFSVAK-------APGKAPSLAPEPSTDSAK  243

Query  363  ADEP  352
            A +P
Sbjct  244  APKP  247



>ref|XP_006591618.1| PREDICTED: fasciclin-like arabinogalactan protein 12-like [Glycine 
max]
Length=312

 Score =   130 bits (327),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 85/227 (37%), Positives = 131/227 (58%), Gaps = 20/227 (9%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGT  718
            P DI  ILK  K F++ ++ L T   +   I++Q+IT+ + G+++LA  DSAF++L +G 
Sbjct  74   PDDITRILKKAKMFSVLIRLLKTT-EIMNNINSQLITAKSGGITILAPDDSAFSNLKAGF  132

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTS  547
            LN L++ QK+ L+QFHILP+F S  + ++ SNPV+T+AG       LN       VN+++
Sbjct  133  LNSLNEGQKIELVQFHILPEFVSSSNFDSLSNPVQTVAGKDPARLPLNVNALGNSVNIST  192

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF--TSKARPTLGNKGRPNKTAAAAPKNSKE  373
            GVV   V  ++  +  L +Y +DKVLLPL+F  T+KA P L        T A APK++K+
Sbjct  193  GVVNATVLGVVYSDNKLGIYHVDKVLLPLDFFVTNKA-PALA-----PTTLAKAPKSAKD  246

Query  372  HSPADEPSPAANGEPNSAGRMSQFGLG------LAPAAVVLFCMGVF  250
            +S  D+     N   N +G +S   +G      L  A V +  MG+ 
Sbjct  247  NSSEDD-QEGTNQHQNKSGAVSVVSIGRTTLMLLGIALVAVATMGLI  292



>ref|XP_006361812.1| PREDICTED: fasciclin-like arabinogalactan protein 12-like [Solanum 
tuberosum]
Length=239

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 96/150 (64%), Gaps = 5/150 (3%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            +++  IL+   Q + F++ L     L  +I +Q+  S +G+++    D+AF ++ +GTLN
Sbjct  33   LNVTKILEKAGQCSTFIRLLQNTQQL-NEITSQLNNSNNGITMFVPTDNAFLNMKAGTLN  91

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGG----EFVLNFTGSNGQVNVTSG  544
              +DQQK  LIQFHILP +YSL   +TASNP+ T AGG    EF +N T     VN+T+G
Sbjct  92   SFTDQQKAELIQFHILPTYYSLTQFQTASNPLRTQAGGTTDREFPINITTIGSSVNITTG  151

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            +V T +SN +  +  LA+YQ+D VLLPL+F
Sbjct  152  IVNTSISNTIYTDNQLAIYQVDNVLLPLQF  181



>ref|XP_009404414.1| PREDICTED: fasciclin-like arabinogalactan protein 6 [Musa acuminata 
subsp. malaccensis]
Length=313

 Score =   130 bits (326),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 101/150 (67%), Gaps = 4/150 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P+++  IL+ G Q+  F++ L     +G+QI++Q+  S +G+++ A  D+AF +L  GTL
Sbjct  101  PLNLTGILEKGGQYGTFLRLLKET-QVGEQIESQLNNSFNGLTIFAPTDNAFNNLKPGTL  159

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE---FVLNFTGSNGQVNVTSG  544
            N L+ Q++V L+ +H+LP++Y+L   ET SNPV T A G    + +N T S+ QVNV++G
Sbjct  160  NSLTTQEQVSLVLYHVLPRYYTLSTFETTSNPVNTQASGSNGVYTINITSSSNQVNVSTG  219

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            V +T V+N +  +FPLAVY +DKVLL  E 
Sbjct  220  VNETPVNNNLHLDFPLAVYSVDKVLLAPEL  249



>ref|XP_010916030.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Elaeis 
guineensis]
Length=254

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 101/150 (67%), Gaps = 4/150 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P+++  IL+ G Q+   ++ L     +G+Q+ +Q+  S DG+++ A  D+AF+SL SGTL
Sbjct  42   PLNVTAILEKGGQYTTLLRLLK-ETQVGEQVQSQLNNSYDGLTIFAPTDNAFSSLKSGTL  100

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE---FVLNFTGSNGQVNVTSG  544
            N L+ Q++V L+ +H+LP+FYSL   +T SNPV T A G    +++N T S+ QVNV++G
Sbjct  101  NGLNPQEQVSLVLYHVLPRFYSLTTFQTTSNPVRTQASGNNGVYMINVTTSSNQVNVSTG  160

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            V    +++ +  +FPLAVY IDKVLLP + 
Sbjct  161  VDDAPINDDLYSDFPLAVYSIDKVLLPYDL  190



>ref|XP_004246666.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Solanum 
lycopersicum]
Length=239

 Score =   128 bits (321),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 96/150 (64%), Gaps = 5/150 (3%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            +++  IL+   Q + F++ L     L  +I +Q+  S +G+++    D+AF ++ +GTLN
Sbjct  33   LNVTKILEKAGQCSTFIRLLQNTQQL-NEITSQLNNSNNGITMFVPTDNAFLNMKAGTLN  91

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGG----EFVLNFTGSNGQVNVTSG  544
              +DQQK  LIQFHILP +YSL   +TASNP+ T AGG    EF +N T +   VN+T+G
Sbjct  92   SFNDQQKAELIQFHILPTYYSLTQFQTASNPLRTQAGGTTDREFPINITTTGSSVNITTG  151

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            +V   +SN +  +  LA+YQ+D VLLPL+F
Sbjct  152  IVNASISNTIYTDNQLAIYQVDNVLLPLQF  181



>ref|XP_004304418.1| PREDICTED: fasciclin-like arabinogalactan protein 12-like [Fragaria 
vesca subsp. vesca]
Length=246

 Score =   128 bits (321),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 96/146 (66%), Gaps = 5/146 (3%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNK  709
            ++  +L+   QF   +K L  +     QI+TQ+ TS  G+++ A  D+AF SL +GTLN 
Sbjct  37   NVTAVLEKAGQFTTLIKLLK-STKTADQINTQLSTSNQGITIFAPTDNAFASLKAGTLNS  95

Query  708  LSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTSGV  541
            +++QQK++L+QFHILP +YS    +TA+NP+ T AG    G+F LN T S  QVN+T+GV
Sbjct  96   ITEQQKLQLLQFHILPTYYSTSQFQTATNPLHTQAGNSDDGQFPLNVTTSGTQVNITTGV  155

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLP  463
                VSN +  +  LAVYQ+D+VLLP
Sbjct  156  DTASVSNTIFTDNQLAVYQVDQVLLP  181



>ref|XP_004505977.1| PREDICTED: fasciclin-like arabinogalactan protein 12-like [Cicer 
arietinum]
 ref|XP_004517220.1| PREDICTED: fasciclin-like arabinogalactan protein 12-like [Cicer 
arietinum]
Length=255

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 96/150 (64%), Gaps = 4/150 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P DII IL+    F   ++ L T   +  QI++Q++TS  G+++ A  D+AF+SL  G L
Sbjct  43   PTDIIRILRKAGGFATLIRLLQTT-KVSTQINSQLLTSNGGLTMFAPNDNAFSSLKPGFL  101

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE---FVLNFTGSNGQVNVTSG  544
            N LSD+QK +LIQFH+LP F S+ + +T SNPV T AG +     LN T S  QVN+T+G
Sbjct  102  NSLSDEQKNKLIQFHLLPTFVSVSNFDTLSNPVRTQAGDDPYRLALNVTSSGNQVNITTG  161

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            +V   +   +  +  LAVYQ+DKVLLP +F
Sbjct  162  IVNVTLGGTVYTDHQLAVYQVDKVLLPRDF  191



>ref|XP_011002659.1| PREDICTED: fasciclin-like arabinogalactan protein 13 [Populus 
euphratica]
Length=245

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 85/203 (42%), Positives = 123/203 (61%), Gaps = 11/203 (5%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            V+   +L  G QF  F+  L+       QI+ QI +S++G+++ A  D+AF +L SG LN
Sbjct  37   VNFTAVLVKGGQFVTFISLLNKTQTF-NQIENQINSSSEGMTIFAPTDNAFNNLKSGALN  95

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE---FVLNFTGSNGQVNVTSGV  541
             L+ QQ+V+L+Q+H+LPKFYSL +L   SNPV T A G+   + LNF+G + QVNV++G+
Sbjct  96   DLNQQQQVQLLQYHMLPKFYSLSNLLLVSNPVPTQASGQEGVWGLNFSGKSNQVNVSTGL  155

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLE-FTSKARPTLGNKGRPNKTAAAAPKNSKEHSP  364
            V+ Q++N +R++FPLAVY +DKVLLP E F  K             T  ++P  S     
Sbjct  156  VEVQLNNALRQDFPLAVYPVDKVLLPEELFGVKPPSA---SPPAPATKGSSPGKSNSSDT  212

Query  363  ADEPSPAANGEPNSAGRMSQFGL  295
            A EPSP  N   ++ GR    GL
Sbjct  213  AAEPSPGKN---SAGGRNVALGL  232



>ref|XP_010104108.1| hypothetical protein L484_014391 [Morus notabilis]
 gb|EXB98549.1| hypothetical protein L484_014391 [Morus notabilis]
Length=250

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 99/145 (68%), Gaps = 3/145 (2%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNK  709
            DI  IL    QF + ++ L  +  +G QI+ Q+ ++   +++ A PD+AF+SL +GTLN+
Sbjct  42   DIYKILIKAGQFTVLLRLL-RSTQVGDQINNQLSSTNSELTLFAPPDNAFSSLKTGTLNQ  100

Query  708  LSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGG--EFVLNFTGSNGQVNVTSGVVQ  535
            LSDQQKV+L+QFH++P F S+ + +T SNPV+T A    E+ LN T +  QVN+T+GVV 
Sbjct  101  LSDQQKVQLVQFHLVPAFISISNFQTLSNPVQTQAADTYEYPLNITTNGSQVNITTGVVN  160

Query  534  TQVSNIMRKNFPLAVYQIDKVLLPL  460
            T ++  +  +  LAVYQ+DKVL PL
Sbjct  161  TTITGTVYSDNQLAVYQVDKVLQPL  185



>ref|XP_007132229.1| hypothetical protein PHAVU_011G076900g [Phaseolus vulgaris]
 gb|ESW04223.1| hypothetical protein PHAVU_011G076900g [Phaseolus vulgaris]
Length=291

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 82/226 (36%), Positives = 131/226 (58%), Gaps = 23/226 (10%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGTL  715
            VDI+ IL+  K FNI ++ + T   L  Q++ Q++T+ + G+++LA  DS+F+ L +G L
Sbjct  71   VDIVGILRQAKSFNILIRLMKT-TQLINQLNAQLLTTKSGGITILAPDDSSFSELKAGFL  129

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTSG  544
            N LSD QK+ L+QFH+L  + S  + +T +NPV TLAG   G+  LN     G VN+++G
Sbjct  130  NSLSDGQKLELLQFHVLSDYVSSSNFDTLTNPVRTLAGAKPGKVELNVISYGGSVNISTG  189

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKAR-----PTLGNKGRPNKTAAAAPKNS  379
             V T ++ I+  +  LA+Y++ KVLLPL+F + A+     P+L    +P+  A  APK  
Sbjct  190  EVNTTITGIVYTDKHLAIYKVGKVLLPLDFFTVAKAPAKAPSLA--PQPSTDATKAPKAD  247

Query  378  KEH---------SPADEPSPAANGEPNSAGRMSQFGLGLAPAAVVL  268
            K+          +P ++ S     + N  G++   GLGLA  A  +
Sbjct  248  KDDSSSSDSSHVNPTEQNS--GTDKINMYGKLVSLGLGLALVATTM  291



>gb|ACZ67174.1| fasciclin and related adhesion glycoprotein [Populus deltoides]
Length=240

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 107/184 (58%), Gaps = 11/184 (6%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P ++  +L+ G QF++F++ L  A      ++ Q+  + + +++ A  D+AF+SL SGTL
Sbjct  36   PTNVTKVLEKGGQFSVFIRLLK-ATQEDVTLNGQLNNTNNAITIFAPSDNAFSSLKSGTL  94

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA--GGEFVLNFTGSNGQVNVTSGV  541
            N LSDQ+K  L+QFHI+P+F S    +T SNP+ T A  GG   LN T +   VN+T+G+
Sbjct  95   NSLSDQEKAELVQFHIIPQFLSSSQFQTVSNPLTTQAGSGGRLELNVTTTGNSVNITTGL  154

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLEF---TSKARPTLGNKGRPNKTAAAAPKNSKEH  370
              T VS  +  +  LAVYQ+DKVLLPL+              K +    AAA+P+     
Sbjct  155  TNTSVSGTIYTDNQLAVYQVDKVLLPLDIFTPKPPTPAPAPEKSKKRSKAAASPE-----  209

Query  369  SPAD  358
            SPAD
Sbjct  210  SPAD  213



>gb|KHN32072.1| Fasciclin-like arabinogalactan protein 11 [Glycine soja]
Length=278

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/220 (38%), Positives = 130/220 (59%), Gaps = 18/220 (8%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGT  718
            P DI  ILK  K F++ ++ L T   +   I++Q+IT+ + G+++LA  DSAF++L +G 
Sbjct  61   PDDITRILKKAKMFSVLIRLLKTT-EIMNNINSQLITAKSGGITILAPDDSAFSNLKAGF  119

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTS  547
            LN L++ QK+ L+QFHILP+F S  + ++ SNPV+T+AG       LN       VN+++
Sbjct  120  LNSLNEGQKIELVQFHILPEFVSSSNFDSLSNPVQTVAGKDPARLPLNVNALGNSVNIST  179

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF--TSKARPTLGNKGRPNKTAAAAPKNSKE  373
            GVV   +  ++  +  L +Y +DKVLLPL+F  T+KA P L        T A APK +KE
Sbjct  180  GVVNATILGVVYSDNKLGIYHVDKVLLPLDFFLTNKA-PALA-----PTTLAKAPKAAKE  233

Query  372  HSPADEPSPAANGEPNSAGRMSQFGLGLAPAAVVLFCMGV  253
            +S +D+     +   N +G +S   LG A    +L  +G+
Sbjct  234  NS-SDDDQEETDQNHNKSGAVSLVSLGGA----MLMSIGI  268



>ref|XP_009630866.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Nicotiana 
tomentosiformis]
Length=239

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 96/150 (64%), Gaps = 5/150 (3%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            +++  IL    Q + F++ L     L  +I +Q+  S +G+++    D+AF S+ +GTLN
Sbjct  33   LNVTKILDKAGQCSTFIRLLQNTQQL-NEITSQLNNSNNGITMFVPTDNAFLSMKAGTLN  91

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGG----EFVLNFTGSNGQVNVTSG  544
              +DQQK  LIQFHILP +YSL   +TASNP+ T AGG    EF +N T +   VN+T+G
Sbjct  92   SFTDQQKAELIQFHILPTYYSLTQFQTASNPLRTQAGGTSNREFPINITTTGSSVNITTG  151

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            +V   VS+ +  +  LA+YQ+D+VLLPL+F
Sbjct  152  IVNASVSSTIYTDNQLAIYQVDQVLLPLKF  181



>gb|ACJ85305.1| unknown [Medicago truncatula]
Length=221

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 95/150 (63%), Gaps = 4/150 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P DII ILK    F   ++ L T   +  QI++Q++ S  G+++ A  D++F+SL  G L
Sbjct  40   PTDIIRILKKAGGFTTLIRLLQTT-QVSTQINSQLLNSNGGLTLFAPNDNSFSSLKPGFL  98

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE---FVLNFTGSNGQVNVTSG  544
            N LSD+QK +LIQFH+LP F S+ + +T SNPV T AG +     LN T S  QVN+T+G
Sbjct  99   NSLSDEQKNKLIQFHLLPTFVSMSNFDTLSNPVRTQAGDDPYRLGLNVTSSGNQVNMTTG  158

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            +V   V   +  +  LAVYQ+DKVLLP +F
Sbjct  159  IVNVTVGGTVYTDHQLAVYQVDKVLLPRDF  188



>ref|XP_003538053.1| PREDICTED: fasciclin-like arabinogalactan protein 12-like [Glycine 
max]
 gb|KHN22058.1| Fasciclin-like arabinogalactan protein 11 [Glycine soja]
Length=290

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 123/207 (59%), Gaps = 9/207 (4%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGTL  715
            VDI+ IL+  K FNI ++ + T   L  Q++ Q++T+ + G+++L+  DSAF+ L  G L
Sbjct  70   VDIVGILRKAKSFNILIRLMKT-TQLINQLNAQLLTTKSGGITILSPDDSAFSELKVGFL  128

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTSG  544
            N LSD QK+ L+QFH+L  + S  + +T +NPV TLAG   G+  LN     G VN+++G
Sbjct  129  NSLSDGQKLELLQFHVLSDYVSSSNFDTLTNPVRTLAGAKPGKVELNVISYGGSVNISTG  188

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKG---RPNKTAAAAPKNSKE  373
             V T ++ I+  +  LA+Y++ KVLLP++F + A+           P+  AA APK  K+
Sbjct  189  EVNTTITGIIYTDKHLAIYKVGKVLLPMDFFAVAKAPAKAPSLAPEPSSDAAKAPKADKD  248

Query  372  HSPADEPSPAANGEPNSA-GRMSQFGL  295
             S + + S     E NS   ++S +G+
Sbjct  249  ESSSSDASQVNPTEQNSGIEKISVYGM  275



>ref|XP_002458287.1| hypothetical protein SORBIDRAFT_03g030690 [Sorghum bicolor]
 gb|EES03407.1| hypothetical protein SORBIDRAFT_03g030690 [Sorghum bicolor]
Length=248

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 98/154 (64%), Gaps = 7/154 (5%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANH---LGKQIDTQIITSTDGVSVLAAPDSAFTSLPS  724
            P ++  +L+ G Q+ +F++ +        L  Q+++   ++  G +V A  D+AF SL  
Sbjct  36   PPNVTAVLEKGGQYTMFMRLMKETQQDTQLNSQLNSSFASNGGGYTVFAPTDNAFNSLKP  95

Query  723  GTLNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE---FVLNFTG-SNGQVN  556
            GTLN L+ QQ+V L+Q H+LP+FYS+D  +TASNPV T A G    + LN T  +N Q+N
Sbjct  96   GTLNSLTQQQQVALVQGHVLPQFYSMDSFQTASNPVRTQASGRDGPYTLNVTSTTNNQLN  155

Query  555  VTSGVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            V++GVV+  V+N +    PLAVY +DKVLLPLE 
Sbjct  156  VSTGVVEVTVNNALSAVKPLAVYSVDKVLLPLEL  189



>dbj|BAD61084.1| putative arabinogalactan protein [Oryza sativa Japonica Group]
Length=269

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 85/219 (39%), Positives = 118/219 (54%), Gaps = 17/219 (8%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNK  709
            +I  +L    QFN  ++ + +     +QID Q+ +S +G++V A  D+AFTSLPSGTLN 
Sbjct  54   NITGVLAKAGQFNTLIRLMRSTGA-AEQIDNQLNSSRNGLTVFAPTDNAFTSLPSGTLNS  112

Query  708  LSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTSGV  541
            LSDQQK  L+Q+H+L     +   +T SNP+ T AG    G++ LN T    QVN+++GV
Sbjct  113  LSDQQKNSLVQYHVLSTLIPMSQFDTVSNPLRTQAGSNSPGQYPLNVTAEGQQVNISTGV  172

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLG-------NKGR-PNKTAAAAPK  385
            V   V N +     L VYQ+DKVLLP+   S   P           KG+ P  + A AP+
Sbjct  173  VNATVGNALYTGDNLVVYQVDKVLLPMAIYSTPAPAPAPLSPATKKKGKTPATSVADAPE  232

Query  384  NSKEHSPADEPSPAANGEPNSAGRMSQFGLGLAPAAVVL  268
             +     A  PS AA      AG     G+ LA A+V L
Sbjct  233  AADATPDATTPSLAAARVTAGAG----VGVVLALASVWL  267



>ref|XP_003606412.1| Fasciclin-like arabinogalactan protein [Medicago truncatula]
 gb|AES88609.1| fasciclin-like arabinogalactan protein [Medicago truncatula]
Length=291

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 115/184 (63%), Gaps = 12/184 (7%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQII-TSTDGVSVLAAPDSAFTSLPSGTL  715
            VDI+ IL+  K +N+F++ + T   L  Q+++Q++ T T G+++LA  DSAF+ L +G L
Sbjct  72   VDIVGILRKAKAYNVFIRLMKTT-QLINQLNSQLLATKTGGLTILAPDDSAFSGLKAGFL  130

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTSG  544
            N LSD QK+ L+QFH++  + S  + +T +NPV TLAG   G+  LN     G VN+++G
Sbjct  131  NSLSDGQKLELLQFHVISDYVSSSNFDTLTNPVRTLAGDKPGKVELNVVSYGGSVNISTG  190

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSP  364
             V T ++ I+  +  LA+Y++ KVLLP++F S A+        P K  + AP+ S + + 
Sbjct  191  EVNTTINGIIYTDKRLAIYKVGKVLLPMDFFSVAK-------APGKAPSLAPEPSTDTAK  243

Query  363  ADEP  352
            A +P
Sbjct  244  APKP  247



>gb|AAO92753.1| arabinogalactan protein [Gossypium hirsutum]
Length=243

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/215 (38%), Positives = 121/215 (56%), Gaps = 18/215 (8%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P ++  IL+   QF +F++ L  +  +  Q+  Q+  S +G++V A  D+AF+SL SGTL
Sbjct  37   PTNVTKILEKAGQFTLFIRLLK-STQVANQLLGQLNNSNNGMTVFAPTDNAFSSLKSGTL  95

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N L+D+QKV L+QFHI+P + +    +T SNP+ T AG    G+F LN T S   VN+T+
Sbjct  96   NSLTDEQKVELVQFHIVPTYLTSSQFQTISNPLRTQAGDSGDGKFPLNITTSGNSVNITT  155

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHS  367
            G+  T VS  +  +  LAVYQID+VL PL+           +      A A  KN K  +
Sbjct  156  GLTNTSVSGTIYTDGQLAVYQIDQVLQPLQI-------FAPRPPAPAPAPAKSKNKKATT  208

Query  366  PADEP--SPAANGEPNSAGRMSQFGLGLAPAAVVL  268
             AD P  +PA N +  +   +  FG+    AA+V+
Sbjct  209  VADSPDVTPADNSKAATLQNVGLFGV----AALVI  239



>gb|AFK46797.1| unknown [Medicago truncatula]
Length=291

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 115/184 (63%), Gaps = 12/184 (7%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQII-TSTDGVSVLAAPDSAFTSLPSGTL  715
            VDI+ IL+  K +N+F++ + T   L  Q+++Q++ T T G+++LA  DSAF+ L +G L
Sbjct  72   VDIVGILRKAKAYNVFIRLMKTT-QLINQLNSQLLATKTGGLTILAPDDSAFSGLKAGFL  130

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTSG  544
            N LSD QK+ L+QFH++  + S  + +T +NPV TLAG   G+  LN     G VN+++G
Sbjct  131  NSLSDGQKLELLQFHVISDYVSSSNFDTLTNPVRTLAGDKPGKVELNVVSYGGSVNISTG  190

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSP  364
             V T ++ I+  +  LA+Y++ KVLLP++F S A+        P K  + AP+ S + + 
Sbjct  191  EVNTTINGIIYTDKRLAIYKVGKVLLPMDFFSVAK-------APGKAPSLAPEPSTDTAK  243

Query  363  ADEP  352
            A +P
Sbjct  244  APKP  247



>gb|ADE62309.1| fasciclin-like arabinogalactan protein [Eucalyptus nitens]
Length=248

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 95/151 (63%), Gaps = 7/151 (5%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIIT--STDGVSVLAAPDSAFTSLPSG  721
            P ++  IL+   QF  F++ L ++  +G Q+ +Q+    S  G ++ A  D+AF SL SG
Sbjct  38   PTNVTAILEKAGQFTTFIRLLKSS-LVGDQLSSQLSNQKSNQGFTIFAPTDNAFASLKSG  96

Query  720  TLNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNV  553
            TLN LSDQ+K +L+QFHI+P   SL    T SNP+ T AG    G+F LN T S  QVNV
Sbjct  97   TLNMLSDQEKTQLVQFHIIPSVISLTQFSTISNPLRTQAGNTDNGQFPLNVTTSGNQVNV  156

Query  552  TSGVVQTQVSNIMRKNFPLAVYQIDKVLLPL  460
            T+GVV   V N +  N  LA+YQ+D+VLLPL
Sbjct  157  TTGVVAASVDNAITSNSKLAIYQVDQVLLPL  187



>ref|XP_009612445.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Nicotiana 
tomentosiformis]
Length=248

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 96/150 (64%), Gaps = 5/150 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P +I  IL+   QF   ++ +     +G QI+TQ+  S  G++V A  D+AF++L SGT+
Sbjct  35   PTNITKILEKAGQFTTLIRLMKVT-QVGDQINTQLNNSNQGMTVFAPTDNAFSNLKSGTI  93

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N LS QQ+V+L+QFH+LP F S+   +T SNP+ T AG    G+F LN T S  QVNV++
Sbjct  94   NSLSAQQQVQLVQFHVLPNFISMTQFQTVSNPLRTQAGDASPGDFPLNVTTSGNQVNVST  153

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLE  457
            GV    V+N +  +  LA+YQ+DKVL PL 
Sbjct  154  GVDDATVANTIYTDGQLALYQVDKVLQPLS  183



>gb|ABR68797.1| arabinogalactan protein 2 [Gossypium hirsutum]
 gb|ABV27472.1| fasciclin-like arabinogalactan protein 1 [Gossypium hirsutum]
Length=243

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/207 (38%), Positives = 117/207 (57%), Gaps = 14/207 (7%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P ++  IL+   QF +F++ L  +  +  Q+  Q+  S +G++V A  D+AF+SL SGTL
Sbjct  37   PTNVTKILEKAGQFTLFIRLLK-STQVANQLLGQLNNSNNGMTVFAPTDNAFSSLKSGTL  95

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N L+D+QKV+L+QFHI+P + +    +T SNP+ T AG    G+F LN T S   VN+T+
Sbjct  96   NSLTDEQKVQLVQFHIVPTYLTSSQFQTISNPLRTQAGDSGDGKFPLNVTTSGNSVNITT  155

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHS  367
            G+  T VS  +  +  LAVYQID+VL PL+           +      A A  KN K  +
Sbjct  156  GLTNTSVSGTIYTDGQLAVYQIDQVLQPLQI-------FAPRPPAPAPAPAKSKNKKATT  208

Query  366  PADEP--SPAANGEPNSAGRMSQFGLG  292
             AD P  +PA N +  +   +  FG+ 
Sbjct  209  VADSPDVTPADNSKAATLQNVGLFGVA  235



>gb|KHN38782.1| Fasciclin-like arabinogalactan protein 11 [Glycine soja]
Length=303

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 84/227 (37%), Positives = 130/227 (57%), Gaps = 20/227 (9%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGT  718
            P DI  ILK  K F++ ++ L T   +   I++Q+IT+ + G+++LA  DSAF++L +G 
Sbjct  65   PDDITRILKKAKMFSVLIRLLKTT-EIMNNINSQLITAKSGGITILAPDDSAFSNLKAGF  123

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTS  547
            LN L++ QK+ L+Q HILP+F S  + ++ SNPV+T+AG       LN       VN+++
Sbjct  124  LNSLNEGQKIELVQLHILPEFVSSSNFDSLSNPVQTVAGKDPARLPLNVNALGNSVNIST  183

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF--TSKARPTLGNKGRPNKTAAAAPKNSKE  373
            GVV   V  ++  +  L +Y +DKVLLPL+F  T+KA P L        T A APK++K+
Sbjct  184  GVVNANVLGVVYSDNKLGIYHVDKVLLPLDFFVTNKA-PALA-----PTTLAKAPKSAKD  237

Query  372  HSPADEPSPAANGEPNSAGRMSQFGLG------LAPAAVVLFCMGVF  250
            +S  D+     N   N +G +S   +G      L  A V +  MG+ 
Sbjct  238  NSSEDD-QEGTNQHQNKSGAVSVVSIGRTTLMLLGIALVAVATMGLI  283



>ref|XP_004961219.1| PREDICTED: fasciclin-like arabinogalactan protein 11-like [Setaria 
italica]
Length=194

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 102/165 (62%), Gaps = 12/165 (7%)
 Frame = -1

Query  807  QIDTQIITS-TDGVSVLAAPDSAFTSLPSGTLNKLSDQQKVRLIQFHILPKFYSLDDLET  631
            Q+++Q+  S   G +V A  D+AFTSL  GTLNKLS Q++V L+Q+HILP+FYSLD  ET
Sbjct  9    QLNSQLNNSFGSGYTVFAPTDNAFTSLKPGTLNKLSQQEQVSLVQYHILPQFYSLDSFET  68

Query  630  ASNPVETLAGGE---FVLNFTG-SNGQVNVTSGVVQTQVSNIMRKNFPLAVYQIDKVLLP  463
            ASNPV T A G    + LN T  SN QVNV++G+V T+V   +R   PLAVY +DKVLLP
Sbjct  69   ASNPVRTQASGSDGPYTLNITADSNNQVNVSTGLVATRVGTALRDTQPLAVYSVDKVLLP  128

Query  462  LEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSPADEPSPAANGEP  328
             +         G K   +   A   K SK  S A+ P+ +A+  P
Sbjct  129  NDL-------FGVKPPSSAPPAPNKKPSKGGSVAEAPAGSADSAP  166



>gb|KHN05735.1| Fasciclin-like arabinogalactan protein 11 [Glycine soja]
Length=278

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/207 (39%), Positives = 124/207 (60%), Gaps = 14/207 (7%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGT  718
            P DI  ILK  K F++ ++ L T   +   I++Q+IT+ + G+++LA  DSAF++L +G 
Sbjct  61   PDDITRILKKAKMFSVLIRLLKTT-EIMNNINSQLITAKSGGITILAPDDSAFSNLKAGF  119

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTS  547
            LN L++ QK+ L+QFHILP+F S  + ++ SNPV+T+AG       LN       VN+++
Sbjct  120  LNSLNEGQKIELVQFHILPEFVSSSNFDSLSNPVQTVAGKDPARLPLNVNALGNSVNIST  179

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF--TSKARPTLGNKGRPNKTAAAAPKNSKE  373
            GVV   +  ++  +  L +Y +DKVLLPL+F  T+KA P L        T A APK +KE
Sbjct  180  GVVNATILGVVYSDNKLGIYHVDKVLLPLDFFLTNKA-PALA-----PTTLAKAPKAAKE  233

Query  372  HSPADEPSPAANGEPNSAGRMSQFGLG  292
            +S +D+     +   N +G +S   LG
Sbjct  234  NS-SDDDQEETDQNHNKSGAVSLVSLG  259



>ref|XP_010046692.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Eucalyptus 
grandis]
Length=251

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 95/151 (63%), Gaps = 7/151 (5%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIIT--STDGVSVLAAPDSAFTSLPSG  721
            P ++  IL+   QF  F++ L ++  +G Q+ +Q+    S  G ++ A  D+AF SL SG
Sbjct  38   PTNVTAILEKAGQFTTFIRLLKSS-LVGDQLSSQLSNQKSNQGFTIFAPTDNAFASLKSG  96

Query  720  TLNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNV  553
            TLN LSDQ+K +L+QFHI+P   SL    T SNP+ T AG    G+F LN T S  QVNV
Sbjct  97   TLNMLSDQEKTQLVQFHIIPSVISLTQFSTISNPLRTQAGNTDNGQFPLNVTTSGNQVNV  156

Query  552  TSGVVQTQVSNIMRKNFPLAVYQIDKVLLPL  460
            T+GVV   V N +  N  LA+YQ+D+VLLPL
Sbjct  157  TTGVVAASVDNAITSNSKLAIYQVDQVLLPL  187



>gb|AFK41879.1| unknown [Lotus japonicus]
Length=282

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 82/222 (37%), Positives = 129/222 (58%), Gaps = 14/222 (6%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDG-VSVLAAPDSAFTSLPSGT  718
            P DI  IL+  K F++ ++ L T   +   I++Q+IT+ +G +++LA  DSAF+ L +G 
Sbjct  66   PDDITKILRKAKIFSVLIRLLKTT-EIMNNINSQLITAKNGGITILAPDDSAFSHLKAGF  124

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGEFV---LNFTG-SNGQVNVT  550
            LN L++ QK+ L QFHILP++ S  + ++ SNPV+T+AG + V   LN     N  VN++
Sbjct  125  LNSLNENQKIELCQFHILPQYVSSSNFDSLSNPVQTVAGKDPVRLPLNVNALGNSIVNIS  184

Query  549  SGVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF--TSKARPTLGNKGRPNKTAAAAPKNSK  376
            +GVV   +  ++  +  LAVY +DKVLLPL+F  T+KA P L         +A APK +K
Sbjct  185  TGVVNASIIGVVYSDRNLAVYHVDKVLLPLDFFLTAKA-PALA-----PSLSAKAPKAAK  238

Query  375  EHSPADEPSPAANGEPNSAGRMSQFGLGLAPAAVVLFCMGVF  250
            E+S A++       + N +G +S          V L  +G+ 
Sbjct  239  ENSSAEDEDETNQDKDNKSGAVSLVKTTFMSLGVALVAIGMM  280



>dbj|BAB08198.1| unnamed protein product [Oryza sativa Japonica Group]
Length=255

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 81/215 (38%), Positives = 116/215 (54%), Gaps = 9/215 (4%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNK  709
            +I  +L    QFN  ++ + +     +QID Q+ +S +G++V A  D+AFTSLPSGTLN 
Sbjct  40   NITGVLAKAGQFNTLIRLMRSTGA-AEQIDNQLNSSRNGLTVFAPTDNAFTSLPSGTLNS  98

Query  708  LSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTSGV  541
            LSDQQK  L+Q+H+L     +   +T SNP+ T AG    G++ LN T    QVN+++GV
Sbjct  99   LSDQQKNSLVQYHVLSTLIPMSQFDTVSNPLRTQAGSNSPGQYPLNVTAEGQQVNISTGV  158

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSP-  364
            V   V N +     L VYQ+DKVLLP+   S   P         K     P  S   +P 
Sbjct  159  VNATVGNALYTGDNLVVYQVDKVLLPMAIYSTPAPAPAPLSPATKKKGKTPATSVADAPE  218

Query  363  ADEPSPAANGEPNSAGRMSQ---FGLGLAPAAVVL  268
            A + +P A     +A R++     G+ LA A+V L
Sbjct  219  AADATPDATTPSLAAARVTAGAGVGVVLALASVWL  253



>gb|AFK36056.1| unknown [Medicago truncatula]
Length=230

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 95/150 (63%), Gaps = 4/150 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P DII ILK    F   ++ L T   +  QI++Q++ S  G+++ A  D++F+SL  G L
Sbjct  40   PTDIIRILKKAGGFTTLIRLLQTT-QVSTQINSQLLNSNGGLTLFAPNDNSFSSLKPGFL  98

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE---FVLNFTGSNGQVNVTSG  544
            N LSD+QK +LIQFH+LP F S+ + +T SNPV T AG +     LN T S  QVN+T+G
Sbjct  99   NSLSDEQKNKLIQFHLLPTFVSMSNFDTLSNPVRTQAGDDPYRLGLNVTSSGNQVNMTTG  158

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            +V   V   +  +  LAVYQ+DKVLLP +F
Sbjct  159  IVNVTVGGTVYTDHQLAVYQVDKVLLPRDF  188



>ref|XP_010232123.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Brachypodium 
distachyon]
Length=250

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 98/153 (64%), Gaps = 7/153 (5%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS--TDGVSVLAAPDSAFTSLPSG  721
            P ++  IL  G Q+  F++ +        Q+++Q+  S   +G +V A  D+AF +L  G
Sbjct  37   PPNVTAILVKGGQYTTFIRLMKETQQ-DTQLNSQLNNSFNGNGYTVFAPTDNAFNNLKPG  95

Query  720  TLNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE---FVLNFTGS-NGQVNV  553
            TLN L+ QQ+V L+Q H+LP+FYS++  +TASNPV T A G+   F LN T + N QVNV
Sbjct  96   TLNSLTQQQQVALVQGHVLPQFYSMESFQTASNPVRTQASGQDGPFTLNITATANNQVNV  155

Query  552  TSGVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            +SGV +  V+N +    PLAVY +DKVLLPLEF
Sbjct  156  SSGVSEVTVNNALSDKKPLAVYSVDKVLLPLEF  188



>gb|ACU15329.1| unknown [Glycine max]
Length=172

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 94/138 (68%), Gaps = 5/138 (4%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            V++  IL+ G Q+   +K L     L  QI++Q+ +++ G ++ A  D+AF SL  G LN
Sbjct  36   VNLTAILEKGGQYTTLMKLLKDTQQL-TQIESQLKSNSQGFTLFAPTDNAFQSLKPGALN  94

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNG-QVNVTSG  544
            KLSD QKV+LI FH+ PK+Y++ DL T SNPV T A    G + LNFTG  G QVN+++G
Sbjct  95   KLSDDQKVKLILFHVTPKYYTISDLLTVSNPVRTQATEKEGTWGLNFTGQGGNQVNISTG  154

Query  543  VVQTQVSNIMRKNFPLAV  490
            VVQTQ++N +R+ FPLAV
Sbjct  155  VVQTQLNNPLREKFPLAV  172



>ref|XP_003606406.1| Fasciclin-like arabinogalactan protein [Medicago truncatula]
 gb|AES88603.1| fasciclin-like arabinogalactan protein [Medicago truncatula]
Length=250

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 95/150 (63%), Gaps = 4/150 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P DII ILK    F   ++ L T   +  QI++Q++ S  G+++ A  D++F+SL  G L
Sbjct  40   PTDIIRILKKAGGFTTLIRLLQTT-QVSTQINSQLLNSNGGLTLFAPNDNSFSSLKPGFL  98

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE---FVLNFTGSNGQVNVTSG  544
            N LSD+QK +LIQFH+LP F S+ + +T SNPV T AG +     LN T S  QVN+T+G
Sbjct  99   NSLSDEQKNKLIQFHLLPTFVSMSNFDTLSNPVRTQAGDDPYRLGLNVTSSGNQVNMTTG  158

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            +V   V   +  +  LAVYQ+DKVLLP +F
Sbjct  159  IVNVTVGGTVYTDHQLAVYQVDKVLLPRDF  188



>ref|XP_004246667.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Solanum 
lycopersicum]
Length=247

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 99/149 (66%), Gaps = 6/149 (4%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNK  709
            ++  IL+   Q + F++ L T   + +   T ++ +++ +++   PD+AF S+  GTLN 
Sbjct  47   NVTKILEKAGQCSTFIRLLQTTQEISQ--ITSLLNNSNSITIFVPPDNAFLSMKEGTLNS  104

Query  708  LSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGG----EFVLNFTGSNGQVNVTSGV  541
            L+DQQK  LI+FH+LP+++SL   +TASNP++T AGG    EF +N T +   VN+T+G+
Sbjct  105  LNDQQKSELIKFHVLPQYFSLSQFQTASNPMQTQAGGTSNREFPINITTNGTSVNITTGI  164

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            V   +SN +  +  LA+YQ+DKVLLPL+F
Sbjct  165  VNASISNTIYIDSQLAIYQVDKVLLPLQF  193



>ref|XP_009630865.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Nicotiana 
tomentosiformis]
Length=256

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 99/149 (66%), Gaps = 6/149 (4%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNK  709
            ++  IL+   Q + F++ L T   + +   T ++ +++ +++   PD+AF ++ +GTLN 
Sbjct  47   NVTKILEKAGQCSTFIRLLQTTQEISQ--ITSLLNNSNSITIFVPPDNAFLNMKAGTLNS  104

Query  708  LSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGG----EFVLNFTGSNGQVNVTSGV  541
             +DQQK  LI+FHILP+++S+   +TASNPV+T AGG    EF +N T +   VN+T+G+
Sbjct  105  FNDQQKAELIKFHILPQYFSISQFQTASNPVQTQAGGTSNREFPINITTNGTSVNITTGI  164

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            V   +SN +  +  LA+YQ+DKVLLPL+F
Sbjct  165  VNASISNTVYTDSQLAIYQVDKVLLPLQF  193



>emb|CAN62433.1| hypothetical protein VITISV_022135 [Vitis vinifera]
Length=247

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 121/214 (57%), Gaps = 18/214 (8%)
 Frame = -1

Query  978  ILIFLLFPHQIHTQpattapppssstTWPVDIIDILKTGKQFNIFVKFLDTANHLGKQID  799
            +L+ +LF H   T+ +  +  P+ +   P +I  IL+   Q+  F++ L +   +  +I+
Sbjct  9    VLLLILFLH--CTRTSGQSSAPAPAPAGPTNITAILEKAGQYTTFIRLLKST-QMDDRIN  65

Query  798  TQIITSTDGVSVLAAPDSAFTSLPSGTLNKLSDQQKVRLIQFHILPKFYSLDDLETASNP  619
             Q+  S  G+++ A  D+AF++L +GTLN  +DQQK +L+QFH++  F S    +T SNP
Sbjct  66   IQLNNSNQGLTIFAPTDNAFSNLKAGTLNSFTDQQKAQLVQFHVVSSFLSTSQFQTVSNP  125

Query  618  VETLAG----GEFVLNFTGSNGQVNVTSGVVQTQVSNIMRKNFPLAVYQIDKVLLPLEFT  451
            V T AG    G+F LN T S  QVN+TSG+  T V+N +  +  LAVYQID+VLLP+   
Sbjct  126  VSTQAGGSNSGDFSLNITTSGNQVNMTSGLTNTSVANTVYTDGQLAVYQIDQVLLPMGVV  185

Query  450  SKARPTLGNKGRPNKTAAAAPKNSKEHSPADEPS  349
                       RP+      PK  K  SP+D PS
Sbjct  186  -----------RPSAPPPETPKPKKAASPSDAPS  208



>gb|ABB97042.1| unknown [Brassica rapa]
Length=248

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 95/148 (64%), Gaps = 5/148 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P ++  IL+   QF +F++ L +   +  Q+  Q+  S +G+++ A  DS+F+SL +GTL
Sbjct  36   PTNVTKILEKAGQFTVFIRLLKSTG-VANQLYGQLNNSDNGITIFAPSDSSFSSLKAGTL  94

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N LSD+Q+V L+QFH++P + S  + +T SNP+ T AG    G F LN T S   VN+TS
Sbjct  95   NSLSDEQQVELVQFHVIPSYVSSSNFQTISNPLRTQAGDSAEGHFPLNITTSGNTVNITS  154

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLP  463
            GV  T VS  +  +  LAVYQ+DKVLLP
Sbjct  155  GVTNTTVSGSVYSDGQLAVYQVDKVLLP  182



>gb|EAY72628.1| hypothetical protein OsI_00494 [Oryza sativa Indica Group]
Length=269

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 84/219 (38%), Positives = 118/219 (54%), Gaps = 17/219 (8%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNK  709
            +I  +L    QFN  ++ + +     +QID Q+ +S +G++V A  D+AFTSLPSGTLN 
Sbjct  54   NITGVLAKAGQFNTLIRLMRSTGA-AEQIDNQLNSSRNGLTVFAPTDNAFTSLPSGTLNS  112

Query  708  LSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTSGV  541
            LSDQQK  L+Q+H+L     +   +T SNP+ T AG    G++ LN T    QVN+++GV
Sbjct  113  LSDQQKNSLVQYHVLSTLIPMSQFDTVSNPLRTQAGSNSPGQYPLNVTAEGQQVNISTGV  172

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLEF-------TSKARPTLGNKGR-PNKTAAAAPK  385
            V   V N +     L VYQ+DKVLLP+          +   P    KG+ P  + A AP+
Sbjct  173  VNATVGNALYTGDNLVVYQVDKVLLPMAIYGTPAPAPAPLSPATKKKGKTPATSVADAPE  232

Query  384  NSKEHSPADEPSPAANGEPNSAGRMSQFGLGLAPAAVVL  268
             +     A  PS AA      AG     G+ LA A+V L
Sbjct  233  AADATPDATTPSLAAARVTAGAG----VGVVLALASVWL  267



>ref|XP_002325592.1| fasciclin-like arabinogalactan-protein 9 [Populus trichocarpa]
 gb|EEE99973.1| fasciclin-like arabinogalactan-protein 9 [Populus trichocarpa]
Length=245

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 124/204 (61%), Gaps = 11/204 (5%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            PV+   +L  G QF  F+  L+       QI+ QI +S++G+++ A  D+AF++L SG L
Sbjct  36   PVNFTAVLVKGGQFVTFISLLNKTQTF-NQIENQINSSSEGMTIFAPTDNAFSNLKSGAL  94

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE---FVLNFTGSNGQVNVTSG  544
            N LS QQ+V+L+Q+H+LPKFYSL +L   SNPV T A G+   + LNFTG + QVNV++G
Sbjct  95   NGLSQQQQVQLLQYHMLPKFYSLSNLLLVSNPVPTQASGQEGVWGLNFTGQSNQVNVSTG  154

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLE-FTSKARPTLGNKGRPNKTAAAAPKNSKEHS  367
            +V+ QV+N +R++FPLAVY +DKVLLP E F  K             T  ++   S    
Sbjct  155  LVEVQVNNALRQDFPLAVYPVDKVLLPDELFGVKPPSA---SPPAPATKGSSSGKSNSSD  211

Query  366  PADEPSPAANGEPNSAGRMSQFGL  295
             A EPSP  N   ++ GR    GL
Sbjct  212  TAAEPSPGKN---SAGGRNVALGL  232



>ref|XP_009131912.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Brassica 
rapa]
Length=248

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 95/148 (64%), Gaps = 5/148 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P ++  IL+   QF +F++ L +   +  Q+  Q+  S +G+++ A  DS+F+SL +GTL
Sbjct  36   PTNVTKILEKAGQFTVFIRLLKSTG-VANQLYGQLNNSDNGITIFAPSDSSFSSLKAGTL  94

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N LSD+Q+V L+QFH++P + S  + +T SNP+ T AG    G F LN T S   VN+TS
Sbjct  95   NSLSDEQQVELVQFHVIPSYVSSSNFQTISNPLRTQAGDSAEGHFPLNITTSGNTVNITS  154

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLP  463
            GV  T VS  +  +  LAVYQ+DKVLLP
Sbjct  155  GVTNTTVSGSVYSDGQLAVYQVDKVLLP  182



>ref|XP_003539725.1| PREDICTED: fasciclin-like arabinogalactan protein 12-like [Glycine 
max]
Length=278

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 82/220 (37%), Positives = 128/220 (58%), Gaps = 18/220 (8%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGT  718
            P DI  ILK  K F++ ++ L T   +   I++Q+IT+ + G+++LA  DSAF++L +G 
Sbjct  61   PDDITRILKKAKMFSVLIRLLKTT-EIMNNINSQLITAKSGGITILAPDDSAFSNLKAGF  119

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTS  547
            LN L++ QK+ L+QFHILP+F S  + ++ SNPV+T+AG       LN       VN+++
Sbjct  120  LNSLNEGQKIELVQFHILPEFVSSSNFDSLSNPVQTVAGKDPARLPLNVNALGNSVNIST  179

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF--TSKARPTLGNKGRPNKTAAAAPKNSKE  373
            GVV   +  ++  +  L +Y +DKVLLPL+F  T+KA P L        T A APK +K+
Sbjct  180  GVVNATILGVVYSDNKLGIYHVDKVLLPLDFFLTNKA-PALA-----PTTLAKAPKAAKQ  233

Query  372  HSPADEPSPAANGEPNSAGRMSQFGLGLAPAAVVLFCMGV  253
            +S  D+         N +G +S   LG A    +L  +G+
Sbjct  234  NSSEDDQEETDQNH-NKSGAVSLVSLGGA----MLMSIGI  268



>emb|CDY67775.1| BnaCnng56350D [Brassica napus]
Length=248

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 95/148 (64%), Gaps = 5/148 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P ++  IL+   QF IF++ L +   +  Q+  Q+  S +G+++ A  DS+F+SL +GTL
Sbjct  36   PTNVTKILEKAGQFTIFIRLLKSTG-VANQLYGQLNNSDNGITIFAPSDSSFSSLKAGTL  94

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N LSD+Q+V L+QFH++P + S  + +T SNP+ T AG    G F LN T S   VN+TS
Sbjct  95   NSLSDEQQVELVQFHVVPSYVSSSNFQTISNPLRTQAGDSADGHFPLNITTSGNTVNITS  154

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLP  463
            GV  T VS  +  +  LAVYQ+DKVLLP
Sbjct  155  GVTNTTVSGSVYSDGQLAVYQVDKVLLP  182



>ref|XP_007132200.1| hypothetical protein PHAVU_011G074500g [Phaseolus vulgaris]
 gb|ESW04194.1| hypothetical protein PHAVU_011G074500g [Phaseolus vulgaris]
Length=280

 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 84/224 (38%), Positives = 128/224 (57%), Gaps = 17/224 (8%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGT  718
            P DI  ILK  K F+  V+ L T   +   I++Q+IT+ + G+++LA  DSAF++L +G 
Sbjct  63   PDDITRILKKAKMFSTLVRLLKTT-EIMNNINSQLITAKSGGITILAPDDSAFSNLKAGF  121

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE---FVLNFTGSNGQVNVTS  547
            LN L+  QK+ L+QFHILP+F S  + ++ SNPV+T+AG +     LN       VN+++
Sbjct  122  LNSLNAGQKIELVQFHILPEFVSSSNFDSLSNPVQTVAGKDPARLPLNVNALGNSVNIST  181

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF--TSKARPTLGNKGRPNKTAAAAPKNSKE  373
            GVV   +  ++  +  L +Y +DKVLLPL+F  T+KA P L        + A APK +KE
Sbjct  182  GVVNATILGVVYSDNKLGIYHVDKVLLPLDFFATNKA-PALA-----PSSLAKAPKAAKE  235

Query  372  HSPADEPSPAANGEPNSAGRMS---QFGLGLAPAAVVLFCMGVF  250
            +S +D+    AN + N +G +S     G       + LF M   
Sbjct  236  NS-SDDDQEEANQDHNKSGALSLSNVSGTKFVSLGIALFAMATM  278



>ref|XP_002455162.1| hypothetical protein SORBIDRAFT_03g005280 [Sorghum bicolor]
 gb|EES00282.1| hypothetical protein SORBIDRAFT_03g005280 [Sorghum bicolor]
Length=267

 Score =   126 bits (316),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 101/186 (54%), Gaps = 12/186 (6%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNK  709
            +I  +L  G QFN F++ L +   +  QID Q+    +G++V A  D+AFTSLP+GTLN 
Sbjct  51   NITGVLAKGGQFNTFIRLLKSTG-VASQIDNQVSNGGNGITVFAPTDNAFTSLPAGTLNS  109

Query  708  LSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTSGV  541
            LSDQ K  L+Q+H++     +   +T SNP+ T AG    GE+ LN T    QVN+T+GV
Sbjct  110  LSDQDKNALVQYHVVSTAIPMSQFDTVSNPLRTQAGSASPGEYPLNVTSEGQQVNITTGV  169

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLEF-------TSKARPTLGNKGRPNKTAAAAPKN  382
            V   V+N +     L VYQ+DKVLLP +                  KG+     A +P+ 
Sbjct  170  VNATVANSLYSEDSLVVYQVDKVLLPQKLFGAAEAPAPAPLAPAKKKGKTPAAVADSPEA  229

Query  381  SKEHSP  364
              E SP
Sbjct  230  EAEASP  235



>ref|XP_007132237.1| hypothetical protein PHAVU_011G077700g [Phaseolus vulgaris]
 gb|ESW04231.1| hypothetical protein PHAVU_011G077700g [Phaseolus vulgaris]
Length=290

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 112/178 (63%), Gaps = 5/178 (3%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGTL  715
            VDI+ IL+  K FNI ++ + T   L  Q++ Q++T+ + G+++LA  DS+F+ L +G L
Sbjct  69   VDIVGILRQAKSFNILIRLMKT-TQLINQLNAQLLTTKSGGITILAPDDSSFSELKAGFL  127

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTSG  544
            N LSD QK+ L+QFH+L  + S  + +T +NPV TLAG   G+  LN     G VN+++G
Sbjct  128  NSLSDGQKLELLQFHVLSDYVSSSNFDTLTNPVRTLAGAKPGKVELNVISYGGSVNISTG  187

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEH  370
             V T ++ I+  +  LA+Y++ KVLLP++F + A+    +     + +A APK  KE+
Sbjct  188  EVNTTITGIVYTDKHLAIYKVGKVLLPMDFFAVAKAPAKSPSLAPEPSAKAPKADKEN  245



>ref|XP_002280829.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Vitis vinifera]
Length=247

 Score =   125 bits (314),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 106/184 (58%), Gaps = 16/184 (9%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNK  709
            +I  IL+   Q+  F++ L +   +  +I+ Q+  S  G+++ A  D+AF++L +GTLN 
Sbjct  37   NITAILEKAGQYTTFIRLLKST-QMDDRINIQLNNSNQGLTIFAPTDNAFSNLKAGTLNS  95

Query  708  LSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTSGV  541
             +DQQK +L+QFH++  F S    +T SNPV T AG    G+F LN T S  QVN+TSG+
Sbjct  96   FTDQQKAQLVQFHVVSSFLSTSQFQTVSNPVSTQAGGSNSGDFSLNITTSGNQVNMTSGL  155

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSPA  361
              T V+N +  +  LAVYQID+VLLP+              RP+      PK  K  SP+
Sbjct  156  TNTSVANTVYTDGQLAVYQIDQVLLPMGVV-----------RPSAPPPETPKPKKAASPS  204

Query  360  DEPS  349
            D PS
Sbjct  205  DAPS  208



>ref|XP_009769904.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Nicotiana 
sylvestris]
Length=258

 Score =   125 bits (315),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 99/149 (66%), Gaps = 6/149 (4%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNK  709
            ++  IL+   Q + F++ L T   + +   T ++ +++ +++   PD+AF S+ +GTLN 
Sbjct  47   NVTKILEKAGQCSTFIRLLQTTQEISQ--ITSLLNNSNSITIFVPPDNAFLSMKAGTLNS  104

Query  708  LSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGG----EFVLNFTGSNGQVNVTSGV  541
             +DQQK  LI+FHILP+++S+   +TASNPV+T AGG    EF +N T +   VN+T+G+
Sbjct  105  FNDQQKAELIKFHILPQYFSISQFQTASNPVQTQAGGTSNREFPINITTNGTSVNITTGI  164

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            V   +S+ +  +  LA+YQ+DKVLLPL+F
Sbjct  165  VNASISSTIYTDSQLAIYQVDKVLLPLQF  193



>gb|ABS50664.1| fasciclin-like arabinogalactan protein [Eucalyptus grandis]
Length=251

 Score =   125 bits (314),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 95/151 (63%), Gaps = 7/151 (5%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIIT--STDGVSVLAAPDSAFTSLPSG  721
            P ++  IL+   QF  F++ L ++  +G Q+ +Q+    S  G ++ A  D+AF +L SG
Sbjct  38   PTNVTAILEKAGQFTTFIRLLKSS-LVGDQLSSQLSNQKSNQGFTIFAPTDNAFANLKSG  96

Query  720  TLNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNV  553
            TLN LSDQ+K +L+QFHI+P   SL    T SNP+ T AG    G+F LN T S  QVNV
Sbjct  97   TLNMLSDQEKTQLVQFHIIPSVISLTQFSTISNPLRTQAGNTDNGQFPLNVTTSGNQVNV  156

Query  552  TSGVVQTQVSNIMRKNFPLAVYQIDKVLLPL  460
            T+GVV   V N +  N  LA+YQ+D+VLLPL
Sbjct  157  TTGVVAASVDNAITSNSKLAIYQVDQVLLPL  187



>gb|KHN32074.1| Fasciclin-like arabinogalactan protein 11 [Glycine soja]
Length=239

 Score =   125 bits (313),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 96/151 (64%), Gaps = 5/151 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P DII ILK    F   ++ L  A  +  QI++Q++T++ G+++ A  D+AF+SL  G L
Sbjct  31   PTDIIRILKKAGGFTTLIRLLQ-ATQVSNQINSQLLTTSGGLTLFAPNDNAFSSLKPGFL  89

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNG-QVNVTS  547
            N L+DQQK  LIQFH+LP + S+ + +T SNPV T AG       LN T S G QVN+T+
Sbjct  90   NSLNDQQKNELIQFHLLPTYVSVSNFDTLSNPVRTQAGENPDRLALNITSSGGNQVNMTT  149

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            GVV   +   +  +  LAVYQ+DKVLLP +F
Sbjct  150  GVVNVTLGGTVYTDHQLAVYQVDKVLLPRDF  180



>ref|XP_003539723.1| PREDICTED: fasciclin-like arabinogalactan protein 12-like [Glycine 
max]
Length=280

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 123/209 (59%), Gaps = 14/209 (7%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGT  718
            P DI  ILK  K F++ ++ L T   +   I++Q+IT+ + G+++LA  DSAF++L +G 
Sbjct  65   PDDITRILKKAKMFSVLIRLLKTT-EIMNNINSQLITAKSGGITILAPDDSAFSNLKAGF  123

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTS  547
            LN L++ QK+ L+QFHILP+F S  + ++ SNPV+T+AG       LN       VN+++
Sbjct  124  LNSLNEGQKIELVQFHILPEFVSSSNFDSLSNPVQTVAGKDPARLPLNVNALGNSVNIST  183

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF--TSKARPTLGNKGRPNKTAAAAPKNSKE  373
            GVV   V  ++  +  L +Y +DKVLLPL+F  T+KA            T A +PK +K+
Sbjct  184  GVVNATVLGVVYSDNKLGIYHVDKVLLPLDFFITNKA------PASAPSTLAKSPKAAKD  237

Query  372  HSPADEPSPAANGEPNSAGRMSQFGLGLA  286
            +S +D+     N   N +G +S   +G A
Sbjct  238  NS-SDDDQEETNQHQNKSGAVSVVSIGGA  265



>ref|XP_007132234.1| hypothetical protein PHAVU_011G077400g [Phaseolus vulgaris]
 gb|ESW04228.1| hypothetical protein PHAVU_011G077400g [Phaseolus vulgaris]
Length=263

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 95/151 (63%), Gaps = 5/151 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P DII ILK    F   ++ L  A  +  QI++Q++T+  G+++ A  D+AF+SL  G L
Sbjct  56   PTDIIRILKKAGGFTTLIRLLQ-ATQVSNQINSQLLTTNGGLTLFAPNDNAFSSLKPGFL  114

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNG-QVNVTS  547
            N L+DQQK  LIQFH+LP F S+ + +T SNPV T AG       LN T S G QVN+T+
Sbjct  115  NSLNDQQKNELIQFHLLPTFVSVSNFDTLSNPVRTQAGENPDRLALNITSSGGNQVNMTT  174

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            G+V   +   +  +  LAVYQ+DKVLLP +F
Sbjct  175  GIVNVTLGGTVYTDHQLAVYQVDKVLLPRDF  205



>gb|ACZ67172.1| fasciclin and related adhesion glycoprotein, partial [Populus 
nigra]
Length=233

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 107/184 (58%), Gaps = 11/184 (6%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P ++  +L+ G QF++F++ L  A      ++ Q+  + + +++ A  D+AF+SL SGTL
Sbjct  29   PTNVTKVLEKGGQFSVFIRLLK-ATQEDVTLNGQLNNTNNAITIFAPSDNAFSSLKSGTL  87

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA--GGEFVLNFTGSNGQVNVTSGV  541
            N LSDQ+K  L+QFHI+P+F S    +T SNP+ T A  GG   LN T +   VN+T+G+
Sbjct  88   NSLSDQEKAELVQFHIIPQFLSSSQFQTVSNPLTTQAGSGGRLELNVTTTGNSVNITTGL  147

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLEF---TSKARPTLGNKGRPNKTAAAAPKNSKEH  370
              T VS  +  +  LAVYQ+DKVLLPL+              K +    AAA+P+     
Sbjct  148  TNTSVSGTIYTDNQLAVYQVDKVLLPLDIFTPKPPTPAPAPEKPKKRSKAAASPE-----  202

Query  369  SPAD  358
            SPAD
Sbjct  203  SPAD  206



>ref|XP_004148768.1| PREDICTED: fasciclin-like arabinogalactan protein 11-like [Cucumis 
sativus]
 gb|KGN64742.1| Arabinogalactan protein 2 [Cucumis sativus]
Length=243

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 105/183 (57%), Gaps = 3/183 (2%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            ++I  IL+ G QFN+ ++ L     +  QI+TQ+  S   +++ A  D+AF++L SGTLN
Sbjct  35   MNITKILEKGGQFNVLIRLLKNT-QVANQINTQLNDSNSELTLFAPTDNAFSNLQSGTLN  93

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGG--EFVLNFTGSNGQVNVTSGVV  538
             L+DQ+KV L+QFH++P F SL + +T SNPV T AG   EF LN T S   VNV+SG+V
Sbjct  94   SLNDQEKVELLQFHMIPTFLSLSNFQTISNPVRTQAGDAYEFPLNVTTSGNSVNVSSGLV  153

Query  537  QTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSPAD  358
             T +S  +  +  LA+YQID VL P+       P        +K  A     S + S  D
Sbjct  154  NTSISGTVYTDNQLAIYQIDSVLKPIGVFQPRPPPPAPAPEKSKKKAKGNSESPKDSDDD  213

Query  357  EPS  349
              S
Sbjct  214  NSS  216



>ref|XP_004505974.1| PREDICTED: fasciclin-like arabinogalactan protein 12-like [Cicer 
arietinum]
Length=292

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 117/184 (64%), Gaps = 10/184 (5%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGTL  715
            VDI+ IL+  K FN+F++ + T   L  Q+++Q++T+ + G+++LA  DSAF+ L +G L
Sbjct  73   VDIVGILRQAKSFNVFIRLMKTT-QLINQLNSQLLTTKSGGLTILAPDDSAFSELKAGYL  131

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTSG  544
            N LSD QK+ L+QFH++ ++ S  + +T +NPV TLAG   G+  LN     G VN+++G
Sbjct  132  NSLSDGQKLELLQFHVISEYVSSSNFDTLTNPVRTLAGAKPGKVELNVISYGGNVNISTG  191

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKG-----RPNKTAAAAPKNS  379
             V T ++ I+  +  LA+Y++ KVLLP++F + A+     KG      P+  AA APK  
Sbjct  192  EVNTTINGIIYTDKHLAIYKVAKVLLPVDFFAVAKAPAKAKGPSLAPGPSVDAAKAPKAD  251

Query  378  KEHS  367
            K+ S
Sbjct  252  KDTS  255



>ref|XP_008463798.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Cucumis 
melo]
Length=243

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 97/146 (66%), Gaps = 3/146 (2%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            ++I  IL+ G QFN+ ++ L +   +  QI+TQ+  S   +++ A  D+AF++L SGTLN
Sbjct  35   MNISKILEKGGQFNVLIRLLKST-QVANQINTQLNDSNSELTIFAPTDNAFSNLQSGTLN  93

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGG--EFVLNFTGSNGQVNVTSGVV  538
             L+DQ+KV L+QFH++P F SL + +T SNPV T AG   EF LN T S   VN++SG+V
Sbjct  94   SLNDQEKVELLQFHMIPTFLSLSNFQTISNPVRTQAGDAYEFPLNVTTSGNSVNISSGLV  153

Query  537  QTQVSNIMRKNFPLAVYQIDKVLLPL  460
             T +S  +  +  LA+YQID VL P+
Sbjct  154  NTSISGTVYTDNQLAIYQIDSVLKPI  179



>ref|XP_007132231.1| hypothetical protein PHAVU_011G077100g [Phaseolus vulgaris]
 gb|ESW04225.1| hypothetical protein PHAVU_011G077100g [Phaseolus vulgaris]
Length=283

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 80/202 (40%), Positives = 122/202 (60%), Gaps = 14/202 (7%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGT  718
            P DI  ILK  K F+  V+ L T   +   I++Q+IT+ + G+++LA  DSAF++L +G 
Sbjct  66   PDDITRILKKAKMFSTLVRLLKTT-EIMNNINSQLITAKSGGITILAPDDSAFSNLKAGF  124

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTS  547
            LN L+  QK+ L+QFHILP+F S  + ++ SNPV+T+AG       LN       VN+++
Sbjct  125  LNSLNAGQKIELVQFHILPEFVSSSNFDSLSNPVQTVAGKDPARLPLNVNALGNSVNIST  184

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF--TSKARPTLGNKGRPNKTAAAAPKNSKE  373
            GVV   +  ++  +  L +Y +DKVLLPL+F  T+KA P L        + A APK +KE
Sbjct  185  GVVNATILGVVYADNKLGIYHVDKVLLPLDFFVTNKA-PALA-----PSSLAKAPKAAKE  238

Query  372  HSPADEPSPAANGEPNSAGRMS  307
            +S +D+    AN + N +G +S
Sbjct  239  NS-SDDDQEEANQDHNKSGALS  259



>ref|XP_007132216.1| hypothetical protein PHAVU_011G076000g [Phaseolus vulgaris]
 gb|ESW04210.1| hypothetical protein PHAVU_011G076000g [Phaseolus vulgaris]
Length=292

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 77/201 (38%), Positives = 122/201 (61%), Gaps = 9/201 (4%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGTL  715
            VDI+ IL+  K FNI ++ + T   L  Q++ Q++T+ + G+++LA  DS+F+ L +G L
Sbjct  71   VDIVGILRQAKSFNILIRLMKTT-QLINQLNAQLLTTKSGGITILAPDDSSFSELKAGFL  129

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTSG  544
            N LSD QK+ L+QFH+L  + S  + +T +NPV TLAG   G+  LN     G VN+++G
Sbjct  130  NSLSDSQKLELLQFHVLSDYVSSSNFDTLTNPVRTLAGAKPGKVELNVISYGGSVNISTG  189

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKAR-PTLGNKGRPNKTAAAAPKNSKEH-  370
             V T ++ I+  +  LA+Y++ KVLLP++F + A+ P  G    P + +A APK  KE  
Sbjct  190  EVNTTITGIVYTDKHLAIYKVGKVLLPMDFFAVAKAPAKGPSLAP-EPSAKAPKADKEKP  248

Query  369  -SPADEPSPAANGEPNSAGRM  310
             SP    S   N   +++G +
Sbjct  249  VSPDSSESSDINSTNDNSGTV  269



>ref|XP_010107552.1| hypothetical protein L484_024406 [Morus notabilis]
 gb|EXC16234.1| hypothetical protein L484_024406 [Morus notabilis]
Length=269

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 99/156 (63%), Gaps = 15/156 (10%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIIT-----STDGVSVLAAPDSAFTSL  730
            P D+I +LK   QF  F+K +      G Q+  QI +      + G++V A  D AF+ L
Sbjct  48   PEDVIAVLKKAGQFTTFIKLMK-----GTQVSDQINSHLSGGGSQGITVFAPTDGAFSGL  102

Query  729  PSGTLNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGS-NG  565
             +GTLN LS +Q++RL+Q+H+LP +Y+L   +T SNP+ T AG    G++ LN T S + 
Sbjct  103  KTGTLNSLSSEQQIRLVQYHVLPAYYTLSQFQTVSNPLHTQAGNSDNGQYPLNVTTSTSN  162

Query  564  QVNVTSGVVQTQVSNIMRKNFPLAVYQIDKVLLPLE  457
            QVN+T+GVV   VSN +  +  LAV+Q+DKVLLP++
Sbjct  163  QVNITTGVVNATVSNTVYTDGQLAVFQVDKVLLPID  198



>ref|XP_007132209.1| hypothetical protein PHAVU_011G075300g [Phaseolus vulgaris]
 gb|ESW04203.1| hypothetical protein PHAVU_011G075300g [Phaseolus vulgaris]
Length=280

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/202 (40%), Positives = 122/202 (60%), Gaps = 14/202 (7%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGT  718
            P DI  ILK  K F+  V+ L T   +   I++Q+IT+ + G+++LA  DSAF++L +G 
Sbjct  63   PDDITRILKRAKMFSTLVRLLKTT-EIMNNINSQLITAKSGGITILAPDDSAFSNLKAGF  121

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTS  547
            LN L+  QK+ L+QFHILP+F S  + ++ SNPV+T+AG       LN       VN+++
Sbjct  122  LNSLNAGQKIELVQFHILPEFVSSSNFDSLSNPVQTVAGKDPARLPLNVNALGNSVNIST  181

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF--TSKARPTLGNKGRPNKTAAAAPKNSKE  373
            GVV   +  ++  +  L +Y +DKVLLPL+F  T+KA P L        + A APK +KE
Sbjct  182  GVVNATILGVVYADNKLGIYHVDKVLLPLDFFVTNKA-PALA-----PSSLAKAPKAAKE  235

Query  372  HSPADEPSPAANGEPNSAGRMS  307
            +S +D+    AN + N +G +S
Sbjct  236  NS-SDDDQEEANQDHNKSGALS  256



>ref|XP_011041714.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Populus 
euphratica]
Length=240

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 107/184 (58%), Gaps = 11/184 (6%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P ++  +L+ G QF++F++ L  A      ++ Q+  + + +++ A  D+AF+SL SGTL
Sbjct  36   PTNVTKVLEKGGQFSVFIRLLK-ATQEDVTLNGQLNNTNNAITIFAPSDNAFSSLKSGTL  94

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA--GGEFVLNFTGSNGQVNVTSGV  541
            N LSDQ+K  L+QFHI+P+F S    +T SNP+ T A  GG   LN T +   VN+T+G+
Sbjct  95   NSLSDQEKAELVQFHIIPQFLSSSQFQTVSNPLTTQAGSGGRLELNITTTGNSVNITTGL  154

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLEF---TSKARPTLGNKGRPNKTAAAAPKNSKEH  370
              T VS  +  +  LAVYQ+DKVLLPL+              K +    AAA+P+     
Sbjct  155  TNTSVSGTIYTDNQLAVYQVDKVLLPLDIFTPKPPTPAPAPEKPKKRSKAAASPE-----  209

Query  369  SPAD  358
            SPAD
Sbjct  210  SPAD  213



>ref|XP_007015428.1| FASCICLIN-like arabinogalactan-protein 11 [Theobroma cacao]
 gb|EOY33047.1| FASCICLIN-like arabinogalactan-protein 11 [Theobroma cacao]
Length=249

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 96/151 (64%), Gaps = 5/151 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P ++  IL+   QF +F++ L  A  +  Q+  Q+  + +G+++ A  D+AF+SL SGTL
Sbjct  42   PTNVTKILEKAGQFTLFIRLLK-ATAVANQLLGQLNNTNNGMTIFAPTDNAFSSLKSGTL  100

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N LSD+QKV L+QFHI+P + S    +T SNP+ T AG    G+F LN T S   VN+T+
Sbjct  101  NSLSDEQKVELVQFHIIPTYLSSTQFQTISNPLRTQAGDSADGKFPLNVTTSGNSVNITT  160

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            G+  T VS  +  +  LAVYQ+DKVL PL+ 
Sbjct  161  GLTNTSVSGTIYTDGQLAVYQVDKVLQPLQI  191



>ref|XP_003539724.1| PREDICTED: fasciclin-like arabinogalactan protein 12-like [Glycine 
max]
 gb|KHN05736.1| Fasciclin-like arabinogalactan protein 11 [Glycine soja]
 gb|KHN32071.1| Fasciclin-like arabinogalactan protein 11 [Glycine soja]
Length=280

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 124/209 (59%), Gaps = 14/209 (7%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGT  718
            P DI  ILK  K F++ ++ L T   +   I++Q+IT+ + G+++LA  DSAF++L +G 
Sbjct  65   PDDITRILKKAKMFSVLIRLLKTT-EIMNNINSQLITAKSGGITILAPDDSAFSNLKAGF  123

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTS  547
            LN L++ QK+ L+QFHILP+F S  + ++ SNPV+T+AG       LN       VN+++
Sbjct  124  LNSLNEGQKIELVQFHILPEFVSSSNFDSLSNPVQTVAGKDPARLPLNVNALGNSVNIST  183

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF--TSKARPTLGNKGRPNKTAAAAPKNSKE  373
            GVV   V  ++  +  L +Y +DKVLLPL+F  T+KA  +  +      T A +PK +K+
Sbjct  184  GVVNATVLGVVYSDNKLGIYHVDKVLLPLDFFITNKAPASAPS------TLAKSPKAAKD  237

Query  372  HSPADEPSPAANGEPNSAGRMSQFGLGLA  286
            +S  D+     N   N +G +S   +G A
Sbjct  238  NSSEDD-QEETNQHQNKSGAVSVVSIGGA  265



>gb|ACU18837.1| unknown [Glycine max]
Length=280

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 124/209 (59%), Gaps = 14/209 (7%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGT  718
            P DI  ILK  K F++ ++ L T   +   I++Q+IT+ + G+++LA  DSAF++L +G 
Sbjct  65   PDDITRILKKAKMFSVLIRLLKTT-EIMNNINSQLITAKSGGITILAPDDSAFSNLKAGF  123

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTS  547
            LN L++ QK+ L+QFHILP+F S  + ++ SNPV+T+AG       LN       VN+++
Sbjct  124  LNSLNEGQKIELVQFHILPEFVSSSNFDSLSNPVQTVAGKDPARLPLNVNALGNSVNIST  183

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF--TSKARPTLGNKGRPNKTAAAAPKNSKE  373
            GVV   V  ++  +  L +Y +DKVLLPL+F  T+KA  +  +      T A +PK +K+
Sbjct  184  GVVNATVLGVVYSDNKLGIYHVDKVLLPLDFFITNKAPASAPS------TLAKSPKAAKD  237

Query  372  HSPADEPSPAANGEPNSAGRMSQFGLGLA  286
            +S  D+     N   N +G +S   +G A
Sbjct  238  NSSEDD-QEETNQHQNKSGAVSVVSIGGA  265



>ref|XP_003538217.1| PREDICTED: fasciclin-like arabinogalactan protein 12-like [Glycine 
max]
Length=282

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 125/207 (60%), Gaps = 14/207 (7%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGT  718
            P DI  ILK  K F++ ++ L T   +   I++Q+IT+ + G+++LA  DSAF++L +G 
Sbjct  65   PDDITRILKKAKMFSVLIRLLKTT-EIMNNINSQLITAKSGGITILAPDDSAFSNLKAGF  123

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE---FVLNFTGSNGQVNVTS  547
            LN L++ QK+ L+QFH+LP+F S  + ++ SNPV+T+AG +     LN       VN+++
Sbjct  124  LNSLNEGQKIELVQFHLLPEFVSSSNFDSLSNPVQTVAGKDPARLPLNVNALGNSVNIST  183

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF--TSKARPTLGNKGRPNKTAAAAPKNSKE  373
            GVV   V  ++  +  L +Y +DKVLLPL+F  T+KA P L     P K     PK++K+
Sbjct  184  GVVNATVLGVVYSDNKLGIYHVDKVLLPLDFFVTNKA-PALAPTA-PTKV----PKDAKD  237

Query  372  HSPADEPSPAANGEPNSAGRMSQFGLG  292
            +S  D+     N + N +G +S   LG
Sbjct  238  NSSEDD-QEETNRDHNKSGAVSLVSLG  263



>ref|XP_008455488.1| PREDICTED: fasciclin-like arabinogalactan protein 6 [Cucumis 
melo]
Length=247

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 103/146 (71%), Gaps = 5/146 (3%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITST-DGVSVLAAPDSAFTSLPSGTL  715
            +++  IL  G QF+ F++ L+ +  L  Q+D Q+  S  +G+++LA  D+ F +L SG L
Sbjct  36   INLTGILSQGGQFSTFIRLLNQS-RLIIQLDNQLNNSQGEGLTILAPTDNGFNALESGAL  94

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGEFVLNFTG--SNGQVNVTSGV  541
            N L DQQK +L+ +H+LPKFY+L +L+T SNPV T A G++ LNFTG  ++ QVNV++GV
Sbjct  95   NSLDDQQKSQLLLYHVLPKFYTLTELQTISNPVRTQA-GDWGLNFTGQANSNQVNVSTGV  153

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLP  463
            V   ++N +R+  PL+V+ +DKVLLP
Sbjct  154  VTVPINNKLREQSPLSVFVVDKVLLP  179



>ref|XP_002321841.1| fasciclin-like AGP 15 family protein [Populus trichocarpa]
 gb|ABK92565.1| unknown [Populus trichocarpa]
 gb|EEF05968.1| fasciclin-like AGP 15 family protein [Populus trichocarpa]
 gb|ACZ67173.1| fasciclin and related adhesion glycoprotein [Populus balsamifera]
Length=240

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 107/184 (58%), Gaps = 11/184 (6%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P ++  +L+ G QF++F++ L  A      ++ Q+  + + +++ A  D+AF+SL SGTL
Sbjct  36   PTNVTKVLEKGGQFSVFIRLLK-ATQEDVTLNGQLNNTNNAITIFAPSDNAFSSLKSGTL  94

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA--GGEFVLNFTGSNGQVNVTSGV  541
            N LSDQ+K  L+QFHI+P+F S    +T SNP+ T A  GG   LN T +   VN+T+G+
Sbjct  95   NSLSDQEKAELVQFHIIPQFLSSSQFQTVSNPLTTQAGSGGRLELNVTTTGNSVNITTGL  154

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLEF---TSKARPTLGNKGRPNKTAAAAPKNSKEH  370
              T VS  +  +  LAVYQ+DKVLLPL+              K +    AAA+P+     
Sbjct  155  TNTSVSGTIYTDNQLAVYQVDKVLLPLDIFTPKPPTPAPAPEKPKKRSKAAASPE-----  209

Query  369  SPAD  358
            SPAD
Sbjct  210  SPAD  213



>ref|XP_003539213.1| PREDICTED: fasciclin-like arabinogalactan protein 12-like [Glycine 
max]
Length=292

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/220 (38%), Positives = 130/220 (59%), Gaps = 13/220 (6%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGTL  715
            VDI+ IL+  K FNI ++ + T   L  Q++ Q++T+ + G+++LA  DSAF+ L +G L
Sbjct  72   VDIVGILRKAKSFNILIRLMKT-TQLINQLNAQLLTTKSGGITILAPDDSAFSELKAGFL  130

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTSG  544
            N LSD QK+ L+QFH++  + S  + +T +NPV TLAG   G+  LN     G VN+++G
Sbjct  131  NSLSDGQKLELLQFHVISDYVSSSNFDTLTNPVRTLAGAKPGKVELNVISYGGSVNISTG  190

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKG---RPNKTAAAAPKNSKE  373
             V T ++ I+  +  LA+Y++ KVLLP++F + A+           P+  AA APK  K+
Sbjct  191  EVNTTITGIIYTDKHLAIYKVGKVLLPMDFFAVAKAPAKAPSLAPEPSSDAAKAPKADKD  250

Query  372  HSPADEPSPAANGEPNS-AGRMSQFG----LGLAPAAVVL  268
             S + + S     E NS A ++S +G    LGLA  A  +
Sbjct  251  RSSSSDSSRVNPTEQNSGAKKISVYGMWVSLGLALVATAM  290



>gb|KHN39526.1| Fasciclin-like arabinogalactan protein 11 [Glycine soja]
Length=282

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 125/207 (60%), Gaps = 14/207 (7%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGT  718
            P DI  ILK  K F++ ++ L T   +   I++Q+IT+ + G+++LA  DSAF++L +G 
Sbjct  65   PDDITRILKKAKMFSVLIRLLKTT-EIMNNINSQLITAKSGGITILAPDDSAFSNLKAGF  123

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE---FVLNFTGSNGQVNVTS  547
            LN L++ QK+ L+QFH+LP+F S  + ++ SNPV+T+AG +     LN       VN+++
Sbjct  124  LNSLNEGQKIELVQFHLLPEFVSSSNFDSLSNPVQTVAGKDPARLPLNVNALGNSVNIST  183

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF--TSKARPTLGNKGRPNKTAAAAPKNSKE  373
            GVV   V  ++  +  L +Y +DKVLLPL+F  T+KA P L     P K     PK++K+
Sbjct  184  GVVNATVLGVVYSDNKLGIYHVDKVLLPLDFFVTNKA-PALAPTA-PTKV----PKDAKD  237

Query  372  HSPADEPSPAANGEPNSAGRMSQFGLG  292
            +S  D+     N + N +G +S   LG
Sbjct  238  NSSEDD-QEETNQDHNKSGAVSLVSLG  263



>ref|XP_003539728.1| PREDICTED: fasciclin-like arabinogalactan protein 12-like isoform 
1 [Glycine max]
Length=293

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 126/221 (57%), Gaps = 8/221 (4%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGTL  715
            +DI+ IL+  K FNI ++ + T   L  Q++ Q++T+ + G+++LA  DSAF+ L +G L
Sbjct  72   LDIVGILRKAKSFNILIRLMKTT-QLINQLNAQLLTTKSGGITILAPDDSAFSELKAGFL  130

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTSG  544
            N LSD QK+ L+QFH+L  + S  + +T +NPV TLAG   G+  LN     G VN+++G
Sbjct  131  NSLSDGQKLELLQFHVLSDYVSSSNFDTLTNPVRTLAGAKPGKVELNVISYGGSVNISTG  190

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHS-  367
             V T ++ I+  +  LA+Y++ KVLLP +F +  +    +     + +  APK  KE+S 
Sbjct  191  EVNTTITGIIYTDKHLAIYKVGKVLLPTDFFAVTKAPAKSPSLAPEPSTKAPKADKENSL  250

Query  366  -PADEPSPAANGEPNSAGRMSQFGLGLAPAAVV-LFCMGVF  250
             P    S   N    ++G +  +  G   + V+ L  M VF
Sbjct  251  CPDSSESSQINSTNENSGTVKIYAHGKWVSLVLGLVLMTVF  291



>ref|XP_003546043.1| PREDICTED: fasciclin-like arabinogalactan protein 11-like [Glycine 
max]
 gb|KHN28639.1| Fasciclin-like arabinogalactan protein 11 [Glycine soja]
Length=283

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 84/224 (38%), Positives = 123/224 (55%), Gaps = 21/224 (9%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIIT--STDGVSVLAAPDSAFTSLPSGTL  715
            DII IL+  K FN  ++ L T   +  Q++ Q++T  S  G+++LA  D AF+ L +G  
Sbjct  67   DIIRILRKAKSFNTLIRLLKTT-QIINQVNAQLVTTKSGGGLTILAPDDGAFSQLKAGYF  125

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE---FVLNFTGSNGQVNVTSG  544
            N L D+Q+  LIQFH+LP + S  + ++ SNPV TLA      + +N T     VN+++G
Sbjct  126  NSLGDRQQKALIQFHVLPVYVSSSNFDSLSNPVMTLASDSPNGYQINVTAYGNSVNISTG  185

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSP  364
            VV   ++ I+  +  LA+Y +DKVL+PL+F SK RP       P  T A APK  K++S 
Sbjct  186  VVNATLTGIVYTDKTLAIYHVDKVLIPLDF-SKPRPP-----APAPTLAKAPKADKDNSS  239

Query  363  ADEPSPA----ANGEPNSAGRMSQFG-----LGLAPAAVVLFCM  259
            AD+        A    NS   +S  G     LG+A  A V F +
Sbjct  240  ADDDDQGELNKATSAANSINLISIRGTMLVSLGVALVAAVTFSI  283



>gb|KDO73213.1| hypothetical protein CISIN_1g025798mg [Citrus sinensis]
Length=248

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 110/179 (61%), Gaps = 7/179 (4%)
 Frame = -1

Query  981  LILIFLLFPHQIHTQpattapppssstTWPVDIIDILKTGKQFNIFVKFLDTANHLGKQI  802
            L+L+FLL  H  +T  A  A  P+     P ++  +L+   QF +F++ L  A  +  QI
Sbjct  12   LVLLFLL--HCTNTVVAQPAAAPAPGPPGPTNVTKVLEKAGQFTLFIRLLK-ATSVADQI  68

Query  801  DTQIITSTDGVSVLAAPDSAFTSLPSGTLNKLSDQQKVRLIQFHILPKFYSLDDLETASN  622
            D Q+  + +G+++ A  D+AF+SL SGTLN L+DQ+KV LIQFH++P + SL   +T SN
Sbjct  69   DHQLNDTNNGMTLFAPTDNAFSSLSSGTLNSLNDQEKVALIQFHVIPTYVSLSQFQTVSN  128

Query  621  PVETLAGG----EFVLNFTGSNGQVNVTSGVVQTQVSNIMRKNFPLAVYQIDKVLLPLE  457
            P+ T AG     E+ LN T     VN++SG+  T VS  +  +  LAVYQ+DKVLLP +
Sbjct  129  PLRTNAGDSSRFEYPLNVTTFGNSVNISSGITNTSVSGTVYTDGQLAVYQVDKVLLPWD  187



>ref|XP_007132197.1| hypothetical protein PHAVU_011G074200g [Phaseolus vulgaris]
 gb|ESW04191.1| hypothetical protein PHAVU_011G074200g [Phaseolus vulgaris]
Length=290

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 109/178 (61%), Gaps = 5/178 (3%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGTL  715
            VDI+ IL+  K FNI ++ + T   L  Q++ Q++T+ + G+++LA  DS+F+ L +G L
Sbjct  70   VDIVGILRQAKSFNILIRLMKT-TQLINQLNAQLLTTKSGGITILAPDDSSFSELKAGFL  128

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTSG  544
            N LSD QK+ L+QFH+L  + S  + +T +NPV TLAG   G+  LN     G VN+++G
Sbjct  129  NSLSDGQKLELLQFHVLSDYVSSSNFDTLTNPVRTLAGAKPGKVELNVISYGGSVNISTG  188

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEH  370
             V T ++ I+  +  LA+Y++ KVLLP++F   A+          + +A APK  KE 
Sbjct  189  EVNTTITGIVYTDKHLAIYKVGKVLLPMDFFVVAKAPAKAPSLAPEPSAKAPKADKEK  246



>ref|XP_002532604.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29770.1| conserved hypothetical protein [Ricinus communis]
Length=271

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 99/150 (66%), Gaps = 4/150 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSL-PSGT  718
            P++++ +L+    F  FV+ + T      Q+ +Q+  S+DGV++ A  D AF+++  SGT
Sbjct  65   PLNVVKVLQKAGHFTFFVRLIKTTQE-DIQLFSQLNDSSDGVTIFAPTDGAFSTIIKSGT  123

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA--GGEFVLNFTGSNGQVNVTSG  544
            LN LSDQQK+ L+Q+HI+P+F S    +T SNP++TLA  G  F LN T S   VNV+SG
Sbjct  124  LNSLSDQQKIELVQYHIIPRFLSTSQFQTVSNPLKTLAGSGSGFGLNVTTSESLVNVSSG  183

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            + +T VS I+  +  + +YQ+DKVLLPL+ 
Sbjct  184  LTRTYVSGIVYTDAKVGIYQVDKVLLPLDL  213



>ref|XP_006488128.1| PREDICTED: fasciclin-like arabinogalactan protein 12-like [Citrus 
sinensis]
Length=248

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 110/179 (61%), Gaps = 7/179 (4%)
 Frame = -1

Query  981  LILIFLLFPHQIHTQpattapppssstTWPVDIIDILKTGKQFNIFVKFLDTANHLGKQI  802
            L+L+FLL  H  +T  A  A  P+     P ++  +L+   QF +F++ L  A  +  QI
Sbjct  12   LVLLFLL--HCTNTVLAQPAAAPAPGPPGPTNVTKVLEKAGQFTLFIRLLK-ATSVADQI  68

Query  801  DTQIITSTDGVSVLAAPDSAFTSLPSGTLNKLSDQQKVRLIQFHILPKFYSLDDLETASN  622
            D Q+  + +G+++ A  D+AF+SL SGTLN L+DQ+KV LIQFH++P + SL   +T SN
Sbjct  69   DHQLNDTNNGMTLFAPTDNAFSSLSSGTLNSLNDQEKVALIQFHVIPTYVSLSQFQTVSN  128

Query  621  PVETLAGG----EFVLNFTGSNGQVNVTSGVVQTQVSNIMRKNFPLAVYQIDKVLLPLE  457
            P+ T AG     E+ LN T     VN++SG+  T VS  +  +  LAVYQ+DKVLLP +
Sbjct  129  PLRTNAGDSSRFEYPLNVTTFGNSVNISSGITNTSVSGTVYTDGQLAVYQVDKVLLPWD  187



>ref|XP_006361822.1| PREDICTED: fasciclin-like arabinogalactan protein 12-like [Solanum 
tuberosum]
Length=247

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 98/149 (66%), Gaps = 6/149 (4%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNK  709
            ++  IL+   Q + F + L T   + +   T ++ +++ +++   PD+AF S+ +GTLN 
Sbjct  47   NVTKILEKAGQCSTFNRLLQTTQEISQ--ITSLLNNSNSITIFVPPDNAFLSMKAGTLNS  104

Query  708  LSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGG----EFVLNFTGSNGQVNVTSGV  541
             +DQQK  LI+FH+LP+++SL   +TASNPV+T AGG    EF +N T +   VN+T+G+
Sbjct  105  FNDQQKSELIKFHVLPQYFSLSQFQTASNPVQTQAGGTSNREFPINITTNGTSVNITTGI  164

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            V   +SN +  +  LA+YQ+DKVLLPL+F
Sbjct  165  VNASISNTIYIDSQLAIYQVDKVLLPLQF  193



>ref|XP_007132199.1| hypothetical protein PHAVU_011G074400g [Phaseolus vulgaris]
 gb|ESW04193.1| hypothetical protein PHAVU_011G074400g [Phaseolus vulgaris]
Length=288

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 112/179 (63%), Gaps = 11/179 (6%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGTL  715
            VDI+ IL+  K FNI ++ + T   L  Q++ Q++T+ + G+++LA  DS+F+ L  G L
Sbjct  71   VDIVGILRQAKSFNILIRLMKT-TQLINQLNAQLLTTKSGGITLLAPDDSSFSELKPGFL  129

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTSG  544
            N LSD QK+ L+QFH+L  + S  + +T +NPV TLAG   G+  LN     G VN+++G
Sbjct  130  NSLSDGQKLELLQFHVLSDYVSSSNFDTLTNPVRTLAGAKPGKVELNVISYGGSVNISTG  189

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKAR-PTLGNKGRPNKTAAAAPKNSKEH  370
             V T ++ I+  +  LA+Y++ KVLLP++F + A+ PTL       + +A APK  KE 
Sbjct  190  EVNTTITGIVYTDKHLAIYKVGKVLLPMDFFAVAKAPTLA-----PEPSAKAPKADKEK  243



>gb|ABR68798.1| arabinogalactan protein 3 [Gossypium hirsutum]
Length=264

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 95/148 (64%), Gaps = 5/148 (3%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNK  709
            ++  IL+   QF+ F++ +  A  +  Q+  Q+  + +G+++ A  DSAF+SL SGTLN 
Sbjct  56   NVTKILEKAGQFSTFIRLMK-ATQVANQLLGQLNNTNNGITIFAPSDSAFSSLKSGTLNS  114

Query  708  LSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTSGV  541
            LSD+QKV LIQFHI+P + S    +T SNP+ T AG    G+F LN T S   VN+TSG+
Sbjct  115  LSDEQKVELIQFHIIPTYLSSAQFQTISNPLRTQAGDSGDGKFPLNVTSSGDTVNITSGL  174

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLE  457
              T VS  +  +  LAVYQID+VL PL+
Sbjct  175  TNTSVSGTVYTDGQLAVYQIDRVLQPLQ  202



>gb|KHN05734.1| Fasciclin-like arabinogalactan protein 11 [Glycine soja]
Length=293

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 114/183 (62%), Gaps = 12/183 (7%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGTL  715
            +DI+ IL+  K FNI ++ + T   L  Q++ Q++T+ + G+++LA  DSAF+ L +G L
Sbjct  72   LDIVGILRKAKSFNILIRLMKT-TQLINQLNAQLLTTKSGGITILAPDDSAFSELKAGFL  130

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTSG  544
            N LSD QK+ L+QFH+L  + S  + +T +NPV TLAG   G+  LN     G VN+++G
Sbjct  131  NSLSDGQKLELLQFHVLSDYVSSSNFDTLTNPVRTLAGAKPGKVELNVISYGGSVNISTG  190

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEF--TSKA---RPTLGNKGRPNKTAAAAPKNS  379
             V T ++ I+  +  LA+Y++ KVLLP++F   +KA    P+L  +  P+   A APK  
Sbjct  191  EVNTTITGIIYTDKHLAIYKVGKVLLPMDFFAVTKAPAKSPSLAPE--PSSDTAKAPKAH  248

Query  378  KEH  370
            K+ 
Sbjct  249  KDE  251



>gb|KHG08221.1| Fasciclin-like arabinogalactan protein 12 [Gossypium arboreum]
Length=266

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 95/148 (64%), Gaps = 5/148 (3%)
 Frame = -1

Query  888  DIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLNK  709
            ++  IL+   QF+ F++ +  A  +  Q+  Q+  + +G+++ A  DSAF+SL SGTLN 
Sbjct  54   NVTKILEKAGQFSTFIRLMK-ATQVANQLLGQLNNTNNGITIFAPTDSAFSSLKSGTLNS  112

Query  708  LSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTSGV  541
            LSD+QKV LIQFHI+P + S    +T SNP+ T AG    G+F LN T +   VN+TSG+
Sbjct  113  LSDEQKVELIQFHIIPTYLSSAQFQTISNPLRTQAGDSGDGKFPLNVTSTGDTVNITSGL  172

Query  540  VQTQVSNIMRKNFPLAVYQIDKVLLPLE  457
              T VS  +  +  LAVYQID+VL PL+
Sbjct  173  TNTSVSGTVYTDGQLAVYQIDRVLQPLQ  200



>ref|XP_002532603.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29769.1| conserved hypothetical protein [Ricinus communis]
Length=267

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 99/152 (65%), Gaps = 4/152 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSL-PSGT  718
            P++++ +L+    F  FV+ + T      Q+ +Q+  S+DGV++ +  D AF+++  SGT
Sbjct  63   PLNVVKVLQKAGHFTFFVRLIKTTQE-DIQLFSQLNDSSDGVTIFSPTDGAFSTIIKSGT  121

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA--GGEFVLNFTGSNGQVNVTSG  544
            LN LSDQQK+ L+QFHILP+F S    +T SNP++TLA  G  F LN T +   VNV+SG
Sbjct  122  LNSLSDQQKIELVQFHILPRFLSTSQFQTVSNPLKTLAGSGSGFALNVTTTESLVNVSSG  181

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTS  448
            +  T VS I+  +  + +YQ+DKVLLP++  S
Sbjct  182  LTHTYVSGIVYTDGKVGIYQVDKVLLPVDLFS  213



>ref|XP_002275538.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Vitis vinifera]
 emb|CAN68230.1| hypothetical protein VITISV_008024 [Vitis vinifera]
 emb|CBI32715.3| unnamed protein product [Vitis vinifera]
Length=239

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 121/205 (59%), Gaps = 10/205 (5%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P++I+ +LK   ++  F++ L +   +  QI++Q+     G++V A  DSAF++L  G L
Sbjct  34   PINIVSVLKKSGKYTTFIRLLKST-QIDDQINSQLNDLNQGLTVFAPTDSAFSNLKPGML  92

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGG---EFVLNFTGSNGQVNVTSG  544
            N L+DQQK +L+QFH++P F S+   +T SNP+ T AGG   +F LN T S  QVN+T+G
Sbjct  93   NSLTDQQKFQLVQFHVVPSFLSIPQFQTVSNPLRTQAGGGTAQFPLNITMSGNQVNMTTG  152

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEHSP  364
             V T ++N +  +  LAVY+ID+VLL     ++          P KT+  +   S  +  
Sbjct  153  RVNTSLTNTLYTDGQLAVYEIDQVLL-----AEGLFRPPAPAPPPKTSDPSDAPSGSNGA  207

Query  363  ADEPSPAANGEPNSAGRMSQFGLGL  289
            +D+ S A +  P+SA ++  FG+ +
Sbjct  208  SDDSSDAKD-RPHSAQKLVSFGVAV  231



>gb|KHN39525.1| Fasciclin-like arabinogalactan protein 11 [Glycine soja]
Length=291

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 82/220 (37%), Positives = 129/220 (59%), Gaps = 13/220 (6%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGTL  715
            VDI+ IL+  K FNI ++ + T   L  Q++ Q++T+ + G+++LA  DSAF+ L +G L
Sbjct  71   VDIVGILRKAKSFNILIRLMKT-TQLINQLNAQLLTTKSGGITILAPDDSAFSELKAGFL  129

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTSG  544
            N LSD QK+ L+QFH++  + S  + +T +NPV TLAG   G+  LN     G VN+++G
Sbjct  130  NSLSDGQKLELLQFHVISDYVSSSNFDTLTNPVRTLAGAKPGKVELNVISYGGSVNISTG  189

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKG---RPNKTAAAAPKNSKE  373
             V T ++ I+  +  LA+Y++ KVLLP++F + A+           P+  AA APK  K+
Sbjct  190  EVNTTITGIIYTDKHLAIYKVGKVLLPMDFFAVAKAPAKAPSLAPEPSSDAAKAPKADKD  249

Query  372  HSPADEPSPAANGEPNSAGR-MSQFG----LGLAPAAVVL  268
             S + + S     E NS  + +S +G    LGLA  A  +
Sbjct  250  RSSSSDSSRVNPTEQNSGAKEISVYGMWVSLGLALVATAM  289



>ref|XP_010446221.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Camelina 
sativa]
Length=248

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 95/148 (64%), Gaps = 5/148 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P ++  IL+   QF +F++ L +   +  Q+  Q+  S +G+++ A  DS+F+SL +GTL
Sbjct  39   PTNVTKILEKAGQFTVFIRLLKSTG-VANQLLGQLNNSDNGITIFAPSDSSFSSLKAGTL  97

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N L+D+Q+V LIQFH++P + S  + +T SNP+ T AG    G F LN T S   VN+T+
Sbjct  98   NSLNDEQQVELIQFHVIPSYVSSSNFQTISNPLRTQAGDSAEGHFPLNITTSGNTVNITT  157

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLP  463
            GV  T VS  +  +  LAVYQ+DKVLLP
Sbjct  158  GVTNTTVSGNVYSDGQLAVYQVDKVLLP  185



>ref|XP_004505975.1| PREDICTED: fasciclin-like arabinogalactan protein 12-like [Cicer 
arietinum]
Length=267

 Score =   123 bits (309),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 80/220 (36%), Positives = 128/220 (58%), Gaps = 16/220 (7%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGT  718
            P DI  ILK  K F++ ++ L +   +   I++Q+IT+ T G+++LA  D+AF++L +G 
Sbjct  54   PDDITRILKKAKIFSVLIRLLKST-EIMSSINSQLITAKTGGLTILAPDDAAFSNLKAGF  112

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE---FVLNFTGSNGQVNVTS  547
            LN L++ QK+ L+QFHILP++ S  + ++ SNPV+T+AG +     LN       VN+++
Sbjct  113  LNSLNEGQKIELLQFHILPEYVSSSNFDSLSNPVQTVAGKDPTRLPLNVNALGNSVNIST  172

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF--TSKARPTLGNKGRPNKTAAAAPKNSKE  373
            GVV   +  ++  +  L +Y++DKVLLPL+F  T+KA P L        T A APK +KE
Sbjct  173  GVVNASIVGVVYSDNKLGIYRLDKVLLPLDFFATTKA-PALA------PTLAKAPKGAKE  225

Query  372  HSPADEPSPAANGEPNSAG--RMSQFGLGLAPAAVVLFCM  259
            +S +++      G+  S        FG  L    VV+  M
Sbjct  226  NSSSEDQDEDDEGKSKSGAVSLCGYFGTNLMLFVVVVAIM  265



>gb|KDP44078.1| hypothetical protein JCGZ_05545 [Jatropha curcas]
Length=280

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 100/150 (67%), Gaps = 4/150 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSL-PSGT  718
            P++++ +L+    F  FV+ + T      Q+ +Q+  STDGV++ A  D+AF+S+  SGT
Sbjct  73   PLNVVKVLQKAGHFTFFVRLIKTTQE-DIQLFSQLNASTDGVTIFAPYDAAFSSIIKSGT  131

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGG--EFVLNFTGSNGQVNVTSG  544
            LN LSDQ+K  L+QFHI+P+F S    +T SNP+++LAG      LN T S+  VNV++G
Sbjct  132  LNSLSDQEKRELVQFHIIPRFLSTSQFQTVSNPLKSLAGASSRLALNVTTSDNLVNVSTG  191

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            + +T VS I+  +  +A+YQ+DKVLLP++ 
Sbjct  192  LTKTYVSAIVYTDGKVAIYQVDKVLLPIDL  221



>gb|ACU17607.1| unknown [Glycine max]
Length=278

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 81/220 (37%), Positives = 129/220 (59%), Gaps = 18/220 (8%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGT  718
            P DI  ILK  K F++ ++ L T   +   I++Q+IT+ + G+++LA  DSAF++L +G 
Sbjct  61   PDDITRILKKAKMFSVLIRLLKTT-EIMNNINSQLITAKSGGITILAPDDSAFSNLKAGF  119

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTS  547
            LN L++ QK+ L+QFHILP+F S  + ++ SNPV+T+AG       LN       VN+++
Sbjct  120  LNSLNEGQKIELVQFHILPEFVSSSNFDSLSNPVQTVAGKDPARLPLNVNALGNSVNIST  179

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF--TSKARPTLGNKGRPNKTAAAAPKNSKE  373
            GVV   +  ++  +  L +Y +DKVLLPL+F  T+KA P L        T A APK +K+
Sbjct  180  GVVNATILGVVYSDNKLGIYHVDKVLLPLDFFLTNKA-PALA-----PTTLAKAPKAAKQ  233

Query  372  HSPADEPSPAANGEPNSAGRMSQFGLGLAPAAVVLFCMGV  253
            +S ++      +   N +G +S   LG A    +L  +G+
Sbjct  234  NS-SEGDQEETDQNHNKSGAVSLVSLGGA----MLMSIGI  268



>gb|AAT37958.1| fasciclin-like AGP 15 [Populus tremula x Populus alba]
Length=240

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 107/183 (58%), Gaps = 11/183 (6%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            +++  +L+ G QF++F++ L  A      ++ Q+  + + +++ A  DSAF+SL SGTLN
Sbjct  37   INVTKVLEKGGQFSVFIRLLK-ATQEDVTLNGQLNNTNNAITIFAPSDSAFSSLKSGTLN  95

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA--GGEFVLNFTGSNGQVNVTSGVV  538
             LSDQ+K  L+QFHI+P+F S    +T SNP+ T A  GG   LN T +   VN+T+G+ 
Sbjct  96   SLSDQEKAELVQFHIIPQFLSSSLFQTVSNPLTTQAGSGGRLELNVTTTGNSVNITTGLT  155

Query  537  QTQVSNIMRKNFPLAVYQIDKVLLPLEF---TSKARPTLGNKGRPNKTAAAAPKNSKEHS  367
             T VS  +  +  LAVYQ+DKVLLPL+              K +    AAA+P+     S
Sbjct  156  NTSVSGTIYTDNQLAVYQVDKVLLPLDIFTPKPPTPAPAPEKPKKRSKAAASPE-----S  210

Query  366  PAD  358
            PAD
Sbjct  211  PAD  213



>ref|NP_001235903.1| uncharacterized protein LOC100500034 precursor [Glycine max]
 gb|ACU14668.1| unknown [Glycine max]
 gb|KHN21527.1| Fasciclin-like arabinogalactan protein 11 [Glycine soja]
Length=245

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 94/150 (63%), Gaps = 4/150 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P DII ILK    F   ++ L T   +  QI+ Q++ S +G++V A  D+AF SL  G L
Sbjct  36   PTDIIRILKKAGGFTTLIRLL-TTTQVSTQINAQLLNSNNGLTVFAPNDNAFQSLKPGFL  94

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE---FVLNFTGSNGQVNVTSG  544
            N L+DQQK  LIQFH+LP F S+ + +T SNPV T AG +     LN T S  QVN+T+G
Sbjct  95   NSLNDQQKNELIQFHVLPTFVSISNFDTLSNPVRTQAGDDPDRLALNITSSGNQVNLTTG  154

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            VV T V   +  +  LA+YQ+DKVLLP +F
Sbjct  155  VVNTTVGGSVYSDHQLAIYQVDKVLLPRDF  184



>ref|XP_006424604.1| hypothetical protein CICLE_v10028988mg [Citrus clementina]
 gb|ESR37844.1| hypothetical protein CICLE_v10028988mg [Citrus clementina]
Length=287

 Score =   123 bits (309),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 110/179 (61%), Gaps = 7/179 (4%)
 Frame = -1

Query  981  LILIFLLFPHQIHTQpattapppssstTWPVDIIDILKTGKQFNIFVKFLDTANHLGKQI  802
            L+L+FLL  H  +T  A  A  P+     P ++  +L+   QF +F++ L  A  +  QI
Sbjct  51   LVLLFLL--HCTNTVLAQPAAAPAPGPPGPTNVTKVLEKAGQFTLFIRLLK-ATSVADQI  107

Query  801  DTQIITSTDGVSVLAAPDSAFTSLPSGTLNKLSDQQKVRLIQFHILPKFYSLDDLETASN  622
            D Q+  + +G+++ A  D+AF+SL SGTLN L+DQ+KV LIQFH++P + SL   +T SN
Sbjct  108  DHQLNDTNNGMTLFAPTDNAFSSLSSGTLNSLNDQEKVALIQFHVIPTYVSLSQFQTVSN  167

Query  621  PVETLAGG----EFVLNFTGSNGQVNVTSGVVQTQVSNIMRKNFPLAVYQIDKVLLPLE  457
            P+ T AG     E+ LN T     VN++SG+  T VS  +  +  LAVYQ+DKVLLP +
Sbjct  168  PLRTNAGDSSRFEYPLNVTTFGNSVNISSGITNTSVSGTVYTDGQLAVYQVDKVLLPWD  226



>ref|XP_004505973.1| PREDICTED: fasciclin-like arabinogalactan protein 12-like [Cicer 
arietinum]
Length=296

 Score =   124 bits (310),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 102/150 (68%), Gaps = 5/150 (3%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGTL  715
            VDI+ IL+  K FN+F++ + T   L  Q+++Q++T+ + G+++LA  DSAF+ L +G L
Sbjct  73   VDIVGILRQAKSFNVFIRLMKTT-QLINQLNSQLLTTKSGGLTILAPDDSAFSELKAGYL  131

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTSG  544
            N LSD QK+ L+QFH++ ++ S  + +T +NPV TLAG   G+  LN     G VN+++G
Sbjct  132  NSLSDGQKLELLQFHVISEYVSSSNFDTLTNPVRTLAGAKPGKVELNVISYGGNVNISTG  191

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
             V T +S I+  +  LA+Y++ KVLLP++F
Sbjct  192  EVNTTISGIIYTDKHLAIYKVAKVLLPVDF  221



>gb|ADE62307.1| fasciclin-like arabinogalactan protein [Eucalyptus nitens]
Length=265

 Score =   123 bits (308),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 94/151 (62%), Gaps = 5/151 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P DI  +LK   QF + +K +  A  + KQI+ Q+  S +G+++ A  D+AF+SL SGTL
Sbjct  57   PTDITKVLKKASQFTVLLKLMR-ATSVDKQINAQLNNSNNGLTIFAPNDNAFSSLKSGTL  115

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGG----EFVLNFTGSNGQVNVTS  547
            N+LS +Q+V L+QFH++P + ++   +T SNP+ T AGG    EF L  T S   VN+++
Sbjct  116  NQLSSEQQVELVQFHVVPTYLAVPQFQTVSNPLRTQAGGSGKFEFPLTLTTSGSSVNIST  175

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            GV    V   +  +  LAVY +DKVLLP+  
Sbjct  176  GVTNATVDQTVYNDGQLAVYMVDKVLLPMSI  206



>gb|KHN05732.1| Beta-galactosidase 8 [Glycine soja]
Length=480

 Score =   125 bits (315),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 81/230 (35%), Positives = 134/230 (58%), Gaps = 19/230 (8%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGTL  715
            +DI+ IL+  K FNI ++ + T   L  Q++ Q++T+ + G+++LA  DSAF+ L +G L
Sbjct  72   LDIVGILRKAKSFNILIRLMKT-TQLINQLNAQLLTTKSGGITILAPDDSAFSELKAGFL  130

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTSG  544
            N LSD QK+ L+QFH+L  + S  + +T +NPV TLAG   G+  LN     G VN+++G
Sbjct  131  NSLSDGQKLELLQFHVLSDYVSSSNFDTLTNPVRTLAGAKPGKVELNVISYGGSVNISTG  190

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEF--TSKA---RPTLGNKGRPNKTAAAAPKNS  379
             V T ++ I+  +  LA+Y++ KVLLP++F   +KA    P+L  +  P+   A APK  
Sbjct  191  EVNTTITGIIYTDKHLAIYKVGKVLLPMDFFAVTKAPAKSPSLAPE--PSSDTAKAPKAD  248

Query  378  KEHSPADEPSPAANGEPNSAG-RMSQFGLGLAPAAVVLFCMGVF*LREEF  232
            K+ S + + S     E NS   +++ +G+ ++        +G   +R E 
Sbjct  249  KDESSSSDSSQVNPTEQNSGTEKIAVYGMWMS------LGLGALLMRNEM  292



>ref|XP_003540183.1| PREDICTED: fasciclin-like arabinogalactan protein 12-like [Glycine 
max]
 gb|KHN11210.1| Fasciclin-like arabinogalactan protein 11 [Glycine soja]
Length=240

 Score =   122 bits (306),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 94/150 (63%), Gaps = 4/150 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P DII ILK    F   ++ L T   +  QI+ Q++ S +G++V A  D+AF SL  G L
Sbjct  34   PTDIIRILKKAGGFTTLIRLL-TTTQVSTQINAQLLNSNNGLTVFAPNDNAFQSLKPGFL  92

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGGE---FVLNFTGSNGQVNVTSG  544
            N L+DQQK  LIQFH+LP F S+ + +T SNPV T AG +     LN T S  QVN+T+G
Sbjct  93   NSLNDQQKNELIQFHVLPTFVSISNFDTLSNPVRTQAGDDPDRLALNITSSGNQVNLTTG  152

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEF  454
            VV T V   +  +  LA+YQ+DKVLLP +F
Sbjct  153  VVNTTVGGSVYSDHQLAIYQVDKVLLPRDF  182



>ref|XP_003539718.1| PREDICTED: fasciclin-like arabinogalactan protein 11-like isoform 
1 [Glycine max]
Length=291

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 118/199 (59%), Gaps = 6/199 (3%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGTL  715
            VDI+ IL+  K FNI ++ + T   L  Q++ Q++T+ + G+++LA  DSAF+ L +G L
Sbjct  71   VDIVGILRKAKSFNILIRLMKTT-QLINQLNAQLLTTKSGGITILAPDDSAFSELKAGFL  129

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTSG  544
            N LSD QK+ L+QFH+L  + S  + +T +NPV TLAG   G+  LN     G VN+++G
Sbjct  130  NSLSDGQKLELLQFHVLSDYVSSSNFDTLTNPVRTLAGAKPGKVELNVISYGGSVNISTG  189

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEH-S  367
             V T ++ I+  +  LA+Y++ KVLLP++F + A+          + +A APK  K+  S
Sbjct  190  EVNTTITGIIYTDKHLAIYKVGKVLLPMDFFAVAKAPAKAPSLAPEPSAKAPKADKDPLS  249

Query  366  PADEPSPAANGEPNSAGRM  310
            P    S   N    ++G +
Sbjct  250  PDSSESSQINSTNENSGTV  268



>gb|KHN32070.1| Fasciclin-like arabinogalactan protein 11 [Glycine soja]
Length=293

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 113/183 (62%), Gaps = 12/183 (7%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGTL  715
            +DI+ IL+  K FNI ++ + T   L  Q++ Q++T+ + G+++LA  DSAF+ L +G L
Sbjct  72   LDIVGILRKAKSFNILIRLMKT-TQLINQLNAQLLTTKSGGITILAPDDSAFSELKAGFL  130

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTSG  544
            N LSD QK+ L+QFH+L  + S  + +T +NPV TLAG   G+  LN     G VN+++G
Sbjct  131  NSLSDGQKLELLQFHVLSDYVSSSNFDTLTNPVRTLAGAKPGKVELNVISYGGSVNISTG  190

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEF--TSKA---RPTLGNKGRPNKTAAAAPKNS  379
             V T ++ I+  +  LA+Y++ KVLLP +F   +KA    P+L  +  P+   A APK  
Sbjct  191  EVNTTITGIIYTDKHLAIYKVGKVLLPTDFFAVTKAPAKSPSLAPE--PSSDTAKAPKAD  248

Query  378  KEH  370
            K+ 
Sbjct  249  KDE  251



>gb|KHN32077.1| Fasciclin-like arabinogalactan protein 11 [Glycine soja]
Length=290

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 118/199 (59%), Gaps = 6/199 (3%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITS-TDGVSVLAAPDSAFTSLPSGTL  715
            VDI+ IL+  K FNI ++ + T   L  Q++ Q++T+ + G+++LA  DSAF+ L +G L
Sbjct  70   VDIVGILRKAKSFNILIRLMKTT-QLINQLNAQLLTTKSGGITILAPDDSAFSELKAGFL  128

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG---GEFVLNFTGSNGQVNVTSG  544
            N LSD QK+ L+QFH+L  + S  + +T +NPV TLAG   G+  LN     G VN+++G
Sbjct  129  NSLSDGQKLELLQFHVLSDYVSSSNFDTLTNPVRTLAGAKPGKVELNVISYGGSVNISTG  188

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLEFTSKARPTLGNKGRPNKTAAAAPKNSKEH-S  367
             V T ++ I+  +  LA+Y++ KVLLP++F + A+          + +A APK  K+  S
Sbjct  189  EVNTTITGIIYTDKHLAIYKVGKVLLPMDFFAVAKAPAKAPSLAPEPSAKAPKADKDPLS  248

Query  366  PADEPSPAANGEPNSAGRM  310
            P    S   N    ++G +
Sbjct  249  PDSSESSQINSTNENSGTV  267



>ref|XP_010483697.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Camelina 
sativa]
Length=250

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 95/148 (64%), Gaps = 5/148 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P ++  IL+   QF +F++ L +   +  Q+  Q+  S +G+++ A  DS+F+SL +GTL
Sbjct  38   PTNVTKILEKAGQFTVFIRLLKSTG-VANQLLGQLNNSDNGITIFAPSDSSFSSLKAGTL  96

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTS  547
            N L+D+Q+V LIQFH++P + S  + +T SNP+ T AG    G F LN T S   VN+T+
Sbjct  97   NSLNDEQQVELIQFHVIPSYVSSSNFQTISNPLRTQAGDSAEGHFPLNITTSGNTVNITT  156

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLP  463
            GV  T +S  +  +  LAVYQ+DKVLLP
Sbjct  157  GVTNTTISGNVYSDGQLAVYQVDKVLLP  184



>ref|NP_001174524.1| Os05g0563550 [Oryza sativa Japonica Group]
 gb|AAT77395.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAY99025.1| hypothetical protein OsI_20983 [Oryza sativa Indica Group]
 dbj|BAH93252.1| Os05g0563550 [Oryza sativa Japonica Group]
Length=251

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 96/147 (65%), Gaps = 5/147 (3%)
 Frame = -1

Query  891  VDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTLN  712
            +++  IL+ G  +  F++ + +      Q+++Q+  ++ G +V A  D AF+SL  GTLN
Sbjct  42   LNVTAILEKGGSYTTFIRLMKSTQQ-DTQLNSQLNGTSTGFTVFAPTDGAFSSLKPGTLN  100

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA-GGE--FVLNFTG-SNGQVNVTSG  544
             LS Q +V L+Q HI+PKFYS+D  +TASNPV T A GG+  + LN T  S  QVNV++G
Sbjct  101  SLSAQDQVSLVQAHIVPKFYSMDAFDTASNPVRTQASGGDGPYTLNITATSTNQVNVSTG  160

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLP  463
            VV T +   +R + PLAVY +DKVLLP
Sbjct  161  VVDTTLGTALRADQPLAVYSVDKVLLP  187



>ref|XP_002317778.1| fasciclin-like AGP 15 family protein [Populus trichocarpa]
 gb|EEE95998.1| fasciclin-like AGP 15 family protein [Populus trichocarpa]
Length=269

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 95/149 (64%), Gaps = 4/149 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSL-PSGT  718
            PV++I IL+    F +F++ + +      Q+ +Q+  S DGV++ A  D AF+++  SG 
Sbjct  65   PVNVIKILQKAGGFAVFIRLIKSTQE-DIQVFSQLNDSRDGVTIFAPTDGAFSAIIKSGV  123

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA--GGEFVLNFTGSNGQVNVTSG  544
            LN LSD QK+ L+QFHI+PK  +  + +T SNP+ TLA  G  F LN   +   VNVTSG
Sbjct  124  LNSLSDHQKIELVQFHIIPKILTTANFQTVSNPITTLAGSGSRFALNVITTENMVNVTSG  183

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLE  457
            +  T VS I+  +  LAVYQ+DKVLLPL+
Sbjct  184  LTNTSVSAIVYTDSQLAVYQVDKVLLPLD  212



>ref|XP_010043729.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Eucalyptus 
grandis]
 gb|ABS50662.1| fasciclin-like arabinogalactan protein [Eucalyptus grandis]
Length=265

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 94/150 (63%), Gaps = 5/150 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P DI  +LK   QF + +K +  A  + KQI+ Q+  S +G+++ A  D+AF+SL SGTL
Sbjct  57   PTDITKVLKKASQFTVLLKLMR-ATSVDKQINAQLNNSNNGLTIFAPNDNAFSSLKSGTL  115

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGG----EFVLNFTGSNGQVNVTS  547
            N+LS +Q+V L+QFH++P + ++   +T SNP+ T AGG    EF L  T S   VN+++
Sbjct  116  NQLSSEQQVELVQFHVVPTYLAVPQFQTVSNPLRTQAGGSGKFEFPLTLTTSGSSVNIST  175

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLE  457
            GV    V   +  +  LAVY +DKVLLP+ 
Sbjct  176  GVTNATVDQTVYNDGQLAVYMVDKVLLPMS  205



>gb|AAT37950.1| fasciclin-like AGP 7 [Populus tremula x Populus alba]
Length=269

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 95/149 (64%), Gaps = 4/149 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSL-PSGT  718
            PV++I IL+    F +F++ + +      Q+ +Q+  S DGV++ A  D AF+++  SG 
Sbjct  65   PVNVIKILQKAGGFAVFIRLIKSTQE-DIQVFSQLNDSRDGVTIFAPTDGAFSAIIKSGV  123

Query  717  LNKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLA--GGEFVLNFTGSNGQVNVTSG  544
            LN LSD QK+ L+QFHI+PK  +  + +T SNP+ TLA  G  F LN   +   VNVTSG
Sbjct  124  LNSLSDHQKIELVQFHIIPKVLTTANFQTVSNPITTLAGSGSRFALNVITTENMVNVTSG  183

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLPLE  457
            +  T VS I+  +  LAVYQ+DKVLLPL+
Sbjct  184  LTNTSVSAIVYTDSQLAVYQVDKVLLPLD  212



>gb|KCW85724.1| hypothetical protein EUGRSUZ_B02486 [Eucalyptus grandis]
Length=314

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 94/150 (63%), Gaps = 5/150 (3%)
 Frame = -1

Query  894  PVDIIDILKTGKQFNIFVKFLDTANHLGKQIDTQIITSTDGVSVLAAPDSAFTSLPSGTL  715
            P DI  +LK   QF + +K +  A  + KQI+ Q+  S +G+++ A  D+AF+SL SGTL
Sbjct  106  PTDITKVLKKASQFTVLLKLMR-ATSVDKQINAQLNNSNNGLTIFAPNDNAFSSLKSGTL  164

Query  714  NKLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAGG----EFVLNFTGSNGQVNVTS  547
            N+LS +Q+V L+QFH++P + ++   +T SNP+ T AGG    EF L  T S   VN+++
Sbjct  165  NQLSSEQQVELVQFHVVPTYLAVPQFQTVSNPLRTQAGGSGKFEFPLTLTTSGSSVNIST  224

Query  546  GVVQTQVSNIMRKNFPLAVYQIDKVLLPLE  457
            GV    V   +  +  LAVY +DKVLLP+ 
Sbjct  225  GVTNATVDQTVYNDGQLAVYMVDKVLLPMS  254



>ref|XP_006655019.1| PREDICTED: fasciclin-like arabinogalactan protein 11-like [Oryza 
brachyantha]
Length=212

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 93/147 (63%), Gaps = 7/147 (5%)
 Frame = -1

Query  885  IIDILKTGKQFNIFVKFLDTANHLGKQIDTQII--TSTDGVSVLAAPDSAFTSLPSGTLN  712
            I  +L    QF  F++ L ++   G+QI+ QI    S+ G++V A PD+AFT+LP+GTLN
Sbjct  41   ITAVLTKAGQFTKFLQLL-SSTQAGEQINNQIKGKASSGGLTVFAPPDNAFTALPTGTLN  99

Query  711  KLSDQQKVRLIQFHILPKFYSLDDLETASNPVETLAG----GEFVLNFTGSNGQVNVTSG  544
            KLSDQQK  L+QFH++ +   +   +T SNP+ T AG    G++ LN T    +VN+++G
Sbjct  100  KLSDQQKTSLVQFHVVSQLLPMAQFDTVSNPLRTQAGETAAGKYPLNVTAEGSRVNISTG  159

Query  543  VVQTQVSNIMRKNFPLAVYQIDKVLLP  463
            VV   V N +     L VYQ+DKVLLP
Sbjct  160  VVNATVDNTLYSGDRLVVYQVDKVLLP  186



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2677841696448