BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c120516_g1_i1 len=321 path=[299:0-320]

Length=321
                                                                      Score     E

ref|XP_006349125.1|  PREDICTED: zinc finger protein ZAT5-like           106   2e-25   
ref|XP_004251369.1|  PREDICTED: zinc finger protein ZAT5                104   1e-24   
ref|XP_011077299.1|  PREDICTED: zinc finger protein ZAT5                102   7e-24   
ref|XP_004246607.1|  PREDICTED: zinc finger protein ZAT5                102   1e-23   
emb|CBI17130.3|  unnamed protein product                              99.8    3e-23   
ref|XP_006354388.1|  PREDICTED: zinc finger protein ZAT5-like         99.8    8e-23   
emb|CAN59833.1|  hypothetical protein VITISV_017619                   99.8    8e-23   Vitis vinifera
ref|XP_002274374.1|  PREDICTED: zinc finger protein ZAT5              99.8    9e-23   Vitis vinifera
ref|XP_010267264.1|  PREDICTED: zinc finger protein ZAT5              99.8    1e-22   
ref|XP_007132339.1|  hypothetical protein PHAVU_011G086400g           99.4    1e-22   
ref|XP_011089966.1|  PREDICTED: zinc finger protein ZAT5-like         99.4    1e-22   
ref|XP_009613500.1|  PREDICTED: zinc finger protein ZAT5-like         99.4    1e-22   
ref|XP_011088799.1|  PREDICTED: zinc finger protein ZAT5              99.4    1e-22   
ref|XP_002311984.2|  hypothetical protein POPTR_0008s03220g           97.8    2e-22   Populus trichocarpa [western balsam poplar]
emb|CAA43111.1|  DNA-binding protein                                  98.6    2e-22   Petunia x hybrida [garden petunia]
emb|CDP15290.1|  unnamed protein product                              98.6    2e-22   
ref|XP_010109936.1|  Zinc finger protein ZAT5                         98.6    2e-22   
ref|XP_009776555.1|  PREDICTED: zinc finger protein ZAT5-like         98.6    3e-22   
ref|XP_010935821.1|  PREDICTED: zinc finger protein ZAT5-like         98.2    3e-22   
ref|XP_008226652.1|  PREDICTED: zinc finger protein ZAT5              97.8    5e-22   
ref|XP_002315335.2|  putative zinc finger family protein              97.4    5e-22   Populus trichocarpa [western balsam poplar]
ref|XP_007016063.1|  C2H2-type zinc finger family protein, putative   97.4    5e-22   
ref|XP_009122879.1|  PREDICTED: zinc finger protein ZAT5-like         97.8    6e-22   
gb|EPS70723.1|  hypothetical protein M569_04037                       94.7    6e-22   
ref|XP_008807698.1|  PREDICTED: zinc finger protein ZAT5              97.1    7e-22   
ref|XP_008779116.1|  PREDICTED: zinc finger protein ZAT5-like         97.1    7e-22   
ref|XP_009394662.1|  PREDICTED: zinc finger protein ZAT5-like         96.7    7e-22   
emb|CDY41350.1|  BnaA01g31690D                                        96.7    8e-22   
ref|XP_011031622.1|  PREDICTED: zinc finger protein ZAT5-like         97.1    9e-22   
emb|CAI77630.1|  putative Cys2-His2 zinc finger transcription factor  95.1    9e-22   Juglans regia
ref|XP_004294532.1|  PREDICTED: zinc finger protein ZAT5-like         96.7    1e-21   
ref|XP_007144239.1|  hypothetical protein PHAVU_007G139600g           96.7    1e-21   
ref|XP_010933179.1|  PREDICTED: zinc finger protein ZAT5-like         96.3    1e-21   
ref|XP_007205449.1|  hypothetical protein PRUPE_ppa007860mg           96.7    1e-21   
ref|XP_009384553.1|  PREDICTED: zinc finger protein ZAT5-like         96.3    1e-21   
ref|XP_009390198.1|  PREDICTED: zinc finger protein ZAT5-like         95.9    2e-21   
ref|XP_006347206.1|  PREDICTED: zinc finger protein ZAT5-like         96.3    2e-21   
ref|XP_009372494.1|  PREDICTED: zinc finger protein ZAT5-like         96.3    2e-21   
gb|KEH43312.1|  C2H2-type zinc finger protein                         95.9    2e-21   
ref|XP_010910785.1|  PREDICTED: zinc finger protein ZAT5-like         95.5    3e-21   
gb|AAS79571.1|  putative zinc finger protein                          94.7    3e-21   Ipomoea trifida
ref|XP_008787454.1|  PREDICTED: zinc finger protein ZAT5              95.5    3e-21   
ref|XP_011024338.1|  PREDICTED: zinc finger protein ZAT5              95.1    4e-21   
emb|CDP07026.1|  unnamed protein product                              95.1    4e-21   
ref|XP_008801217.1|  PREDICTED: zinc finger protein ZAT5-like         94.7    4e-21   
ref|XP_002267645.1|  PREDICTED: zinc finger protein ZAT5              94.7    4e-21   Vitis vinifera
ref|XP_009386213.1|  PREDICTED: zinc finger protein ZAT5-like         94.7    5e-21   
ref|XP_010243202.1|  PREDICTED: zinc finger protein ZAT5              94.7    6e-21   
emb|CBI30164.3|  unnamed protein product                              93.6    8e-21   
ref|XP_006381377.1|  hypothetical protein POPTR_0006s12340g           94.0    9e-21   
ref|XP_002876215.1|  zinc finger family protein                       92.4    9e-21   
ref|XP_010470129.1|  PREDICTED: zinc finger protein ZAT5-like         94.0    1e-20   
emb|CDY00945.1|  BnaC05g42550D                                        94.0    1e-20   
ref|XP_010558885.1|  PREDICTED: zinc finger protein ZAT5-like         94.0    1e-20   
ref|XP_007010041.1|  C2H2-type zinc finger family protein, putative   94.0    1e-20   
gb|KDO44126.1|  hypothetical protein CISIN_1g031966mg                 91.3    1e-20   
ref|XP_010253292.1|  PREDICTED: zinc finger protein ZAT12-like        91.7    2e-20   
ref|XP_009420453.1|  PREDICTED: zinc finger protein ZAT5-like         92.8    2e-20   
ref|XP_009396915.1|  PREDICTED: zinc finger protein ZAT5-like         92.8    2e-20   
ref|XP_010542577.1|  PREDICTED: zinc finger protein ZAT5-like         93.2    2e-20   
ref|XP_003538193.1|  PREDICTED: zinc finger protein ZAT5-like         93.2    2e-20   
ref|XP_006429010.1|  hypothetical protein CICLE_v10013311mg           91.3    2e-20   
gb|KDO47574.1|  hypothetical protein CISIN_1g045639mg                 93.2    2e-20   
ref|XP_002313544.1|  zinc finger family protein                       93.2    2e-20   Populus trichocarpa [western balsam poplar]
emb|CDY04544.1|  BnaA07g13700D                                        92.4    2e-20   
gb|KHN00957.1|  Zinc finger protein ZAT5                              93.2    2e-20   
ref|XP_006606310.1|  PREDICTED: zinc finger protein ZAT5-like         92.8    2e-20   
ref|XP_002533000.1|  zinc finger protein, putative                    91.3    3e-20   Ricinus communis
ref|XP_010414581.1|  PREDICTED: zinc finger protein ZAT5-like         92.4    3e-20   
ref|XP_010510676.1|  PREDICTED: zinc finger protein ZAT5              92.4    3e-20   
ref|XP_002265877.1|  PREDICTED: zinc finger protein ZAT5              92.4    3e-20   Vitis vinifera
ref|XP_011028268.1|  PREDICTED: zinc finger protein ZAT5              92.8    3e-20   
ref|XP_006384965.1|  hypothetical protein POPTR_0004s22650g           92.4    3e-20   
ref|XP_006384966.1|  zinc finger family protein                       92.4    3e-20   
gb|ADL36645.1|  C2H2L domain class transcription factor               92.4    3e-20   
gb|ABK95183.1|  unknown                                               92.4    3e-20   Populus trichocarpa [western balsam poplar]
ref|XP_008377900.1|  PREDICTED: zinc finger protein ZAT5-like         92.4    3e-20   
gb|KDP35585.1|  hypothetical protein JCGZ_09023                       90.5    4e-20   
emb|CDX71375.1|  BnaC04g16100D                                        92.0    4e-20   
ref|XP_009103654.1|  PREDICTED: zinc finger protein ZAT5              92.0    4e-20   
ref|XP_009139386.1|  PREDICTED: zinc finger protein ZAT11-like        90.5    5e-20   
ref|XP_004495268.1|  PREDICTED: zinc finger protein ZAT11-like        90.1    5e-20   
ref|XP_006837964.1|  hypothetical protein AMTR_s00102p00073930        91.3    5e-20   
ref|XP_004306266.1|  PREDICTED: zinc finger protein ZAT5-like         91.7    5e-20   
ref|XP_009601615.1|  PREDICTED: zinc finger protein ZAT5-like         92.0    5e-20   
ref|XP_010468099.1|  PREDICTED: zinc finger protein ZAT5-like         90.9    5e-20   
ref|NP_180387.2|  zinc finger protein ZAT5                            91.7    6e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009377110.1|  PREDICTED: zinc finger protein ZAT11-like        90.1    6e-20   
emb|CAA67233.1|  zinc finger protein                                  91.7    6e-20   Arabidopsis thaliana [mouse-ear cress]
gb|AFK34837.1|  unknown                                               90.1    6e-20   
gb|AAD29833.1|  putative zinc-finger protein                          91.7    6e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010937700.1|  PREDICTED: zinc finger protein ZAT12-like        89.7    7e-20   
ref|XP_010260064.1|  PREDICTED: zinc finger protein ZAT12             89.7    7e-20   
ref|XP_002882674.1|  hypothetical protein ARALYDRAFT_478379           92.4    7e-20   
ref|XP_008371383.1|  PREDICTED: zinc finger protein ZAT12-like        90.1    7e-20   
ref|XP_008385492.1|  PREDICTED: zinc finger protein ZAT5-like         91.7    7e-20   
ref|XP_010486658.1|  PREDICTED: zinc finger protein ZAT5              92.0    7e-20   
ref|XP_002880944.1|  hypothetical protein ARALYDRAFT_481690           91.3    8e-20   
gb|KHN27209.1|  Zinc finger protein ZAT11                             89.7    8e-20   
ref|NP_001235351.1|  uncharacterized protein LOC100526874             89.7    8e-20   
gb|KHN49000.1|  Zinc finger protein ZAT11                             89.7    8e-20   
ref|XP_003606327.1|  ZPT2-11                                          91.3    8e-20   
ref|XP_002879670.1|  zinc finger family protein                       89.7    9e-20   
ref|XP_009782985.1|  PREDICTED: zinc finger protein ZAT5-like         91.3    9e-20   
ref|XP_004142506.1|  PREDICTED: zinc finger protein ZAT5-like         91.7    9e-20   
ref|XP_010484714.1|  PREDICTED: zinc finger protein ZAT5-like         92.0    9e-20   
ref|XP_009140851.1|  PREDICTED: zinc finger protein ZAT5-like         90.9    1e-19   
ref|XP_010468098.1|  PREDICTED: zinc finger protein ZAT5-like         92.0    1e-19   
ref|XP_007206686.1|  hypothetical protein PRUPE_ppa022066mg           89.7    1e-19   
gb|KGN52233.1|  hypothetical protein Csa_5G622500                     91.3    1e-19   
gb|KFK32333.1|  hypothetical protein AALP_AA6G228200                  90.9    1e-19   
ref|XP_007027469.1|  Nucleic acid binding protein, putative           90.9    1e-19   
gb|KEH42342.1|  C2H2 type zinc finger transcription factor family...  89.0    1e-19   
ref|NP_190928.1|  C2H2-type zinc finger protein                       89.4    1e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AEY76110.1|  Cys2/His2-type zinc finger protein                    89.4    1e-19   
ref|NP_187658.1|  C2H2-type zinc finger protein                       91.7    1e-19   Arabidopsis thaliana [mouse-ear cress]
emb|CDY08602.1|  BnaA05g28380D                                        90.9    1e-19   
gb|KEH42343.1|  C2H2 type zinc finger transcription factor family...  89.0    1e-19   
ref|XP_006294403.1|  hypothetical protein CARUB_v10023420mg           91.3    2e-19   
gb|KDO43945.1|  hypothetical protein CISIN_1g036604mg                 90.1    2e-19   
ref|XP_009103876.1|  PREDICTED: zinc finger protein ZAT11-like        88.6    2e-19   
gb|EPS68966.1|  hypothetical protein M569_05802                       88.6    2e-19   
gb|KHN23143.1|  Zinc finger protein ZAT11                             88.6    2e-19   
gb|KHN09437.1|  Zinc finger protein ZAT11                             87.8    2e-19   
ref|XP_010505329.1|  PREDICTED: zinc finger protein ZAT11-like        89.0    2e-19   
gb|KDP43958.1|  hypothetical protein JCGZ_05425                       90.5    2e-19   
ref|XP_010509338.1|  PREDICTED: zinc finger protein ZAT11             89.0    2e-19   
ref|XP_004492093.1|  PREDICTED: zinc finger protein ZAT11-like        88.6    2e-19   
ref|NP_001236265.1|  uncharacterized protein LOC100500316             88.6    2e-19   
ref|XP_010097386.1|  Zinc finger protein ZAT11                        89.0    2e-19   
ref|XP_010098815.1|  Zinc finger protein ZAT5                         90.1    2e-19   
ref|XP_009411362.1|  PREDICTED: zinc finger protein ZAT5-like         90.1    2e-19   
ref|XP_006428462.1|  hypothetical protein CICLE_v10012395mg           90.1    2e-19   
ref|XP_008233585.1|  PREDICTED: zinc finger protein ZAT12-like        89.0    2e-19   
ref|XP_010043586.1|  PREDICTED: zinc finger protein ZAT12-like        88.2    2e-19   
ref|NP_001235663.1|  uncharacterized protein LOC100526897             88.2    2e-19   
ref|XP_009416690.1|  PREDICTED: zinc finger protein ZAT11-like        88.2    2e-19   
emb|CDY44852.1|  BnaC09g50520D                                        90.1    2e-19   
ref|XP_008241560.1|  PREDICTED: zinc finger protein ZAT11             88.6    2e-19   
ref|XP_009347446.1|  PREDICTED: zinc finger protein ZAT12-like        88.6    3e-19   
ref|XP_009357691.1|  PREDICTED: zinc finger protein ZAT12-like        88.6    3e-19   
ref|XP_007218449.1|  hypothetical protein PRUPE_ppa011762mg           88.6    3e-19   
ref|XP_006493540.1|  PREDICTED: zinc finger protein ZAT5-like         89.7    3e-19   
ref|XP_009613142.1|  PREDICTED: zinc finger protein ZAT5-like         89.7    3e-19   
ref|XP_008446814.1|  PREDICTED: zinc finger protein ZAT5-like         90.1    3e-19   
emb|CBI31394.3|  unnamed protein product                              90.1    3e-19   
gb|KCW88902.1|  hypothetical protein EUGRSUZ_A01230                   88.2    3e-19   
ref|XP_011094585.1|  PREDICTED: zinc finger protein ZAT5-like         89.4    3e-19   
ref|XP_003541431.1|  PREDICTED: zinc finger protein ZAT5-like         89.4    4e-19   
emb|CDY30857.1|  BnaC04g27120D                                        87.8    4e-19   
ref|NP_001237020.1|  uncharacterized protein LOC100500371             88.2    4e-19   
ref|XP_004142087.1|  PREDICTED: zinc finger protein ZAT11-like        87.4    4e-19   
emb|CDX70228.1|  BnaA10g25770D                                        89.4    4e-19   
ref|XP_010940535.1|  PREDICTED: zinc finger protein ZAT5-like         89.4    4e-19   
ref|XP_004305218.1|  PREDICTED: zinc finger protein ZAT11-like        87.8    4e-19   
ref|XP_010047364.1|  PREDICTED: zinc finger protein ZAT11-like        87.8    4e-19   
ref|XP_003539794.1|  PREDICTED: zinc finger protein ZAT5-like         89.4    4e-19   
ref|XP_009125554.1|  PREDICTED: zinc finger protein ZAT5-like         89.7    5e-19   
emb|CDY07578.1|  BnaC06g14860D                                        87.4    5e-19   
ref|XP_010431330.1|  PREDICTED: zinc finger protein ZAT11-like        87.8    5e-19   
gb|KHN21079.1|  Zinc finger protein ZAT5                              89.4    5e-19   
ref|XP_004302781.1|  PREDICTED: zinc finger protein ZAT11-like        87.4    5e-19   
emb|CDX91362.1|  BnaC04g07880D                                        87.8    5e-19   
gb|KHN48238.1|  Zinc finger protein ZAT5                              89.0    5e-19   
ref|XP_007144472.1|  hypothetical protein PHAVU_007G158900g           87.4    5e-19   
ref|XP_002533110.1|  nucleic acid binding protein, putative           87.0    5e-19   Ricinus communis
emb|CDY58436.1|  BnaC03g71210D                                        89.4    6e-19   
ref|XP_008359103.1|  PREDICTED: zinc finger protein ZAT12-like        87.4    6e-19   
gb|KHN02411.1|  Zinc finger protein ZAT11-like protein                87.0    6e-19   
ref|XP_008447526.1|  PREDICTED: zinc finger protein ZAT11             87.0    6e-19   
ref|XP_011018810.1|  PREDICTED: zinc finger protein ZAT5-like         89.0    6e-19   
ref|XP_006407564.1|  hypothetical protein EUTSA_v10020904mg           89.7    6e-19   
emb|CDP00044.1|  unnamed protein product                              88.2    6e-19   
ref|XP_003625524.1|  Zinc finger protein                              87.0    6e-19   
ref|XP_010504128.1|  PREDICTED: zinc finger protein ZAT11-like        87.4    6e-19   
ref|XP_010515858.1|  PREDICTED: zinc finger protein ZAT11-like        87.4    6e-19   
ref|XP_010050475.1|  PREDICTED: zinc finger protein ZAT5-like         89.0    7e-19   
ref|XP_010905716.1|  PREDICTED: zinc finger protein ZAT12-like        87.0    7e-19   
gb|KHN13875.1|  Zinc finger protein ZAT11                             87.0    7e-19   
ref|XP_010517014.1|  PREDICTED: zinc finger protein ZAT11-like        87.4    7e-19   
ref|XP_004294604.1|  PREDICTED: zinc finger protein ZAT12-like        87.0    7e-19   
ref|XP_010043587.1|  PREDICTED: zinc finger protein ZAT12-like        87.0    7e-19   
ref|XP_010041405.1|  PREDICTED: zinc finger protein ZAT12-like        87.0    8e-19   
ref|XP_010920692.1|  PREDICTED: zinc finger protein ZAT12-like        87.0    8e-19   
ref|XP_003552680.1|  PREDICTED: zinc finger protein ZAT11-like        87.0    8e-19   
ref|XP_009146836.1|  PREDICTED: zinc finger protein ZAT5-like         89.4    8e-19   
ref|XP_006424440.1|  hypothetical protein CICLE_v10028853mg           88.6    8e-19   
ref|XP_010045301.1|  PREDICTED: zinc finger protein ZAT5              88.6    8e-19   
ref|XP_008776431.1|  PREDICTED: zinc finger protein ZAT11-like        86.7    9e-19   
ref|XP_002284384.1|  PREDICTED: zinc finger protein ZAT11             86.7    9e-19   Vitis vinifera
gb|EYU41596.1|  hypothetical protein MIMGU_mgv1a024147mg              88.2    9e-19   
ref|XP_010312586.1|  PREDICTED: zinc finger protein ZAT5              89.0    9e-19   
ref|XP_006409841.1|  hypothetical protein EUTSA_v10016842mg           89.0    9e-19   
ref|XP_008795640.1|  PREDICTED: zinc finger protein ZAT12-like        86.7    9e-19   
gb|KCW88903.1|  hypothetical protein EUGRSUZ_A01231                   86.7    9e-19   
ref|XP_010529859.1|  PREDICTED: zinc finger protein ZAT11-like        87.4    9e-19   
gb|AGK28202.1|  C2H2-type zinc finger protein 4                       86.7    1e-18   
ref|XP_010067376.1|  PREDICTED: zinc finger protein ZAT12-like        87.4    1e-18   
ref|XP_008807730.1|  PREDICTED: zinc finger protein ZAT12-like        86.7    1e-18   
gb|EYU19898.1|  hypothetical protein MIMGU_mgv1a014646mg              87.0    1e-18   
ref|XP_007219175.1|  hypothetical protein PRUPE_ppa016651mg           88.6    1e-18   
ref|XP_008448374.1|  PREDICTED: zinc finger protein ZAT11-like        86.3    1e-18   
ref|XP_006410928.1|  hypothetical protein EUTSA_v10017303mg           86.7    1e-18   
ref|XP_009791832.1|  PREDICTED: uncharacterized protein DDB_G0283...  89.4    1e-18   
ref|XP_009143499.1|  PREDICTED: zinc finger protein ZAT11             86.7    1e-18   
ref|XP_009141657.1|  PREDICTED: zinc finger protein ZAT11-like        86.7    1e-18   
dbj|BAA19110.1|  PEThy;ZPT2-5                                         86.7    1e-18   Petunia x hybrida [garden petunia]
ref|XP_007139263.1|  hypothetical protein PHAVU_008G014600g           86.3    1e-18   
ref|XP_009404616.1|  PREDICTED: zinc finger protein ZAT12-like        86.3    1e-18   
ref|XP_004167789.1|  PREDICTED: zinc finger protein ZAT5-like         86.7    1e-18   
ref|XP_007149157.1|  hypothetical protein PHAVU_005G046200g           86.3    1e-18   
ref|XP_004294605.1|  PREDICTED: zinc finger protein ZAT11-like        86.7    1e-18   
ref|XP_010103498.1|  Zinc finger protein ZAT5                         88.6    1e-18   
ref|XP_003536960.1|  PREDICTED: zinc finger protein ZAT11-like        86.3    1e-18   
ref|XP_003547427.1|  PREDICTED: zinc finger protein ZAT11             86.3    1e-18   
ref|XP_010043588.1|  PREDICTED: zinc finger protein ZAT8-like         86.3    1e-18   
ref|NP_196059.1|  C2H2-type zinc finger protein                       88.2    1e-18   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA21920.1|  ZPT2-11                                              87.8    2e-18   Petunia x hybrida [garden petunia]
ref|XP_008385163.1|  PREDICTED: zinc finger protein ZAT12-like        86.3    2e-18   
ref|NP_001236732.1|  uncharacterized protein LOC100500607             85.9    2e-18   
ref|XP_010553303.1|  PREDICTED: zinc finger protein ZAT11-like        86.3    2e-18   
gb|KCW87459.1|  hypothetical protein EUGRSUZ_B03929                   88.2    2e-18   
ref|XP_008385161.1|  PREDICTED: zinc finger protein ZAT12-like        86.3    2e-18   
gb|ADL36628.1|  C2H2L domain class transcription factor               86.3    2e-18   
ref|XP_006487999.1|  PREDICTED: zinc finger protein ZAT5-like         87.8    2e-18   
gb|KHN33407.1|  Zinc finger protein ZAT12                             86.3    2e-18   
ref|XP_009757271.1|  PREDICTED: zinc finger protein ZAT11-like        85.9    2e-18   
ref|XP_009593204.1|  PREDICTED: zinc finger protein ZAT11-like        85.9    2e-18   
ref|XP_010043581.1|  PREDICTED: zinc finger protein ZAT8-like         86.3    2e-18   
ref|NP_001049734.1|  Os03g0279700                                     86.3    2e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011091501.1|  PREDICTED: zinc finger protein ZAT12-like        85.9    2e-18   
gb|KCW85603.1|  hypothetical protein EUGRSUZ_B02390                   85.9    2e-18   
gb|KDP29859.1|  hypothetical protein JCGZ_18434                       86.3    2e-18   
ref|XP_003621801.1|  Zinc finger protein                              86.3    2e-18   
ref|XP_009341517.1|  PREDICTED: zinc finger protein ZAT11-like        86.3    2e-18   
gb|KDP30500.1|  hypothetical protein JCGZ_16179                       87.8    2e-18   
ref|XP_009771157.1|  PREDICTED: zinc finger protein ZAT11-like        85.9    2e-18   
gb|EEE58806.1|  hypothetical protein OsJ_10357                        85.9    3e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004148235.1|  PREDICTED: zinc finger protein ZAT11-like        84.7    3e-18   
emb|CDX93380.1|  BnaC04g45160D                                        85.9    3e-18   
gb|KCW85608.1|  hypothetical protein EUGRSUZ_B02395                   85.9    3e-18   
ref|XP_007162678.1|  hypothetical protein PHAVU_001G170800g           86.3    3e-18   
ref|XP_009382162.1|  PREDICTED: zinc finger protein ZAT5-like         87.0    3e-18   
gb|AFK36078.1|  unknown                                               85.5    3e-18   
ref|XP_008376265.1|  PREDICTED: zinc finger protein ZAT5-like         87.4    3e-18   
gb|KHN02412.1|  Zinc finger protein ZAT11-like protein                85.5    3e-18   
gb|EYU37028.1|  hypothetical protein MIMGU_mgv1a021331mg              86.7    3e-18   
ref|XP_008369844.1|  PREDICTED: zinc finger protein ZAT11-like        85.5    3e-18   
ref|XP_002528469.1|  nucleic acid binding protein, putative           85.9    3e-18   Ricinus communis
dbj|BAA19111.1|  PEThy;ZPT2-6                                         87.0    3e-18   Petunia x hybrida [garden petunia]
ref|XP_010523126.1|  PREDICTED: zinc finger protein ZAT5-like         86.7    3e-18   
ref|XP_009599326.1|  PREDICTED: zinc finger protein ZAT11-like        85.1    3e-18   
gb|KEH44476.1|  C2H2-type zinc finger protein                         85.9    3e-18   
ref|XP_009762518.1|  PREDICTED: zinc finger protein ZAT11-like        85.1    4e-18   
ref|XP_009402337.1|  PREDICTED: zinc finger protein ZAT12-like        85.1    4e-18   
emb|CDY70037.1|  BnaCnng66450D                                        86.3    4e-18   
ref|XP_011004487.1|  PREDICTED: zinc finger protein ZAT5-like         86.7    4e-18   
ref|XP_010669838.1|  PREDICTED: zinc finger protein ZAT12-like        85.5    4e-18   
gb|KDP29189.1|  hypothetical protein JCGZ_16578                       86.7    4e-18   
ref|XP_004515927.1|  PREDICTED: zinc finger protein ZAT5-like         86.7    4e-18   
ref|XP_010068234.1|  PREDICTED: zinc finger protein 433-like          87.4    4e-18   
ref|XP_004493901.1|  PREDICTED: zinc finger protein ZAT11-like        85.1    4e-18   
ref|XP_002458732.1|  hypothetical protein SORBIDRAFT_03g039250        85.9    4e-18   Sorghum bicolor [broomcorn]
ref|XP_009420085.1|  PREDICTED: zinc finger protein ZAT12-like        85.1    4e-18   
ref|XP_004145820.1|  PREDICTED: zinc finger protein ZAT5-like         85.9    5e-18   
emb|CDY30501.1|  BnaA04g16320D                                        86.3    5e-18   
emb|CDY61764.1|  BnaAnng17660D                                        86.7    5e-18   
ref|XP_008222989.1|  PREDICTED: zinc finger protein ZAT12             85.1    5e-18   
ref|XP_002311150.1|  zinc finger family protein                       84.7    5e-18   Populus trichocarpa [western balsam poplar]
dbj|BAA21923.1|  ZPT2-14                                              84.7    6e-18   Petunia x hybrida [garden petunia]
gb|KFK24889.1|  hypothetical protein AALP_AA8G037800                  87.0    6e-18   
ref|XP_010920697.1|  PREDICTED: zinc finger protein ZAT11-like        84.3    6e-18   
ref|XP_010552949.1|  PREDICTED: zinc finger protein ZAT5-like         86.7    6e-18   
ref|XP_009368951.1|  PREDICTED: zinc finger protein ZAT5-like         86.7    6e-18   
ref|XP_003521347.1|  PREDICTED: zinc finger protein ZAT11-like        84.7    7e-18   
ref|XP_002284111.1|  PREDICTED: zinc finger protein ZAT12             84.7    7e-18   Vitis vinifera
ref|XP_010067204.1|  PREDICTED: zinc finger protein ZAT5              85.9    7e-18   
gb|KHN09436.1|  Zinc finger protein ZAT11                             84.7    7e-18   
gb|KGN46888.1|  hypothetical protein Csa_6G148300                     85.9    7e-18   
ref|NP_001235638.1|  uncharacterized protein LOC100527151             84.7    7e-18   
ref|XP_007142720.1|  hypothetical protein PHAVU_007G011300g           84.3    7e-18   
ref|XP_004239776.1|  PREDICTED: zinc finger protein ZAT11-like        84.3    8e-18   
ref|XP_009604641.1|  PREDICTED: zinc finger protein ZAT12-like        84.3    8e-18   
gb|KDP44196.1|  hypothetical protein JCGZ_05663                       84.7    8e-18   
ref|XP_009609087.1|  PREDICTED: zinc finger protein ZAT5              86.3    8e-18   
gb|KHN37328.1|  Zinc finger protein ZAT11                             84.3    8e-18   
ref|XP_010043582.1|  PREDICTED: zinc finger protein ZAT8-like         84.3    8e-18   
gb|KCW65288.1|  hypothetical protein EUGRSUZ_G02745                   85.5    8e-18   
ref|NP_001241413.1|  uncharacterized protein LOC100816598             84.3    9e-18   
ref|XP_008466979.1|  PREDICTED: zinc finger protein ZAT5-like         85.9    9e-18   
ref|XP_006350904.1|  PREDICTED: zinc finger protein ZAT11-like        84.0    9e-18   
gb|KHN30196.1|  Zinc finger protein ZAT11                             84.0    9e-18   
ref|XP_008654280.1|  PREDICTED: zinc finger protein ZAT12-like        84.3    1e-17   
ref|XP_010322414.1|  PREDICTED: zinc finger protein ZAT5-like         85.5    1e-17   
ref|XP_006345938.1|  PREDICTED: zinc finger protein ZAT11-like        83.6    1e-17   
ref|XP_008788081.1|  PREDICTED: zinc finger protein ZAT11             84.0    1e-17   
ref|XP_007205995.1|  hypothetical protein PRUPE_ppa012242mg           84.0    1e-17   
emb|CAN64128.1|  hypothetical protein VITISV_022422                   87.8    1e-17   
ref|XP_006299831.1|  hypothetical protein CARUB_v10016033mg           86.3    1e-17   
ref|XP_009587785.1|  PREDICTED: putative uncharacterized protein ...  86.7    1e-17   
ref|XP_004493902.1|  PREDICTED: zinc finger protein ZAT11-like        84.0    1e-17   
gb|EYU38574.1|  hypothetical protein MIMGU_mgv1a027111mg              85.1    1e-17   
ref|XP_006398898.1|  hypothetical protein EUTSA_v10013864mg           85.9    1e-17   
ref|XP_002323497.1|  hypothetical protein POPTR_0016s10790g           85.5    1e-17   
ref|XP_009122602.1|  PREDICTED: zinc finger protein ZAT5              85.5    1e-17   
ref|XP_002316305.2|  hypothetical protein POPTR_0010s21650g           84.0    1e-17   
gb|ACJ48970.1|  putative Cys2-His2 type zinc finger protein           84.0    1e-17   
gb|AFK41279.1|  unknown                                               84.0    1e-17   
ref|XP_011027131.1|  PREDICTED: zinc finger protein ZAT11-like        84.0    1e-17   
ref|XP_009338354.1|  PREDICTED: zinc finger protein ZAT12-like        84.7    1e-17   
ref|XP_007150141.1|  hypothetical protein PHAVU_005G130300g           85.1    1e-17   
ref|XP_003543503.1|  PREDICTED: zinc finger protein ZAT11-like        84.0    1e-17   
ref|XP_006345939.1|  PREDICTED: zinc finger protein ZAT11-like        83.6    1e-17   
gb|AFK39144.1|  unknown                                               84.0    1e-17   
ref|XP_009608410.1|  PREDICTED: zinc finger protein ZAT12-like        84.0    1e-17   
ref|XP_009628782.1|  PREDICTED: zinc finger protein ZAT12-like        84.0    1e-17   
gb|KHN37885.1|  Zinc finger protein ZAT5                              85.5    1e-17   
ref|XP_010922390.1|  PREDICTED: zinc finger protein ZAT11             83.6    2e-17   
ref|XP_006403670.1|  hypothetical protein EUTSA_v10010956mg           83.6    2e-17   
gb|AES12473.1|  C2H2-type zinc finger protein 1                       83.6    2e-17   
emb|CAF74934.1|  zinc finger DNA-binding protein                      84.0    2e-17   
ref|XP_003625522.1|  Zinc finger protein                              83.2    2e-17   
ref|XP_006295072.1|  hypothetical protein CARUB_v10024141mg           83.6    2e-17   
ref|XP_009759911.1|  PREDICTED: zinc finger protein ZAT5-like         85.1    2e-17   
ref|XP_006291929.1|  hypothetical protein CARUB_v10018114mg           83.2    2e-17   
ref|XP_009384889.1|  PREDICTED: zinc finger protein ZAT11-like        82.8    2e-17   
ref|XP_008650662.1|  PREDICTED: zinc finger protein ZAT12-like        83.6    2e-17   
emb|CDY11288.1|  BnaA03g01240D                                        84.7    2e-17   
gb|KDO67723.1|  hypothetical protein CISIN_1g040287mg                 82.8    2e-17   
ref|XP_004494993.1|  PREDICTED: zinc finger protein ZAT11-like        82.8    2e-17   
ref|XP_003520631.1|  PREDICTED: zinc finger protein ZAT11-like        82.8    2e-17   
gb|AAY40247.1|  Cys2/His2 zinc-finger transcription factor            84.3    2e-17   
ref|XP_006436055.1|  hypothetical protein CICLE_v10032899mg           83.2    3e-17   
ref|XP_009782299.1|  PREDICTED: zinc finger protein ZAT12-like        83.2    3e-17   
gb|AFK41453.1|  unknown                                               83.6    3e-17   
ref|XP_009337587.1|  PREDICTED: zinc finger protein ZAT12-like        83.2    3e-17   
ref|XP_008233248.1|  PREDICTED: zinc finger protein ZAT5              84.7    3e-17   
ref|XP_004497300.1|  PREDICTED: zinc finger protein ZAT11-like        83.2    3e-17   
ref|XP_009130819.1|  PREDICTED: zinc finger protein ZAT5-like         84.7    3e-17   
gb|AFW75670.1|  hypothetical protein ZEAMMB73_318375                  83.6    3e-17   
ref|XP_008370922.1|  PREDICTED: zinc finger protein ZAT12-like        82.8    4e-17   
ref|XP_009604696.1|  PREDICTED: zinc finger protein ZAT12-like        83.2    4e-17   
ref|XP_011023518.1|  PREDICTED: zinc finger protein ZAT11-like        82.4    4e-17   
gb|KHN05931.1|  Zinc finger protein ZAT11                             82.4    4e-17   
gb|ACU20152.1|  unknown                                               82.4    4e-17   
emb|CAA60828.1|  putative zinc finger protein                         83.6    4e-17   
ref|XP_010043584.1|  PREDICTED: zinc finger protein ZAT11-like        82.4    5e-17   
ref|XP_010043590.1|  PREDICTED: zinc finger protein ZAT8-like         82.4    5e-17   
ref|XP_009358331.1|  PREDICTED: zinc finger protein ZAT12-like        82.4    5e-17   
emb|CDY71034.1|  BnaCnng71010D                                        83.2    5e-17   
ref|XP_009622961.1|  PREDICTED: zinc finger protein ZAT8-like         82.4    5e-17   
ref|XP_007150296.1|  hypothetical protein PHAVU_005G141500g           82.4    5e-17   
ref|XP_008357752.1|  PREDICTED: zinc finger protein ZAT12             82.0    5e-17   
gb|ACU18906.1|  unknown                                               83.6    6e-17   
gb|KCW51529.1|  hypothetical protein EUGRSUZ_J01041                   83.6    6e-17   
gb|KHN05932.1|  Zinc finger protein ZAT11                             82.0    6e-17   
ref|XP_010321336.1|  PREDICTED: zinc finger protein ZAT5-like         84.0    6e-17   
ref|XP_009773332.1|  PREDICTED: zinc finger protein ZAT12-like        82.0    6e-17   
ref|XP_002519455.1|  nucleic acid binding protein, putative           83.2    7e-17   
ref|XP_010910911.1|  PREDICTED: zinc finger protein ZAT8-like         82.0    7e-17   
ref|XP_009628781.1|  PREDICTED: zinc finger protein ZAT12-like        81.6    7e-17   
ref|XP_008461644.1|  PREDICTED: zinc finger protein ZAT12-like        82.0    7e-17   
ref|XP_010032134.1|  PREDICTED: zinc finger protein ZAT5              83.2    7e-17   
ref|XP_004147699.1|  PREDICTED: zinc finger protein ZAT11-like        82.0    8e-17   
ref|XP_003536961.1|  PREDICTED: zinc finger protein ZAT11-like        82.0    8e-17   
ref|XP_010228788.1|  PREDICTED: zinc finger protein ZAT11-like        82.0    8e-17   
ref|XP_010696311.1|  PREDICTED: zinc finger protein ZAT5-like         83.2    9e-17   
ref|XP_010050234.1|  PREDICTED: zinc finger protein ZAT5-like         82.8    9e-17   
ref|XP_010096626.1|  Zinc finger protein ZAT11                        81.6    9e-17   
gb|KDO72957.1|  hypothetical protein CISIN_1g031430mg                 81.3    1e-16   
emb|CDY04886.1|  BnaAnng00680D                                        82.4    1e-16   
gb|AGY36840.1|  Cys2/His2-type zinc finger protein                    80.9    1e-16   
ref|XP_009125507.1|  PREDICTED: zinc finger protein ZAT5-like         82.4    1e-16   
ref|XP_011077219.1|  PREDICTED: zinc finger protein ZAT11-like        81.3    1e-16   
ref|XP_010552999.1|  PREDICTED: zinc finger protein ZAT5              82.4    1e-16   
emb|CDP09001.1|  unnamed protein product                              80.5    1e-16   
ref|XP_006289848.1|  hypothetical protein CARUB_v10003458mg           83.2    1e-16   
ref|XP_010424795.1|  PREDICTED: zinc finger protein ZAT5-like         82.4    1e-16   
ref|XP_007016517.1|  C2H2 and C2HC zinc fingers superfamily prote...  80.9    2e-16   
gb|KEH42344.1|  Cys2-His2 zinc finger transcription factor            80.9    2e-16   
ref|XP_010490947.1|  PREDICTED: zinc finger protein ZAT5-like         82.8    2e-16   
ref|XP_010043583.1|  PREDICTED: zinc finger protein ZAT8-like         80.9    2e-16   
ref|XP_002871040.1|  zinc finger family protein                       82.0    2e-16   
ref|XP_010452334.1|  PREDICTED: zinc finger protein ZAT5-like         82.8    2e-16   
ref|XP_002465455.1|  hypothetical protein SORBIDRAFT_01g039190        81.3    2e-16   
ref|XP_002871091.1|  zinc finger family protein                       82.8    2e-16   
ref|XP_008241377.1|  PREDICTED: zinc finger protein ZAT5-like         82.0    2e-16   
ref|XP_010423704.1|  PREDICTED: zinc finger protein ZAT5-like         82.0    2e-16   
gb|AGW47690.1|  trifoliate orange Cys2/His2-type zinc finger protein  80.9    2e-16   
ref|XP_004984762.1|  PREDICTED: zinc finger protein ZAT11-like        80.9    2e-16   
ref|XP_006361708.1|  PREDICTED: zinc finger protein ZAT5-like         82.8    2e-16   
ref|XP_006592720.1|  PREDICTED: zinc finger protein ZAT5-like iso...  82.0    2e-16   
ref|XP_008442730.1|  PREDICTED: zinc finger protein ZAT5-like         81.6    2e-16   
ref|XP_009402256.1|  PREDICTED: zinc finger protein ZAT12-like        80.5    2e-16   
emb|CDY65670.1|  BnaCnng48130D                                        80.5    2e-16   
ref|XP_007144473.1|  hypothetical protein PHAVU_007G159000g           80.1    2e-16   
dbj|BAA21921.1|  ZPT2-12                                              80.5    2e-16   
gb|KHN21482.1|  Zinc finger protein ZAT5                              81.3    3e-16   
gb|AHN52234.1|  C2H2-type zinc finger protein 3                       81.6    3e-16   
ref|XP_003541392.1|  PREDICTED: zinc finger protein ZAT11-like        81.3    3e-16   
ref|XP_009421348.1|  PREDICTED: zinc finger protein ZAT12-like        79.7    3e-16   
ref|XP_006663123.1|  PREDICTED: zinc finger protein ZAT11-like        80.5    3e-16   
gb|KCW85605.1|  hypothetical protein EUGRSUZ_B02391                   80.9    3e-16   
tpg|DAA56924.1|  TPA: zinc finger, C2H2 type family protein           80.9    3e-16   
ref|XP_008794835.1|  PREDICTED: zinc finger protein ZAT11-like        79.7    3e-16   
ref|XP_010905714.1|  PREDICTED: zinc finger protein ZAT11-like        79.7    3e-16   
ref|NP_001151309.1|  zinc finger, C2H2 type family protein            80.5    3e-16   
ref|XP_009779269.1|  PREDICTED: zinc finger protein ZAT11-like        79.7    3e-16   
ref|XP_004241248.2|  PREDICTED: zinc finger protein ZAT11-like        79.3    3e-16   
ref|XP_008795823.1|  PREDICTED: zinc finger protein ZAT11-like        80.1    3e-16   
ref|XP_010490834.1|  PREDICTED: zinc finger protein ZAT5              81.3    3e-16   
gb|KCW85606.1|  hypothetical protein EUGRSUZ_B02393                   81.3    3e-16   
ref|XP_011042666.1|  PREDICTED: zinc finger protein ZAT12-like        80.1    4e-16   
gb|KHN21982.1|  Zinc finger protein ZAT8                              79.3    4e-16   
emb|CDY11255.1|  BnaA03g00910D                                        80.5    4e-16   
gb|ACB20696.1|  putative cold-inducible protein                       79.3    5e-16   
ref|XP_002314198.2|  RESPONSIVE TO HIGH LIGHT 41 family protein       80.1    5e-16   
ref|XP_009397260.1|  PREDICTED: zinc finger protein ZAT4-like         82.4    5e-16   
ref|XP_006387108.1|  hypothetical protein POPTR_1833s00200g           79.0    5e-16   
ref|XP_004294603.1|  PREDICTED: zinc finger protein ZAT11-like        79.3    5e-16   
dbj|BAA21922.1|  ZPT2-13                                              79.3    5e-16   
emb|CDX80870.1|  BnaC03g01240D                                        80.5    5e-16   
ref|XP_004251306.1|  PREDICTED: zinc finger protein ZAT11-like        79.0    6e-16   
gb|AFK46502.1|  unknown                                               79.3    6e-16   
emb|CDM84910.1|  unnamed protein product                              79.7    6e-16   
ref|XP_008788150.1|  PREDICTED: zinc finger protein ZAT11-like        78.6    6e-16   
ref|NP_181279.1|  zinc finger protein ZAT11                           79.3    6e-16   
ref|XP_010112909.1|  Zinc finger protein ZAT8                         79.7    6e-16   
emb|CAA67230.1|  zinc finger protein                                  79.3    6e-16   
ref|XP_006590993.1|  PREDICTED: zinc finger protein ZAT11-like        78.6    7e-16   
dbj|BAA21925.1|  ZPT2-8                                               79.0    7e-16   
ref|XP_004306355.1|  PREDICTED: zinc finger protein ZAT11-like        79.0    8e-16   
ref|XP_006436057.1|  hypothetical protein CICLE_v10032922mg           79.0    8e-16   
ref|XP_010452231.1|  PREDICTED: zinc finger protein ZAT5-like         80.1    8e-16   
gb|EPS70963.1|  hypothetical protein M569_03799                       79.7    8e-16   
ref|XP_006398801.1|  hypothetical protein EUTSA_v10014348mg           80.1    8e-16   
ref|XP_010043589.1|  PREDICTED: zinc finger protein ZAT8-like         79.0    8e-16   
ref|XP_004241247.1|  PREDICTED: zinc finger protein ZAT12-like        78.6    8e-16   
emb|CDP16476.1|  unnamed protein product                              79.0    9e-16   
ref|NP_195971.1|  C2H2-type zinc finger protein                       80.1    9e-16   
emb|CDP09000.1|  unnamed protein product                              79.0    9e-16   
ref|XP_009594752.1|  PREDICTED: zinc finger protein ZAT11-like        78.6    9e-16   
gb|KDO67725.1|  hypothetical protein CISIN_1g041414mg                 78.6    9e-16   
gb|KGN59004.1|  hypothetical protein Csa_3G743410                     79.7    9e-16   
ref|XP_009628790.1|  PREDICTED: zinc finger protein ZAT12-like        79.0    1e-15   
ref|XP_006363363.1|  PREDICTED: zinc finger protein ZAT11-like        78.6    1e-15   
ref|XP_006350750.1|  PREDICTED: zinc finger protein ZAT11-like        78.6    1e-15   
ref|XP_008660288.1|  PREDICTED: zinc finger protein ZAT8-like         79.0    1e-15   
ref|XP_011000297.1|  PREDICTED: zinc finger protein ZAT11             79.0    1e-15   
gb|KHN05934.1|  Zinc finger protein ZAT11                             78.6    1e-15   
ref|XP_006436056.1|  hypothetical protein CICLE_v10032889mg           78.6    1e-15   
ref|XP_003537203.1|  PREDICTED: zinc finger protein ZAT11-like        78.6    1e-15   
ref|XP_007027111.1|  C2H2 and C2HC zinc fingers superfamily prote...  79.0    1e-15   
ref|XP_006288382.1|  hypothetical protein CARUB_v10001633mg           79.3    1e-15   
emb|CDY10376.1|  BnaCnng02770D                                        79.3    1e-15   
ref|XP_004506485.1|  PREDICTED: zinc finger protein ZAT9-like         80.1    1e-15   
ref|XP_004967311.1|  PREDICTED: zinc finger protein ZAT5-like         79.3    1e-15   
ref|XP_006363362.1|  PREDICTED: zinc finger protein ZAT11-like        78.2    1e-15   
ref|XP_009416689.1|  PREDICTED: zinc finger protein ZAT11-like        77.8    1e-15   
ref|XP_004161279.1|  PREDICTED: zinc finger protein ZAT5-like         79.3    1e-15   
ref|XP_002299891.2|  zinc finger family protein                       78.6    1e-15   
ref|XP_006338916.1|  PREDICTED: zinc finger protein ZAT9-like         79.0    1e-15   
gb|AAP74358.1|  C2H2 type zinc finger transcription factor ZFP17      78.2    1e-15   
ref|XP_009117667.1|  PREDICTED: zinc finger protein ZAT11-like        78.2    2e-15   
gb|KGN62196.1|  hypothetical protein Csa_2G326490                     79.0    2e-15   
gb|KHN02300.1|  Zinc finger protein ZAT5                              79.0    2e-15   
emb|CDM84884.1|  unnamed protein product                              78.6    2e-15   
ref|XP_002523729.1|  conserved hypothetical protein                   79.7    2e-15   
ref|XP_003554400.1|  PREDICTED: zinc finger protein ZAT5-like         79.0    2e-15   
gb|AHN52237.1|  C2H2-type zinc finger protein 6                       79.0    2e-15   
ref|XP_010313549.1|  PREDICTED: zinc finger protein ZAT11-like        77.8    2e-15   
emb|CDO99809.1|  unnamed protein product                              79.7    2e-15   
ref|NP_001068532.1|  Os11g0702400                                     77.8    2e-15   
ref|XP_009130761.1|  PREDICTED: zinc finger protein ZAT5              78.6    3e-15   
gb|AFK48956.1|  unknown                                               76.6    3e-15   
ref|XP_009122694.1|  PREDICTED: zinc finger protein ZAT5-like         78.2    4e-15   
gb|AAY40248.1|  Cys2/His2 zinc-finger transcription factor            78.2    4e-15   
gb|KEH29190.1|  Cys2/His2 zinc-finger transcription factor            79.3    4e-15   
ref|XP_011077260.1|  PREDICTED: zinc finger protein ZAT5-like         78.6    4e-15   
ref|XP_002437653.1|  hypothetical protein SORBIDRAFT_10g031270        77.4    4e-15   
emb|CAQ64474.1|  putative Cys2/His2 zinc finger protein               77.4    5e-15   
ref|NP_001054460.1|  Os05g0114400                                     77.4    5e-15   
emb|CDY44371.1|  BnaC02g03060D                                        77.8    5e-15   
emb|CDX70302.1|  BnaA10g26510D                                        77.8    5e-15   
ref|XP_004960500.1|  PREDICTED: zinc finger protein ZAT12-like        77.0    5e-15   
emb|CAF74933.1|  zinc finger DNA-binding protein                      76.6    6e-15   
ref|XP_007162794.1|  hypothetical protein PHAVU_001G181200g           78.2    7e-15   
ref|XP_006363364.1|  PREDICTED: zinc finger protein ZAT11-like        76.3    8e-15   
ref|XP_003541393.1|  PREDICTED: zinc finger protein ZAT11-like        76.3    9e-15   
dbj|BAA21919.1|  ZPT2-10                                              77.0    9e-15   
ref|XP_004307547.1|  PREDICTED: zinc finger protein ZAT11-like        76.6    9e-15   
gb|EYU32430.1|  hypothetical protein MIMGU_mgv1a010048mg              77.4    1e-14   
ref|XP_004494014.1|  PREDICTED: zinc finger protein ZAT4-like         77.8    1e-14   
ref|XP_004165931.1|  PREDICTED: zinc finger protein ZAT12-like        75.9    1e-14   
ref|XP_004149058.1|  PREDICTED: zinc finger protein ZAT12-like        75.5    1e-14   
gb|AAY40249.1|  Cys2/His2 zinc-finger transcription factor            77.0    1e-14   
gb|AGK28205.1|  C2H2-type zinc finger protein 7                       75.5    1e-14   
ref|XP_010443762.1|  PREDICTED: zinc finger protein ZAT12             75.9    1e-14   
emb|CDY11027.1|  BnaA03g46860D                                        76.6    1e-14   
gb|AFW74905.1|  ZFP16-1                                               76.3    1e-14   



>ref|XP_006349125.1| PREDICTED: zinc finger protein ZAT5-like [Solanum tuberosum]
Length=291

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 64/100 (64%), Gaps = 15/100 (15%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKK------STPLDHHHHHQEIQDKTHE  102
            YECKTCNR F SFQALGGHRASH KPK I ED K       ST +   H +   QDK H 
Sbjct  129  YECKTCNRTFNSFQALGGHRASHKKPKTILEDKKSVTINTDSTAIAAGHDNLHDQDKEHL  188

Query  101  K---------SNKTKIHECLICGSLFFSGQALGGHMRRHR  9
                      ++KTKIHEC ICGS F SGQALGGHMRRHR
Sbjct  189  NKISSTTTHSNSKTKIHECSICGSEFSSGQALGGHMRRHR  228



>ref|XP_004251369.1| PREDICTED: zinc finger protein ZAT5 [Solanum lycopersicum]
Length=294

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 66/100 (66%), Gaps = 15/100 (15%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKK--------STPLDHHHHHQEIQDKT  108
            YECKTCNR F SFQALGGHRASH KPK I ED K         +   DH + H + Q++ 
Sbjct  136  YECKTCNRTFNSFQALGGHRASHKKPKTILEDKKSVTDTTATATAAADHDNLHDQGQERL  195

Query  107  HEKSN-------KTKIHECLICGSLFFSGQALGGHMRRHR  9
            ++ SN       KTKIHEC ICGS F SGQALGGHMRRHR
Sbjct  196  NKISNTTIQSNVKTKIHECSICGSEFSSGQALGGHMRRHR  235



>ref|XP_011077299.1| PREDICTED: zinc finger protein ZAT5 [Sesamum indicum]
Length=267

 Score =   102 bits (254),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 65/106 (61%), Gaps = 19/106 (18%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPK--LIPEDHKK----------STPLDHHHHHQEI  120
            Y+CKTCN+ F+SFQALGGHRASH KP   +I  D KK          S+P D  H    I
Sbjct  102  YQCKTCNKSFQSFQALGGHRASHKKPTKPIIAVDEKKASSSRDHKQESSPSDGEHDDTTI  161

Query  119  -------QDKTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHRPL  3
                   +  +    NKT++HEC ICG+ F SGQALGGHMRRHRPL
Sbjct  162  LSLQIPSRTPSSPNKNKTRVHECSICGAEFTSGQALGGHMRRHRPL  207



>ref|XP_004246607.1| PREDICTED: zinc finger protein ZAT5 [Solanum lycopersicum]
Length=310

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 65/112 (58%), Gaps = 26/112 (23%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKT-  87
            Y+CKTCNR F SFQALGGHRASH KPK + ED  K+   + HHHHQ+ ++    K N   
Sbjct  124  YQCKTCNRSFPSFQALGGHRASHKKPKTL-EDQIKNLKSNDHHHHQQAENNIRLKLNNND  182

Query  86   ------------------------KIHECLICGSLFFSGQALGGHMRRHRPL  3
                                    ++HEC ICG+ F SGQALGGHMRRHRPL
Sbjct  183  DHVTTLSLQIPNNSNNNSNNKNKNRVHECSICGAEFNSGQALGGHMRRHRPL  234



>emb|CBI17130.3| unnamed protein product [Vitis vinifera]
Length=228

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 58/85 (68%), Gaps = 10/85 (12%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            YECKTCNR F SFQALGGHRASH KPK I      S PL      Q   +K    SNK+K
Sbjct  83   YECKTCNRTFPSFQALGGHRASHKKPKAI------SPPLSL----QIGNNKALHSSNKSK  132

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +HEC ICGS F SGQALGGHMRRHR
Sbjct  133  VHECSICGSEFSSGQALGGHMRRHR  157



>ref|XP_006354388.1| PREDICTED: zinc finger protein ZAT5-like [Solanum tuberosum]
Length=307

 Score = 99.8 bits (247),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 64/111 (58%), Gaps = 27/111 (24%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKT-  87
            Y+CKTCNR F SFQALGGHRASH KPK++ +  K S   D   HHQ++++    K N   
Sbjct  126  YQCKTCNRSFPSFQALGGHRASHKKPKILDDQIKNSKSSD---HHQQVENNIRLKLNNND  182

Query  86   -----------------------KIHECLICGSLFFSGQALGGHMRRHRPL  3
                                   ++HEC ICG+ F SGQALGGHMRRHRPL
Sbjct  183  DHVTTLSLQMPSNNNNNNNKNKNRVHECSICGAEFTSGQALGGHMRRHRPL  233



>emb|CAN59833.1| hypothetical protein VITISV_017619 [Vitis vinifera]
Length=308

 Score = 99.8 bits (247),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 64/101 (63%), Gaps = 16/101 (16%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHK--KSTPLDHHHHHQEIQ---------  117
            YECKTCNR F SFQALGGHRASH KPK + E+ K   +T      +++E Q         
Sbjct  137  YECKTCNRTFPSFQALGGHRASHKKPKAVVEEKKGPAATAXWDDDYYEEGQFNKISPPLS  196

Query  116  -----DKTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
                 +K    SNK+K+HEC ICGS F SGQALGGHMRRHR
Sbjct  197  LQIGNNKALHSSNKSKVHECSICGSEFSSGQALGGHMRRHR  237



>ref|XP_002274374.1| PREDICTED: zinc finger protein ZAT5 [Vitis vinifera]
Length=296

 Score = 99.8 bits (247),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 64/101 (63%), Gaps = 16/101 (16%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHK--KSTPLDHHHHHQEIQ---------  117
            YECKTCNR F SFQALGGHRASH KPK + E+ K   +T      +++E Q         
Sbjct  125  YECKTCNRTFPSFQALGGHRASHKKPKAVVEEKKGPAATASWDDDYYEEGQFNKISPPLS  184

Query  116  -----DKTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
                 +K    SNK+K+HEC ICGS F SGQALGGHMRRHR
Sbjct  185  LQIGNNKALHSSNKSKVHECSICGSEFSSGQALGGHMRRHR  225



>ref|XP_010267264.1| PREDICTED: zinc finger protein ZAT5 [Nelumbo nucifera]
Length=304

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 63/100 (63%), Gaps = 15/100 (15%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKK----STPLDH-----------HHHH  129
            YECKTCNR F SFQALGGHRASH KPK +  + KK    S+P +            H H 
Sbjct  134  YECKTCNRCFPSFQALGGHRASHKKPKAMAAEEKKALMVSSPEEDEAQFNNVNSSPHLHL  193

Query  128  QEIQDKTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
            Q   +K     NK+++HEC ICGS F SGQALGGHMRRHR
Sbjct  194  QIAGNKASVYGNKSRVHECSICGSEFSSGQALGGHMRRHR  233



>ref|XP_007132339.1| hypothetical protein PHAVU_011G086400g [Phaseolus vulgaris]
 gb|ESW04333.1| hypothetical protein PHAVU_011G086400g [Phaseolus vulgaris]
Length=305

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 62/101 (61%), Gaps = 17/101 (17%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDK---------  111
            YECKTCNR F SFQALGGHRASH KPKL+ E+ KK+ P    H      D+         
Sbjct  138  YECKTCNRTFPSFQALGGHRASHKKPKLVGEE-KKTPPSQLQHMFVTKYDRFEEDNVKSG  196

Query  110  -------THEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
                    H  ++K KIHEC ICGS F SGQALGGHMRRHR
Sbjct  197  PPISLQLGHGNNSKGKIHECSICGSEFSSGQALGGHMRRHR  237



>ref|XP_011089966.1| PREDICTED: zinc finger protein ZAT5-like [Sesamum indicum]
Length=290

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 61/99 (62%), Gaps = 14/99 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPK-LIPEDHKKSTPLDHHHHHQEIQDKTHEKS---  96
            YECKTCNR F SFQALGGHRASH KPK    +D KKS P      +QE ++     +   
Sbjct  118  YECKTCNRTFPSFQALGGHRASHKKPKPTTDDDQKKSPPAPPPPDYQEEEEAPPPSTQLP  177

Query  95   ----------NKTKIHECLICGSLFFSGQALGGHMRRHR  9
                      NK KIHEC ICGS F SGQALGGHMRRHR
Sbjct  178  NNKSCHYYDHNKPKIHECSICGSEFASGQALGGHMRRHR  216



>ref|XP_009613500.1| PREDICTED: zinc finger protein ZAT5-like [Nicotiana tomentosiformis]
Length=316

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 64/107 (60%), Gaps = 24/107 (22%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKT-  87
            YECKTCNR F SFQALGGHR SH K K I E+ KKST    +H  Q +Q++  EK NK  
Sbjct  137  YECKTCNRTFPSFQALGGHRTSHKKAKTIVEE-KKSTADSENHDRQYLQEE--EKLNKII  193

Query  86   --------------------KIHECLICGSLFFSGQALGGHMRRHRP  6
                                KIHEC ICG+ F SGQALGGHMRRHRP
Sbjct  194  TPTQIVNKGNYSHGNLNSKQKIHECSICGAEFSSGQALGGHMRRHRP  240



>ref|XP_011088799.1| PREDICTED: zinc finger protein ZAT5 [Sesamum indicum]
Length=309

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 64/111 (58%), Gaps = 24/111 (22%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPE-DHKKSTPLDHHHHHQEIQ-DKTHE----  102
            YECKTC+R F SFQALGGHRASH KPK   + D K S P D  H  +E +  K H     
Sbjct  121  YECKTCSRAFPSFQALGGHRASHKKPKPTTDIDQKNSPPDDQQHEVEEGESSKLHTVPPP  180

Query  101  ------------------KSNKTKIHECLICGSLFFSGQALGGHMRRHRPL  3
                              + NK KIHEC ICGS F SGQALGGHMRRHRP+
Sbjct  181  PPPPPSTQSPNKNFHVDHQINKPKIHECSICGSEFASGQALGGHMRRHRPV  231



>ref|XP_002311984.2| hypothetical protein POPTR_0008s03220g, partial [Populus trichocarpa]
 gb|EEE89351.2| hypothetical protein POPTR_0008s03220g, partial [Populus trichocarpa]
Length=231

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 63/104 (61%), Gaps = 17/104 (16%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKK------STPLDHHHHH---------  129
            YECKTC+R F SFQALGGHRASH KPK I  D KK      S   D H+ +         
Sbjct  54   YECKTCSRTFPSFQALGGHRASHKKPKAIHNDEKKQNLSISSDEEDGHYKNVSSLSLQLS  113

Query  128  -QEIQDKTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHR-PL  3
                   T+   NK KIHEC +CG++F SGQALGGHMRRHR PL
Sbjct  114  ENNTNRGTYSNHNKGKIHECSVCGAVFTSGQALGGHMRRHRGPL  157



>emb|CAA43111.1| DNA-binding protein [Petunia x hybrida]
Length=281

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 64/109 (59%), Gaps = 25/109 (23%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQE-------------  123
            YECKTCNR F SFQALGGHR SH K K I  +  K++ L+ HH  QE             
Sbjct  90   YECKTCNRTFPSFQALGGHRTSHKKSKTIAAE--KTSTLEDHHQQQERVAQEEGEFIKII  147

Query  122  -------IQDKTHEKSN---KTKIHECLICGSLFFSGQALGGHMRRHRP  6
                   I    + +SN   K+KIHEC ICG+ F SGQALGGHMRRHRP
Sbjct  148  PSISTQIINKGNNMQSNFNSKSKIHECAICGAEFTSGQALGGHMRRHRP  196



>emb|CDP15290.1| unnamed protein product [Coffea canephora]
Length=304

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 63/107 (59%), Gaps = 20/107 (19%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQE----IQDKTHEKS  96
            Y+CKTCNR F SFQALGGHRASH KPK    + K   PL    H +     I+D+    S
Sbjct  125  YQCKTCNRSFPSFQALGGHRASHKKPKPTDLEDKSPPPLSLGGHQESTVGLIRDEDTTLS  184

Query  95   ----------------NKTKIHECLICGSLFFSGQALGGHMRRHRPL  3
                            NK+++HEC ICG+ F SGQALGGHMRRHRPL
Sbjct  185  LQIPSGRKDPIISGDVNKSRVHECSICGAEFSSGQALGGHMRRHRPL  231



>ref|XP_010109936.1| Zinc finger protein ZAT5 [Morus notabilis]
 gb|EXC24912.1| Zinc finger protein ZAT5 [Morus notabilis]
Length=319

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 62/102 (61%), Gaps = 17/102 (17%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPE-DHKKSTPL---------DHHHHHQEIQD  114
            YECKTCNR F SFQALGGHRASH KPK     D KK T L         D   HH  + +
Sbjct  135  YECKTCNRTFPSFQALGGHRASHKKPKTAAAVDDKKPTILSEELEDNQDDKEEHHVFLLN  194

Query  113  KTHEK-------SNKTKIHECLICGSLFFSGQALGGHMRRHR  9
            KT +K       +   K+HEC ICGS F SGQALGGHMRRHR
Sbjct  195  KTLQKVGIISTSTITNKVHECSICGSEFTSGQALGGHMRRHR  236



>ref|XP_009776555.1| PREDICTED: zinc finger protein ZAT5-like [Nicotiana sylvestris]
Length=306

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 62/97 (64%), Gaps = 12/97 (12%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQ------EIQDKTH-  105
            YECKTCNR F SFQALGGHR SH K K I E+ KKST    +  HQ      EI   T  
Sbjct  137  YECKTCNRTFPSFQALGGHRTSHKKAKTIVEE-KKSTADSENPDHQNEEKLNEIITPTQI  195

Query  104  -EKSN---KTKIHECLICGSLFFSGQALGGHMRRHRP  6
              K N   K KIHEC ICG+ F SGQALGGHMRRHRP
Sbjct  196  VNKGNSHSKPKIHECSICGAEFSSGQALGGHMRRHRP  232



>ref|XP_010935821.1| PREDICTED: zinc finger protein ZAT5-like [Elaeis guineensis]
Length=283

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 65/98 (66%), Gaps = 11/98 (11%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKL-IP----EDHKK-----STPLDHHHHHQEIQD  114
            YECKTC++ F SFQALGGHRASH KPKL IP    E+ K      S  +  +   + I  
Sbjct  125  YECKTCSKCFPSFQALGGHRASHKKPKLGIPMTGTEEKKAVIDEDSIQISMNSISKSIMA  184

Query  113  KTHEKSN-KTKIHECLICGSLFFSGQALGGHMRRHRPL  3
             ++  SN K K+HEC ICGS F SGQALGGHMRRHRPL
Sbjct  185  ASNTNSNSKPKVHECSICGSEFSSGQALGGHMRRHRPL  222



>ref|XP_008226652.1| PREDICTED: zinc finger protein ZAT5 [Prunus mume]
Length=309

 Score = 97.8 bits (242),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 61/102 (60%), Gaps = 17/102 (17%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTP--LDHHHHHQEIQDK-------  111
            YECKTCNR F SFQALGGHRASH KPK +  + KK  P         +E +D+       
Sbjct  125  YECKTCNRSFPSFQALGGHRASHKKPKAMSTEEKKPAPAHFIPASPFEEFEDQSKQFIKY  184

Query  110  --------THEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
                    + +  +K KIHEC ICGS F SGQALGGHMRRHR
Sbjct  185  KSSPPPAISSQIGSKPKIHECSICGSEFTSGQALGGHMRRHR  226



>ref|XP_002315335.2| putative zinc finger family protein [Populus trichocarpa]
 gb|EEF01506.2| putative zinc finger family protein [Populus trichocarpa]
Length=290

 Score = 97.4 bits (241),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 60/91 (66%), Gaps = 6/91 (7%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKK-----STPLDHHHHHQEIQDK-THE  102
            YECKTCNR F SFQALGGHRASH KPK    D +K     S+  +   H++ +    T  
Sbjct  121  YECKTCNRTFPSFQALGGHRASHKKPKATHNDERKKNLSPSSDEELDGHYKNVSSLCTFS  180

Query  101  KSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
              NK KIHEC +CG+ F SGQALGGHMRRHR
Sbjct  181  NHNKGKIHECSVCGAEFTSGQALGGHMRRHR  211



>ref|XP_007016063.1| C2H2-type zinc finger family protein, putative [Theobroma cacao]
 gb|EOY33682.1| C2H2-type zinc finger family protein, putative [Theobroma cacao]
Length=316

 Score = 97.4 bits (241),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 60/99 (61%), Gaps = 14/99 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQE-----------IQ  117
            YECKTCNR F SFQALGGHRASH KPK    + KK   L      +E           +Q
Sbjct  134  YECKTCNRSFPSFQALGGHRASHKKPKGATAEEKKPLALAVKGDVEEGQFNRESPVLALQ  193

Query  116  DKTHEKS---NKTKIHECLICGSLFFSGQALGGHMRRHR  9
               + K+   NK KIHEC ICGS F SGQALGGHMRRHR
Sbjct  194  VSNNNKACHGNKGKIHECSICGSEFTSGQALGGHMRRHR  232



>ref|XP_009122879.1| PREDICTED: zinc finger protein ZAT5-like [Brassica rapa]
Length=384

 Score = 97.8 bits (242),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 59/100 (59%), Gaps = 15/100 (15%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPE--DHKKSTPLDHHHHHQEIQDK-------  111
            Y+CKTC+R F SFQALGGHRASH KPK  P   D KKS   D   HH             
Sbjct  173  YQCKTCDRTFPSFQALGGHRASHKKPKAAPGLHDLKKSIYNDAVSHHLNNVLTTTPNNNN  232

Query  110  ------THEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
                   H K+N  K+HEC ICG+ F SGQALGGHMRRHR
Sbjct  233  NHRSLVVHGKANNNKVHECGICGAEFTSGQALGGHMRRHR  272



>gb|EPS70723.1| hypothetical protein M569_04037, partial [Genlisea aurea]
Length=154

 Score = 94.7 bits (234),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 57/85 (67%), Gaps = 4/85 (5%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            YECKTC R F SFQALGGHRASH KPK    D ++ +P + +     +       + K K
Sbjct  74   YECKTCLRAFSSFQALGGHRASHRKPKA---DDRRKSPAEDYDEKVAVPPAA-SLAQKEK  129

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            IHEC +CGS+F SGQALGGHMRRHR
Sbjct  130  IHECSVCGSVFSSGQALGGHMRRHR  154



>ref|XP_008807698.1| PREDICTED: zinc finger protein ZAT5 [Phoenix dactylifera]
Length=286

 Score = 97.1 bits (240),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 59/93 (63%), Gaps = 7/93 (8%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKL-IP--EDHKKSTPLDHHHHHQEIQDKT----H  105
            YECKTCN+ F SFQALGGHRASH KPKL IP  E+ KK    D          K      
Sbjct  131  YECKTCNKCFPSFQALGGHRASHKKPKLAIPAAEEKKKMVEEDMLRMSMNSFPKAVVGGS  190

Query  104  EKSNKTKIHECLICGSLFFSGQALGGHMRRHRP  6
              S K ++HEC ICGS F SGQALGGHMRRHRP
Sbjct  191  SSSTKPRVHECSICGSEFNSGQALGGHMRRHRP  223



>ref|XP_008779116.1| PREDICTED: zinc finger protein ZAT5-like [Phoenix dactylifera]
Length=291

 Score = 97.1 bits (240),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 64/103 (62%), Gaps = 16/103 (16%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKL-IP----EDHKKSTPLD------HHHHHQEIQ  117
            YECKTCN+ F SFQALGGHRASH KPKL IP    E  K +   D      +    + I 
Sbjct  126  YECKTCNKCFPSFQALGGHRASHKKPKLAIPMTGTEAKKAAIDEDSLQISMNSSISKSIM  185

Query  116  DKTHEKS-----NKTKIHECLICGSLFFSGQALGGHMRRHRPL  3
              T+  S     NK ++HEC ICGS F SGQALGGHMRRHRP+
Sbjct  186  AATNTNSTSISNNKPRVHECSICGSEFSSGQALGGHMRRHRPV  228



>ref|XP_009394662.1| PREDICTED: zinc finger protein ZAT5-like [Musa acuminata subsp. 
malaccensis]
Length=266

 Score = 96.7 bits (239),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKS-NKT  87
            Y+CKTC++ F SFQALGGHR SH KPKL P D      +  +    +    +H  + NK 
Sbjct  119  YQCKTCDKCFPSFQALGGHRTSHKKPKLAPVDDGDGPQITMNSPIAKPSVASHIININKP  178

Query  86   KIHECLICGSLFFSGQALGGHMRRHRPL  3
            ++HEC ICG+ F SGQALGGHMRRHRP+
Sbjct  179  RVHECSICGAEFSSGQALGGHMRRHRPI  206



>emb|CDY41350.1| BnaA01g31690D [Brassica napus]
Length=252

 Score = 96.7 bits (239),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 57/87 (66%), Gaps = 15/87 (17%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPE--DHKKSTPLDHHHHHQEIQDKTHEKSNK  90
            Y+CKTC+R F SFQALGGHRASH KPK  P   D KKS  +             H K+N 
Sbjct  67   YQCKTCDRTFPSFQALGGHRASHKKPKAAPGLHDLKKSLVV-------------HGKANN  113

Query  89   TKIHECLICGSLFFSGQALGGHMRRHR  9
             K+HEC ICG+ F SGQALGGHMRRHR
Sbjct  114  NKVHECGICGAEFTSGQALGGHMRRHR  140



>ref|XP_011031622.1| PREDICTED: zinc finger protein ZAT5-like [Populus euphratica]
Length=304

 Score = 97.1 bits (240),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 62/104 (60%), Gaps = 17/104 (16%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKK------STPLDHHHHH---------  129
            YECKTC+R F SFQALGGHRASH KPK I  D KK      S   D H+ +         
Sbjct  127  YECKTCSRTFPSFQALGGHRASHKKPKAIHNDEKKQNLSISSDEEDGHYKNVSSLSLQLS  186

Query  128  -QEIQDKTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHR-PL  3
                   T+   NK KIHEC +CG+ F SGQALGGHMRRHR PL
Sbjct  187  ENNTNRGTYSNHNKGKIHECSVCGAEFTSGQALGGHMRRHRGPL  230



>emb|CAI77630.1| putative Cys2-His2 zinc finger transcription factor [Juglans 
regia]
Length=183

 Score = 95.1 bits (235),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 56/85 (66%), Gaps = 12/85 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH +P+L+ E+HK              + K     NK K
Sbjct  50   FECKTCNRQFSSFQALGGHRASHKRPRLMGEEHKVD------------RTKLQSSGNKPK  97

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +HEC +CG  F  GQALGGHMRRHR
Sbjct  98   MHECSLCGQKFSMGQALGGHMRRHR  122



>ref|XP_004294532.1| PREDICTED: zinc finger protein ZAT5-like [Fragaria vesca subsp. 
vesca]
Length=325

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 64/122 (52%), Gaps = 35/122 (29%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIP----EDHKKSTPL---DHHHHHQEIQD---  114
            YECKTCNR F SFQALGGHRASH KPK +     +  KK  P+         QE++D   
Sbjct  115  YECKTCNRTFPSFQALGGHRASHKKPKSVAAAMADQEKKPAPIHFTTSASMDQEVEDSKQ  174

Query  113  -------------------------KTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
                                     K  + +NK KIHEC ICGS F SGQALGGHMRRHR
Sbjct  175  FVKKSSPPPPPPPPPSTQPAVPIQIKGFQSNNKAKIHECSICGSEFSSGQALGGHMRRHR  234

Query  8    PL  3
             +
Sbjct  235  AI  236



>ref|XP_007144239.1| hypothetical protein PHAVU_007G139600g [Phaseolus vulgaris]
 gb|ESW16233.1| hypothetical protein PHAVU_007G139600g [Phaseolus vulgaris]
Length=333

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 64/101 (63%), Gaps = 18/101 (18%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPK---LIPEDHKKSTPLDHHHHHQEIQDKTHEKS-  96
            YECKTCNR F SFQALGGHRASH KPK    I ++ K+   L      +E Q KT+ KS 
Sbjct  146  YECKTCNRTFPSFQALGGHRASHKKPKAMMAIGQEKKQQHLLS--SDEEEFQLKTNNKSP  203

Query  95   ------------NKTKIHECLICGSLFFSGQALGGHMRRHR  9
                        NK+K+HEC ICG+ F SGQALGGHMRRHR
Sbjct  204  FSLQLNTKGNLYNKSKVHECSICGAEFTSGQALGGHMRRHR  244



>ref|XP_010933179.1| PREDICTED: zinc finger protein ZAT5-like [Elaeis guineensis]
Length=276

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 56/92 (61%), Gaps = 5/92 (5%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKL-----IPEDHKKSTPLDHHHHHQEIQDKTHEK  99
            YECKTCN+ F SFQALGGHR SH KPK      + E  K+    D          K    
Sbjct  123  YECKTCNKCFPSFQALGGHRTSHKKPKPAVVAPVAEGKKEMVDKDMVQISMNSLSKAIAS  182

Query  98   SNKTKIHECLICGSLFFSGQALGGHMRRHRPL  3
            S K ++HEC ICGS F SGQALGGHMRRHRPL
Sbjct  183  SVKPRVHECSICGSEFNSGQALGGHMRRHRPL  214



>ref|XP_007205449.1| hypothetical protein PRUPE_ppa007860mg [Prunus persica]
 gb|EMJ06648.1| hypothetical protein PRUPE_ppa007860mg [Prunus persica]
Length=353

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 61/102 (60%), Gaps = 17/102 (17%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTP--LDHHHHHQEIQDK-------  111
            YECKTCNR F SFQALGGHRASH KPK +  + KK  P         +E +D+       
Sbjct  169  YECKTCNRSFPSFQALGGHRASHKKPKAMSTEDKKPAPAHFIPASTFEEFEDQSKQFIKY  228

Query  110  --------THEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
                    + +  +K KIHEC ICGS F SGQALGGHMRRHR
Sbjct  229  KSSPPPAISSQIGSKPKIHECSICGSEFTSGQALGGHMRRHR  270



>ref|XP_009384553.1| PREDICTED: zinc finger protein ZAT5-like [Musa acuminata subsp. 
malaccensis]
Length=287

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 58/96 (60%), Gaps = 9/96 (9%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKS---TPLDHHHHHQEIQD------K  111
            YECKTCN+ F SFQALGGHR SH KPKL P     +     +D       +         
Sbjct  126  YECKTCNKCFPSFQALGGHRTSHKKPKLAPPPTTAAEEKVVVDDDMLQISMNSFSKPIGS  185

Query  110  THEKSNKTKIHECLICGSLFFSGQALGGHMRRHRPL  3
            + + + K KIHEC ICGS F SGQALGGHMRRHRPL
Sbjct  186  SGQSNTKPKIHECSICGSEFSSGQALGGHMRRHRPL  221



>ref|XP_009390198.1| PREDICTED: zinc finger protein ZAT5-like [Musa acuminata subsp. 
malaccensis]
Length=282

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 59/96 (61%), Gaps = 10/96 (10%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTH-------  105
            YECKTC+R F SFQALGGHRASH KPKL               H   +Q  T+       
Sbjct  125  YECKTCSRWFPSFQALGGHRASHKKPKLTAATTIAIEERKESIHDHLLQTSTNPFSHPVR  184

Query  104  --EKSN-KTKIHECLICGSLFFSGQALGGHMRRHRP  6
              E+SN KTK HEC ICGS F SGQALGGHMRRHRP
Sbjct  185  GVEQSNTKTKTHECSICGSEFSSGQALGGHMRRHRP  220



>ref|XP_006347206.1| PREDICTED: zinc finger protein ZAT5-like [Solanum tuberosum]
Length=329

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 63/112 (56%), Gaps = 27/112 (24%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTP------LDHHHHHQE-------  123
            YECKTCNR F SFQALGGHR SH K K + E+ KKST       +DH    +E       
Sbjct  137  YECKTCNRTFPSFQALGGHRTSHKKIKTVAEE-KKSTADSVSPSIDHQQQQEEKFNRITA  195

Query  122  --IQDKTHEKSN-----------KTKIHECLICGSLFFSGQALGGHMRRHRP  6
                 +T  K N           K KIHEC ICG+ F SGQALGGHMRRHRP
Sbjct  196  SVTSTQTVNKGNSNSHSNLIINSKPKIHECSICGAEFSSGQALGGHMRRHRP  247



>ref|XP_009372494.1| PREDICTED: zinc finger protein ZAT5-like [Pyrus x bretschneideri]
Length=322

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 63/111 (57%), Gaps = 26/111 (23%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPK-------LIPEDHKKSTPLDHHH----HHQEIQ  117
            YECKTCNR F SFQALGGHRASH KPK       +I +    + P  HH       +E +
Sbjct  124  YECKTCNRTFPSFQALGGHRASHKKPKSMSSTEEMIKKSPPAAAPPTHHFITATTFEEFE  183

Query  116  DKTH---------------EKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
            D++                +  NK KIHEC ICGS F SGQALGGHMRRHR
Sbjct  184  DQSKQLIKYKSSPPPAIPIQVGNKPKIHECSICGSEFTSGQALGGHMRRHR  234



>gb|KEH43312.1| C2H2-type zinc finger protein [Medicago truncatula]
Length=355

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 61/105 (58%), Gaps = 23/105 (22%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKS----  96
            YECKTCNR F SFQALGGHRASH KPK +    +K    D     QE Q K + KS    
Sbjct  156  YECKTCNRTFPSFQALGGHRASHKKPKALAIAQEKKHLYD---DDQEFQFKPNHKSISLQ  212

Query  95   ----------------NKTKIHECLICGSLFFSGQALGGHMRRHR  9
                            NK+K+HEC ICGS F SGQALGGHMRRHR
Sbjct  213  LNNNGKGNLHGGSNNNNKSKVHECSICGSEFTSGQALGGHMRRHR  257



>ref|XP_010910785.1| PREDICTED: zinc finger protein ZAT5-like [Elaeis guineensis]
Length=282

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 58/92 (63%), Gaps = 5/92 (5%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLI---PEDHKKSTPLDHHHHHQEIQDKTHEK--  99
            YECKTCN+ F SFQALGGHRASH KPKL     E+ K S   D          K      
Sbjct  129  YECKTCNKCFPSFQALGGHRASHKKPKLAITAGEEKKASVEEDMLKISMNSFSKAMVSGG  188

Query  98   SNKTKIHECLICGSLFFSGQALGGHMRRHRPL  3
            S K ++HEC ICGS F SGQALGGHMRRHRP+
Sbjct  189  STKPRVHECSICGSEFNSGQALGGHMRRHRPV  220



>gb|AAS79571.1| putative zinc finger protein [Ipomoea trifida]
 dbj|BAF36285.1| hypothetical protein [Ipomoea trifida]
Length=237

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 61/98 (62%), Gaps = 14/98 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKS----  96
            YECKTCNR F SFQALGGHRASH KPKL+  DH +    DH+H+  + Q     ++    
Sbjct  63   YECKTCNRSFPSFQALGGHRASHKKPKLM--DHHEQHHYDHYHYELKKQSPPPPQAPLSA  120

Query  95   --------NKTKIHECLICGSLFFSGQALGGHMRRHRP  6
                       KIHEC IC + F SGQALGGHMRRHRP
Sbjct  121  AQSSGGSSKLAKIHECSICRAEFSSGQALGGHMRRHRP  158



>ref|XP_008787454.1| PREDICTED: zinc finger protein ZAT5 [Phoenix dactylifera]
Length=292

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 65/106 (61%), Gaps = 21/106 (20%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKL-IP----EDHKKSTPLDHHHHHQEIQDKTHEK  99
            YECKTC++ F SFQALGGHRASH KPKL IP    ED K +  +D      +I   +  K
Sbjct  127  YECKTCSKCFPSFQALGGHRASHKKPKLAIPTTGTEDKKAAAVIDGDS--LQISMNSFSK  184

Query  98   S--------------NKTKIHECLICGSLFFSGQALGGHMRRHRPL  3
            S              +K K+HEC ICGS F SGQALGGHMRRHRPL
Sbjct  185  SIMAATNANSNSTSNSKPKVHECSICGSEFSSGQALGGHMRRHRPL  230



>ref|XP_011024338.1| PREDICTED: zinc finger protein ZAT5 [Populus euphratica]
Length=300

 Score = 95.1 bits (235),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 61/101 (60%), Gaps = 16/101 (16%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKK------STPLDHHHHHQ-----EIQ  117
            YECKTCNR F SFQALGGHRASH KPK    D +K      S   D H+ +      ++ 
Sbjct  121  YECKTCNRTFPSFQALGGHRASHKKPKATHNDERKKNLSPSSDEEDGHYKNVSSLCLQLS  180

Query  116  DKTHEKS-----NKTKIHECLICGSLFFSGQALGGHMRRHR  9
            D    +      NK KIHEC +CG+ F SGQALGGHMRRHR
Sbjct  181  DNNANRGTFSNHNKGKIHECSVCGAEFTSGQALGGHMRRHR  221



>emb|CDP07026.1| unnamed protein product [Coffea canephora]
Length=335

 Score = 95.1 bits (235),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 65/122 (53%), Gaps = 37/122 (30%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKS--TPLDHHHHHQ------------  126
            Y+CKTCNR F SFQALGGHRASH KPK+  ED+K +  TP + HHHHQ            
Sbjct  141  YQCKTCNRTFPSFQALGGHRASHKKPKINIEDNKATIVTPSNDHHHHQEEEEEEEEEKES  200

Query  125  ------------------EIQD-----KTHEKSNKTKIHECLICGSLFFSGQALGGHMRR  15
                               IQ       T   +  +K HEC ICG+ F SGQALGGHMRR
Sbjct  201  AGEEQAAGQLIGRQSPPLSIQSTNKPCSTAASNKASKSHECSICGAEFASGQALGGHMRR  260

Query  14   HR  9
            HR
Sbjct  261  HR  262



>ref|XP_008801217.1| PREDICTED: zinc finger protein ZAT5-like [Phoenix dactylifera]
Length=272

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 57/92 (62%), Gaps = 5/92 (5%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLI---PEDHKKSTPLDHHHHHQEIQD--KTHEK  99
            YECKTCN+ F SFQALGGHR SH KPK+    P   +K   +D       +    K    
Sbjct  119  YECKTCNKCFPSFQALGGHRTSHKKPKMAVVAPAAEEKKAMVDEDMLQISMNSFSKAIAS  178

Query  98   SNKTKIHECLICGSLFFSGQALGGHMRRHRPL  3
            S K ++H C ICGS F SGQALGGHMRRHRPL
Sbjct  179  SIKPRVHGCSICGSEFNSGQALGGHMRRHRPL  210



>ref|XP_002267645.1| PREDICTED: zinc finger protein ZAT5 [Vitis vinifera]
 emb|CAN64839.1| hypothetical protein VITISV_030377 [Vitis vinifera]
Length=276

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 63/94 (67%), Gaps = 9/94 (10%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPL----DHHHHHQ-----EIQDK  111
            Y+CKTC R F SFQALGGHRASH +PK + E+ +    +    D  +H+      +I ++
Sbjct  116  YQCKTCYRCFPSFQALGGHRASHKRPKAVTEEKRTWALMEDEYDQFNHNSTALSLQIPNR  175

Query  110  THEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
                +NK+K+HEC ICG+ F SGQALGGHMRRHR
Sbjct  176  GLYSNNKSKVHECSICGAEFSSGQALGGHMRRHR  209



>ref|XP_009386213.1| PREDICTED: zinc finger protein ZAT5-like [Musa acuminata subsp. 
malaccensis]
Length=286

 Score = 94.7 bits (234),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 62/98 (63%), Gaps = 15/98 (15%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLI----PED-------HKKSTPLDHHHHHQEIQ  117
            YECKTC + F SFQALGGHRASH KP+++     ED       +  S PL   +    I 
Sbjct  130  YECKTCYKCFPSFQALGGHRASHKKPRMMVPAAAEDDGLQISVNSFSKPLVAPNDGNSIS  189

Query  116  DKTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHRPL  3
                  SNK+++HEC ICGS F SGQALGGHMRRHRPL
Sbjct  190  GG----SNKSRVHECSICGSEFSSGQALGGHMRRHRPL  223



>ref|XP_010243202.1| PREDICTED: zinc finger protein ZAT5 [Nelumbo nucifera]
Length=299

 Score = 94.7 bits (234),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 58/103 (56%), Gaps = 18/103 (17%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQE-------------  123
            YECKTCNR F SFQALGGHRASH KPK + ED K    L       +             
Sbjct  132  YECKTCNRCFPSFQALGGHRASHKKPKAMAEDKKSLMALSPEEDEPQFTHNSIPSSLLPL  191

Query  122  -----IQDKTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
                 +   +   + K+++HEC ICGS F SGQALGGHMRRHR
Sbjct  192  QIGNRVVYNSTTTTTKSRVHECSICGSEFSSGQALGGHMRRHR  234



>emb|CBI30164.3| unnamed protein product [Vitis vinifera]
Length=232

 Score = 93.6 bits (231),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 63/94 (67%), Gaps = 9/94 (10%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPL----DHHHHHQ-----EIQDK  111
            Y+CKTC R F SFQALGGHRASH +PK + E+ +    +    D  +H+      +I ++
Sbjct  93   YQCKTCYRCFPSFQALGGHRASHKRPKAVTEEKRTWALMEDEYDQFNHNSTALSLQIPNR  152

Query  110  THEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
                +NK+K+HEC ICG+ F SGQALGGHMRRHR
Sbjct  153  GLYSNNKSKVHECSICGAEFSSGQALGGHMRRHR  186



>ref|XP_006381377.1| hypothetical protein POPTR_0006s12340g [Populus trichocarpa]
 gb|ERP59174.1| hypothetical protein POPTR_0006s12340g [Populus trichocarpa]
Length=292

 Score = 94.0 bits (232),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 60/86 (70%), Gaps = 3/86 (3%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDH-HHHHQEIQDKTHEKSNKT  87
            Y+CKTC+R+F SFQALGGHRASH KPK    DH+    L      H+E+    + KSN  
Sbjct  121  YQCKTCDRRFPSFQALGGHRASHKKPKPGSLDHEDKKVLTTVRMAHEEVLCSPNVKSN--  178

Query  86   KIHECLICGSLFFSGQALGGHMRRHR  9
            K+HEC ICG+ F SGQALGGHMRRH+
Sbjct  179  KVHECSICGAEFSSGQALGGHMRRHK  204



>ref|XP_002876215.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52474.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=175

 Score = 92.4 bits (228),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 56/85 (66%), Gaps = 17/85 (20%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNRKF SFQALGGHRASH KPKLI +                 Q++   ++N+  
Sbjct  49   FECKTCNRKFDSFQALGGHRASHKKPKLIVD-----------------QEQVKHRNNEND  91

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +H+C IC  +F +GQALGGHMR+HR
Sbjct  92   MHKCTICDQMFGTGQALGGHMRKHR  116



>ref|XP_010470129.1| PREDICTED: zinc finger protein ZAT5-like [Camelina sativa]
Length=287

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 62/101 (61%), Gaps = 17/101 (17%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDH--HHHHQEIQDKTHEKS--  96
            YECKTCNR F SFQALGGHRASH KP+ + E+  +S PL        +E Q+   + S  
Sbjct  115  YECKTCNRTFSSFQALGGHRASHKKPRTLTEEKARS-PLMQPKSSASEEGQNSPFKGSGS  173

Query  95   -----------NKT-KIHECLICGSLFFSGQALGGHMRRHR  9
                       NK  K+HEC ICGS F SGQALGGHMRRHR
Sbjct  174  ALASQASNIIINKANKVHECSICGSEFTSGQALGGHMRRHR  214



>emb|CDY00945.1| BnaC05g42550D [Brassica napus]
Length=338

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 55/85 (65%), Gaps = 8/85 (9%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            Y+CKTC+R F SFQALGGHRASH KPK     H      DH      +    + K+N  K
Sbjct  148  YQCKTCDRTFPSFQALGGHRASHKKPKAAAGLHS-----DHDLKKSLV---VYGKANNNK  199

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +HEC ICG+ F SGQALGGHMRRHR
Sbjct  200  VHECGICGAEFTSGQALGGHMRRHR  224



>ref|XP_010558885.1| PREDICTED: zinc finger protein ZAT5-like [Tarenaya hassleriana]
Length=344

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQD----------  114
            YECKTCNR F SFQALGGHRASH KP+   E  K   P       +++Q+          
Sbjct  177  YECKTCNRTFPSFQALGGHRASHKKPRTEVEKTKLPLPAPKTVAPEDVQNCRTKIPGLTL  236

Query  113  --KTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
                   +   K+HEC ICGS F SGQALGGHMRRHR
Sbjct  237  ASPASNNNKPNKVHECSICGSEFTSGQALGGHMRRHR  273



>ref|XP_007010041.1| C2H2-type zinc finger family protein, putative [Theobroma cacao]
 gb|EOY18851.1| C2H2-type zinc finger family protein, putative [Theobroma cacao]
Length=327

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 60/106 (57%), Gaps = 21/106 (20%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPK---LIPEDHKKSTPLDHHHHHQEIQDKT-----  108
            YECKTCNR F SFQALGGHRASH KPK   ++ E  ++ T        Q I+        
Sbjct  138  YECKTCNRTFPSFQALGGHRASHKKPKTAAMVDEKTRQFTAAASDEEGQFIRTNNLSSLS  197

Query  107  -------------HEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
                         +  +NK K+HEC ICG+ F SGQALGGHMRRHR
Sbjct  198  LQLTNNNNNNRGLYSNNNKAKVHECSICGAEFTSGQALGGHMRRHR  243



>gb|KDO44126.1| hypothetical protein CISIN_1g031966mg [Citrus sinensis]
Length=150

 Score = 91.3 bits (225),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 54/85 (64%), Gaps = 15/85 (18%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KP+LI               + E +  +   + K K
Sbjct  22   FECKTCNRQFPSFQALGGHRASHKKPRLI---------------NGETKTLSSTTATKPK  66

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +HEC ICG  F  GQALGGHMRRHR
Sbjct  67   LHECSICGQEFAMGQALGGHMRRHR  91



>ref|XP_010253292.1| PREDICTED: zinc finger protein ZAT12-like [Nelumbo nucifera]
Length=177

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 55/85 (65%), Gaps = 12/85 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNRKF SFQALGGHRASH KP+L+  D       D +H     Q + H    K K
Sbjct  43   FECKTCNRKFPSFQALGGHRASHKKPRLMGAD-------DPNH-----QAQLHNLQVKPK  90

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  91   THECSICGLEFAIGQALGGHMRRHR  115



>ref|XP_009420453.1| PREDICTED: zinc finger protein ZAT5-like [Musa acuminata subsp. 
malaccensis]
Length=262

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 57/91 (63%), Gaps = 5/91 (5%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTH----EKS  96
            Y+CKTCN+ F SFQALGGHR SH KPK   ED  + +              T+      S
Sbjct  111  YQCKTCNKCFPSFQALGGHRTSHKKPKAD-EDRVQISTSSSTSKPAPTPSATNTGAAAGS  169

Query  95   NKTKIHECLICGSLFFSGQALGGHMRRHRPL  3
            NK ++HEC ICGS F SGQALGGHMRRHRP+
Sbjct  170  NKPRVHECSICGSEFPSGQALGGHMRRHRPI  200



>ref|XP_009396915.1| PREDICTED: zinc finger protein ZAT5-like [Musa acuminata subsp. 
malaccensis]
Length=250

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 55/88 (63%), Gaps = 1/88 (1%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHE-KSNKT  87
            YEC+TC++ F SFQALGGHRASH KPKL       +           +Q   +   S K 
Sbjct  107  YECRTCSKSFPSFQALGGHRASHKKPKLAMATATMAENKKAMGDEDSLQISMNSFPSIKP  166

Query  86   KIHECLICGSLFFSGQALGGHMRRHRPL  3
            KIHEC ICG  F SGQALGGHMRRHRPL
Sbjct  167  KIHECSICGLEFNSGQALGGHMRRHRPL  194



>ref|XP_010542577.1| PREDICTED: zinc finger protein ZAT5-like [Tarenaya hassleriana]
Length=296

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 60/100 (60%), Gaps = 18/100 (18%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDH-----HHHHQEIQDKT---  108
            YECKTCNR F SFQALGGHRASH +P+    D K  +PL+          Q  Q K    
Sbjct  130  YECKTCNRTFPSFQALGGHRASHKRPRT---DEKTKSPLEKAKPRPSEEGQNCQTKIAGE  186

Query  107  ------HEKSNK-TKIHECLICGSLFFSGQALGGHMRRHR  9
                  +  SNK  K+HEC ICGS F SGQALGGHMRRHR
Sbjct  187  NSAPPENNNSNKPNKVHECSICGSEFTSGQALGGHMRRHR  226



>ref|XP_003538193.1| PREDICTED: zinc finger protein ZAT5-like [Glycine max]
 gb|KHN38702.1| Zinc finger protein ZAT5 [Glycine soja]
Length=308

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 64/109 (59%), Gaps = 24/109 (22%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTP---------------LDHHHHH  129
            YECKTCNR F SFQALGGHRASH KPKL  E+ K+  P               + ++   
Sbjct  129  YECKTCNRTFPSFQALGGHRASHKKPKLAAEEKKQPLPPPAQPSPPSQLQHMIVTNYDRF  188

Query  128  QEIQDKT---------HEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
            +E   K+         +  +NK KIHEC ICGS F SGQALGGHMRRHR
Sbjct  189  EEGNVKSGPPISLQLGNNGNNKGKIHECSICGSEFTSGQALGGHMRRHR  237



>ref|XP_006429010.1| hypothetical protein CICLE_v10013311mg [Citrus clementina]
 ref|XP_006480743.1| PREDICTED: zinc finger protein ZAT11-like [Citrus sinensis]
 gb|ESR42250.1| hypothetical protein CICLE_v10013311mg [Citrus clementina]
Length=172

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 54/85 (64%), Gaps = 15/85 (18%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KP+LI               + E +  +   + K K
Sbjct  44   FECKTCNRQFPSFQALGGHRASHKKPRLI---------------NGETKTLSSTTATKPK  88

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +HEC ICG  F  GQALGGHMRRHR
Sbjct  89   LHECSICGQEFAMGQALGGHMRRHR  113



>gb|KDO47574.1| hypothetical protein CISIN_1g045639mg [Citrus sinensis]
Length=348

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 58/96 (60%), Gaps = 11/96 (11%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPK-LIPEDHKKSTPLDHHHH----------HQEIQ  117
            YECKTCNR F SFQALGGHRASH KPK ++  D + S    H               E +
Sbjct  148  YECKTCNRTFPSFQALGGHRASHKKPKAMLMNDDRLSLKSQHQQQQQQQFLVSKSDDEEE  207

Query  116  DKTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
            D      N +K+HEC ICG+ F SGQALGGHMRRHR
Sbjct  208  DGNFRNGNSSKVHECSICGAEFTSGQALGGHMRRHR  243



>ref|XP_002313544.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE87499.1| zinc finger family protein [Populus trichocarpa]
Length=313

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 60/107 (56%), Gaps = 25/107 (23%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEK-----  99
            YECKTCNR F SFQALGGHRASH +PK    + KK   +      +++ D+   K     
Sbjct  130  YECKTCNRCFPSFQALGGHRASHKRPKATAPEEKKGLVV---ASMEDLDDRQLNKRSPYP  186

Query  98   -----------------SNKTKIHECLICGSLFFSGQALGGHMRRHR  9
                             +NK KIHEC ICGS F SGQALGGHMRRHR
Sbjct  187  CLSLQIPNNNNVNKGFQANKAKIHECSICGSEFMSGQALGGHMRRHR  233



>emb|CDY04544.1| BnaA07g13700D [Brassica napus]
Length=256

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 54/87 (62%), Gaps = 17/87 (20%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            YECKTCNR F SFQALGGHRASH KP+    D K   PL            T  KS    
Sbjct  117  YECKTCNRTFPSFQALGGHRASHKKPR-ASIDEKAKVPL------------TQLKS----  159

Query  83   IHECLICGSLFFSGQALGGHMRRHRPL  3
            IHEC ICGS F SGQALGGHMRRHR +
Sbjct  160  IHECSICGSEFTSGQALGGHMRRHRTV  186



>gb|KHN00957.1| Zinc finger protein ZAT5 [Glycine soja]
Length=329

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 62/106 (58%), Gaps = 26/106 (25%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHH------QEIQDKT--  108
            YECKTCNR + SFQALGGHRASH KPK +      +  L+    H      +E Q KT  
Sbjct  141  YECKTCNRTYPSFQALGGHRASHKKPKAL-----MAIGLEKKQQHLLSSDEEEFQLKTNK  195

Query  107  -------------HEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
                         +  +NK+K+HEC ICG+ F SGQALGGHMRRHR
Sbjct  196  SPFSLQLNTKGNLYSNNNKSKVHECSICGAEFTSGQALGGHMRRHR  241



>ref|XP_006606310.1| PREDICTED: zinc finger protein ZAT5-like [Glycine max]
Length=327

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 62/106 (58%), Gaps = 26/106 (25%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHH------QEIQDKT--  108
            YECKTCNR + SFQALGGHRASH KPK +      +  L+    H      +E Q KT  
Sbjct  141  YECKTCNRTYPSFQALGGHRASHKKPKAL-----MAIGLEKKQQHLLSTDEEEFQLKTNK  195

Query  107  -------------HEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
                         +  +NK+K+HEC ICG+ F SGQALGGHMRRHR
Sbjct  196  SPFSLQLNTKGNLYSNNNKSKVHECSICGAEFTSGQALGGHMRRHR  241



>ref|XP_002533000.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF29375.1| zinc finger protein, putative [Ricinus communis]
Length=192

 Score = 91.3 bits (225),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 54/87 (62%), Gaps = 9/87 (10%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLI--PEDHKKSTPLDHHHHHQEIQDKTHEKSNK  90
            +ECKTCN+KF SFQALGGHRASH +P+L   P    KS   D    H          + K
Sbjct  48   FECKTCNKKFSSFQALGGHRASHKRPRLFMGPAADSKSASSDDQAVHS-------SGTKK  100

Query  89   TKIHECLICGSLFFSGQALGGHMRRHR  9
             K+HEC ICG  F  GQALGGHMRRHR
Sbjct  101  PKMHECSICGVEFALGQALGGHMRRHR  127



>ref|XP_010414581.1| PREDICTED: zinc finger protein ZAT5-like [Camelina sativa]
Length=287

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 60/101 (59%), Gaps = 17/101 (17%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDH--HHHHQEIQDKTHEKS--  96
            YECKTCNR F SFQALGGHRASH KP+    D K  +PL        +E Q+   + S  
Sbjct  115  YECKTCNRTFSSFQALGGHRASHKKPR-TSTDEKARSPLMQPKSSASEEGQNSPFKVSGS  173

Query  95   -----------NKT-KIHECLICGSLFFSGQALGGHMRRHR  9
                       NK  K+HEC ICGS F SGQALGGHMRRHR
Sbjct  174  ALASQASNIIINKANKVHECSICGSEFTSGQALGGHMRRHR  214



>ref|XP_010510676.1| PREDICTED: zinc finger protein ZAT5 [Camelina sativa]
Length=287

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 60/101 (59%), Gaps = 17/101 (17%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDH--HHHHQEIQDKTHEKS--  96
            YECKTCNR F SFQALGGHRASH KP+    D K  +PL        +E Q+   + S  
Sbjct  115  YECKTCNRTFSSFQALGGHRASHKKPR-TSTDEKTRSPLMQPKSSASEEGQNSPFKVSGS  173

Query  95   -----------NKT-KIHECLICGSLFFSGQALGGHMRRHR  9
                       NK  K+HEC ICGS F SGQALGGHMRRHR
Sbjct  174  ALASQASNIIINKANKVHECSICGSEFTSGQALGGHMRRHR  214



>ref|XP_002265877.1| PREDICTED: zinc finger protein ZAT5 [Vitis vinifera]
 emb|CAN69085.1| hypothetical protein VITISV_028172 [Vitis vinifera]
Length=302

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 58/91 (64%), Gaps = 6/91 (7%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHH------QEIQDKTHE  102
            YECKTCNR F SFQALGGHRASH KPK   E+ K    L+           Q      + 
Sbjct  120  YECKTCNRTFPSFQALGGHRASHKKPKAFMEEKKIFGFLEEEESQLKPLTLQLSSRAFNS  179

Query  101  KSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
             S+K++IHEC ICG+ F SGQALGGHMRRHR
Sbjct  180  SSSKSRIHECSICGAEFTSGQALGGHMRRHR  210



>ref|XP_011028268.1| PREDICTED: zinc finger protein ZAT5 [Populus euphratica]
Length=311

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 58/107 (54%), Gaps = 24/107 (22%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHK----------------------KSTP  150
            YECKTCNR F SFQALGGHRASH KPK   E+ K                       S  
Sbjct  130  YECKTCNRSFPSFQALGGHRASHKKPKATAEEKKGPVVASMEDLGVCQLIKRSNLDPSLS  189

Query  149  LDHHHHHQEIQDKTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
            L   H++  +      + NK K HEC ICGS F SGQALGGHMRRHR
Sbjct  190  LQIGHNNNNVNKGF--QGNKAKTHECSICGSEFMSGQALGGHMRRHR  234



>ref|XP_006384965.1| hypothetical protein POPTR_0004s22650g [Populus trichocarpa]
 gb|ERP62762.1| hypothetical protein POPTR_0004s22650g [Populus trichocarpa]
Length=308

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 58/104 (56%), Gaps = 19/104 (18%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHK----------------KSTPLDHHHH  132
            YECKTCNR F SFQALGGHRASH +PK   E+ K                K + LD    
Sbjct  128  YECKTCNRSFPSFQALGGHRASHKRPKATAEEKKGLVVASMEDLGVCQLIKRSNLDPSLS  187

Query  131  HQEIQDKTHEK---SNKTKIHECLICGSLFFSGQALGGHMRRHR  9
             Q   +    K    NK K HEC ICGS F SGQALGGHMRRHR
Sbjct  188  LQIGHNNNVNKGFQGNKAKTHECSICGSEFMSGQALGGHMRRHR  231



>ref|XP_006384966.1| zinc finger family protein [Populus trichocarpa]
 gb|ERP62763.1| zinc finger family protein [Populus trichocarpa]
Length=283

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 58/104 (56%), Gaps = 19/104 (18%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHK----------------KSTPLDHHHH  132
            YECKTCNR F SFQALGGHRASH +PK   E+ K                K + LD    
Sbjct  103  YECKTCNRSFPSFQALGGHRASHKRPKATAEEKKGLVVASMEDLGVCQLIKRSNLDPSLS  162

Query  131  HQEIQDKTHEK---SNKTKIHECLICGSLFFSGQALGGHMRRHR  9
             Q   +    K    NK K HEC ICGS F SGQALGGHMRRHR
Sbjct  163  LQIGHNNNVNKGFQGNKAKTHECSICGSEFMSGQALGGHMRRHR  206



>gb|ADL36645.1| C2H2L domain class transcription factor [Malus domestica]
Length=322

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 62/111 (56%), Gaps = 26/111 (23%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPK-------LIPEDHKKSTPLDHHH----HHQEIQ  117
            YECKTCNR F SFQALGGHRASH KPK       +I +    + P  HH       +E +
Sbjct  124  YECKTCNRTFPSFQALGGHRASHKKPKSMSSTEEMIKKSPPAAAPPTHHFITATTFEEFE  183

Query  116  DKTH---------------EKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
            D++                +  NK KIHEC IC S F SGQALGGHMRRHR
Sbjct  184  DQSKQLIKYKSSPPPAIPIQVGNKPKIHECSICRSEFTSGQALGGHMRRHR  234



>gb|ABK95183.1| unknown [Populus trichocarpa]
Length=310

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 58/104 (56%), Gaps = 19/104 (18%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHK----------------KSTPLDHHHH  132
            YECKTCNR F SFQALGGHRASH +PK   E+ K                K + LD    
Sbjct  130  YECKTCNRSFPSFQALGGHRASHKRPKATAEEKKGLVVASMEDLGVCQLIKRSNLDPSLS  189

Query  131  HQEIQDKTHEK---SNKTKIHECLICGSLFFSGQALGGHMRRHR  9
             Q   +    K    NK K HEC ICGS F SGQALGGHMRRHR
Sbjct  190  LQIGHNNNVNKGFQGNKAKTHECSICGSEFMSGQALGGHMRRHR  233



>ref|XP_008377900.1| PREDICTED: zinc finger protein ZAT5-like [Malus domestica]
Length=322

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 62/111 (56%), Gaps = 26/111 (23%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPK-------LIPEDHKKSTPLDHHH----HHQEIQ  117
            YECKTCNR F SFQALGGHRASH KPK       +I +    + P  HH       +E +
Sbjct  124  YECKTCNRTFPSFQALGGHRASHKKPKSMSSTEEMIKKSPPAAAPPTHHFITATTFEEFE  183

Query  116  DKTH---------------EKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
            D++                +  NK KIHEC IC S F SGQALGGHMRRHR
Sbjct  184  DQSKQLIKYKSSPPPAIPIQVGNKPKIHECSICRSEFTSGQALGGHMRRHR  234



>gb|KDP35585.1| hypothetical protein JCGZ_09023 [Jatropha curcas]
Length=169

 Score = 90.5 bits (223),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 55/89 (62%), Gaps = 16/89 (18%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKL--IPEDHKKSTPLDHHHHHQEIQDKTHEKSNK  90
            +ECKTCNRKF SFQALGGHRASH KP+L  I ED                 +K   ++ K
Sbjct  40   FECKTCNRKFSSFQALGGHRASHKKPRLPIIAEDDN--------------SNKAGSETTK  85

Query  89   TKIHECLICGSLFFSGQALGGHMRRHRPL  3
             K+H C ICG  F  GQALGGHMRRHR +
Sbjct  86   RKMHACSICGVEFALGQALGGHMRRHRAV  114



>emb|CDX71375.1| BnaC04g16100D [Brassica napus]
Length=255

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 54/87 (62%), Gaps = 17/87 (20%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            YECKTCNR F SFQALGGHRASH KP+    D K   PL            T  KS    
Sbjct  116  YECKTCNRTFPSFQALGGHRASHKKPR-ASIDEKAKVPL------------TQLKS----  158

Query  83   IHECLICGSLFFSGQALGGHMRRHRPL  3
            IHEC ICGS F SGQALGGHMRRHR +
Sbjct  159  IHECSICGSEFTSGQALGGHMRRHRTV  185



>ref|XP_009103654.1| PREDICTED: zinc finger protein ZAT5 [Brassica rapa]
Length=288

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 57/103 (55%), Gaps = 17/103 (17%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDH-HHHHQEIQDKTHEK----  99
            YECKTCNR F SFQALGGHRASH KP+    D K   PL        E   K H K    
Sbjct  117  YECKTCNRTFPSFQALGGHRASHKKPR-ASIDEKAKVPLTQLKSSASEEGQKGHFKVSGP  175

Query  98   -----------SNKTKIHECLICGSLFFSGQALGGHMRRHRPL  3
                       S   K+HEC ICGS F SGQALGGHMRRHR +
Sbjct  176  ALASKASNIIISKANKVHECSICGSEFTSGQALGGHMRRHRTV  218



>ref|XP_009139386.1| PREDICTED: zinc finger protein ZAT11-like [Brassica rapa]
 emb|CDX76199.1| BnaA04g04630D [Brassica napus]
Length=174

 Score = 90.5 bits (223),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 56/86 (65%), Gaps = 16/86 (19%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNRKF SFQALGGHRASH KPKL+  +                Q++   ++N+  
Sbjct  45   FECKTCNRKFDSFQALGGHRASHKKPKLMSVE----------------QEQAKHRNNEND  88

Query  83   IHECLICGSLFFSGQALGGHMRRHRP  6
            +H+C IC  +F +GQALGGH+RRHR 
Sbjct  89   VHKCSICSQMFGTGQALGGHIRRHRA  114



>ref|XP_004495268.1| PREDICTED: zinc finger protein ZAT11-like [Cicer arietinum]
Length=168

 Score = 90.1 bits (222),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 53/85 (62%), Gaps = 13/85 (15%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +EC TCNRKF SFQALGGHRASH KPKL   + K             +Q +T    NK K
Sbjct  38   FECITCNRKFSSFQALGGHRASHKKPKLDTTELK-------------VQAQTLSLWNKPK  84

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +H C ICG  F  GQALGGHMRRHR
Sbjct  85   MHGCYICGKEFSVGQALGGHMRRHR  109



>ref|XP_006837964.1| hypothetical protein AMTR_s00102p00073930 [Amborella trichopoda]
 gb|ERN00533.1| hypothetical protein AMTR_s00102p00073930 [Amborella trichopoda]
Length=235

 Score = 91.3 bits (225),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 55/91 (60%), Gaps = 6/91 (7%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHK------KSTPLDHHHHHQEIQDKTHE  102
            YECKTCNR F SFQALGGHRASH KP+   E H          P        E     + 
Sbjct  87   YECKTCNRSFSSFQALGGHRASHKKPRATDEGHVSCYFDCAGAPSLSTSTKIEEGKGENN  146

Query  101  KSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
             ++K ++HEC +CGS F SGQALGGHMRRHR
Sbjct  147  GNSKGRVHECSVCGSEFASGQALGGHMRRHR  177



>ref|XP_004306266.1| PREDICTED: zinc finger protein ZAT5-like [Fragaria vesca subsp. 
vesca]
Length=264

 Score = 91.7 bits (226),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 58/107 (54%), Gaps = 22/107 (21%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPE----------------------DHKKSTP  150
            YECKTCNR F SFQALGGHRASH KPK+I                        D + +  
Sbjct  84   YECKTCNRCFSSFQALGGHRASHKKPKVISNVTNTTQAQPKKALSFMEDQDEYDRRFNNN  143

Query  149  LDHHHHHQEIQDKTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
                    ++ ++    S  TK+HEC +CG+ F SGQALGGHMRRHR
Sbjct  144  TTSTTLSLQVSNRVFGNSKGTKVHECSVCGAEFASGQALGGHMRRHR  190



>ref|XP_009601615.1| PREDICTED: zinc finger protein ZAT5-like [Nicotiana tomentosiformis]
Length=340

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 66/128 (52%), Gaps = 42/128 (33%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKK-----------------STPLDHHH  135
            YECKTCNR F SFQALGGHRASH +PK I E+ K                   +P+++H 
Sbjct  131  YECKTCNRTFSSFQALGGHRASHKRPKTIVEEKKSVIITATATAMATASVGADSPVENHD  190

Query  134  HHQEIQDK------------------------THEKSN-KTKIHECLICGSLFFSGQALG  30
             +    D+                        +H  SN K KIHEC ICGS F SGQALG
Sbjct  191  DYHTENDQEEGRFNKISVPLSIQIANNNKVINSHGNSNSKPKIHECSICGSEFSSGQALG  250

Query  29   GHMRRHRP  6
            GHMR+H+P
Sbjct  251  GHMRKHKP  258



>ref|XP_010468099.1| PREDICTED: zinc finger protein ZAT5-like, partial [Camelina sativa]
Length=222

 Score = 90.9 bits (224),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 62/106 (58%), Gaps = 24/106 (23%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPE-----DHKKS----------------TPL  147
            Y+CKTC+R F SFQALGGHRASH KPK         D KKS                TP 
Sbjct  6    YQCKTCDRTFPSFQALGGHRASHKKPKAATGLHSNHDLKKSIYDDPVSLHLNNVVTTTPN  65

Query  146  DHHHHHQEIQDKTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
            ++ +H   +    + K+N  K+HEC ICG+ F SGQALGGHMRRHR
Sbjct  66   NNSNHRSLV---VYGKANNNKVHECGICGAEFTSGQALGGHMRRHR  108



>ref|NP_180387.2| zinc finger protein ZAT5 [Arabidopsis thaliana]
 sp|Q681X4.1|ZAT5_ARATH RecName: Full=Zinc finger protein ZAT5 [Arabidopsis thaliana]
 dbj|BAD43256.1| putative zinc-finger protein [Arabidopsis thaliana]
 dbj|BAF01643.1| putative zinc-finger protein [Arabidopsis thaliana]
 gb|AEC08090.1| zinc finger protein ZAT5 [Arabidopsis thaliana]
Length=286

 Score = 91.7 bits (226),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 59/99 (60%), Gaps = 14/99 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDH--------KKSTPLDHHHHHQEIQDK-  111
            YECKTCNR F SFQALGGHRASH KP+   E+         K S   +  + H ++    
Sbjct  115  YECKTCNRTFSSFQALGGHRASHKKPRTSTEEKTRLPLTQPKSSASEEGQNSHFKVSGSA  174

Query  110  -THEKSN----KTKIHECLICGSLFFSGQALGGHMRRHR  9
               + SN      K+HEC ICGS F SGQALGGHMRRHR
Sbjct  175  LASQASNIINKANKVHECSICGSEFTSGQALGGHMRRHR  213



>ref|XP_009377110.1| PREDICTED: zinc finger protein ZAT11-like [Pyrus x bretschneideri]
Length=185

 Score = 90.1 bits (222),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 57/86 (66%), Gaps = 6/86 (7%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPK-LIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKT  87
            +ECKTCNRKF SFQALGGHRASH +P+ L+  D +     D     ++  +K+   + K 
Sbjct  42   FECKTCNRKFTSFQALGGHRASHKRPRTLMSRDDE-----DRKDEREKGNNKSMVMNKKA  96

Query  86   KIHECLICGSLFFSGQALGGHMRRHR  9
            K HEC ICG  F  GQALGGHMR+HR
Sbjct  97   KTHECSICGLEFGMGQALGGHMRKHR  122



>emb|CAA67233.1| zinc finger protein [Arabidopsis thaliana]
 emb|CAA67236.1| zinc finger protein [Arabidopsis thaliana]
Length=284

 Score = 91.7 bits (226),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 59/99 (60%), Gaps = 14/99 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDH--------KKSTPLDHHHHHQEIQDK-  111
            YECKTCNR F SFQALGGHRASH KP+   E+         K S   +  + H ++    
Sbjct  113  YECKTCNRTFSSFQALGGHRASHKKPRTSTEEKTRLPLTQPKSSASEEGQNSHFKVSGSA  172

Query  110  -THEKSN----KTKIHECLICGSLFFSGQALGGHMRRHR  9
               + SN      K+HEC ICGS F SGQALGGHMRRHR
Sbjct  173  LASQASNIINKANKVHECSICGSEFTSGQALGGHMRRHR  211



>gb|AFK34837.1| unknown [Lotus japonicus]
Length=186

 Score = 90.1 bits (222),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 53/85 (62%), Gaps = 15/85 (18%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNRKF SFQALGGHRASH KPKL  E+  K +                 K +K K
Sbjct  47   FECKTCNRKFSSFQALGGHRASHKKPKLTGEEELKFSA---------------AKPSKPK  91

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +H C ICG  F  GQALGGHMRRHR
Sbjct  92   MHACSICGQEFSLGQALGGHMRRHR  116



>gb|AAD29833.1| putative zinc-finger protein [Arabidopsis thaliana]
Length=284

 Score = 91.7 bits (226),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 59/99 (60%), Gaps = 14/99 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDH--------KKSTPLDHHHHHQEIQDK-  111
            YECKTCNR F SFQALGGHRASH KP+   E+         K S   +  + H ++    
Sbjct  113  YECKTCNRTFSSFQALGGHRASHKKPRTSTEEKTRLPLTQPKSSASEEGQNSHFKVSGSA  172

Query  110  -THEKSN----KTKIHECLICGSLFFSGQALGGHMRRHR  9
               + SN      K+HEC ICGS F SGQALGGHMRRHR
Sbjct  173  LASQASNIINKANKVHECSICGSEFTSGQALGGHMRRHR  211



>ref|XP_010937700.1| PREDICTED: zinc finger protein ZAT12-like [Elaeis guineensis]
Length=168

 Score = 89.7 bits (221),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 54/86 (63%), Gaps = 16/86 (19%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KP+L+ + H ++                     K K
Sbjct  41   FECKTCNRQFPSFQALGGHRASHKKPRLMGDGHGQA----------------QNALAKPK  84

Query  83   IHECLICGSLFFSGQALGGHMRRHRP  6
            +HEC ICG  F  GQALGGHMRRHRP
Sbjct  85   LHECSICGLEFAIGQALGGHMRRHRP  110



>ref|XP_010260064.1| PREDICTED: zinc finger protein ZAT12 [Nelumbo nucifera]
Length=170

 Score = 89.7 bits (221),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 54/85 (64%), Gaps = 10/85 (12%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KP+L+      +   DH    Q +Q        K K
Sbjct  39   FECKTCNRQFPSFQALGGHRASHKKPRLMMTGEDTA---DHQAQLQSLQ-------MKPK  88

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC +CG  F  GQALGGHMRRHR
Sbjct  89   THECSVCGLEFAIGQALGGHMRRHR  113



>ref|XP_002882674.1| hypothetical protein ARALYDRAFT_478379 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58933.1| hypothetical protein ARALYDRAFT_478379 [Arabidopsis lyrata subsp. 
lyrata]
Length=397

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 63/106 (59%), Gaps = 24/106 (23%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPE-----DHKKS----------------TPL  147
            Y+CKTC+R F SFQALGGHRASH KPK         DHKKS                TP 
Sbjct  181  YQCKTCDRTFPSFQALGGHRASHKKPKAATGLHSNHDHKKSIYDDAVSLHLNNVITTTPN  240

Query  146  DHHHHHQEIQDKTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
            ++ +H   +    + K++  K+HEC ICG+ F SGQALGGHMRRHR
Sbjct  241  NNSNHRSLV---AYGKASNNKVHECGICGAEFTSGQALGGHMRRHR  283



>ref|XP_008371383.1| PREDICTED: zinc finger protein ZAT12-like [Malus domestica]
Length=195

 Score = 90.1 bits (222),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 54/85 (64%), Gaps = 7/85 (8%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KP+L       + P    + +   Q  +     KTK
Sbjct  47   FECKTCNRQFPSFQALGGHRASHKKPRL-------TGPSGDGNSNSSDQSLSQGSPPKTK  99

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  100  THECNICGLEFAIGQALGGHMRRHR  124



>ref|XP_008385492.1| PREDICTED: zinc finger protein ZAT5-like [Malus domestica]
Length=326

 Score = 91.7 bits (226),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 57/112 (51%), Gaps = 27/112 (24%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDH----KKSTPLDHHHHHQEIQDKTHEK-  99
            YECKTCNR F SFQALGGHRASH KPK +        K   P      H  I   T EK 
Sbjct  124  YECKTCNRTFPSFQALGGHRASHKKPKSMSSTEEIIKKSPPPAAAPPTHHSITATTFEKF  183

Query  98   ----------------------SNKTKIHECLICGSLFFSGQALGGHMRRHR  9
                                   NK KIHEC ICGS F SGQALGGHMRRHR
Sbjct  184  EDQSKQFIKYKSSPSPAIPIQMGNKPKIHECSICGSEFTSGQALGGHMRRHR  235



>ref|XP_010486658.1| PREDICTED: zinc finger protein ZAT5 [Camelina sativa]
Length=391

 Score = 92.0 bits (227),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 63/106 (59%), Gaps = 24/106 (23%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPE-----DHKKS----------------TPL  147
            Y+CKTC+R F SFQALGGHRASH KPK         D KKS                TP 
Sbjct  175  YQCKTCDRTFPSFQALGGHRASHKKPKAATGLHSNHDLKKSIYDDPVSLHLNNVVTTTPN  234

Query  146  DHHHHHQEIQDKTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
            ++ +H   +    + K+N +K+HEC ICG+ F SGQALGGHMRRHR
Sbjct  235  NNSNHRSLV---VYGKANNSKVHECGICGAEFTSGQALGGHMRRHR  277



>ref|XP_002880944.1| hypothetical protein ARALYDRAFT_481690 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57203.1| hypothetical protein ARALYDRAFT_481690 [Arabidopsis lyrata subsp. 
lyrata]
Length=276

 Score = 91.3 bits (225),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 59/99 (60%), Gaps = 14/99 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDH--------KKSTPLDHHHHHQEIQDK-  111
            YECKTCNR F SFQALGGHRASH KP+   E+         K S   +  + H ++    
Sbjct  113  YECKTCNRTFSSFQALGGHRASHKKPRTSTEEKTRLPLMQPKSSLSEEGQNSHFKVSGSA  172

Query  110  -THEKSN----KTKIHECLICGSLFFSGQALGGHMRRHR  9
               + SN      K+HEC ICGS F SGQALGGHMRRHR
Sbjct  173  LASQASNIINKANKVHECSICGSEFTSGQALGGHMRRHR  211



>gb|KHN27209.1| Zinc finger protein ZAT11 [Glycine soja]
Length=169

 Score = 89.7 bits (221),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 54/85 (64%), Gaps = 13/85 (15%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KP+L+  D+ +   L             H+   K K
Sbjct  30   FECKTCNRQFPSFQALGGHRASHKKPRLMAGDNIEGQLL-------------HDSPPKPK  76

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  77   THECSICGLEFAIGQALGGHMRRHR  101



>ref|NP_001235351.1| uncharacterized protein LOC100526874 [Glycine max]
 gb|ACU15884.1| unknown [Glycine max]
Length=182

 Score = 89.7 bits (221),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 53/85 (62%), Gaps = 12/85 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNRKF SFQALGGHRASH KPK   E+ K            E   K     NK K
Sbjct  46   FECKTCNRKFPSFQALGGHRASHKKPKFEGEELK------------EEAKKGLSLGNKPK  93

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +HEC ICG  F  GQALGGHMR+HR
Sbjct  94   MHECSICGMEFSLGQALGGHMRKHR  118



>gb|KHN49000.1| Zinc finger protein ZAT11 [Glycine soja]
Length=182

 Score = 89.7 bits (221),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 53/85 (62%), Gaps = 12/85 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNRKF SFQALGGHRASH KPK   E+ K            E   K     NK K
Sbjct  46   FECKTCNRKFPSFQALGGHRASHKKPKFEGEELK------------EEAKKGLSLGNKPK  93

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +HEC ICG  F  GQALGGHMR+HR
Sbjct  94   MHECSICGMEFSLGQALGGHMRKHR  118



>ref|XP_003606327.1| ZPT2-11 [Medicago truncatula]
 gb|AES88524.1| C2H2-type zinc finger protein, putative [Medicago truncatula]
Length=293

 Score = 91.3 bits (225),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 63/119 (53%), Gaps = 34/119 (29%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTP-------------------LDH  141
            YECKTCNR F SFQALGGHRASH KPK++ E+ K  +P                   + +
Sbjct  113  YECKTCNRTFPSFQALGGHRASHKKPKIMAEEKKPPSPPSQQPRPQSSSHDSQSDNLVAN  172

Query  140  HHHHQEIQD---------------KTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
               ++E +                K     NK KIHEC ICGS F SGQALGGHMRRHR
Sbjct  173  SDEYEEAEKPRGPMVSFQMGNHGLKAAINGNKAKIHECSICGSEFTSGQALGGHMRRHR  231



>ref|XP_002879670.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55929.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=178

 Score = 89.7 bits (221),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 56/85 (66%), Gaps = 14/85 (16%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KPKL  E  K   PL +++           K N T 
Sbjct  47   FECKTCNRRFSSFQALGGHRASHKKPKLTLE-QKDVKPLSNNY-----------KGNHT-  93

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F +GQALGGHMRRHR
Sbjct  94   -HECSICGQSFGTGQALGGHMRRHR  117



>ref|XP_009782985.1| PREDICTED: zinc finger protein ZAT5-like [Nicotiana sylvestris]
Length=291

 Score = 91.3 bits (225),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 64/109 (59%), Gaps = 22/109 (20%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPK-LIPEDHKKSTPLDH----------HHHHQEIQ  117
            + CKTCNR F SFQALGGHRASH KPK    E+ K S P++           H     +Q
Sbjct  116  FPCKTCNRCFSSFQALGGHRASHKKPKSTTLEEIKNSKPIEQVATCLKLNEDHVTTLSLQ  175

Query  116  DKTHEKS-----------NKTKIHECLICGSLFFSGQALGGHMRRHRPL  3
              ++  +           NKT++HEC ICG+ F SGQALGGHMRRHRPL
Sbjct  176  IPSNNNNSNNNNNNSSGKNKTRVHECSICGAEFTSGQALGGHMRRHRPL  224



>ref|XP_004142506.1| PREDICTED: zinc finger protein ZAT5-like [Cucumis sativus]
Length=341

 Score = 91.7 bits (226),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 57/101 (56%), Gaps = 14/101 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHK--------------KSTPLDHHHHHQ  126
            YECKTC R F SFQALGGHRASH KPK +  + K               +    H    Q
Sbjct  164  YECKTCYRTFPSFQALGGHRASHKKPKAMEAEKKHILSSDDEEIQFKNNNITTTHSLSLQ  223

Query  125  EIQDKTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHRPL  3
              Q  +   S K K+HEC ICG+ F SGQALGGHMRRHR +
Sbjct  224  LNQRGSLNSSGKAKVHECAICGAEFTSGQALGGHMRRHRAM  264



>ref|XP_010484714.1| PREDICTED: zinc finger protein ZAT5-like [Camelina sativa]
Length=391

 Score = 92.0 bits (227),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 62/106 (58%), Gaps = 24/106 (23%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPE-----DHKKS----------------TPL  147
            Y+CKTC+R F SFQALGGHRASH KPK         D KKS                TP 
Sbjct  175  YQCKTCDRTFPSFQALGGHRASHKKPKAATGLHSNHDLKKSIYDDPVSLHLNNVVTTTPN  234

Query  146  DHHHHHQEIQDKTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
            ++ +H   +    + K+N  K+HEC ICG+ F SGQALGGHMRRHR
Sbjct  235  NNSNHRSLV---VYGKANNNKVHECGICGAEFTSGQALGGHMRRHR  277



>ref|XP_009140851.1| PREDICTED: zinc finger protein ZAT5-like [Brassica rapa]
Length=287

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 57/100 (57%), Gaps = 15/100 (15%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEK-----  99
            YECKTC+R F SFQALGGHRASH KP++  E   K   +       E   K++ K     
Sbjct  118  YECKTCSRTFSSFQALGGHRASHKKPRVSIEAKTKLPLMQAKSSGSEEGQKSNFKVFGSS  177

Query  98   ----------SNKTKIHECLICGSLFFSGQALGGHMRRHR  9
                      S   K+HEC ICGS F SGQALGGHMRRHR
Sbjct  178  LASLSSNIIISKANKVHECSICGSEFTSGQALGGHMRRHR  217



>ref|XP_010468098.1| PREDICTED: zinc finger protein ZAT5-like, partial [Camelina sativa]
Length=399

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 62/106 (58%), Gaps = 24/106 (23%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPE-----DHKKS----------------TPL  147
            Y+CKTC+R F SFQALGGHRASH KPK         D KKS                TP 
Sbjct  183  YQCKTCDRTFPSFQALGGHRASHKKPKAATGLHSNHDLKKSIYDDPVSLHLNNVVTTTPN  242

Query  146  DHHHHHQEIQDKTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
            ++ +H   +    + K+N  K+HEC ICG+ F SGQALGGHMRRHR
Sbjct  243  NNSNHRSLV---VYGKANNNKVHECGICGAEFTSGQALGGHMRRHR  285



>ref|XP_007206686.1| hypothetical protein PRUPE_ppa022066mg [Prunus persica]
 gb|EMJ07885.1| hypothetical protein PRUPE_ppa022066mg [Prunus persica]
Length=184

 Score = 89.7 bits (221),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 58/91 (64%), Gaps = 20/91 (22%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKS----  96
            +ECKTCNRKF SFQALGGHRASH++P+         T +DH       Q +T ++S    
Sbjct  43   FECKTCNRKFPSFQALGGHRASHNRPR---------TSMDHDQ-----QSETRKRSNLMA  88

Query  95   --NKTKIHECLICGSLFFSGQALGGHMRRHR  9
              NK K HEC ICG  F  GQALGGHMRRHR
Sbjct  89   TKNKPKAHECSICGLEFGMGQALGGHMRRHR  119



>gb|KGN52233.1| hypothetical protein Csa_5G622500 [Cucumis sativus]
Length=322

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 57/101 (56%), Gaps = 14/101 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHK--------------KSTPLDHHHHHQ  126
            YECKTC R F SFQALGGHRASH KPK +  + K               +    H    Q
Sbjct  164  YECKTCYRTFPSFQALGGHRASHKKPKAMEAEKKHILSSDDEEIQFKNNNITTTHSLSLQ  223

Query  125  EIQDKTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHRPL  3
              Q  +   S K K+HEC ICG+ F SGQALGGHMRRHR +
Sbjct  224  LNQRGSLNSSGKAKVHECAICGAEFTSGQALGGHMRRHRAM  264



>gb|KFK32333.1| hypothetical protein AALP_AA6G228200 [Arabis alpina]
Length=278

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 60/100 (60%), Gaps = 18/100 (18%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPL---------DHHHHHQEI---  120
            YECKTCNR F SFQALGGHRASH KP++     K  +PL         +  + H ++   
Sbjct  110  YECKTCNRTFPSFQALGGHRASHKKPRV---SEKTRSPLMQPKSSGSEEGQNSHFKVSGS  166

Query  119  ---QDKTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
                  ++  S   K+HEC ICGS F SGQALGGHMRRHR
Sbjct  167  ALASQASNMFSKANKVHECSICGSEFTSGQALGGHMRRHR  206



>ref|XP_007027469.1| Nucleic acid binding protein, putative [Theobroma cacao]
 gb|EOY07971.1| Nucleic acid binding protein, putative [Theobroma cacao]
Length=288

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 59/95 (62%), Gaps = 10/95 (11%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKL----------IPEDHKKSTPLDHHHHHQEIQD  114
            ++CKTCNR F SFQALGGHRASH KPK+          + ED  +   ++     Q    
Sbjct  121  HQCKTCNRCFSSFQALGGHRASHKKPKVNNEENKGLVFVREDDDQFNNMNTALSLQITNK  180

Query  113  KTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
                 S+K+K+HEC ICG+ F SGQALGGHMRRHR
Sbjct  181  AVLCNSSKSKVHECSICGAEFSSGQALGGHMRRHR  215



>gb|KEH42342.1| C2H2 type zinc finger transcription factor family protein [Medicago 
truncatula]
Length=170

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 54/85 (64%), Gaps = 15/85 (18%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNRKF SFQALGGHRASH K KL          LD    H     K +  +NK K
Sbjct  38   FECKTCNRKFSSFQALGGHRASHKKLKL----------LDSEEAH-----KVNIHNNKPK  82

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +H+C ICG  F  GQALGGHMRRHR
Sbjct  83   MHQCSICGQEFKLGQALGGHMRRHR  107



>ref|NP_190928.1| C2H2-type zinc finger protein [Arabidopsis thaliana]
 emb|CAB67667.1| zinc finger-like protein [Arabidopsis thaliana]
 gb|ABN04782.1| At3g53600 [Arabidopsis thaliana]
 dbj|BAH30486.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE79115.1| C2H2-type zinc finger protein [Arabidopsis thaliana]
Length=175

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 55/85 (65%), Gaps = 17/85 (20%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNRKF SFQALGGHRASH KPKLI +                 Q++   ++ +  
Sbjct  49   FECKTCNRKFDSFQALGGHRASHKKPKLIVD-----------------QEQVKHRNKEND  91

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +H+C IC  +F +GQALGGHMR+HR
Sbjct  92   MHKCTICDQMFGTGQALGGHMRKHR  116



>gb|AEY76110.1| Cys2/His2-type zinc finger protein [Chrysanthemum x morifolium]
Length=178

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 54/85 (64%), Gaps = 13/85 (15%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KP+L+  D      +  HHH   +         K K
Sbjct  47   FECKTCNRQFPSFQALGGHRASHKKPRLVDGD------MTSHHHDTALL-------IKPK  93

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             H+C ICG  F  GQALGGHMRRHR
Sbjct  94   THKCSICGVEFAIGQALGGHMRRHR  118



>ref|NP_187658.1| C2H2-type zinc finger protein [Arabidopsis thaliana]
 gb|AAG51397.1|AC011560_29 hypothetical protein; 86933-85737 [Arabidopsis thaliana]
 gb|AAF76348.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAH30446.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE74911.1| C2H2-type zinc finger protein [Arabidopsis thaliana]
Length=398

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 62/106 (58%), Gaps = 24/106 (23%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPE-----DHKKS----------------TPL  147
            Y+CKTC+R F SFQALGGHRASH KPK         DHKKS                TP 
Sbjct  182  YQCKTCDRTFPSFQALGGHRASHKKPKAAMGLHSNHDHKKSNYDDAVSLHLNNVLTTTPN  241

Query  146  DHHHHHQEIQDKTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
            ++ +H   +    + K +  K+HEC ICG+ F SGQALGGHMRRHR
Sbjct  242  NNSNHRSLV---VYGKGSNNKVHECGICGAEFTSGQALGGHMRRHR  284



>emb|CDY08602.1| BnaA05g28380D [Brassica napus]
Length=338

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 54/85 (64%), Gaps = 8/85 (9%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            Y+CKTC+R F SFQALGGHRASH KPK     H      DH      +    + K+   K
Sbjct  150  YQCKTCDRTFPSFQALGGHRASHKKPKAAAGLHS-----DHDLKKSLV---VYGKAGNNK  201

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +HEC ICG+ F SGQALGGHMRRHR
Sbjct  202  VHECGICGAEFTSGQALGGHMRRHR  226



>gb|KEH42343.1| C2H2 type zinc finger transcription factor family protein [Medicago 
truncatula]
Length=171

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 54/85 (64%), Gaps = 15/85 (18%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNRKF SFQALGGHRASH K KL          LD    H     K +  +NK K
Sbjct  39   FECKTCNRKFSSFQALGGHRASHKKLKL----------LDSEEAH-----KVNIHNNKPK  83

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +H+C ICG  F  GQALGGHMRRHR
Sbjct  84   MHQCSICGQEFKLGQALGGHMRRHR  108



>ref|XP_006294403.1| hypothetical protein CARUB_v10023420mg [Capsella rubella]
 gb|EOA27301.1| hypothetical protein CARUB_v10023420mg [Capsella rubella]
Length=382

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 60/102 (59%), Gaps = 17/102 (17%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKL-IPEDHKKSTPLDH--HHHHQEIQDKTHEKS-  96
            YECKTCNR F SFQALGGHRASH KP+     D K  +PL        +E Q+   + S 
Sbjct  202  YECKTCNRTFSSFQALGGHRASHKKPRTSTSTDEKTRSPLMQPKSSLSEEGQNSLFKVSG  261

Query  95   ------------NKT-KIHECLICGSLFFSGQALGGHMRRHR  9
                        NK  K+HEC ICGS F SGQALGGHMRRHR
Sbjct  262  SALPSQASNIIINKANKVHECSICGSEFTSGQALGGHMRRHR  303



>gb|KDO43945.1| hypothetical protein CISIN_1g036604mg [Citrus sinensis]
Length=257

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 64/109 (59%), Gaps = 24/109 (22%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLI---------------PEDHK---KSTPLD--  144
            Y+CKTCNR F SFQALGGHRASH KPK+I                ED +    ST L   
Sbjct  83   YQCKTCNRCFPSFQALGGHRASHKKPKVINNNIEASKKAFVLMDEEDDRFSNMSTTLSLQ  142

Query  143  --HHHHHQEIQDKTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHRPL  3
              ++     +  +T+ K+N  K+HEC ICG+ F SGQALGGHMRRHR  
Sbjct  143  MANNRDAANLCARTNNKAN--KVHECSICGAEFSSGQALGGHMRRHRAF  189



>ref|XP_009103876.1| PREDICTED: zinc finger protein ZAT11-like [Brassica rapa]
 emb|CDY52747.1| BnaA07g37620D [Brassica napus]
Length=168

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 54/85 (64%), Gaps = 17/85 (20%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNRKF SFQALGGHRASH KPKL  +                 Q++   + N+  
Sbjct  48   FECKTCNRKFDSFQALGGHRASHKKPKLSID-----------------QEQVKHRYNENA  90

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             H+C ICG +F +GQALGGHMR+HR
Sbjct  91   AHKCSICGQMFGTGQALGGHMRKHR  115



>gb|EPS68966.1| hypothetical protein M569_05802, partial [Genlisea aurea]
Length=160

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 54/89 (61%), Gaps = 4/89 (4%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDK---THEKSN  93
            + CKTC++ F SFQALGGHRASH KP    +    S P D        Q     T +  N
Sbjct  62   FACKTCSKSFPSFQALGGHRASHKKPAKAAQ-RVDSPPADESPISSSAQISGGLTSDSQN  120

Query  92   KTKIHECLICGSLFFSGQALGGHMRRHRP  6
            + ++H C ICG+ F SGQALGGHMRRHRP
Sbjct  121  RARVHVCSICGAGFGSGQALGGHMRRHRP  149



>gb|KHN23143.1| Zinc finger protein ZAT11 [Glycine soja]
Length=157

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 52/85 (61%), Gaps = 14/85 (16%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KP+L+ E               + Q   H    K K
Sbjct  18   FECKTCNRRFASFQALGGHRASHKKPRLMGE--------------SDSQVLIHGSPPKPK  63

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  64   THECSICGLEFAIGQALGGHMRRHR  88



>gb|KHN09437.1| Zinc finger protein ZAT11 [Glycine soja]
Length=133

 Score = 87.8 bits (216),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 55/85 (65%), Gaps = 13/85 (15%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNRKF SFQALGGHRASH + KL  E+ K+             Q K+    NK K
Sbjct  22   FECKTCNRKFSSFQALGGHRASHKRQKLEGEELKE-------------QAKSLSLWNKPK  68

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +HEC ICG  F  GQALGGHMR+HR
Sbjct  69   MHECSICGLEFSLGQALGGHMRKHR  93



>ref|XP_010505329.1| PREDICTED: zinc finger protein ZAT11-like [Camelina sativa]
Length=182

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 54/85 (64%), Gaps = 12/85 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KPKL   + K            E++  ++       
Sbjct  49   FECKTCNRRFSSFQALGGHRASHKKPKLTTVEQK------------EVKHLSNNYKGNNH  96

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +HEC ICG  F +GQALGGHMRRHR
Sbjct  97   LHECSICGQSFGTGQALGGHMRRHR  121



>gb|KDP43958.1| hypothetical protein JCGZ_05425 [Jatropha curcas]
Length=300

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 63/115 (55%), Gaps = 30/115 (26%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKK-----STPL--DHHHHHQEIQDKTH  105
            YECKTCNR F SFQALGGHRASH KPK    D KK     + P+  D+   H ++   + 
Sbjct  111  YECKTCNRSFPSFQALGGHRASHKKPKPTVGDEKKPPLPVAPPVIDDNFDDHCQLNKTST  170

Query  104  EKSN-----------------------KTKIHECLICGSLFFSGQALGGHMRRHR  9
              +N                       K+KIHEC ICGS F SGQALGGHMRRHR
Sbjct  171  CSTNLDHHHHHHHLISLQKGILGNNNSKSKIHECSICGSEFSSGQALGGHMRRHR  225



>ref|XP_010509338.1| PREDICTED: zinc finger protein ZAT11 [Camelina sativa]
Length=182

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 53/85 (62%), Gaps = 12/85 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KPKL   + K     D  H     +   H       
Sbjct  49   FECKTCNRRFSSFQALGGHRASHKKPKLTTVEQK-----DVKHLSNNYRGNNH-------  96

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +HEC ICG  F +GQALGGHMRRHR
Sbjct  97   LHECSICGQSFGTGQALGGHMRRHR  121



>ref|XP_004492093.1| PREDICTED: zinc finger protein ZAT11-like [Cicer arietinum]
Length=177

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 53/85 (62%), Gaps = 12/85 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KP+L+ E+             + I  +      K K
Sbjct  38   FECKTCNRQFSSFQALGGHRASHKKPRLMQEN------------GENIDGQLLNTPPKPK  85

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  86   THECSICGLEFAIGQALGGHMRRHR  110



>ref|NP_001236265.1| uncharacterized protein LOC100500316 [Glycine max]
 gb|ACU15355.1| unknown [Glycine max]
Length=173

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 52/85 (61%), Gaps = 14/85 (16%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KP+L+ E               + Q   H    K K
Sbjct  34   FECKTCNRRFASFQALGGHRASHKKPRLMGE--------------SDSQVLIHGSPPKPK  79

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  80   THECSICGLEFAIGQALGGHMRRHR  104



>ref|XP_010097386.1| Zinc finger protein ZAT11 [Morus notabilis]
 gb|EXB67892.1| Zinc finger protein ZAT11 [Morus notabilis]
Length=183

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 57/87 (66%), Gaps = 12/87 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH+K ++  +DH +S               +  KS+  K
Sbjct  43   FECKTCNRRFSSFQALGGHRASHNKRRMTVDDHHESA------------KTSPAKSSLPK  90

Query  83   IHECLICGSLFFSGQALGGHMRRHRPL  3
             HEC ICG +F  GQALGGHMRRH+ +
Sbjct  91   KHECSICGVVFSMGQALGGHMRRHKAI  117



>ref|XP_010098815.1| Zinc finger protein ZAT5 [Morus notabilis]
 gb|EXB75903.1| Zinc finger protein ZAT5 [Morus notabilis]
Length=303

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 62/112 (55%), Gaps = 27/112 (24%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPK-------------LIPEDHKK------STPLDH  141
            Y+CKTC+R F SFQALGGHRASH KPK              + EDH++      ST L  
Sbjct  120  YQCKTCDRCFPSFQALGGHRASHKKPKGNNSAAEEKKTSFFLVEDHEQFVSSATSTTLSL  179

Query  140  H--------HHHQEIQDKTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
                     + +  I       SNK K+HEC ICG+ F SGQALGGHMRRHR
Sbjct  180  QMSSRGILRNGNNRISVSNTNNSNKAKVHECSICGAEFTSGQALGGHMRRHR  231



>ref|XP_009411362.1| PREDICTED: zinc finger protein ZAT5-like [Musa acuminata subsp. 
malaccensis]
Length=284

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 56/95 (59%), Gaps = 8/95 (8%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEK-----  99
            YECKTCN+ F SFQALGGHR SH K KL      +   L       +I   +  K     
Sbjct  130  YECKTCNKCFPSFQALGGHRTSHRKTKLAAGTTAEEKKLAAGDDILQISMNSFSKPIAGS  189

Query  98   ---SNKTKIHECLICGSLFFSGQALGGHMRRHRPL  3
               + K K+HEC ICGS F SGQALGGHMRRH+PL
Sbjct  190  GQTNTKPKVHECSICGSEFSSGQALGGHMRRHKPL  224



>ref|XP_006428462.1| hypothetical protein CICLE_v10012395mg [Citrus clementina]
 gb|ESR41702.1| hypothetical protein CICLE_v10012395mg [Citrus clementina]
Length=285

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 63/109 (58%), Gaps = 24/109 (22%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIP---EDHKK-------------------STP  150
            Y+CKTCNR F SFQALGGHRASH KPK+I    E  KK                   S  
Sbjct  111  YQCKTCNRCFPSFQALGGHRASHKKPKVINNNIEASKKAFVLMDEEDDRFSNMSTTLSLQ  170

Query  149  LDHHHHHQEIQDKTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHRPL  3
            + ++     +  +T+ K+N  K+HEC ICG+ F SGQALGGHMRRHR  
Sbjct  171  MANNRDAANLCARTNNKAN--KVHECSICGAEFSSGQALGGHMRRHRAF  217



>ref|XP_008233585.1| PREDICTED: zinc finger protein ZAT12-like [Prunus mume]
Length=196

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 54/85 (64%), Gaps = 7/85 (8%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KP+L+          D +  +   Q ++     K K
Sbjct  47   FECKTCNRQFPSFQALGGHRASHKKPRLMGSG-------DGNSSNGSDQSQSQGSPPKPK  99

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  100  THECNICGLEFAIGQALGGHMRRHR  124



>ref|XP_010043586.1| PREDICTED: zinc finger protein ZAT12-like [Eucalyptus grandis]
 gb|KCW85607.1| hypothetical protein EUGRSUZ_B02394 [Eucalyptus grandis]
Length=172

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 52/85 (61%), Gaps = 12/85 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            + CKTCNR+F SFQALGGHRASH KPKLI  D  +            +         K K
Sbjct  43   FTCKTCNREFPSFQALGGHRASHKKPKLISGDLLR------------LGRTADSSPAKLK  90

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +HEC ICG  F +GQALGGHMRRHR
Sbjct  91   MHECSICGLDFPTGQALGGHMRRHR  115



>ref|NP_001235663.1| uncharacterized protein LOC100526897 [Glycine max]
 gb|ACU15918.1| unknown [Glycine max]
Length=158

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 55/85 (65%), Gaps = 13/85 (15%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNRKF SFQALGGHRASH + KL  E+ K+             Q K+    NK K
Sbjct  47   FECKTCNRKFSSFQALGGHRASHKRQKLEGEELKE-------------QAKSLSLWNKPK  93

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +HEC ICG  F  GQALGGHMR+HR
Sbjct  94   MHECSICGLEFSLGQALGGHMRKHR  118



>ref|XP_009416690.1| PREDICTED: zinc finger protein ZAT11-like [Musa acuminata subsp. 
malaccensis]
Length=163

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 54/85 (64%), Gaps = 16/85 (19%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH K +L   DH ++  +                ++K K
Sbjct  54   FECKTCNRQFSSFQALGGHRASHKKSRLAAGDHGRAEAV----------------ADKPK  97

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +H+C ICG  F  GQALGGHMRRHR
Sbjct  98   VHQCSICGQEFALGQALGGHMRRHR  122



>emb|CDY44852.1| BnaC09g50520D [Brassica napus]
Length=325

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 57/85 (67%), Gaps = 6/85 (7%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            Y+CKTC+R F SFQALGGHRASH KPK     +     +D++++        + K+   K
Sbjct  137  YQCKTCDRTFPSFQALGGHRASHKKPKATLSSYSN---IDNNNNRSL---AVYGKAGSNK  190

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +HEC +CG+ F SGQALGGHMRRHR
Sbjct  191  VHECGVCGAEFTSGQALGGHMRRHR  215



>ref|XP_008241560.1| PREDICTED: zinc finger protein ZAT11 [Prunus mume]
Length=184

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 53/86 (62%), Gaps = 10/86 (12%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQ-DKTHEKSNKT  87
            +ECKTCNRKF SFQALGGHRASH +P+         T +DH    +  +        NK 
Sbjct  43   FECKTCNRKFPSFQALGGHRASHKRPR---------TSMDHDQQSETRKGSNLMATKNKP  93

Query  86   KIHECLICGSLFFSGQALGGHMRRHR  9
            K HEC ICG  F  GQALGGHMRRHR
Sbjct  94   KAHECSICGLEFGMGQALGGHMRRHR  119



>ref|XP_009347446.1| PREDICTED: zinc finger protein ZAT12-like [Pyrus x bretschneideri]
Length=196

 Score = 88.6 bits (218),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 54/85 (64%), Gaps = 7/85 (8%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KP+L       + P    + +   Q  +   S K +
Sbjct  48   FECKTCNRQFPSFQALGGHRASHKKPRL-------TGPSGDGNSNSSDQSLSQGSSPKPR  100

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  101  THECNICGLEFAIGQALGGHMRRHR  125



>ref|XP_009357691.1| PREDICTED: zinc finger protein ZAT12-like [Pyrus x bretschneideri]
Length=196

 Score = 88.6 bits (218),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 54/85 (64%), Gaps = 7/85 (8%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KP+L       + P    + +   Q  +   S K +
Sbjct  48   FECKTCNRQFPSFQALGGHRASHKKPRL-------TGPSGDGNSNSSDQSLSQGSSPKPR  100

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  101  THECNICGLEFAIGQALGGHMRRHR  125



>ref|XP_007218449.1| hypothetical protein PRUPE_ppa011762mg [Prunus persica]
 gb|EMJ19648.1| hypothetical protein PRUPE_ppa011762mg [Prunus persica]
Length=197

 Score = 88.6 bits (218),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 54/85 (64%), Gaps = 7/85 (8%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KP+L+          D +  +   Q ++     K K
Sbjct  47   FECKTCNRQFPSFQALGGHRASHKKPRLMGSG-------DGNSSNGSDQSQSQGSPPKPK  99

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  100  THECNICGLEFAIGQALGGHMRRHR  124



>ref|XP_006493540.1| PREDICTED: zinc finger protein ZAT5-like [Citrus sinensis]
Length=300

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 64/109 (59%), Gaps = 24/109 (22%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLI---------------PEDHK---KSTPLD--  144
            Y+CKTCNR F SFQALGGHRASH KPK+I                ED +    ST L   
Sbjct  126  YQCKTCNRCFPSFQALGGHRASHKKPKVINNNIEASKKAFVLMDEEDDRFSNMSTTLSLQ  185

Query  143  --HHHHHQEIQDKTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHRPL  3
              ++     +  +T+ K+N  K+HEC ICG+ F SGQALGGHMRRHR  
Sbjct  186  MANNRDAANLCARTNNKAN--KVHECSICGAEFSSGQALGGHMRRHRAF  232



>ref|XP_009613142.1| PREDICTED: zinc finger protein ZAT5-like [Nicotiana tomentosiformis]
Length=289

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 63/108 (58%), Gaps = 21/108 (19%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPK-LIPEDHKKSTPLDH----------HHHHQEIQ  117
            ++CKTCNR F SFQALGGHRASH KPK    E+ K S P++           H     +Q
Sbjct  115  FQCKTCNRCFSSFQALGGHRASHKKPKSTTQEEIKNSKPIEQVATCLKLNEDHVTTLSLQ  174

Query  116  ----------DKTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHRPL  3
                      +      NKT++HEC ICG+ F SGQALGGHMRRHRPL
Sbjct  175  IPSNNNNNNNNNNSNNKNKTRVHECSICGAEFTSGQALGGHMRRHRPL  222



>ref|XP_008446814.1| PREDICTED: zinc finger protein ZAT5-like [Cucumis melo]
 ref|XP_008446815.1| PREDICTED: zinc finger protein ZAT5-like [Cucumis melo]
Length=361

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 59/106 (56%), Gaps = 23/106 (22%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHE------  102
            YECKTC R F SFQALGGHRASH KPK +  + K     D     +EIQ K +       
Sbjct  161  YECKTCYRTFPSFQALGGHRASHKKPKAMEAEKKHILSSDD----EEIQFKNNNITTTNS  216

Query  101  -------------KSNKTKIHECLICGSLFFSGQALGGHMRRHRPL  3
                          S K K+HEC ICG+ F SGQALGGHMRRHR +
Sbjct  217  LSLQLNQRGSLNNSSGKAKVHECAICGAEFTSGQALGGHMRRHRAM  262



>emb|CBI31394.3| unnamed protein product [Vitis vinifera]
Length=353

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 52/85 (61%), Gaps = 21/85 (25%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            YECKTCNR F SFQALGGHRASH KPK                         +  S+K++
Sbjct  175  YECKTCNRTFPSFQALGGHRASHKKPK---------------------ARAFNSSSSKSR  213

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            IHEC ICG+ F SGQALGGHMRRHR
Sbjct  214  IHECSICGAEFTSGQALGGHMRRHR  238



>gb|KCW88902.1| hypothetical protein EUGRSUZ_A01230 [Eucalyptus grandis]
Length=177

 Score = 88.2 bits (217),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 53/85 (62%), Gaps = 12/85 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            YECKTCNR+F SFQALGGHRASH KPKL+       T L                + +TK
Sbjct  42   YECKTCNRQFSSFQALGGHRASHKKPKLLQNKPGDCTKL------------ALGGTAETK  89

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +HEC +CG  F  GQALGGHMR+HR
Sbjct  90   MHECSVCGLKFALGQALGGHMRKHR  114



>ref|XP_011094585.1| PREDICTED: zinc finger protein ZAT5-like [Sesamum indicum]
Length=268

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 58/103 (56%), Gaps = 16/103 (16%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPL-----DHHHHHQEIQDKT---  108
            Y+CKTCN+ F SFQALGGHRASH KP       ++  PL     D         D T   
Sbjct  103  YQCKTCNKSFPSFQALGGHRASHKKPNKPAVTLEEKKPLRENQEDLQPDGPRPDDGTLVS  162

Query  107  --------HEKSNKTKIHECLICGSLFFSGQALGGHMRRHRPL  3
                        NK+++HEC ICG+ F SGQALGGHMRRHRP+
Sbjct  163  LQISKRVLGSPPNKSRVHECSICGAEFGSGQALGGHMRRHRPI  205



>ref|XP_003541431.1| PREDICTED: zinc finger protein ZAT5-like [Glycine max]
Length=288

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 60/106 (57%), Gaps = 19/106 (18%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPK------------LIPEDHKKSTPLDHHHHHQEI  120
            Y+CKTCNR F SFQALGGHRASH KPK             + E++ +  P        +I
Sbjct  111  YQCKTCNRYFPSFQALGGHRASHKKPKQNGTFSSEAVTTFVEENNDRYDPTTSTTLSLKI  170

Query  119  QDKTHEK-------SNKTKIHECLICGSLFFSGQALGGHMRRHRPL  3
             +  +         + K K+HEC ICG+ F SGQALGGHMRRHR L
Sbjct  171  PNGVNNNMCSTTTTTTKAKVHECSICGAEFSSGQALGGHMRRHRTL  216



>emb|CDY30857.1| BnaC04g27120D [Brassica napus]
Length=167

 Score = 87.8 bits (216),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 54/85 (64%), Gaps = 21/85 (25%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNRKF SFQALGGHRASH KPKL+  + +++                     K  
Sbjct  45   FECKTCNRKFDSFQALGGHRASHKKPKLVSVEQEQA---------------------KHT  83

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +H+C ICG +F +GQALGGHMR+HR
Sbjct  84   VHKCSICGQMFGTGQALGGHMRKHR  108



>ref|NP_001237020.1| uncharacterized protein LOC100500371 [Glycine max]
 gb|ACU15428.1| unknown [Glycine max]
Length=180

 Score = 88.2 bits (217),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 53/85 (62%), Gaps = 13/85 (15%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQ LGGHRASH KP+L+  D+ +   L             H+   K K
Sbjct  41   FECKTCNRQFPSFQTLGGHRASHKKPRLMAGDNIEGQLL-------------HDSPPKPK  87

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  88   THECSICGLEFAIGQALGGHMRRHR  112



>ref|XP_004142087.1| PREDICTED: zinc finger protein ZAT11-like [Cucumis sativus]
 ref|XP_004161684.1| PREDICTED: zinc finger protein ZAT11-like [Cucumis sativus]
 gb|KGN54223.1| hypothetical protein Csa_4G293330 [Cucumis sativus]
Length=162

 Score = 87.4 bits (215),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 53/85 (62%), Gaps = 18/85 (21%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH +P+   E+ K +  L                  K K
Sbjct  42   FECKTCNRQFPSFQALGGHRASHKRPRTSVEEPKDTADL------------------KQK  83

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            IHEC +CG  F SGQALGGHMRRHR
Sbjct  84   IHECGLCGQEFSSGQALGGHMRRHR  108



>emb|CDX70228.1| BnaA10g25770D [Brassica napus]
Length=324

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 57/85 (67%), Gaps = 6/85 (7%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            Y+CKTC+R F SFQALGGHRASH KPK     +     +D++++        + K+   K
Sbjct  136  YQCKTCDRTFPSFQALGGHRASHKKPKATLSLYSN---IDNNNNRSL---AVYGKAGSNK  189

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +HEC +CG+ F SGQALGGHMRRHR
Sbjct  190  VHECGVCGAEFTSGQALGGHMRRHR  214



>ref|XP_010940535.1| PREDICTED: zinc finger protein ZAT5-like [Elaeis guineensis]
Length=291

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 59/101 (58%), Gaps = 16/101 (16%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKL-IPE--DHKKSTPLDHHHHHQEIQD-------  114
            YECKTCN+ F SFQALGGHRASH KPKL IP   +  K   +D       +         
Sbjct  128  YECKTCNKCFPSFQALGGHRASHKKPKLAIPMTGNEAKKAVIDEDSLQVSMNSLISKSIM  187

Query  113  ------KTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
                   +   +NK +IHEC ICGS F SGQALGGHMRRHR
Sbjct  188  ATTNTNSSSISNNKPRIHECSICGSEFSSGQALGGHMRRHR  228



>ref|XP_004305218.1| PREDICTED: zinc finger protein ZAT11-like [Fragaria vesca subsp. 
vesca]
Length=174

 Score = 87.8 bits (216),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 57/84 (68%), Gaps = 12/84 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNRKF SFQALGGHRASH KP+        ST +D     Q+ + +T    +K K
Sbjct  39   FECKTCNRKFPSFQALGGHRASH-KPR--------STVMDTD---QDPKSETKLMQSKLK  86

Query  83   IHECLICGSLFFSGQALGGHMRRH  12
             HEC ICG +F SGQALGGHMRRH
Sbjct  87   KHECSICGLVFSSGQALGGHMRRH  110



>ref|XP_010047364.1| PREDICTED: zinc finger protein ZAT11-like [Eucalyptus grandis]
 gb|AGK28204.1| C2H2-type zinc finger protein 6 [Eucalyptus grandis]
 gb|KCW88904.1| hypothetical protein EUGRSUZ_A01232 [Eucalyptus grandis]
Length=181

 Score = 87.8 bits (216),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 54/88 (61%), Gaps = 18/88 (20%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLI---PEDHKKSTPLDHHHHHQEIQDKTHEKSN  93
            ++CKTCNR+F SFQALGGHRASH KPKL+   PED  KS                   + 
Sbjct  43   FKCKTCNRQFPSFQALGGHRASHKKPKLLETKPEDSTKS---------------VLGTTA  87

Query  92   KTKIHECLICGSLFFSGQALGGHMRRHR  9
              K+HEC ICG  F  GQALGGHMRRHR
Sbjct  88   NPKMHECSICGLKFSLGQALGGHMRRHR  115



>ref|XP_003539794.1| PREDICTED: zinc finger protein ZAT5-like [Glycine max]
Length=315

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 60/111 (54%), Gaps = 26/111 (23%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQ---------DK  111
            YECKTCNR F SFQALGGHRASH KPKL  E+ K+  P          Q         D+
Sbjct  136  YECKTCNRTFPSFQALGGHRASHKKPKLAAEEKKQPLPPSPLPPPTPSQLQHMIVTNYDR  195

Query  110  THEKSNKT-----------------KIHECLICGSLFFSGQALGGHMRRHR  9
              E S K+                 KIHEC ICGS F SGQALGGHMRRHR
Sbjct  196  FEEGSVKSGPPISLQLGNNGNNNKGKIHECSICGSEFTSGQALGGHMRRHR  246



>ref|XP_009125554.1| PREDICTED: zinc finger protein ZAT5-like [Brassica rapa]
Length=352

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 60/98 (61%), Gaps = 13/98 (13%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKL-------------IPEDHKKSTPLDHHHHHQE  123
            Y+CKTC+R F SFQALGGHRASH KPK              I E+   +T    +++++ 
Sbjct  157  YQCKTCDRTFSSFQALGGHRASHKKPKATSFYSNLEHLKKNIYENDSLATTTTIYNNNKN  216

Query  122  IQDKTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
                 + K+   K+H+C ICG+ F SGQALGGHMRRHR
Sbjct  217  RSLVVYGKAGNNKVHKCGICGAEFTSGQALGGHMRRHR  254



>emb|CDY07578.1| BnaC06g14860D [Brassica napus]
Length=168

 Score = 87.4 bits (215),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 54/85 (64%), Gaps = 17/85 (20%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNRKF SFQALGGHRASH KPKL  +                 Q++   ++N+  
Sbjct  48   FECKTCNRKFDSFQALGGHRASHKKPKLSID-----------------QEQVKHRNNENA  90

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             H+C  CG +F +GQALGGHMR+HR
Sbjct  91   AHKCSTCGQMFGTGQALGGHMRKHR  115



>ref|XP_010431330.1| PREDICTED: zinc finger protein ZAT11-like [Camelina sativa]
Length=190

 Score = 87.8 bits (216),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 55/85 (65%), Gaps = 17/85 (20%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNRKF SFQALGGHRASH KPKL  +                 Q++   ++N+  
Sbjct  50   FECKTCNRKFDSFQALGGHRASHKKPKLSVD-----------------QEQVKHRNNEND  92

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +H+C IC  +F +GQALGGHMR+HR
Sbjct  93   MHKCSICDQIFGTGQALGGHMRKHR  117



>gb|KHN21079.1| Zinc finger protein ZAT5 [Glycine soja]
Length=305

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 60/111 (54%), Gaps = 26/111 (23%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQ---------DK  111
            YECKTCNR F SFQALGGHRASH KPKL  E+ K+  P          Q         D+
Sbjct  126  YECKTCNRTFPSFQALGGHRASHKKPKLAAEEKKQPLPPSPLPPPTPSQLQHMIVTNYDR  185

Query  110  THEKSNKT-----------------KIHECLICGSLFFSGQALGGHMRRHR  9
              E S K+                 KIHEC ICGS F SGQALGGHMRRHR
Sbjct  186  FEEGSVKSGPPISLQLGNNGNNNKGKIHECSICGSEFTSGQALGGHMRRHR  236



>ref|XP_004302781.1| PREDICTED: zinc finger protein ZAT11-like [Fragaria vesca subsp. 
vesca]
Length=175

 Score = 87.4 bits (215),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 53/87 (61%), Gaps = 12/87 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            YECKTCNR+F SFQALGGHRASH KP+ +P                +++ +      K K
Sbjct  40   YECKTCNRQFSSFQALGGHRASHKKPRTLP------------GGDDDLKSEAKLAQGKPK  87

Query  83   IHECLICGSLFFSGQALGGHMRRHRPL  3
             HEC ICG  F  GQALGGHMRRHR +
Sbjct  88   KHECSICGLEFSLGQALGGHMRRHRMM  114



>emb|CDX91362.1| BnaC04g07880D [Brassica napus]
Length=180

 Score = 87.8 bits (216),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 56/85 (66%), Gaps = 14/85 (16%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCN++F SFQALGGHRASH KPKL   D K+   + +++             N T 
Sbjct  48   FECKTCNKRFSSFQALGGHRASHKKPKL-SVDQKEVKHVTNNY-------------NGTH  93

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +HEC ICG  F +GQALGGHMRRHR
Sbjct  94   MHECSICGQSFGTGQALGGHMRRHR  118



>gb|KHN48238.1| Zinc finger protein ZAT5 [Glycine soja]
Length=288

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 60/107 (56%), Gaps = 20/107 (19%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPK------------LIPEDHKKSTPLDHHHHHQEI  120
            Y+CKTCNR F SFQALGGHRASH KPK             + E++ +  P        +I
Sbjct  111  YQCKTCNRYFPSFQALGGHRASHKKPKQNGTFSSEAVTTFVEENNDRYDPTTSTTLSLKI  170

Query  119  QDKTHEK--------SNKTKIHECLICGSLFFSGQALGGHMRRHRPL  3
             +  +          + K K+HEC ICG+ F SGQALGGHMRRHR L
Sbjct  171  PNGVNNNMCSTTTTTTTKAKVHECSICGAEFSSGQALGGHMRRHRTL  217



>ref|XP_007144472.1| hypothetical protein PHAVU_007G158900g [Phaseolus vulgaris]
 gb|ESW16466.1| hypothetical protein PHAVU_007G158900g [Phaseolus vulgaris]
Length=160

 Score = 87.4 bits (215),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 53/85 (62%), Gaps = 16/85 (19%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            YEC+TCNRKF SFQALGGHRASH  PK   +D K+             +DK     NK K
Sbjct  35   YECRTCNRKFSSFQALGGHRASHKTPK---QDLKE-------------EDKIVRLENKPK  78

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHM+RHR
Sbjct  79   RHECSICGEEFSLGQALGGHMKRHR  103



>ref|XP_002533110.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF29282.1| nucleic acid binding protein, putative [Ricinus communis]
Length=159

 Score = 87.0 bits (214),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 53/87 (61%), Gaps = 20/87 (23%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKK--STPLDHHHHHQEIQDKTHEKSNK  90
            + CKTCNR+F SFQALGGHRASH KPKLI +D  K  S+P                   K
Sbjct  36   FACKTCNRRFSSFQALGGHRASHKKPKLIGDDLLKLPSSP------------------PK  77

Query  89   TKIHECLICGSLFFSGQALGGHMRRHR  9
             K HEC ICG  F  GQALGGHMRRHR
Sbjct  78   PKTHECSICGLEFAIGQALGGHMRRHR  104



>emb|CDY58436.1| BnaC03g71210D [Brassica napus]
Length=340

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 55/89 (62%), Gaps = 14/89 (16%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIP----EDHKKSTPLDHHHHHQEIQDKTHEKS  96
            Y+CKTC+R F SFQALGGHRASH KP+        D KKS            ++     +
Sbjct  150  YQCKTCDRTFPSFQALGGHRASHKKPRATSFYSNLDLKKSI----------YENDAASLA  199

Query  95   NKTKIHECLICGSLFFSGQALGGHMRRHR  9
            N  K+HEC ICG+ F SGQALGGHMRRHR
Sbjct  200  NNNKVHECGICGAEFTSGQALGGHMRRHR  228



>ref|XP_008359103.1| PREDICTED: zinc finger protein ZAT12-like [Malus domestica]
Length=171

 Score = 87.4 bits (215),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 51/85 (60%), Gaps = 10/85 (12%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            + CKTCNR+F SFQALGGHRASH KPKL+P         D  H  Q           K K
Sbjct  39   FVCKTCNREFPSFQALGGHRASHKKPKLMPGGAA-----DXLHLAQSTGSPV-----KPK  88

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  89   THECPICGLEFAIGQALGGHMRRHR  113



>gb|KHN02411.1| Zinc finger protein ZAT11-like protein [Glycine soja]
Length=155

 Score = 87.0 bits (214),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 55/85 (65%), Gaps = 13/85 (15%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTC+RKF SFQALGGHRASH + KL  E+ K+             Q KT    NK K
Sbjct  44   FECKTCSRKFSSFQALGGHRASHKRQKLEGEELKE-------------QAKTLSLWNKPK  90

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +HEC ICG  F  GQALGGHMR+HR
Sbjct  91   MHECSICGLEFSLGQALGGHMRKHR  115



>ref|XP_008447526.1| PREDICTED: zinc finger protein ZAT11 [Cucumis melo]
Length=162

 Score = 87.0 bits (214),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 53/85 (62%), Gaps = 18/85 (21%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH +P+   E+ K +  L                  K K
Sbjct  42   FECKTCNRQFPSFQALGGHRASHKRPRTSVEEPKDTADL------------------KQK  83

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            IHEC +CG  F SGQALGGHMRRHR
Sbjct  84   IHECGLCGQEFSSGQALGGHMRRHR  108



>ref|XP_011018810.1| PREDICTED: zinc finger protein ZAT5-like [Populus euphratica]
Length=307

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 60/106 (57%), Gaps = 21/106 (20%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPK---LIPEDHKKSTPLDHHHHHQE----------  123
            Y+CKTC+R+F SFQALGGHRASH KPK   L  ED K  T +   H  Q           
Sbjct  122  YQCKTCDRRFPSFQALGGHRASHKKPKPGNLDHEDKKVLTTVQMAHEEQNGNRNNINTST  181

Query  122  ------IQDKT--HEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
                  + D+     K    K+HEC +CG+ F SGQALGGHMRRHR
Sbjct  182  TLSLQLVNDRVLCSPKVKSNKVHECSVCGAEFSSGQALGGHMRRHR  227



>ref|XP_006407564.1| hypothetical protein EUTSA_v10020904mg [Eutrema salsugineum]
 gb|ESQ49017.1| hypothetical protein EUTSA_v10020904mg [Eutrema salsugineum]
Length=388

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 63/103 (61%), Gaps = 21/103 (20%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPE--DHKKS----------------TPLDHH  138
            Y+CKTC+R F SFQALGGHRASH KPK      D KKS                TP +++
Sbjct  178  YQCKTCDRTFPSFQALGGHRASHKKPKAAAGLHDLKKSIYDDAVSLQLNKVLTTTPNNNN  237

Query  137  HHHQEIQDKTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
            +H   +    + K++  K+HEC ICG+ F SGQALGGHMRRHR
Sbjct  238  NHRSLV---VYGKASNNKVHECGICGAEFTSGQALGGHMRRHR  277



>emb|CDP00044.1| unnamed protein product [Coffea canephora]
Length=210

 Score = 88.2 bits (217),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 51/85 (60%), Gaps = 14/85 (16%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KPKL  +                +Q +      K K
Sbjct  58   FECKTCNRQFPSFQALGGHRASHKKPKLGAD--------------LSLQSQVQTSPPKPK  103

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  104  THECSICGQEFAVGQALGGHMRRHR  128



>ref|XP_003625524.1| Zinc finger protein [Medicago truncatula]
 gb|AES81742.1| Cys2-His2 zinc finger transcription factor [Medicago truncatula]
 gb|AFK47111.1| unknown [Medicago truncatula]
Length=165

 Score = 87.0 bits (214),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 54/87 (62%), Gaps = 12/87 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            YECKTCN+KF SFQALGGHRASH + KL   +  K             Q K+    NK K
Sbjct  34   YECKTCNKKFSSFQALGGHRASHKRMKLAEGEELKE------------QAKSLSLWNKPK  81

Query  83   IHECLICGSLFFSGQALGGHMRRHRPL  3
            +HEC ICG  F  GQALGGHMR+HR +
Sbjct  82   MHECSICGMGFSLGQALGGHMRKHRAV  108



>ref|XP_010504128.1| PREDICTED: zinc finger protein ZAT11-like [Camelina sativa]
Length=176

 Score = 87.4 bits (215),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 55/85 (65%), Gaps = 17/85 (20%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNRKF SFQALGGHRASH KPK+  +                 Q++   ++N+  
Sbjct  49   FECKTCNRKFDSFQALGGHRASHKKPKMSVD-----------------QEQVKHRNNEND  91

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +H+C IC  +F +GQALGGHMR+HR
Sbjct  92   MHKCSICDQIFGTGQALGGHMRKHR  116



>ref|XP_010515858.1| PREDICTED: zinc finger protein ZAT11-like [Camelina sativa]
Length=176

 Score = 87.4 bits (215),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 55/85 (65%), Gaps = 17/85 (20%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNRKF SFQALGGHRASH KPK+  +                 Q++   ++N+  
Sbjct  49   FECKTCNRKFDSFQALGGHRASHKKPKMSVD-----------------QEQVKHRNNEND  91

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +H+C IC  +F +GQALGGHMR+HR
Sbjct  92   MHKCSICDQIFGTGQALGGHMRKHR  116



>ref|XP_010050475.1| PREDICTED: zinc finger protein ZAT5-like [Eucalyptus grandis]
 gb|KCW89332.1| hypothetical protein EUGRSUZ_A01622 [Eucalyptus grandis]
Length=296

 Score = 89.0 bits (219),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 62/110 (56%), Gaps = 24/110 (22%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPL------DHHHHHQEIQDKTHE  102
            + CKTC R F SFQALGGHRASH KP+L  ED K + P+      +     Q I D    
Sbjct  120  FSCKTCGRSFPSFQALGGHRASHKKPRLNDED-KNNKPIHVTMKGNDTGDKQRIVDACTA  178

Query  101  KS---------------NKT--KIHECLICGSLFFSGQALGGHMRRHRPL  3
             S               NK+  K+HEC ICG+ F SGQALGGHMRRHRP+
Sbjct  179  LSLQITPAGGPAMLSSGNKSSNKVHECSICGAEFSSGQALGGHMRRHRPV  228



>ref|XP_010905716.1| PREDICTED: zinc finger protein ZAT12-like [Elaeis guineensis]
Length=158

 Score = 87.0 bits (214),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 53/87 (61%), Gaps = 18/87 (21%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KP+L+ +   +                      K +
Sbjct  47   FECKTCNRQFPSFQALGGHRASHKKPRLMTDGQLQG------------------GLAKPR  88

Query  83   IHECLICGSLFFSGQALGGHMRRHRPL  3
            +HEC ICG  F  GQALGGHMRRHRP+
Sbjct  89   VHECSICGLEFAIGQALGGHMRRHRPV  115



>gb|KHN13875.1| Zinc finger protein ZAT11 [Glycine soja]
Length=164

 Score = 87.0 bits (214),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 52/85 (61%), Gaps = 14/85 (16%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KP+L+  D +                  H+   K K
Sbjct  28   FECKTCNRQFPSFQALGGHRASHKKPRLMAGDIEGQL--------------LHDSPPKPK  73

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  74   THECSICGLEFAIGQALGGHMRRHR  98



>ref|XP_010517014.1| PREDICTED: zinc finger protein ZAT11-like [Camelina sativa]
Length=182

 Score = 87.4 bits (215),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 53/85 (62%), Gaps = 12/85 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KPKL   +              E++  ++       
Sbjct  49   FECKTCNRRFSSFQALGGHRASHKKPKLTTVE------------QNEVKHLSNNYKGNNH  96

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +HEC ICG  F +GQALGGHMRRHR
Sbjct  97   LHECSICGQRFGTGQALGGHMRRHR  121



>ref|XP_004294604.1| PREDICTED: zinc finger protein ZAT12-like [Fragaria vesca subsp. 
vesca]
Length=173

 Score = 87.0 bits (214),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 55/87 (63%), Gaps = 9/87 (10%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            + CKTCNR+F SFQALGGHRASH+KPKL+      +T L       ++   T     K K
Sbjct  43   FVCKTCNREFSSFQALGGHRASHNKPKLM---AGGATDL------LQLSQSTASSPAKPK  93

Query  83   IHECLICGSLFFSGQALGGHMRRHRPL  3
             HEC ICG  F  GQALGGHMRRHR L
Sbjct  94   THECPICGLEFALGQALGGHMRRHRDL  120



>ref|XP_010043587.1| PREDICTED: zinc finger protein ZAT12-like [Eucalyptus grandis]
 gb|KCW85609.1| hypothetical protein EUGRSUZ_B02396 [Eucalyptus grandis]
Length=172

 Score = 87.0 bits (214),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 52/85 (61%), Gaps = 12/85 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            + CKTCNR+F SFQALGGHRASH KPKLI  D  +   L H       + KT        
Sbjct  43   FTCKTCNREFSSFQALGGHRASHKKPKLISGDLLR---LGHEADSSPAKPKT--------  91

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  92   -HECPICGLDFPIGQALGGHMRRHR  115



>ref|XP_010041405.1| PREDICTED: zinc finger protein ZAT12-like [Eucalyptus grandis]
 gb|KCW44374.1| hypothetical protein EUGRSUZ_L02150 [Eucalyptus grandis]
Length=172

 Score = 87.0 bits (214),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 52/85 (61%), Gaps = 12/85 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            + CKTCNR+F SFQALGGHRASH KPKLI  D  +   L H       + KT        
Sbjct  43   FACKTCNREFSSFQALGGHRASHKKPKLISGDLLR---LGHEADSSPAKPKT--------  91

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  92   -HECPICGLDFPIGQALGGHMRRHR  115



>ref|XP_010920692.1| PREDICTED: zinc finger protein ZAT12-like [Elaeis guineensis]
Length=165

 Score = 87.0 bits (214),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 53/85 (62%), Gaps = 16/85 (19%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KP+++ + H                D+      K +
Sbjct  38   FECKTCNRQFPSFQALGGHRASHKKPRMMGDGH----------------DQAQSALVKPR  81

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +HEC ICG  F  GQALGGHMRRHR
Sbjct  82   VHECSICGLEFPIGQALGGHMRRHR  106



>ref|XP_003552680.1| PREDICTED: zinc finger protein ZAT11-like [Glycine max]
Length=175

 Score = 87.0 bits (214),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 52/85 (61%), Gaps = 14/85 (16%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KP+L+  D +                  H+   K K
Sbjct  39   FECKTCNRQFPSFQALGGHRASHKKPRLMAGDIEGQL--------------LHDSPPKPK  84

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  85   THECSICGLEFAIGQALGGHMRRHR  109



>ref|XP_009146836.1| PREDICTED: zinc finger protein ZAT5-like [Brassica rapa]
Length=388

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 60/106 (57%), Gaps = 24/106 (23%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPE-----DHKKS----------------TPL  147
            Y+CKTC+R F SFQALGGHRASH KPK         D KKS                TP 
Sbjct  174  YQCKTCDRTFPSFQALGGHRASHKKPKAAAGLHSDHDLKKSIYNDAVSLHLNNVPTATPN  233

Query  146  DHHHHHQEIQDKTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
            ++  H   +    + K+   K+HEC ICG+ F SGQALGGHMRRHR
Sbjct  234  NNSSHRSLV---VYGKAGNNKVHECGICGAEFTSGQALGGHMRRHR  276



>ref|XP_006424440.1| hypothetical protein CICLE_v10028853mg [Citrus clementina]
 gb|ESR37680.1| hypothetical protein CICLE_v10028853mg [Citrus clementina]
 gb|KDO60288.1| hypothetical protein CISIN_1g021063mg [Citrus sinensis]
Length=318

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 61/119 (51%), Gaps = 34/119 (29%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPK-------------------LIP--EDHKKSTPL  147
            YECKTCNR F SFQALGGHRASH KPK                   ++P   ++K S   
Sbjct  132  YECKTCNRSFPSFQALGGHRASHKKPKAALAEAPEKKSSASVPALAVLPTKNEYKDSYST  191

Query  146  DHHHHHQEIQDKTHEKSNK-------------TKIHECLICGSLFFSGQALGGHMRRHR  9
             HHH    +Q  +   +                KIHEC ICGS F SGQALGGHMRRHR
Sbjct  192  LHHHDQSHMQAASAAATAANNNNTANNNNKGGNKIHECSICGSEFTSGQALGGHMRRHR  250



>ref|XP_010045301.1| PREDICTED: zinc finger protein ZAT5 [Eucalyptus grandis]
Length=290

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 58/105 (55%), Gaps = 20/105 (19%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQD----------  114
            YECKTC+R F SFQALGGHRASH KPK   +  +K  P         I D          
Sbjct  105  YECKTCSRVFPSFQALGGHRASHKKPKSTADPDQKIKPSTVVLGLDAIDDEDEGHSGKIS  164

Query  113  ----------KTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
                      K   +++K KIHEC ICGS F SGQALGGHMRRHR
Sbjct  165  PPLSAHVASHKGLHQASKPKIHECNICGSEFASGQALGGHMRRHR  209



>ref|XP_008776431.1| PREDICTED: zinc finger protein ZAT11-like [Phoenix dactylifera]
Length=154

 Score = 86.7 bits (213),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 51/86 (59%), Gaps = 18/86 (21%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KP+L  + H +                      K +
Sbjct  46   FECKTCNRQFSSFQALGGHRASHKKPRLTADGHLRGG------------------LAKPR  87

Query  83   IHECLICGSLFFSGQALGGHMRRHRP  6
             HEC ICG  F  GQALGGHMRRHRP
Sbjct  88   AHECSICGLEFAIGQALGGHMRRHRP  113



>ref|XP_002284384.1| PREDICTED: zinc finger protein ZAT11 [Vitis vinifera]
Length=159

 Score = 86.7 bits (213),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 52/85 (61%), Gaps = 17/85 (20%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNRKF SFQALGGHRASH KP+L+ ++ +  T                    K K
Sbjct  41   FECKTCNRKFPSFQALGGHRASHKKPRLMGDELQLPT-----------------SPAKPK  83

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  84   THECSICGLEFAIGQALGGHMRRHR  108



>gb|EYU41596.1| hypothetical protein MIMGU_mgv1a024147mg, partial [Erythranthe 
guttata]
Length=277

 Score = 88.2 bits (217),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 62/105 (59%), Gaps = 21/105 (20%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQ-EIQD---------  114
            Y+CKTC++ F SFQALGGHRASH KP   P      T +D ++    +I D         
Sbjct  105  YQCKTCDKSFSSFQALGGHRASHKKPSSKP---ITITAVDEYYQRSIQISDNNNNNNNNS  161

Query  113  ------KTHEKSNKT--KIHECLICGSLFFSGQALGGHMRRHRPL  3
                  +T  KS  T  ++HEC +CG+ F SGQALGGHMRRHRP+
Sbjct  162  NIYLGNQTRPKSTATTRRVHECSLCGAEFASGQALGGHMRRHRPI  206



>ref|XP_010312586.1| PREDICTED: zinc finger protein ZAT5 [Solanum lycopersicum]
Length=358

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 62/108 (57%), Gaps = 23/108 (21%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPL------DHHHHHQ--------  126
            YECKTCNR F SFQALGGHRASH KPK+   ++ K +        D+H  H         
Sbjct  176  YECKTCNRTFSSFQALGGHRASHKKPKIFNTEYNKRSYFDFSDEDDYHLQHSPSTLYNKN  235

Query  125  -------EIQDKTHEK--SNKTKIHECLICGSLFFSGQALGGHMRRHR  9
                    + + ++ K  S+  +IHEC  CG+ F SGQALGGHMRRHR
Sbjct  236  KNTNINKNLPNSSNNKYTSSSPRIHECSYCGAEFTSGQALGGHMRRHR  283



>ref|XP_006409841.1| hypothetical protein EUTSA_v10016842mg [Eutrema salsugineum]
 gb|ESQ51294.1| hypothetical protein EUTSA_v10016842mg [Eutrema salsugineum]
Length=364

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 57/102 (56%), Gaps = 17/102 (17%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKT-  87
            YECKTCNR F SFQALGGHRASH KP+   E+  K   +       E    +H K + + 
Sbjct  192  YECKTCNRTFPSFQALGGHRASHKKPRTSMEEKTKLPLMQPKSSGSEEGQNSHFKVSGSA  251

Query  86   ----------------KIHECLICGSLFFSGQALGGHMRRHR  9
                            K+HEC ICGS F SGQALGGHMRRHR
Sbjct  252  LASQASNNNVIINKANKVHECSICGSEFASGQALGGHMRRHR  293



>ref|XP_008795640.1| PREDICTED: zinc finger protein ZAT12-like [Phoenix dactylifera]
Length=165

 Score = 86.7 bits (213),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 52/85 (61%), Gaps = 16/85 (19%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASHSKP+L+ +                 Q +      K K
Sbjct  38   FECKTCNRQFPSFQALGGHRASHSKPRLVGDG----------------QGQGQSALGKPK  81

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +H C ICG  F  GQALGGHMRRHR
Sbjct  82   VHACSICGLEFPIGQALGGHMRRHR  106



>gb|KCW88903.1| hypothetical protein EUGRSUZ_A01231 [Eucalyptus grandis]
Length=164

 Score = 86.7 bits (213),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 56/85 (66%), Gaps = 11/85 (13%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KP+L+     ++T L      ++          K K
Sbjct  28   FECKTCNRRFSSFQALGGHRASHKKPRLL-----ETTKL------EDCTKLALGSMAKPK  76

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +HEC +CG  F SGQALGGHMRRHR
Sbjct  77   MHECSMCGLKFASGQALGGHMRRHR  101



>ref|XP_010529859.1| PREDICTED: zinc finger protein ZAT11-like [Tarenaya hassleriana]
Length=194

 Score = 87.4 bits (215),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 57/86 (66%), Gaps = 13/86 (15%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSK-PKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKT  87
            +ECKTCNRKF+SFQALGGHRASH+K P+    D             QE Q K H  ++K 
Sbjct  51   FECKTCNRKFQSFQALGGHRASHNKRPRSESSD-----------QDQEQQTKKHINNDKQ  99

Query  86   KIHECLICGSLFFSGQALGGHMRRHR  9
            + HEC ICG  F SGQALGGHMRRHR
Sbjct  100  R-HECSICGQSFGSGQALGGHMRRHR  124



>gb|AGK28202.1| C2H2-type zinc finger protein 4 [Eucalyptus grandis]
 gb|KCW85610.1| hypothetical protein EUGRSUZ_B02397 [Eucalyptus grandis]
Length=161

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 54/85 (64%), Gaps = 12/85 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            + CKTCNR+F SFQALGGHRASH KPKLI  D      L H  H  +         +K K
Sbjct  30   FACKTCNREFSSFQALGGHRASHKKPKLISGD------LLHLGHSVD------SSLDKPK  77

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +H+C ICG  F  GQALGGHMRRHR
Sbjct  78   MHKCSICGLEFPLGQALGGHMRRHR  102



>ref|XP_010067376.1| PREDICTED: zinc finger protein ZAT12-like [Eucalyptus grandis]
 gb|KCW65505.1| hypothetical protein EUGRSUZ_G02910 [Eucalyptus grandis]
Length=196

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 51/85 (60%), Gaps = 11/85 (13%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KP+L       S+           Q +      K K
Sbjct  38   FECKTCNRQFSSFQALGGHRASHKKPRLSSAGGDDSS-----------QSQGSASPAKPK  86

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  87   THECSICGLEFAIGQALGGHMRRHR  111



>ref|XP_008807730.1| PREDICTED: zinc finger protein ZAT12-like [Phoenix dactylifera]
Length=168

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 53/85 (62%), Gaps = 16/85 (19%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KP+L+ + H ++                     K +
Sbjct  41   FECKTCNRQFPSFQALGGHRASHKKPRLMGDGHGQA----------------QSALAKPR  84

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +HEC ICG  F  GQALGGHMRRHR
Sbjct  85   VHECSICGLEFAIGQALGGHMRRHR  109



>gb|EYU19898.1| hypothetical protein MIMGU_mgv1a014646mg [Erythranthe guttata]
Length=183

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 54/90 (60%), Gaps = 24/90 (27%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLI-----PEDHKKSTPLDHHHHHQEIQDKTHEK  99
            +ECKTCNR+F SFQALGGHRASH KPKL+      +DH +S P                 
Sbjct  44   FECKTCNRQFPSFQALGGHRASHKKPKLMGGAAAGDDHHRSPP-----------------  86

Query  98   SNKTKIHECLICGSLFFSGQALGGHMRRHR  9
              K K HEC ICG  F  GQALGGHMRRHR
Sbjct  87   --KQKTHECSICGLEFAIGQALGGHMRRHR  114



>ref|XP_007219175.1| hypothetical protein PRUPE_ppa016651mg [Prunus persica]
 gb|EMJ20374.1| hypothetical protein PRUPE_ppa016651mg [Prunus persica]
Length=359

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 64/114 (56%), Gaps = 29/114 (25%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPK---------------LIPEDHKKS----TPLDH  141
            YECKTCNR F SFQALGGHRASH KPK               L+P D + +      + H
Sbjct  141  YECKTCNRTFPSFQALGGHRASHKKPKANTGDDQKNKHFAIGLLPSDEEDTQLFKNSILH  200

Query  140  HHHHQEIQDKTHEKSNK----------TKIHECLICGSLFFSGQALGGHMRRHR  9
            ++++      +   SN+          +K+HEC ICG+ F SGQALGGHMRRHR
Sbjct  201  NNNNTSSSPLSLHLSNRGLVLSSNKSSSKVHECSICGAEFTSGQALGGHMRRHR  254



>ref|XP_008448374.1| PREDICTED: zinc finger protein ZAT11-like [Cucumis melo]
Length=147

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 51/87 (59%), Gaps = 19/87 (22%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSN--K  90
            + CKTCNR+F SFQALGGHRASH KPKL                     D     SN  K
Sbjct  17   FVCKTCNREFSSFQALGGHRASHRKPKL-----------------SISADGVFNSSNQVK  59

Query  89   TKIHECLICGSLFFSGQALGGHMRRHR  9
            TK+HEC ICG  F  GQALGGHMRRHR
Sbjct  60   TKVHECSICGVEFPVGQALGGHMRRHR  86



>ref|XP_006410928.1| hypothetical protein EUTSA_v10017303mg [Eutrema salsugineum]
 gb|ESQ52381.1| hypothetical protein EUTSA_v10017303mg [Eutrema salsugineum]
Length=179

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 52/88 (59%), Gaps = 20/88 (23%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KPKL  E                 Q      SN  K
Sbjct  47   FECKTCNRRFSSFQALGGHRASHKKPKLTVE-----------------QKDVKHLSNNNK  89

Query  83   ---IHECLICGSLFFSGQALGGHMRRHR  9
               +HEC ICG  F +GQALGGHMRRHR
Sbjct  90   GNHMHECSICGQSFGTGQALGGHMRRHR  117



>ref|XP_009791832.1| PREDICTED: uncharacterized protein DDB_G0283357-like [Nicotiana 
sylvestris]
Length=416

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 55/108 (51%), Positives = 62/108 (57%), Gaps = 23/108 (21%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPE---DHKKSTPLDHHHH--HQEIQDKTHE-  102
            YECKTCNR F SFQALGGHRASH KPK I      +KKS+  D      +QE+   T   
Sbjct  233  YECKTCNRTFPSFQALGGHRASHKKPKTILTTELSNKKSSYFDFSDEDDYQELSPSTTTL  292

Query  101  -KSNKT----------------KIHECLICGSLFFSGQALGGHMRRHR  9
             K+NK                 +IHEC  CG+ F SGQALGGHMRRHR
Sbjct  293  YKNNKNVTKTLPNSSNNKFSSPRIHECSYCGAEFTSGQALGGHMRRHR  340



>ref|XP_009143499.1| PREDICTED: zinc finger protein ZAT11 [Brassica rapa]
 emb|CDX74961.1| BnaA05g07070D [Brassica napus]
Length=180

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 55/85 (65%), Gaps = 14/85 (16%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCN++F SFQALGGHRASH KPKL   D K+   + +++             N T 
Sbjct  48   FECKTCNKRFSSFQALGGHRASHKKPKL-SVDQKEVKHVTNNY-------------NGTH  93

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            IHEC IC   F +GQALGGHMRRHR
Sbjct  94   IHECSICSQSFGTGQALGGHMRRHR  118



>ref|XP_009141657.1| PREDICTED: zinc finger protein ZAT11-like [Brassica rapa]
 emb|CDY18446.1| BnaA04g21410D [Brassica napus]
Length=180

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 55/85 (65%), Gaps = 15/85 (18%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCN++F SFQALGGHRASH KPKL  +              Q++  K +   + T+
Sbjct  49   FECKTCNKRFSSFQALGGHRASHKKPKLTVD--------------QKVV-KQYLTKDGTQ  93

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F +GQALGGHMRRHR
Sbjct  94   AHECTICGQSFGTGQALGGHMRRHR  118



>dbj|BAA19110.1| PEThy;ZPT2-5 [Petunia x hybrida]
Length=176

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 53/87 (61%), Gaps = 15/87 (17%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KP+L+ E H                   HE   K K
Sbjct  49   FECKTCNRQFSSFQALGGHRASHKKPRLMGELHNLQL--------------FHELP-KRK  93

Query  83   IHECLICGSLFFSGQALGGHMRRHRPL  3
             HEC ICG  F  GQALGGHMRRHR +
Sbjct  94   THECSICGLEFAIGQALGGHMRRHRAV  120



>ref|XP_007139263.1| hypothetical protein PHAVU_008G014600g [Phaseolus vulgaris]
 gb|ESW11257.1| hypothetical protein PHAVU_008G014600g [Phaseolus vulgaris]
Length=165

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 52/85 (61%), Gaps = 16/85 (19%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KP+L+  +                 +  H+   K K
Sbjct  40   FECKTCNRQFPSFQALGGHRASHKKPRLMASE----------------GELLHDSPAKPK  83

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  84   THECSICGLEFAIGQALGGHMRRHR  108



>ref|XP_009404616.1| PREDICTED: zinc finger protein ZAT12-like [Musa acuminata subsp. 
malaccensis]
Length=159

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 54/85 (64%), Gaps = 18/85 (21%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTC+R+F SFQALGGHRASH KPKL  ED                  + H ++ K +
Sbjct  43   FECKTCSRQFPSFQALGGHRASHKKPKLA-ED-----------------GRGHGEAAKPR  84

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +HEC ICG  F  GQALGGHMRRHR
Sbjct  85   VHECAICGLEFAIGQALGGHMRRHR  109



>ref|XP_004167789.1| PREDICTED: zinc finger protein ZAT5-like [Cucumis sativus]
Length=189

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 55/97 (57%), Gaps = 12/97 (12%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPK----LIPEDHKKSTPLDHHHHHQEIQDKTHEKS  96
            YECKTCNR F SFQALGGHRASH KPK    +   + +   P         +Q  T   +
Sbjct  11   YECKTCNRTFPSFQALGGHRASHKKPKTTTMVTALEDQPEEPQLIKIAASPVQIPTKTVT  70

Query  95   NKT--------KIHECLICGSLFFSGQALGGHMRRHR  9
              T        K+HEC ICG  F SGQALGGHMRRHR
Sbjct  71   AGTNFQTHKGGKVHECSICGLEFTSGQALGGHMRRHR  107



>ref|XP_007149157.1| hypothetical protein PHAVU_005G046200g [Phaseolus vulgaris]
 gb|ESW21151.1| hypothetical protein PHAVU_005G046200g [Phaseolus vulgaris]
Length=168

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 53/85 (62%), Gaps = 12/85 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNRKF SFQALGGHRASH + KL   +HK     D       I        NK K
Sbjct  40   FECKTCNRKFSSFQALGGHRASHKRSKLEGYEHKA----DAMSLSLGI--------NKPK  87

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +HEC ICG  F  GQALGGHMRRHR
Sbjct  88   MHECTICGQEFSLGQALGGHMRRHR  112



>ref|XP_004294605.1| PREDICTED: zinc finger protein ZAT11-like [Fragaria vesca subsp. 
vesca]
Length=176

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 52/85 (61%), Gaps = 8/85 (9%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            + CKTCNR+F SFQALGGHRASH+KPKL+  +              ++   +     K K
Sbjct  43   FACKTCNREFSSFQALGGHRASHNKPKLVAGNGAADL--------LQLAQSSPSSPAKPK  94

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  95   SHECPICGVEFAIGQALGGHMRRHR  119



>ref|XP_010103498.1| Zinc finger protein ZAT5 [Morus notabilis]
 gb|EXB96158.1| Zinc finger protein ZAT5 [Morus notabilis]
Length=366

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 64/117 (55%), Gaps = 32/117 (27%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKK-------------------------  159
            YECKTCNR F SFQALGGHRASH KPK + E  KK                         
Sbjct  147  YECKTCNRTFPSFQALGGHRASHKKPKAMAEIEKKTQLFALQSDDEDQLQLTKSNHNTIS  206

Query  158  STPLDHHHHHQEIQDKTHEK-----SNKT--KIHECLICGSLFFSGQALGGHMRRHR  9
            ST L    +++ +   +H       +NK+  K+HEC ICG+ F SGQALGGHMRRHR
Sbjct  207  STTLSLQLNNRSLYGISHNNNNHHITNKSPNKVHECSICGAEFTSGQALGGHMRRHR  263



>ref|XP_003536960.1| PREDICTED: zinc finger protein ZAT11-like [Glycine max]
Length=164

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 51/85 (60%), Gaps = 16/85 (19%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +EC TCNRKF SFQALGGHRASH KPKL                H + Q K     NK K
Sbjct  37   FECMTCNRKFTSFQALGGHRASHKKPKL----------------HVKEQGKILMLGNKPK  80

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHM++HR
Sbjct  81   KHECTICGREFTLGQALGGHMKKHR  105



>ref|XP_003547427.1| PREDICTED: zinc finger protein ZAT11 [Glycine max]
 gb|AAZ03389.1| C2H2 transcription factor [Glycine max]
Length=172

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 57/85 (67%), Gaps = 11/85 (13%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            ++CKTCNR+F SFQALGGHRASH KPKL+  D            HQE+ + T ++  + +
Sbjct  40   FKCKTCNRRFSSFQALGGHRASHKKPKLMVTD---------LSCHQELPNPTMKQ--QPR  88

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +H C ICG  F  GQALGGHMR+HR
Sbjct  89   MHPCPICGLEFAIGQALGGHMRKHR  113



>ref|XP_010043588.1| PREDICTED: zinc finger protein ZAT8-like [Eucalyptus grandis]
 gb|AGK28203.1| C2H2-type zinc finger protein 5 [Eucalyptus grandis]
Length=172

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 52/85 (61%), Gaps = 12/85 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            + CKTCNR+F SFQALGGHRASH KPKLI  D      L H  H  +          K K
Sbjct  43   FACKTCNREFSSFQALGGHRASHKKPKLISGD------LFHLGHAAD------SSQAKPK  90

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  91   KHECSICGLDFPIGQALGGHMRRHR  115



>ref|NP_196059.1| C2H2-type zinc finger protein [Arabidopsis thaliana]
 gb|AAO41934.1| putative zinc finger transcription factor [Arabidopsis thaliana]
 gb|AAO50564.1| putative zinc finger transcription factor [Arabidopsis thaliana]
 gb|AED90737.1| C2H2-type zinc finger protein [Arabidopsis thaliana]
Length=362

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 60/103 (58%), Gaps = 21/103 (20%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKL------------------IPEDHKKSTPLDHH  138
            Y+CKTC+R F SFQALGGHRASH KPK                   +   H  +T   ++
Sbjct  153  YQCKTCDRTFPSFQALGGHRASHKKPKAASFYSNLDLKKNTYANDAVSLVHTTTTVFKNN  212

Query  137  HHHQEIQDKTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
            +    +    + K++K K+HEC ICG+ F SGQALGGHMRRHR
Sbjct  213  NSRSLV---VYGKASKNKVHECGICGAEFTSGQALGGHMRRHR  252



>dbj|BAA21920.1| ZPT2-11 [Petunia x hybrida]
Length=282

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 63/116 (54%), Gaps = 33/116 (28%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPE-DHKKSTPLDHHHHHQEIQDKTHEKSNKT  87
            Y+CKTCNR F SFQALGGHRASH KPKL    + K S P++H     E   K++E    T
Sbjct  105  YQCKTCNRCFPSFQALGGHRASHKKPKLPTNLEEKNSKPIEH----VENCSKSNEDHVTT  160

Query  86   ----------------------------KIHECLICGSLFFSGQALGGHMRRHRPL  3
                                        ++HEC ICG+ F SGQALGGHMRRHRPL
Sbjct  161  LSLQISNNNINNNNSNNNNNNNIIKNKNRVHECSICGAEFTSGQALGGHMRRHRPL  216



>ref|XP_008385163.1| PREDICTED: zinc finger protein ZAT12-like [Malus domestica]
Length=171

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 51/85 (60%), Gaps = 10/85 (12%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            + CKTCNR+F SFQALGGHRASH KPKL+P         D  H  Q           K K
Sbjct  39   FVCKTCNREFPSFQALGGHRASHKKPKLMPGGAA-----DLLHLAQSPGSPV-----KPK  88

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  89   THECPICGLEFAIGQALGGHMRRHR  113



>ref|NP_001236732.1| uncharacterized protein LOC100500607 [Glycine max]
 gb|ACU15733.1| unknown [Glycine max]
Length=155

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 55/85 (65%), Gaps = 13/85 (15%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTC+RKF SFQALGGHRASH + KL  E+ K+             Q KT    NK +
Sbjct  44   FECKTCSRKFSSFQALGGHRASHKRQKLEGEELKE-------------QAKTLSLWNKPQ  90

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +HEC ICG  F  GQALGGHMR+HR
Sbjct  91   MHECSICGLEFSLGQALGGHMRKHR  115



>ref|XP_010553303.1| PREDICTED: zinc finger protein ZAT11-like [Tarenaya hassleriana]
Length=175

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 54/87 (62%), Gaps = 18/87 (21%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCN++F SFQALGGHRASH KPKL+ E           H++    DKT        
Sbjct  46   FECKTCNKRFSSFQALGGHRASHKKPKLVGEP---------KHNNGADNDKT--------  88

Query  83   IHECLICGSLFFSGQALGGHMRRHRPL  3
             HEC IC   F SGQALGGHMRRHR +
Sbjct  89   -HECSICRQSFGSGQALGGHMRRHRAV  114



>gb|KCW87459.1| hypothetical protein EUGRSUZ_B03929 [Eucalyptus grandis]
Length=343

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 58/105 (55%), Gaps = 20/105 (19%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQD----------  114
            YECKTC+R F SFQALGGHRASH KPK   +  +K  P         I D          
Sbjct  158  YECKTCSRVFPSFQALGGHRASHKKPKSTADPDQKIKPSTVVLGLDAIDDEDEGHSGKIS  217

Query  113  ----------KTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
                      K   +++K KIHEC ICGS F SGQALGGHMRRHR
Sbjct  218  PPLSAHVASHKGLHQASKPKIHECNICGSEFASGQALGGHMRRHR  262



>ref|XP_008385161.1| PREDICTED: zinc finger protein ZAT12-like [Malus domestica]
Length=171

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 51/85 (60%), Gaps = 10/85 (12%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            + CKTCNR+F SFQALGGHRASH KPKL+P         D  H  Q           K K
Sbjct  39   FVCKTCNREFPSFQALGGHRASHKKPKLMPGGAA-----DLLHLAQSPGSPV-----KPK  88

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  89   THECPICGLEFAIGQALGGHMRRHR  113



>gb|ADL36628.1| C2H2L domain class transcription factor [Malus domestica]
Length=171

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 51/85 (60%), Gaps = 10/85 (12%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            + CKTCNR+F SFQALGGHRASH KPKL+P         D  H  Q           K K
Sbjct  39   FVCKTCNREFPSFQALGGHRASHKKPKLMPGGAA-----DLLHLAQSPGSPV-----KPK  88

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  89   THECPICGLEFAIGQALGGHMRRHR  113



>ref|XP_006487999.1| PREDICTED: zinc finger protein ZAT5-like [Citrus sinensis]
Length=319

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 61/119 (51%), Gaps = 34/119 (29%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPK-------------------LIP--EDHKKSTPL  147
            YECKTCNR F SFQALGGHRASH KPK                   ++P   ++K S   
Sbjct  133  YECKTCNRSFPSFQALGGHRASHKKPKAALAEAPEKKSSASVPALAVMPTKNEYKDSYSS  192

Query  146  DHHHHHQEIQDKTHEKSNK-------------TKIHECLICGSLFFSGQALGGHMRRHR  9
             HHH    +Q  +   +                KIHEC ICGS F SGQALGGHMRRHR
Sbjct  193  LHHHDQSHMQAASAAAAAANNNNTNNNNNKGGNKIHECSICGSEFTSGQALGGHMRRHR  251



>gb|KHN33407.1| Zinc finger protein ZAT12 [Glycine soja]
Length=174

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 57/85 (67%), Gaps = 11/85 (13%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            ++CKTCNR+F SFQALGGHRASH KPKL+  D            HQE+ + T ++  + +
Sbjct  40   FKCKTCNRRFSSFQALGGHRASHKKPKLMVTD---------LSCHQELPNPTMKQ--QPR  88

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +H C ICG  F  GQALGGHMR+HR
Sbjct  89   MHPCPICGLEFAIGQALGGHMRKHR  113



>ref|XP_009757271.1| PREDICTED: zinc finger protein ZAT11-like [Nicotiana sylvestris]
Length=168

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 55/87 (63%), Gaps = 15/87 (17%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KP+L+ E       L++H        +      K K
Sbjct  46   FECKTCNRQFSSFQALGGHRASHKKPRLMGE-------LNYH--------QLPTSPPKPK  90

Query  83   IHECLICGSLFFSGQALGGHMRRHRPL  3
             HEC ICG  F  GQALGGHMRRHR +
Sbjct  91   THECSICGLEFPIGQALGGHMRRHRAI  117



>ref|XP_009593204.1| PREDICTED: zinc finger protein ZAT11-like [Nicotiana tomentosiformis]
Length=168

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 54/87 (62%), Gaps = 15/87 (17%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KP+L+ E       L+ H        +      K K
Sbjct  47   FECKTCNRQFSSFQALGGHRASHKKPRLMGE-------LNFH--------QLSTSPPKPK  91

Query  83   IHECLICGSLFFSGQALGGHMRRHRPL  3
             HEC ICG  F  GQALGGHMRRHR +
Sbjct  92   THECSICGVEFPIGQALGGHMRRHRAI  118



>ref|XP_010043581.1| PREDICTED: zinc finger protein ZAT8-like [Eucalyptus grandis]
Length=175

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 52/85 (61%), Gaps = 12/85 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            + CKTCNR+F SFQALGGH+ASH KPKLI  D      L H  H  +          K K
Sbjct  46   FACKTCNREFSSFQALGGHKASHKKPKLISGD------LFHLGHAAD------SSPAKPK  93

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  94   THECSICGLDFPMGQALGGHMRRHR  118



>ref|NP_001049734.1| Os03g0279700 [Oryza sativa Japonica Group]
 gb|ABF95297.1| zinc finger DNA-binding protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11648.1| Os03g0279700 [Oryza sativa Japonica Group]
 gb|EAY89482.1| hypothetical protein OsI_11011 [Oryza sativa Indica Group]
 dbj|BAG99219.1| unnamed protein product [Oryza sativa Japonica Group]
Length=191

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 49/85 (58%), Gaps = 18/85 (21%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KP+L   D     P                   K K
Sbjct  51   FECKTCNRQFPSFQALGGHRASHKKPRLADGDPAAEAP------------------AKPK  92

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +H C ICG  F  GQALGGHMRRHR
Sbjct  93   VHGCSICGLEFAVGQALGGHMRRHR  117



>ref|XP_011091501.1| PREDICTED: zinc finger protein ZAT12-like [Sesamum indicum]
Length=174

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 50/85 (59%), Gaps = 15/85 (18%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            + CKTCNR+F SFQALGGHRASH KP+L+  D     PL                  K K
Sbjct  46   FTCKTCNRQFPSFQALGGHRASHKKPRLMAGDESLQRPL---------------SPPKPK  90

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  91   THECSICGLEFPIGQALGGHMRRHR  115



>gb|KCW85603.1| hypothetical protein EUGRSUZ_B02390, partial [Eucalyptus grandis]
Length=178

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 52/85 (61%), Gaps = 12/85 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            + CKTCNR+F SFQALGGH+ASH KPKLI  D      L H  H  +          K K
Sbjct  49   FACKTCNREFSSFQALGGHKASHKKPKLISGD------LFHLGHAAD------SSPAKPK  96

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  97   THECSICGLDFPMGQALGGHMRRHR  121



>gb|KDP29859.1| hypothetical protein JCGZ_18434 [Jatropha curcas]
Length=191

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 51/85 (60%), Gaps = 9/85 (11%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KP+L+  D               ++ KT        
Sbjct  48   FECKTCNRQFPSFQALGGHRASHKKPRLMGGDGSLENQTSSLSSSSPVKPKT--------  99

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  100  -HECSICGLEFAIGQALGGHMRRHR  123



>ref|XP_003621801.1| Zinc finger protein [Medicago truncatula]
 gb|AES78019.1| C2H2-type zinc finger protein [Medicago truncatula]
Length=184

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 54/85 (64%), Gaps = 15/85 (18%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KP+L+ E+      +D    H   + KT        
Sbjct  40   FECKTCNRQFPSFQALGGHRASHKKPRLMGEN------IDGQLLHTPPKPKT--------  85

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  86   -HECSICGLEFAIGQALGGHMRRHR  109



>ref|XP_009341517.1| PREDICTED: zinc finger protein ZAT11-like [Pyrus x bretschneideri]
 ref|XP_009374648.1| PREDICTED: zinc finger protein ZAT11-like [Pyrus x bretschneideri]
Length=185

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 54/85 (64%), Gaps = 4/85 (5%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNRKF SFQALGGHRASH + +       +    D  +  ++  DK    + K K
Sbjct  42   FECKTCNRKFASFQALGGHRASHKRLRTSTSHDDE----DRKNEPEKGSDKLMVTNKKAK  97

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICGS F  GQALGGHMRRH+
Sbjct  98   THECSICGSKFGMGQALGGHMRRHK  122



>gb|KDP30500.1| hypothetical protein JCGZ_16179 [Jatropha curcas]
Length=368

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 63/106 (59%), Gaps = 21/106 (20%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKST-----------------PLDHHH  135
            YECKTCNR F SFQALGGHRASH KPKL  E+ K+ T                  L  +H
Sbjct  170  YECKTCNRTFPSFQALGGHRASHKKPKLNIEEKKQFTLSSDEEEGHLNSSSLSLQLSSNH  229

Query  134  HHQEI----QDKTHEKSNKTKIHECLICGSLFFSGQALGGHMRRHR  9
            +H+ +        +   NK KIHEC ICG+ F SGQALGGHMRRHR
Sbjct  230  NHRGVIYSSSSSNNNHHNKNKIHECSICGAEFTSGQALGGHMRRHR  275



>ref|XP_009771157.1| PREDICTED: zinc finger protein ZAT11-like [Nicotiana sylvestris]
Length=177

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 55/87 (63%), Gaps = 12/87 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNRKF SFQALGGHRASH KP+LI         +   ++ Q  Q      + K K
Sbjct  55   FECKTCNRKFSSFQALGGHRASHKKPRLI--------NMRELNNMQLFQ----LPNIKPK  102

Query  83   IHECLICGSLFFSGQALGGHMRRHRPL  3
             HEC ICG  F  GQALGGHMRRHR +
Sbjct  103  THECSICGLEFGLGQALGGHMRRHRAV  129



>gb|EEE58806.1| hypothetical protein OsJ_10357 [Oryza sativa Japonica Group]
Length=191

 Score = 85.9 bits (211),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 49/85 (58%), Gaps = 18/85 (21%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KP+L   D     P                   K K
Sbjct  51   FECKTCNRQFPSFQALGGHRASHKKPRLANGDPAAEAP------------------AKPK  92

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +H C ICG  F  GQALGGHMRRHR
Sbjct  93   VHGCSICGLEFAVGQALGGHMRRHR  117



>ref|XP_004148235.1| PREDICTED: zinc finger protein ZAT11-like [Cucumis sativus]
 gb|KGN47359.1| hypothetical protein Csa_6G303740 [Cucumis sativus]
Length=139

 Score = 84.7 bits (208),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 49/85 (58%), Gaps = 16/85 (19%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            + CKTCNR+F SFQALGGHRASH KPKL                        +   NKTK
Sbjct  14   FVCKTCNREFSSFQALGGHRASHRKPKL----------------SMSGDALCNSNQNKTK  57

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  58   AHECSICGVEFPVGQALGGHMRRHR  82



>emb|CDX93380.1| BnaC04g45160D [Brassica napus]
Length=179

 Score = 85.9 bits (211),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 54/85 (64%), Gaps = 15/85 (18%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCN++F SFQALGGHRASH KPKL  +              Q++  K +     T+
Sbjct  48   FECKTCNKRFSSFQALGGHRASHKKPKLTVD--------------QKVV-KQYLTKEGTQ  92

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F +GQALGGHMRRHR
Sbjct  93   AHECTICGKSFGTGQALGGHMRRHR  117



>gb|KCW85608.1| hypothetical protein EUGRSUZ_B02395, partial [Eucalyptus grandis]
Length=194

 Score = 85.9 bits (211),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 52/85 (61%), Gaps = 12/85 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            + CKTCNR+F SFQALGGHRASH KPKLI  D      L H  H  +          K K
Sbjct  65   FACKTCNREFSSFQALGGHRASHKKPKLISGD------LFHLGHAAD------SSQAKPK  112

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
             HEC ICG  F  GQALGGHMRRHR
Sbjct  113  KHECSICGLDFPIGQALGGHMRRHR  137



>ref|XP_007162678.1| hypothetical protein PHAVU_001G170800g [Phaseolus vulgaris]
 gb|ESW34672.1| hypothetical protein PHAVU_001G170800g [Phaseolus vulgaris]
Length=217

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 55/85 (65%), Gaps = 13/85 (15%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNRKF SFQALGGHRASH K K+  E+ K+             Q K+    +K K
Sbjct  106  FECKTCNRKFSSFQALGGHRASHKKQKVEGEELKE-------------QGKSLSLWSKPK  152

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +HEC ICG  F  GQALGGHMR+HR
Sbjct  153  MHECSICGQEFSLGQALGGHMRKHR  177



>ref|XP_009382162.1| PREDICTED: zinc finger protein ZAT5-like [Musa acuminata subsp. 
malaccensis]
Length=287

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 57/96 (59%), Gaps = 9/96 (9%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKL-----IPEDHKKSTPLDHHHHHQEIQDKTHEK  99
            YECKTC++ F SFQALGGHR SH K KL       E+ K     D          K    
Sbjct  130  YECKTCSKCFPSFQALGGHRTSHKKHKLAATTTTAEEKKLEVTDDMLQISMNSFSKPFAS  189

Query  98   SNKT----KIHECLICGSLFFSGQALGGHMRRHRPL  3
            S++T    K+HEC ICGS F SGQALGGHMRRHRPL
Sbjct  190  SSQTPTKPKVHECSICGSEFSSGQALGGHMRRHRPL  225



>gb|AFK36078.1| unknown [Medicago truncatula]
Length=165

 Score = 85.5 bits (210),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 54/87 (62%), Gaps = 12/87 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            YECKTCN+KF SFQALGGHRASH + KL   +  K             + K+    NK K
Sbjct  34   YECKTCNKKFSSFQALGGHRASHKRMKLAEGEELKE------------RAKSLSLWNKPK  81

Query  83   IHECLICGSLFFSGQALGGHMRRHRPL  3
            +HEC ICG  F  GQALGGHMR+HR +
Sbjct  82   MHECSICGMGFSLGQALGGHMRKHRAV  108



>ref|XP_008376265.1| PREDICTED: zinc finger protein ZAT5-like [Malus domestica]
Length=366

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 61/114 (54%), Gaps = 29/114 (25%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKL-IPEDHKKS-------TPLDHHHHHQEIQDKT  108
            YECKTCNR F SFQALGGHRASH K K  I +DHK          P D     Q ++D  
Sbjct  155  YECKTCNRTFPSFQALGGHRASHKKLKANIGDDHKNKHLGIGXLPPSDEDQDTQSLKDNI  214

Query  107  HE-------------------KSNKT--KIHECLICGSLFFSGQALGGHMRRHR  9
                                  SNK+  KIHEC ICG+ F SGQALGGHMRRHR
Sbjct  215  FHINTSSSPLSLHLSNRGLVLSSNKSSPKIHECSICGAEFTSGQALGGHMRRHR  268



>gb|KHN02412.1| Zinc finger protein ZAT11-like protein [Glycine soja]
Length=171

 Score = 85.5 bits (210),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 55/85 (65%), Gaps = 12/85 (14%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNRKF SFQALGGHRASH + KL   DH+    L  H     +       +NK K
Sbjct  41   FECKTCNRKFSSFQALGGHRASHKRSKL-EGDHE----LKAHAISLSL-------ANKPK  88

Query  83   IHECLICGSLFFSGQALGGHMRRHR  9
            +HEC ICG  F  GQALGGHMRRHR
Sbjct  89   MHECSICGQEFSLGQALGGHMRRHR  113



>gb|EYU37028.1| hypothetical protein MIMGU_mgv1a021331mg [Erythranthe guttata]
Length=267

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 54/90 (60%), Gaps = 5/90 (6%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPK----LIPEDHKKSTPLDHHHHHQEIQDKTHEKS  96
            YECKTC+R F SFQALGGHRASH KPK        D K+  P       Q  +      S
Sbjct  112  YECKTCSRTFPSFQALGGHRASHKKPKPSAAAADVDRKRPPPPAAAPIDQTAEYAPAAPS  171

Query  95   NK-TKIHECLICGSLFFSGQALGGHMRRHR  9
             +  K HEC ICGS F SGQALGGHMRRHR
Sbjct  172  TQFPKTHECSICGSEFASGQALGGHMRRHR  201



>ref|XP_008369844.1| PREDICTED: zinc finger protein ZAT11-like [Malus domestica]
 ref|XP_008345441.1| PREDICTED: zinc finger protein ZAT11-like [Malus domestica]
Length=185

 Score = 85.5 bits (210),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 55/86 (64%), Gaps = 4/86 (5%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNRKF SFQALGGH+ASH + +++     +    +     ++  DK+   + K K
Sbjct  42   FECKTCNRKFTSFQALGGHKASHKRSRILMSRDDE----BCKDEREKGSDKSMVMNKKAK  97

Query  83   IHECLICGSLFFSGQALGGHMRRHRP  6
             H+C ICG  F  GQALGGHMRRHR 
Sbjct  98   THKCSICGLEFGMGQALGGHMRRHRA  123



>ref|XP_002528469.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF33952.1| nucleic acid binding protein, putative [Ricinus communis]
Length=190

 Score = 85.9 bits (211),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 51/87 (59%), Gaps = 14/87 (16%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIPEDHKKSTPLDHHHHHQEIQDKTHEKSNKTK  84
            +ECKTCNR+F SFQALGGHRASH KP+L   D                  +T     K K
Sbjct  49   FECKTCNRQFPSFQALGGHRASHKKPRLTNGDVGSL--------------ETQSSPAKPK  94

Query  83   IHECLICGSLFFSGQALGGHMRRHRPL  3
             HEC ICG  F  GQALGGHMRRHR +
Sbjct  95   THECSICGLEFAIGQALGGHMRRHRAI  121



>dbj|BAA19111.1| PEThy;ZPT2-6 [Petunia x hybrida]
Length=341

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 58/103 (56%), Gaps = 18/103 (17%)
 Frame = -2

Query  263  YECKTCNRKFRSFQALGGHRASHSKPKLIP---------------EDHKKSTPLDHHHHH  129
            YECKTCNR F SFQALGGHRASH KPK +                ED + S        +
Sbjct  161  YECKTCNRTFPSFQALGGHRASHKKPKTLTTELVNNKKLYFDFSDEDDQPSPSTTLCKTN  220

Query  128  QEIQDKTHEKSNK---TKIHECLICGSLFFSGQALGGHMRRHR  9
            +++       SNK    +IHEC  CG+ F SGQALGGHMRRHR
Sbjct  221  KDVNRILPNSSNKYTSPRIHECSYCGAEFTSGQALGGHMRRHR  263



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506643158204