BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c12026_g1_i1 len=743 path=[759:0-614 20:615-742]

Length=743
                                                                      Score     E

gb|ACU17345.1|  unknown                                               87.0    2e-18   Glycine max [soybeans]
ref|XP_010243441.1|  PREDICTED: serine/threonine-protein phosphat...  90.1    2e-18   
ref|XP_004494304.1|  PREDICTED: serine/threonine-protein phosphat...  89.7    1e-17   
gb|AID52922.1|  serine/threonine-protein phosphatase PP2A catalyt...  89.7    1e-17   
gb|KHG25216.1|  Serine/threonine-protein phosphatase PP2A catalyt...  87.0    2e-17   
ref|XP_009782045.1|  PREDICTED: serine/threonine-protein phosphat...  89.0    2e-17   
ref|XP_009620868.1|  PREDICTED: serine/threonine-protein phosphat...  89.0    2e-17   
sp|O04860.1|PP2A5_TOBAC  RecName: Full=Serine/threonine-protein p...  89.0    2e-17   Nicotiana tabacum [American tobacco]
ref|XP_004229332.1|  PREDICTED: serine/threonine-protein phosphat...  88.6    2e-17   
gb|KDP21900.1|  hypothetical protein JCGZ_03038                       88.6    3e-17   
ref|XP_002309283.1|  hypothetical protein POPTR_0006s21080g           88.6    3e-17   Populus trichocarpa [western balsam poplar]
ref|XP_008796687.1|  PREDICTED: serine/threonine-protein phosphat...  88.6    3e-17   
ref|XP_002527066.1|  protein phsophatase-2a, putative                 88.2    3e-17   Ricinus communis
ref|XP_010923348.1|  PREDICTED: serine/threonine-protein phosphat...  88.2    3e-17   
dbj|BAA92699.1|  type 2A protein phosphatase-3                        88.2    3e-17   Vicia faba [broad bean]
ref|XP_003629703.1|  Serine/threonine protein phosphatase             88.2    3e-17   
ref|XP_002304866.1|  type 2A protein phosphatase-3                    88.2    3e-17   Populus trichocarpa [western balsam poplar]
ref|XP_003638109.1|  Serine/threonine protein phosphatase             88.2    3e-17   
ref|XP_002299121.1|  type 2A protein phosphatase-3                    88.2    3e-17   Populus trichocarpa [western balsam poplar]
ref|XP_011048241.1|  PREDICTED: serine/threonine-protein phosphat...  88.2    3e-17   
ref|XP_011025169.1|  PREDICTED: serine/threonine-protein phosphat...  88.2    3e-17   
ref|XP_008796690.1|  PREDICTED: serine/threonine-protein phosphat...  88.2    3e-17   
ref|XP_008796691.1|  PREDICTED: serine/threonine-protein phosphat...  87.8    3e-17   
ref|XP_002270378.1|  PREDICTED: serine/threonine-protein phosphat...  88.2    3e-17   Vitis vinifera
ref|XP_004294990.1|  PREDICTED: serine/threonine-protein phosphat...  88.2    3e-17   
gb|AET04180.2|  serine/threonine protein phosphatase 2A               88.2    3e-17   
ref|XP_004504333.1|  PREDICTED: serine/threonine-protein phosphat...  88.2    3e-17   
ref|XP_003554484.1|  PREDICTED: serine/threonine-protein phosphat...  88.2    3e-17   
ref|XP_006842771.1|  hypothetical protein AMTR_s00133p00104740        88.2    4e-17   
ref|XP_009397685.1|  PREDICTED: serine/threonine-protein phosphat...  88.2    4e-17   
ref|XP_008351677.1|  PREDICTED: serine/threonine-protein phosphat...  88.2    4e-17   
ref|XP_007163032.1|  hypothetical protein PHAVU_001G200300g           88.2    4e-17   
emb|CBI32153.3|  unnamed protein product                              88.2    4e-17   
ref|XP_003521515.1|  PREDICTED: serine/threonine-protein phosphat...  88.2    4e-17   
ref|XP_006445820.1|  hypothetical protein CICLE_v10015516mg           88.2    4e-17   
ref|XP_003524949.1|  PREDICTED: serine/threonine-protein phosphat...  88.2    4e-17   
ref|XP_003629704.1|  Serine/threonine protein phosphatase             88.2    4e-17   
ref|XP_010934485.1|  PREDICTED: serine/threonine-protein phosphat...  88.2    4e-17   
ref|XP_010923345.1|  PREDICTED: serine/threonine-protein phosphat...  88.2    4e-17   
gb|KDP26943.1|  hypothetical protein JCGZ_21036                       88.2    4e-17   
ref|XP_007159403.1|  hypothetical protein PHAVU_002G235400g           88.2    4e-17   
gb|AFK46352.1|  unknown                                               88.2    4e-17   
emb|CDP17353.1|  unnamed protein product                              88.2    4e-17   
gb|KDO63013.1|  hypothetical protein CISIN_1g016098mg                 87.8    4e-17   
ref|XP_009398410.1|  PREDICTED: serine/threonine-protein phosphat...  88.2    4e-17   
ref|XP_010257587.1|  PREDICTED: serine/threonine-protein phosphat...  88.2    4e-17   
ref|XP_010934493.1|  PREDICTED: serine/threonine-protein phosphat...  87.8    4e-17   
ref|XP_002285694.1|  PREDICTED: serine/threonine-protein phosphat...  88.2    4e-17   Vitis vinifera
ref|XP_010673507.1|  PREDICTED: serine/threonine-protein phosphat...  88.2    4e-17   
gb|KHG30742.1|  Serine/threonine-protein phosphatase PP2A-4 catal...  88.6    4e-17   
ref|XP_008798733.1|  PREDICTED: serine/threonine-protein phosphat...  88.2    4e-17   
ref|XP_010907340.1|  PREDICTED: serine/threonine-protein phosphat...  87.8    4e-17   
ref|XP_007205603.1|  hypothetical protein PRUPE_ppa009000mg           87.8    4e-17   
ref|XP_010907341.1|  PREDICTED: serine/threonine-protein phosphat...  87.8    5e-17   
ref|XP_008798734.1|  PREDICTED: serine/threonine-protein phosphat...  87.4    5e-17   
ref|XP_008241160.1|  PREDICTED: serine/threonine-protein phosphat...  85.9    6e-17   
ref|XP_007145716.1|  hypothetical protein PHAVU_007G262200g           86.3    8e-17   
ref|XP_010524038.1|  PREDICTED: serine/threonine-protein phosphat...  87.0    8e-17   
emb|CDP07661.1|  unnamed protein product                              87.0    9e-17   
ref|XP_011093402.1|  PREDICTED: serine/threonine-protein phosphat...  87.0    9e-17   
ref|XP_010550105.1|  PREDICTED: serine/threonine-protein phosphat...  87.0    9e-17   
ref|XP_010524846.1|  PREDICTED: serine/threonine-protein phosphat...  86.7    1e-16   
ref|XP_006587188.1|  PREDICTED: serine/threonine-protein phosphat...  86.7    1e-16   
ref|XP_010550187.1|  PREDICTED: serine/threonine-protein phosphat...  86.7    1e-16   
ref|XP_010101131.1|  Serine/threonine-protein phosphatase PP2A-4 ...  89.7    1e-16   
ref|XP_004303366.1|  PREDICTED: serine/threonine-protein phosphat...  86.7    1e-16   
ref|XP_006587189.1|  PREDICTED: serine/threonine-protein phosphat...  85.9    1e-16   
ref|XP_008387207.1|  PREDICTED: serine/threonine-protein phosphat...  86.7    1e-16   
ref|XP_006354151.1|  PREDICTED: serine/threonine-protein phosphat...  86.7    1e-16   
ref|XP_004228641.1|  PREDICTED: serine/threonine-protein phosphat...  86.7    1e-16   
ref|XP_007145715.1|  hypothetical protein PHAVU_007G262200g           86.7    1e-16   
ref|XP_002322743.1|  hypothetical protein POPTR_0016s06190g           86.7    1e-16   Populus trichocarpa [western balsam poplar]
ref|XP_008370945.1|  PREDICTED: serine/threonine-protein phosphat...  86.7    1e-16   
ref|XP_009757229.1|  PREDICTED: serine/threonine-protein phosphat...  86.7    1e-16   
gb|ACN30926.1|  unknown                                               85.5    1e-16   Zea mays [maize]
ref|XP_003533904.1|  PREDICTED: serine/threonine-protein phosphat...  86.7    1e-16   
gb|ACU23691.1|  unknown                                               86.7    1e-16   Glycine max [soybeans]
ref|XP_007202275.1|  hypothetical protein PRUPE_ppa008946mg           86.7    1e-16   
ref|XP_009603918.1|  PREDICTED: serine/threonine-protein phosphat...  86.3    1e-16   
ref|XP_008241162.1|  PREDICTED: serine/threonine-protein phosphat...  86.3    1e-16   
ref|XP_004168224.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...  86.3    2e-16   
ref|XP_008449804.1|  PREDICTED: serine/threonine-protein phosphat...  86.3    2e-16   
ref|XP_004142163.1|  PREDICTED: serine/threonine-protein phosphat...  86.3    2e-16   
ref|XP_008789091.1|  PREDICTED: serine/threonine-protein phosphat...  86.3    2e-16   
ref|XP_004144671.1|  PREDICTED: serine/threonine-protein phosphat...  86.3    2e-16   
ref|XP_008813488.1|  PREDICTED: serine/threonine-protein phosphat...  85.5    2e-16   
emb|CDX67746.1|  BnaA07g17860D                                        84.7    2e-16   
ref|XP_008813485.1|  PREDICTED: serine/threonine-protein phosphat...  85.9    3e-16   
ref|XP_008813486.1|  PREDICTED: serine/threonine-protein phosphat...  85.5    3e-16   
ref|NP_001149212.1|  PP2Ac-5 - Phosphatase 2A isoform 5 belonging...  85.5    3e-16   Zea mays [maize]
ref|XP_006429940.1|  hypothetical protein CICLE_v10012259mg           84.7    3e-16   
ref|XP_002531165.1|  protein phsophatase-2a, putative                 85.1    4e-16   Ricinus communis
gb|KCW52393.1|  hypothetical protein EUGRSUZ_J01802                   85.1    4e-16   
ref|NP_973672.1|  serine/threonine-protein phosphatase PP2A-3 cat...  84.7    4e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010032900.1|  PREDICTED: serine/threonine-protein phosphat...  85.1    4e-16   
gb|ACF83060.1|  unknown                                               84.3    4e-16   Zea mays [maize]
ref|XP_008442200.1|  PREDICTED: serine/threonine-protein phosphat...  85.1    4e-16   
ref|XP_010044955.1|  PREDICTED: serine/threonine-protein phosphat...  85.1    4e-16   
gb|KCW87087.1|  hypothetical protein EUGRSUZ_B03620                   84.7    4e-16   
ref|XP_006429942.1|  hypothetical protein CICLE_v10012259mg           85.1    5e-16   
ref|XP_006429941.1|  hypothetical protein CICLE_v10012259mg           84.7    5e-16   
sp|P0C5D7.1|PP2A4_ORYSI  RecName: Full=Putative serine/threonine-...  84.7    5e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_002467261.1|  hypothetical protein SORBIDRAFT_01g022230        84.7    5e-16   Sorghum bicolor [broomcorn]
ref|NP_001150190.1|  PP2Ac-4 - Phosphatase 2A isoform 4 belonging...  84.7    5e-16   Zea mays [maize]
ref|XP_009142847.1|  PREDICTED: serine/threonine-protein phosphat...  84.7    5e-16   
ref|NP_001064578.1|  Os10g0410600                                     84.7    5e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010506078.1|  PREDICTED: serine/threonine-protein phosphat...  84.7    5e-16   
ref|XP_006411507.1|  hypothetical protein EUTSA_v10016971mg           84.7    5e-16   
ref|NP_565974.1|  serine/threonine-protein phosphatase PP2A-3 cat...  84.7    5e-16   Arabidopsis thaliana [mouse-ear cress]
gb|ACT53402.1|  protein phosphatase 2Ac                               84.7    5e-16   Brassica juncea [brown mustard]
ref|XP_006661767.1|  PREDICTED: serine/threonine-protein phosphat...  84.7    5e-16   
gb|KDO70818.1|  hypothetical protein CISIN_1g021077mg                 84.7    6e-16   
ref|XP_009104146.1|  PREDICTED: serine/threonine-protein phosphat...  84.7    6e-16   
gb|KDO70820.1|  hypothetical protein CISIN_1g021077mg                 84.7    6e-16   
gb|KFK35108.1|  hypothetical protein AALP_AA5G237100                  84.7    6e-16   
ref|XP_006402781.1|  hypothetical protein EUTSA_v10006109mg           84.7    6e-16   
ref|XP_004983161.1|  PREDICTED: putative serine/threonine-protein...  84.7    6e-16   
ref|XP_009104147.1|  PREDICTED: serine/threonine-protein phosphat...  84.3    6e-16   
sp|P23778.2|PP2A_BRANA  RecName: Full=Serine/threonine-protein ph...  84.7    6e-16   Brassica napus [oilseed rape]
emb|CDY00569.1|  BnaC04g23560D                                        84.7    6e-16   
ref|XP_009138958.1|  PREDICTED: serine/threonine-protein phosphat...  84.7    6e-16   
ref|NP_567066.1|  serine/threonine-protein phosphatase PP2A-3 cat...  84.7    6e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007029090.1|  Phosphatase 2A-4                                 84.7    6e-16   
prf||1702228B  protein phosphatase 2A                                 84.7    6e-16
tpg|DAA52017.1|  TPA: putative serine/threonine protein phosphata...  84.0    6e-16   
gb|ABK24697.1|  unknown                                               84.7    6e-16   Picea sitchensis
ref|XP_010516502.1|  PREDICTED: serine/threonine-protein phosphat...  84.3    6e-16   
gb|KHN00026.1|  Serine/threonine-protein phosphatase PP2A-3 catal...  84.3    7e-16   
ref|XP_003519014.1|  PREDICTED: serine/threonine-protein phosphat...  84.3    7e-16   
ref|XP_006575178.1|  PREDICTED: serine/threonine-protein phosphat...  84.0    7e-16   
ref|XP_011089122.1|  PREDICTED: serine/threonine-protein phosphat...  84.3    7e-16   
emb|CAA07471.1|  PP2A1 protein                                        84.3    7e-16   Catharanthus roseus [chatas]
gb|AAF86353.1|AF283668_1  serine/threonine protein phosphatase PP...  84.3    7e-16   Oryza sativa Indica Group [Indian rice]
gb|ABO16371.1|  serine/threonine-protein phosphatase PP2A-1 catal...  84.3    8e-16   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001049084.1|  Os03g0167700                                     84.3    8e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011039507.1|  PREDICTED: serine/threonine-protein phosphat...  83.6    8e-16   
gb|AAL84295.1|AC073556_12  serine/threonine protein phosphatase P...  84.3    8e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011086859.1|  PREDICTED: serine/threonine-protein phosphat...  84.3    9e-16   
ref|XP_010036522.1|  PREDICTED: serine/threonine-protein phosphat...  84.3    9e-16   
ref|NP_001130096.1|  uncharacterized protein LOC100191189             84.3    9e-16   Zea mays [maize]
ref|XP_011087915.1|  PREDICTED: serine/threonine-protein phosphat...  84.3    9e-16   
ref|XP_006649459.1|  PREDICTED: serine/threonine-protein phosphat...  84.0    9e-16   
ref|XP_003558732.1|  PREDICTED: serine/threonine-protein phosphat...  84.0    9e-16   
gb|EYU27166.1|  hypothetical protein MIMGU_mgv1a010409mg              84.0    9e-16   
ref|XP_004985576.1|  PREDICTED: serine/threonine-protein phosphat...  84.0    9e-16   
gb|ACG34764.1|  PP2Ac-5 - Phosphatase 2A isoform 5 belonging to f...  84.0    1e-15   Zea mays [maize]
gb|EYU42248.1|  hypothetical protein MIMGU_mgv1a023841mg              84.0    1e-15   
gb|EPS68420.1|  serine/threonine-protein phosphatase                  84.0    1e-15   
ref|XP_002465801.1|  hypothetical protein SORBIDRAFT_01g046020        84.0    1e-15   Sorghum bicolor [broomcorn]
gb|EEE58392.1|  hypothetical protein OsJ_09554                        85.1    1e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010238310.1|  PREDICTED: serine/threonine-protein phosphat...  83.6    1e-15   
gb|EMS59473.1|  Serine/threonine-protein phosphatase PP2A-2 catal...  84.0    1e-15   
ref|NP_001148686.1|  LOC100282302                                     83.6    1e-15   Zea mays [maize]
ref|NP_001167654.1|  putative serine/threonine protein phosphatas...  83.6    1e-15   Zea mays [maize]
gb|ACG38746.1|  PP2Ac-2 - Phosphatase 2A isoform 2 belonging to f...  83.6    1e-15   Zea mays [maize]
dbj|BAJ93161.1|  predicted protein                                    83.6    1e-15   
ref|XP_003564197.1|  PREDICTED: serine/threonine-protein phosphat...  83.6    1e-15   
emb|CDY66916.1|  BnaC03g72670D                                        83.6    1e-15   
ref|XP_003578345.1|  PREDICTED: serine/threonine-protein phosphat...  83.6    1e-15   
gb|ACO57639.1|  protein phosphatase 2A catalytic subunit              83.6    1e-15   Castanea mollissima
emb|CDY69521.1|  BnaCnng63970D                                        83.6    1e-15   
ref|NP_001051627.1|  Os03g0805300                                     83.6    1e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004981369.1|  PREDICTED: serine/threonine-protein phosphat...  83.6    2e-15   
ref|XP_009133540.1|  PREDICTED: serine/threonine-protein phosphat...  83.6    2e-15   
ref|XP_006650755.1|  PREDICTED: serine/threonine-protein phosphat...  83.2    2e-15   
gb|EMT19169.1|  Serine/threonine-protein phosphatase PP2A-2 catal...  84.7    2e-15   
gb|AAM65153.1|  phosphoprotein phosphatase 2A isoform 4               83.2    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011039506.1|  PREDICTED: serine/threonine-protein phosphat...  83.2    2e-15   
emb|CDX98300.1|  BnaC06g16610D                                        83.2    2e-15   
ref|XP_009417153.1|  PREDICTED: serine/threonine-protein phosphat...  83.2    2e-15   
emb|CDY14840.1|  BnaC04g48370D                                        82.4    3e-15   
ref|XP_009142071.1|  PREDICTED: serine/threonine-protein phosphat...  82.4    3e-15   
gb|KHG13023.1|  Serine/threonine-protein phosphatase PP2A catalyt...  81.6    5e-15   
ref|XP_009389048.1|  PREDICTED: serine/threonine-protein phosphat...  81.6    6e-15   
ref|XP_002966246.1|  hypothetical protein SELMODRAFT_270568           81.6    6e-15   
ref|XP_001766048.1|  predicted protein                                81.6    7e-15   
ref|XP_004228954.1|  PREDICTED: serine/threonine-protein phosphat...  79.0    6e-14   
ref|XP_006364157.1|  PREDICTED: serine/threonine-protein phosphat...  79.0    6e-14   
ref|XP_009612069.1|  PREDICTED: serine/threonine-protein phosphat...  78.2    7e-14   
ref|XP_009612068.1|  PREDICTED: serine/threonine-protein phosphat...  77.4    2e-13   
ref|XP_001766933.1|  predicted protein                                76.3    6e-13   
ref|XP_004362124.1|  P-type ATPase                                    77.0    2e-12   
gb|KFM80898.1|  Serine/threonine-protein phosphatase 2A catalytic...  68.6    8e-12   
gb|AEB61183.1|  serine/threonine-protein phosphatase 2a catalytic...  68.9    1e-11   
ref|XP_635791.1|  protein phosphatase 2A catalytic subunit            72.0    2e-11   Dictyostelium discoideum AX4
ref|XP_003285474.1|  protein phosphatase 2A catalytic subunit         71.6    2e-11   
gb|ELK28881.1|  Testis-expressed sequence 15 protein                  73.2    3e-11   
gb|AEB61396.1|  serine/threonine-protein phosphatase 2a catalytic...  68.2    3e-11   
gb|EGW12684.1|  Serine/threonine-protein phosphatase 2A catalytic...  67.0    3e-11   
ref|XP_003375214.1|  serine/threonine-protein phosphatase 2A cata...  71.2    3e-11   
emb|CDQ73649.1|  unnamed protein product                              70.1    4e-11   
dbj|GAM22091.1|  hypothetical protein SAMD00019534_052660             70.9    4e-11   
dbj|GAM16955.1|  hypothetical protein SAMD00019534_001300             70.9    5e-11   
gb|EFA78478.1|  protein phosphatase 2A catalytic subunit              70.9    5e-11   Heterostelium album PN500
gb|ELV11295.1|  Serine/threonine-protein phosphatase 2A catalytic...  68.9    5e-11   
gb|ERE80011.1|  acyl-coenzyme A synthetase ACSM5                      72.0    5e-11   
gb|EFX62364.1|  hypothetical protein DAPPUDRAFT_68048                 68.9    6e-11   
ref|XP_008689826.1|  PREDICTED: cyclin-dependent kinase-like 3 is...  72.0    6e-11   
ref|XP_007053627.1|  PREDICTED: serine/threonine-protein phosphat...  71.6    7e-11   
ref|XP_002171875.1|  serine/threonine protein phosphatase Ppa2        70.5    7e-11   Schizosaccharomyces japonicus yFS275
gb|AEB61013.1|  serine/threonine-protein phosphatase 2a catalytic...  68.9    8e-11   
ref|XP_007177066.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    8e-11   
ref|XP_008573329.1|  PREDICTED: serine/threonine-protein phosphat...  69.7    8e-11   
ref|XP_002735017.1|  PREDICTED: serine/threonine-protein phosphat...  69.7    9e-11   Saccoglossus kowalevskii
gb|KFQ20777.1|  Serine/threonine-protein phosphatase 2A catalytic...  68.6    9e-11   
ref|XP_001107958.2|  PREDICTED: serine/threonine-protein phosphat...  68.9    9e-11   Macaca mulatta [rhesus macaque]
emb|CDQ79365.1|  unnamed protein product                              69.3    9e-11   
ref|XP_010177015.1|  PREDICTED: serine/threonine-protein phosphat...  68.6    9e-11   
ref|XP_005888741.1|  PREDICTED: serine/threonine-protein phosphat...  68.2    1e-10   
ref|XP_010590772.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    1e-10   
gb|KFO92257.1|  Serine/threonine-protein phosphatase 2A catalytic...  68.9    1e-10   
emb|CDW52230.1|  serine:threonine protein phosphatase 2A              69.7    1e-10   
ref|XP_004606933.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    1e-10   
ref|XP_007062900.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    1e-10   
gb|AEB61362.1|  serine/threonine-protein phosphatase 2a catalytic...  68.9    1e-10   
gb|AAH19161.1|  Ppp2cb protein                                        69.3    1e-10   Mus musculus [mouse]
ref|XP_010847636.1|  PREDICTED: serine/threonine-protein phosphat...  69.7    1e-10   
ref|XP_009933773.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    1e-10   
gb|KFM22989.1|  Serine/threonine-protein phosphatase PP2A-2 catal...  69.7    1e-10   
ref|XP_001602506.2|  PREDICTED: serine/threonine-protein phosphat...  69.7    1e-10   Nasonia vitripennis
gb|ELU08354.1|  hypothetical protein CAPTEDRAFT_227677                69.7    1e-10   
gb|EFN88778.1|  Serine/threonine-protein phosphatase 2A catalytic...  69.3    1e-10   
gb|ENN77718.1|  hypothetical protein YQE_05789                        69.7    1e-10   
gb|ABE98242.1|  protein phosphatase-2A catalytic subunit-like         69.7    1e-10   Oreochromis mossambicus [Hawaiian perch]
ref|XP_623105.1|  PREDICTED: serine/threonine-protein phosphatase...  69.3    1e-10   Apis mellifera [bee]
ref|XP_004342697.1|  serine/threonine-protein phosphatase 2A cata...  69.3    1e-10   
ref|XP_009872784.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    1e-10   
emb|CDQ82738.1|  unnamed protein product                              69.3    1e-10   
ref|XP_009065210.1|  hypothetical protein LOTGIDRAFT_184125           69.3    1e-10   
emb|CAG12590.1|  unnamed protein product                              69.3    1e-10   Tetraodon nigroviridis
ref|XP_002980611.1|  hypothetical protein SELMODRAFT_178363           69.3    1e-10   
gb|KFP22633.1|  Serine/threonine-protein phosphatase 2A catalytic...  68.9    1e-10   
gb|ERE68925.1|  serine/threonine-protein phosphatase 2A catalytic...  68.9    1e-10   
gb|EGI68551.1|  Serine/threonine-protein phosphatase 2A catalytic...  69.3    1e-10   
ref|XP_008934414.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    1e-10   
ref|XP_002976892.1|  hypothetical protein SELMODRAFT_175936           69.3    1e-10   
ref|XP_011049527.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...  69.3    1e-10   
ref|XP_005343168.1|  PREDICTED: LOW QUALITY PROTEIN: protein phos...  68.9    1e-10   
ref|XP_010887912.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    1e-10   
gb|KFP73348.1|  Serine/threonine-protein phosphatase 2A catalytic...  68.9    1e-10   
ref|XP_008553427.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    1e-10   
ref|XP_002426726.1|  serine/threonine-protein phosphatase PP-V, p...  69.3    1e-10   Pediculus humanus corporis [human body lice]
gb|KFP40133.1|  Serine/threonine-protein phosphatase 2A catalytic...  68.9    1e-10   
gb|ETE70021.1|  Serine/threonine-protein phosphatase 2A catalytic...  68.9    1e-10   
ref|XP_003133430.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_002197656.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   Taeniopygia guttata
ref|XP_009876544.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
gb|ACI67354.1|  Serine/threonine-protein phosphatase 2A catalytic...  69.3    2e-10   Salmo salar
gb|EKC38582.1|  Serine/threonine-protein phosphatase 2A catalytic...  69.3    2e-10   
gb|EHH28397.1|  Serine/threonine-protein phosphatase 2A catalytic...  68.9    2e-10   
gb|KDR18186.1|  Serine/threonine-protein phosphatase 2A catalytic...  69.3    2e-10   
ref|XP_003700689.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    2e-10   
ref|XP_009321052.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_006076268.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_005025183.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    2e-10   
ref|XP_005671871.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_005100173.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    2e-10   
ref|XP_009478963.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_010137872.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_006017289.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
gb|ACO10114.1|  Serine/threonine-protein phosphatase 2A catalytic...  69.3    2e-10   Osmerus mordax
ref|XP_002414442.1|  serine/threonine protein phosphatase, putative   69.3    2e-10   Ixodes scapularis [blacklegged tick]
ref|XP_009693656.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_009700571.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    2e-10   
ref|XP_004909053.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_005865687.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_003738416.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    2e-10   
ref|XP_010183573.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_005698868.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_010138515.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_009512018.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_005011292.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    2e-10   
ref|XP_010894313.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    2e-10   
ref|XP_010388984.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_010292596.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_010782932.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    2e-10   
ref|XP_003458480.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    2e-10   
ref|XP_973546.1|  PREDICTED: serine/threonine-protein phosphatase...  69.3    2e-10   Tribolium castaneum [rust-red flour beetle]
ref|XP_006076269.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_780423.1|  PREDICTED: serine/threonine-protein phosphatase...  69.3    2e-10   
ref|XP_003738415.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    2e-10   
ref|XP_010735992.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    2e-10   
ref|XP_003971026.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    2e-10   
ref|NP_001266615.1|  uncharacterized protein LOC100697538             69.3    2e-10   
emb|CDQ69726.1|  unnamed protein product                              68.9    2e-10   
ref|XP_001621859.1|  hypothetical protein NEMVEDRAFT_v1g195622        69.3    2e-10   
gb|AEB61404.1|  serine/threonine-protein phosphatase 2a catalytic...  68.9    2e-10   
ref|XP_008635649.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_007172205.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    2e-10   
ref|XP_010166303.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_004633404.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    2e-10   
gb|EGW07748.1|  Serine/threonine-protein phosphatase 2A catalytic...  68.9    2e-10   
ref|XP_008630888.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    2e-10   
gb|KFR11394.1|  Serine/threonine-protein phosphatase 2A catalytic...  68.6    2e-10   
ref|XP_009520636.1|  hypothetical protein PHYSODRAFT_297044           67.4    2e-10   
ref|XP_009909865.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_005864148.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_004666944.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_001744851.1|  hypothetical protein                             69.3    2e-10   
pdb|3FGA|C  Chain C, Structural Basis Of Pp2a And Sgo Interaction     69.3    2e-10   
ref|XP_007014731.1|  Phosphatase 2A-3                                 69.7    2e-10   
ref|XP_002193383.2|  PREDICTED: serine/threonine-protein phosphat...  68.6    2e-10   
ref|XP_004086485.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    2e-10   
ref|XP_004076109.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    2e-10   
ref|XP_003974579.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    2e-10   
gb|AAP36249.1|  Homo sapiens protein phosphatase 2 (formerly 2A),...  69.3    2e-10   
ref|XP_010753161.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    2e-10   
ref|XP_008303475.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    2e-10   
ref|XP_007577633.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    2e-10   
ref|XP_005435392.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_009968852.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
dbj|BAC41164.1|  unnamed protein product                              68.9    2e-10   
ref|XP_009077125.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_004008848.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_008334702.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    2e-10   
ref|XP_008325604.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    2e-10   
ref|NP_001167080.1|  Serine/threonine-protein phosphatase 2A cata...  69.3    2e-10   
gb|EPQ07376.1|  Serine/threonine-protein phosphatase 2A catalytic...  70.1    2e-10   
ref|XP_010084267.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    2e-10   
ref|XP_005243214.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_010895595.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|NP_001017886.1|  protein phosphatase 2, catalytic subunit, al...  68.9    2e-10   
ref|XP_007543101.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|NP_957205.1|  serine/threonine-protein phosphatase 2A catalyt...  68.9    2e-10   
ref|XP_009507687.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_006167244.1|  PREDICTED: serine/threonine-protein phosphat...  68.6    2e-10   
pdb|4I5L|C  Chain C, Structural Mechanism Of Trimeric Pp2a Holoen...  68.9    2e-10   
ref|XP_007626801.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_008330538.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
emb|CAG33698.1|  PPP2CA                                               68.9    2e-10   
ref|XP_008282677.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
gb|AAD12587.1|  protein phosphatase type 2A catalytic subunit alp...  68.9    2e-10   
ref|NP_990455.1|  serine/threonine-protein phosphatase 2A catalyt...  68.9    2e-10   
ref|XP_003455219.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_009284353.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_010887911.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_005989407.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_004282169.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|NP_058735.1|  serine/threonine-protein phosphatase 2A catalyt...  68.9    2e-10   
ref|NP_001006152.1|  serine/threonine-protein phosphatase 2A cata...  68.9    2e-10   
ref|XP_008920435.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_007610461.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
gb|ACO12642.1|  Serine/threonine-protein phosphatase 2A catalytic...  68.9    2e-10   
ref|XP_007670439.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
gb|AAX46574.1|  protein phosphatase 2, catalytic subunit, alpha i...  68.9    2e-10   
ref|NP_001003063.1|  serine/threonine-protein phosphatase 2A cata...  68.9    2e-10   
ref|XP_007427938.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|NP_002706.1|  serine/threonine-protein phosphatase 2A catalyt...  68.9    2e-10   
ref|XP_007241402.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_006631847.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
gb|ETE61972.1|  Serine/threonine-protein phosphatase 2A catalytic...  68.9    2e-10   
ref|XP_006270096.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_006086657.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_005795405.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|NP_989274.1|  serine/threonine-protein phosphatase 2A catalyt...  68.9    2e-10   
gb|ABQ18264.1|  protein serine/threonine phosphatase-2a catalytic...  68.9    2e-10   
ref|XP_003499698.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_005852059.1|  protein phosphatase 2A catalytic subunit         68.9    2e-10   
ref|XP_010114864.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_007899483.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_009917003.1|  PREDICTED: serine/threonine-protein phosphat...  68.6    2e-10   
ref|XP_006930670.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_002613758.1|  hypothetical protein BRAFLDRAFT_123893           68.9    2e-10   
ref|XP_009815851.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
pdb|3C5W|C  Chain C, Complex Between Pp2a-Specific Methylesterase...  68.9    2e-10   
ref|XP_007904127.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_005807251.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|NP_001080353.1|  protein phosphatase 2, catalytic subunit, al...  68.9    2e-10   
ref|NP_001279183.1|  serine/threonine-protein phosphatase 2A cata...  68.9    2e-10   
ref|XP_006753636.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_005242862.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_007940880.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_007532203.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_006884185.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_009977440.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    2e-10   
ref|XP_010289610.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    2e-10   
emb|CDQ79818.1|  unnamed protein product                              68.9    2e-10   
ref|NP_001005443.1|  serine/threonine-protein phosphatase 2A cata...  68.9    2e-10   
ref|NP_058736.1|  serine/threonine-protein phosphatase 2A catalyt...  68.9    2e-10   
ref|NP_001187331.1|  serine/threonine-protein phosphatase 2a cata...  68.9    2e-10   
gb|AAV38333.1|  protein phosphatase 2 (formerly 2A), catalytic su...  68.9    2e-10   
ref|NP_001095177.1|  serine/threonine-protein phosphatase 2A cata...  68.9    2e-10   
ref|XP_003224684.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_008922928.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
sp|P11493.2|PP2AB_PIG  RecName: Full=Serine/threonine-protein pho...  68.9    2e-10   
ref|XP_005143054.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_002819017.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_001363791.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
gb|AAL35904.1|  protein phosphatase type 2A catalytic subunit         68.9    2e-10   
ref|NP_998458.1|  serine/threonine-protein phosphatase 2A catalyt...  68.9    2e-10   
ref|XP_007255313.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_006731701.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_005440788.1|  PREDICTED: serine/threonine-protein phosphat...  68.6    2e-10   
ref|XP_008495647.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_008589496.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_004383442.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|NP_001069325.1|  serine/threonine-protein phosphatase 2A cata...  68.9    2e-10   
gb|AAB38020.1|  phosphatase 2A                                        68.9    2e-10   
ref|XP_009685532.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_009985979.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_006627098.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_003474926.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...  68.9    2e-10   
ref|XP_010000591.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_004428944.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_002115846.1|  phosphatase 2A                                   68.9    2e-10   
ref|XP_009894278.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
gb|EPB89021.1|  serine/threonine-protein phosphatase PP2A catalyt...  68.9    2e-10   
ref|XP_006125471.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_005429339.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
gb|EIE89788.1|  serine/threonine-protein phosphatase 2A catalytic...  68.9    2e-10   
ref|XP_008508621.1|  PREDICTED: serine/threonine-protein phosphat...  68.6    2e-10   
ref|XP_006034057.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
gb|EGV98433.1|  Serine/threonine-protein phosphatase 2A catalytic...  69.3    2e-10   
ref|XP_006166976.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    2e-10   
ref|XP_002920874.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
dbj|BAG52434.1|  unnamed protein product                              68.9    2e-10   
ref|XP_006991419.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_003772846.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_010717595.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...  68.9    2e-10   
ref|XP_006006216.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_009318153.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    2e-10   
ref|XP_009277062.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    2e-10   
ref|XP_008944054.1|  PREDICTED: serine/threonine-protein phosphat...  68.6    2e-10   
gb|EFZ22272.1|  hypothetical protein SINV_14598                       69.3    2e-10   
ref|XP_010837111.1|  PREDICTED: serine/threonine-protein phosphat...  68.6    2e-10   
ref|XP_007667427.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    2e-10   
ref|XP_009911884.1|  PREDICTED: serine/threonine-protein phosphat...  68.6    2e-10   
emb|CEG65351.1|  Putative Serine/threonine-protein phosphatase        67.4    2e-10   
ref|XP_005649021.1|  Metallo-dependent phosphatase                    68.9    2e-10   
ref|XP_009089888.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    3e-10   
ref|XP_008684804.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    3e-10   
ref|XP_009884108.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    3e-10   
ref|XP_005536934.1|  protein phosphatase 2a                           68.9    3e-10   
emb|CDJ06031.1|  serine:threonine protein phosphatase 2A              68.6    3e-10   
ref|XP_005809785.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    3e-10   
ref|XP_007087872.1|  PREDICTED: serine/threonine-protein phosphat...  68.6    3e-10   
ref|XP_010218305.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    3e-10   
gb|ABQ18263.1|  protein serine/threonine phosphatase-2a catalytic...  68.6    3e-10   
ref|XP_009647386.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    3e-10   
ref|XP_010638022.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    3e-10   
ref|XP_007094036.1|  PREDICTED: serine/threonine-protein phosphat...  68.6    3e-10   
emb|CDS20410.1|  serine:threonine protein phosphatase 2A              68.6    3e-10   
gb|EHJ73732.1|  putative serine/threonine-protein phosphatase PP-V    68.6    3e-10   
ref|XP_004926298.1|  PREDICTED: serine/threonine-protein phosphat...  68.6    3e-10   
gb|AGK93074.1|  serine/threonine-protein phosphatase 2A catalytic...  68.6    3e-10   
gb|AFS50168.1|  PP2Ac                                                 68.6    3e-10   
gb|EUB55502.1|  Serine/threonine-protein phosphatase 2A catalytic...  68.6    3e-10   
ref|XP_010153069.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    3e-10   
ref|XP_004855515.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    3e-10   
gb|AHF45926.1|  protein phosphatase 2A catalytic subunit alpha is...  68.6    3e-10   
ref|NP_001119644.1|  protein phosphatase 2 catalytic subunit alph...  68.6    3e-10   
ref|XP_006675179.1|  protein phosphatase 2A                           68.6    3e-10   
ref|XP_008144472.1|  PREDICTED: serine/threonine-protein phosphat...  68.6    3e-10   
ref|XP_004209578.1|  PREDICTED: serine/threonine-protein phosphat...  68.6    3e-10   
ref|XP_010209730.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    3e-10   
ref|XP_009645181.1|  PREDICTED: serine/threonine-protein phosphat...  68.6    3e-10   
emb|CDS33620.1|  serine:threonine protein phosphatase 2A              68.2    3e-10   
ref|XP_010620675.1|  PREDICTED: serine/threonine-protein phosphat...  68.6    3e-10   
ref|XP_009994104.1|  PREDICTED: serine/threonine-protein phosphat...  68.6    3e-10   
gb|ESA17989.1|  hypothetical protein GLOINDRAFT_344832                68.2    4e-10   
ref|XP_005971539.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    4e-10   
ref|XP_001917962.1|  PREDICTED: serine/threonine-protein phosphat...  68.6    4e-10   
ref|XP_006086325.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    4e-10   
ref|XP_005496641.1|  PREDICTED: serine/threonine-protein phosphat...  68.2    4e-10   
ref|XP_010986311.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    4e-10   
ref|XP_004021909.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    4e-10   
gb|ELK03087.1|  Serine/threonine-protein phosphatase 2A catalytic...  68.6    4e-10   
ref|XP_005418909.1|  PREDICTED: serine/threonine-protein phosphat...  68.6    4e-10   
ref|XP_005398528.1|  PREDICTED: serine/threonine-protein phosphat...  68.6    4e-10   
emb|CAF90395.1|  unnamed protein product                              68.6    4e-10   
emb|CBY32244.1|  unnamed protein product                              68.2    5e-10   
gb|EPB88713.1|  serine/threonine-protein phosphatase PP2A catalyt...  67.8    5e-10   
gb|KDD76350.1|  calcineurin-like phosphoesterase                      67.8    5e-10   
gb|EIE75824.1|  serine/threonine-protein phosphatase PP2A catalyt...  67.8    6e-10   
ref|XP_003796369.1|  PREDICTED: serine/threonine-protein phosphat...  68.2    6e-10   
emb|CEG65350.1|  Putative Serine/threonine-protein phosphatase        67.8    6e-10   
ref|XP_004758373.1|  PREDICTED: serine/threonine-protein phosphat...  68.2    6e-10   
ref|XP_009447935.1|  PREDICTED: serine/threonine-protein phosphat...  67.8    6e-10   
gb|KGB37109.1|  Serine/threonine-protein phosphatase 2A catalytic...  66.2    6e-10   
emb|CBJ25911.1|  Serine/threonine-protein phosphatase PP2A cataly...  67.8    6e-10   
emb|CEF65242.1|  Serine/threonine-protein phosphatase 2A catalyti...  67.8    7e-10   
pdb|2IAE|C  Chain C, Crystal Structure Of A Protein Phosphatase 2...  67.4    7e-10   
ref|XP_002128830.1|  PREDICTED: serine/threonine-protein phosphat...  67.4    7e-10   
emb|CDH51934.1|  rsc complex subunit                                  68.6    7e-10   
emb|CCA21414.1|  serine/threonineprotein phosphatase PP2A catalyt...  67.4    8e-10   
ref|XP_003317697.1|  PREDICTED: serine/threonine-protein phosphat...  67.4    8e-10   
emb|CCA21415.1|  serine/threonineprotein phosphatase PP2A catalyt...  67.4    8e-10   
gb|EYC09058.1|  hypothetical protein Y032_0062g3327                   65.5    8e-10   
gb|EYC09057.1|  hypothetical protein Y032_0062g3327                   65.5    8e-10   
ref|XP_005187515.1|  PREDICTED: serine/threonine-protein phosphat...  67.0    8e-10   
ref|XP_001783244.1|  predicted protein                                67.0    9e-10   
gb|ETN66387.1|  protein phsophatase-2a                                67.0    1e-09   
ref|XP_319345.3|  AGAP010172-PA                                       67.0    1e-09   
ref|XP_002064646.1|  GK23721                                          67.0    1e-09   
ref|XP_008905555.1|  serine/threonine-protein phosphatase 2A cata...  67.0    1e-09   
ref|XP_001989140.1|  GH10208                                          67.0    1e-09   
ref|XP_005187514.1|  PREDICTED: serine/threonine-protein phosphat...  67.0    1e-09   
gb|AFW76468.1|  putative protein phosphatase 2A family protein        62.4    1e-09   
ref|NP_476805.1|  microtubule star, isoform A                         67.0    1e-09   
ref|XP_001663281.1|  protein phsophatase-2a                           67.0    1e-09   



>gb|ACU17345.1| unknown [Glycine max]
Length=65

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  25   CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  65



>ref|XP_010243441.1| PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic 
subunit-like [Nelumbo nucifera]
Length=194

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  154  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  194



>ref|XP_004494304.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like [Cicer arietinum]
Length=313

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/41 (98%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPDYFL  313



>gb|AID52922.1| serine/threonine-protein phosphatase PP2A catalytic subunit [Carthamus 
tinctorius]
Length=312

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/41 (98%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTP+YFL
Sbjct  272  CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPDYFL  312



>gb|KHG25216.1| Serine/threonine-protein phosphatase PP2A catalytic subunit [Gossypium 
arboreum]
Length=163

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCK HTFIQF+PAPRRGEPDVTRRTPEYFL
Sbjct  123  CGNMASILEVDDCKAHTFIQFEPAPRRGEPDVTRRTPEYFL  163



>ref|XP_009782045.1| PREDICTED: serine/threonine-protein phosphatase PP2A-5 catalytic 
subunit [Nicotiana sylvestris]
Length=314

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+GHTFIQFDPAPRRGEPDVTRRTP+YFL
Sbjct  274  CGNMASILEVDDCRGHTFIQFDPAPRRGEPDVTRRTPDYFL  314



>ref|XP_009620868.1| PREDICTED: serine/threonine-protein phosphatase PP2A-5 catalytic 
subunit [Nicotiana tomentosiformis]
Length=314

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+GHTFIQFDPAPRRGEPDVTRRTP+YFL
Sbjct  274  CGNMASILEVDDCRGHTFIQFDPAPRRGEPDVTRRTPDYFL  314



>sp|O04860.1|PP2A5_TOBAC RecName: Full=Serine/threonine-protein phosphatase PP2A-5 catalytic 
subunit [Nicotiana tabacum]
 emb|CAB07807.1| protein phosphatase type 2A [Nicotiana tabacum]
Length=314

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+GHTFIQFDPAPRRGEPDVTRRTP+YFL
Sbjct  274  CGNMASILEVDDCRGHTFIQFDPAPRRGEPDVTRRTPDYFL  314



>ref|XP_004229332.1| PREDICTED: serine/threonine-protein phosphatase PP2A-5 catalytic 
subunit [Solanum lycopersicum]
 ref|XP_006359133.1| PREDICTED: serine/threonine-protein phosphatase PP2A-5 catalytic 
subunit-like [Solanum tuberosum]
Length=312

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+GHTFIQFDPAPRRGEPDVTRRTP+YFL
Sbjct  272  CGNMASILEVDDCRGHTFIQFDPAPRRGEPDVTRRTPDYFL  312



>gb|KDP21900.1| hypothetical protein JCGZ_03038 [Jatropha curcas]
Length=313

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_002309283.1| hypothetical protein POPTR_0006s21080g [Populus trichocarpa]
 ref|XP_011047094.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit [Populus euphratica]
 gb|EEE92806.1| hypothetical protein POPTR_0006s21080g [Populus trichocarpa]
Length=313

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_008796687.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit isoform X1 [Phoenix dactylifera]
 ref|XP_008796689.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit isoform X1 [Phoenix dactylifera]
Length=313

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_002527066.1| protein phsophatase-2a, putative [Ricinus communis]
 gb|EEF35310.1| protein phsophatase-2a, putative [Ricinus communis]
Length=289

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  249  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  289



>ref|XP_010923348.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like isoform X2 [Elaeis guineensis]
Length=289

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  249  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  289



>dbj|BAA92699.1| type 2A protein phosphatase-3 [Vicia faba]
Length=313

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_003629703.1| Serine/threonine protein phosphatase [Medicago truncatula]
 gb|AET04179.1| serine/threonine protein phosphatase 2A [Medicago truncatula]
Length=308

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  268  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  308



>ref|XP_002304866.1| type 2A protein phosphatase-3 [Populus trichocarpa]
 ref|XP_006386056.1| hypothetical protein POPTR_0003s21320g [Populus trichocarpa]
 gb|EEE79845.1| type 2A protein phosphatase-3 [Populus trichocarpa]
 gb|ERP63853.1| hypothetical protein POPTR_0003s21320g [Populus trichocarpa]
Length=313

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_003638109.1| Serine/threonine protein phosphatase [Medicago truncatula]
 sp|Q06009.1|PP2A_MEDSA RecName: Full=Serine/threonine-protein phosphatase PP2A catalytic 
subunit [Medicago sativa]
 emb|CAA49849.1| phosphoprotein phosphatase type 2A [Medicago sativa]
 gb|KEH24330.1| serine/threonine protein phosphatase 2A [Medicago truncatula]
Length=313

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_002299121.1| type 2A protein phosphatase-3 [Populus trichocarpa]
 gb|EEE83926.1| type 2A protein phosphatase-3 [Populus trichocarpa]
Length=313

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_011048241.1| PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic 
subunit-like [Populus euphratica]
 ref|XP_011010678.1| PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic 
subunit-like [Populus euphratica]
Length=313

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_011025169.1| PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic 
subunit [Populus euphratica]
Length=313

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_008796690.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit isoform X2 [Phoenix dactylifera]
Length=284

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  244  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  284



>ref|XP_008796691.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit isoform X3 [Phoenix dactylifera]
Length=270

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  230  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  270



>ref|XP_002270378.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit [Vitis vinifera]
Length=313

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_004294990.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like [Fragaria vesca subsp. vesca]
Length=311

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  271  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  311



>gb|AET04180.2| serine/threonine protein phosphatase 2A [Medicago truncatula]
Length=284

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  244  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  284



>ref|XP_004504333.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like isoform X1 [Cicer arietinum]
 ref|XP_004504334.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like isoform X2 [Cicer arietinum]
Length=308

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  268  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  308



>ref|XP_003554484.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like [Glycine max]
 gb|KHN43573.1| Serine/threonine-protein phosphatase PP2A catalytic subunit [Glycine 
soja]
Length=313

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_006842771.1| hypothetical protein AMTR_s00133p00104740 [Amborella trichopoda]
 gb|ERN04446.1| hypothetical protein AMTR_s00133p00104740 [Amborella trichopoda]
Length=312

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  272  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  312



>ref|XP_009397685.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Musa acuminata subsp. malaccensis]
Length=314

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  274  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  314



>ref|XP_008351677.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Malus domestica]
 ref|XP_008384402.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Malus domestica]
 ref|XP_009375523.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Pyrus x bretschneideri]
 ref|XP_009364118.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Pyrus x bretschneideri]
Length=311

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  271  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  311



>ref|XP_007163032.1| hypothetical protein PHAVU_001G200300g [Phaseolus vulgaris]
 gb|ESW35026.1| hypothetical protein PHAVU_001G200300g [Phaseolus vulgaris]
Length=313

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>emb|CBI32153.3| unnamed protein product [Vitis vinifera]
Length=311

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  271  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  311



>ref|XP_003521515.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like [Glycine max]
 gb|KHN22564.1| Serine/threonine-protein phosphatase PP2A catalytic subunit [Glycine 
soja]
Length=313

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_006445820.1| hypothetical protein CICLE_v10015516mg [Citrus clementina]
 ref|XP_006445822.1| hypothetical protein CICLE_v10015516mg [Citrus clementina]
 ref|XP_006492715.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit-like isoform X2 [Citrus sinensis]
 gb|ESR59060.1| hypothetical protein CICLE_v10015516mg [Citrus clementina]
 gb|ESR59062.1| hypothetical protein CICLE_v10015516mg [Citrus clementina]
 gb|KDO63010.1| hypothetical protein CISIN_1g016098mg [Citrus sinensis]
Length=313

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_003524949.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like [Glycine max]
 ref|XP_003531237.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Glycine max]
 gb|KHN47965.1| Serine/threonine-protein phosphatase PP2A catalytic subunit [Glycine 
soja]
Length=311

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  271  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  311



>ref|XP_003629704.1| Serine/threonine protein phosphatase [Medicago truncatula]
Length=293

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  253  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  293



>ref|XP_010934485.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit isoform X1 [Elaeis guineensis]
Length=313

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_010923345.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit-like isoform X1 [Elaeis guineensis]
 ref|XP_010923346.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit-like isoform X1 [Elaeis guineensis]
 ref|XP_010923347.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit-like isoform X1 [Elaeis guineensis]
Length=313

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>gb|KDP26943.1| hypothetical protein JCGZ_21036 [Jatropha curcas]
Length=313

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_007159403.1| hypothetical protein PHAVU_002G235400g [Phaseolus vulgaris]
 gb|ESW31397.1| hypothetical protein PHAVU_002G235400g [Phaseolus vulgaris]
Length=311

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  271  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  311



>gb|AFK46352.1| unknown [Lotus japonicus]
Length=311

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  271  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  311



>emb|CDP17353.1| unnamed protein product [Coffea canephora]
Length=317

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  277  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  317



>gb|KDO63013.1| hypothetical protein CISIN_1g016098mg [Citrus sinensis]
Length=285

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  245  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  285



>ref|XP_009398410.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit [Musa acuminata subsp. malaccensis]
Length=314

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  274  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  314



>ref|XP_010257587.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Nelumbo nucifera]
Length=313

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_010934493.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit isoform X2 [Elaeis guineensis]
Length=264

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  224  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  264



>ref|XP_002285694.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Vitis vinifera]
 emb|CAN78260.1| hypothetical protein VITISV_016121 [Vitis vinifera]
 emb|CBI16499.3| unnamed protein product [Vitis vinifera]
Length=314

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  274  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  314



>ref|XP_010673507.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Beta vulgaris subsp. vulgaris]
Length=313

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>gb|KHG30742.1| Serine/threonine-protein phosphatase PP2A-4 catalytic subunit 
-like protein [Gossypium arboreum]
Length=364

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  324  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  364



>ref|XP_008798733.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like isoform X1 [Phoenix dactylifera]
Length=313

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_010907340.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like isoform X1 [Elaeis guineensis]
Length=313

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_007205603.1| hypothetical protein PRUPE_ppa009000mg [Prunus persica]
 ref|XP_008239817.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit [Prunus mume]
 gb|EMJ06802.1| hypothetical protein PRUPE_ppa009000mg [Prunus persica]
Length=311

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  271  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  311



>ref|XP_010907341.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like isoform X2 [Elaeis guineensis]
Length=294

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  254  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  294



>ref|XP_008798734.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit-like isoform X2 [Phoenix dactylifera]
Length=270

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  230  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  270



>ref|XP_008241160.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit-like, partial [Prunus mume]
Length=175

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMAS+LEVDDC+GHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  135  CGNMASVLEVDDCRGHTFIQFEPAPRRGEPDVTRRTPDYFL  175



>ref|XP_007145716.1| hypothetical protein PHAVU_007G262200g [Phaseolus vulgaris]
 gb|ESW17710.1| hypothetical protein PHAVU_007G262200g [Phaseolus vulgaris]
Length=227

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDD KGHTFIQFDPAPRRGEPDVTRRTP+YFL
Sbjct  187  CGNMASILEVDDSKGHTFIQFDPAPRRGEPDVTRRTPDYFL  227



>ref|XP_010524038.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit-like [Tarenaya hassleriana]
Length=313

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+GHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCRGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>emb|CDP07661.1| unnamed protein product [Coffea canephora]
Length=314

 Score = 87.0 bits (214),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+GHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  274  CGNMASILEVDDCRGHTFIQFEPAPRRGEPDVTRRTPDYFL  314



>ref|XP_011093402.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit-like [Sesamum indicum]
Length=313

 Score = 87.0 bits (214),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+GHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCRGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_010550105.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit isoform X1 [Tarenaya hassleriana]
Length=313

 Score = 87.0 bits (214),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+GHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCRGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_010524846.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit [Tarenaya hassleriana]
Length=292

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+GHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  252  CGNMASILEVDDCRGHTFIQFEPAPRRGEPDVTRRTPDYFL  292



>ref|XP_006587188.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit-like isoform X2 [Glycine max]
Length=286

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDD KGHTFIQFDPAPRRGEPDVTRRTP+YFL
Sbjct  246  CGNMASILEVDDSKGHTFIQFDPAPRRGEPDVTRRTPDYFL  286



>ref|XP_010550187.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit isoform X2 [Tarenaya hassleriana]
Length=298

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+GHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  258  CGNMASILEVDDCRGHTFIQFEPAPRRGEPDVTRRTPDYFL  298



>ref|XP_010101131.1| Serine/threonine-protein phosphatase PP2A-4 catalytic subunit 
[Morus notabilis]
 gb|EXB87349.1| Serine/threonine-protein phosphatase PP2A-4 catalytic subunit 
[Morus notabilis]
Length=783

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  743  CGNMASILEVDDCKGHTFIQFEPAPRRGEPDVTRRTPDYFL  783



>ref|XP_004303366.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like [Fragaria vesca subsp. vesca]
Length=313

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMAS+LEVDDC+GHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASVLEVDDCRGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_006587189.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit-like isoform X3 [Glycine max]
Length=247

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDD KGHTFIQFDPAPRRGEPDVTRRTP+YFL
Sbjct  207  CGNMASILEVDDSKGHTFIQFDPAPRRGEPDVTRRTPDYFL  247



>ref|XP_008387207.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit [Malus domestica]
Length=313

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMAS+LEVDDC+GHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASVLEVDDCRGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_006354151.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like [Solanum tuberosum]
Length=313

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC GHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCNGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_004228641.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Solanum lycopersicum]
Length=313

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC GHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCNGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_007145715.1| hypothetical protein PHAVU_007G262200g [Phaseolus vulgaris]
 ref|XP_007145717.1| hypothetical protein PHAVU_007G262200g [Phaseolus vulgaris]
 gb|ESW17709.1| hypothetical protein PHAVU_007G262200g [Phaseolus vulgaris]
 gb|ESW17711.1| hypothetical protein PHAVU_007G262200g [Phaseolus vulgaris]
Length=314

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDD KGHTFIQFDPAPRRGEPDVTRRTP+YFL
Sbjct  274  CGNMASILEVDDSKGHTFIQFDPAPRRGEPDVTRRTPDYFL  314



>ref|XP_002322743.1| hypothetical protein POPTR_0016s06190g [Populus trichocarpa]
 gb|EEF04504.1| hypothetical protein POPTR_0016s06190g [Populus trichocarpa]
Length=313

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC GHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCNGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_008370945.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit-like [Malus domestica]
 ref|XP_009335875.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit [Pyrus x bretschneideri]
Length=313

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMAS+LEVDDC+GHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASVLEVDDCRGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_009757229.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like [Nicotiana sylvestris]
Length=312

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC GHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  272  CGNMASILEVDDCNGHTFIQFEPAPRRGEPDVTRRTPDYFL  312



>gb|ACN30926.1| unknown [Zea mays]
Length=228

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  188  CGNMASILEVDDCRNHTFIQFEPAPRRGEPDVTRRTPDYFL  228



>ref|XP_003533904.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit-like isoformX1 [Glycine max]
 gb|KHN43995.1| Serine/threonine-protein phosphatase PP2A-3 catalytic subunit 
[Glycine soja]
Length=314

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDD KGHTFIQFDPAPRRGEPDVTRRTP+YFL
Sbjct  274  CGNMASILEVDDSKGHTFIQFDPAPRRGEPDVTRRTPDYFL  314



>gb|ACU23691.1| unknown [Glycine max]
Length=314

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDD KGHTFIQFDPAPRRGEPDVTRRTP+YFL
Sbjct  274  CGNMASILEVDDSKGHTFIQFDPAPRRGEPDVTRRTPDYFL  314



>ref|XP_007202275.1| hypothetical protein PRUPE_ppa008946mg [Prunus persica]
 gb|EMJ03474.1| hypothetical protein PRUPE_ppa008946mg [Prunus persica]
Length=313

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMAS+LEVDDC+GHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASVLEVDDCRGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_009603918.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like [Nicotiana tomentosiformis]
Length=312

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC GHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  272  CGNMASILEVDDCNGHTFIQFEPAPRRGEPDVTRRTPDYFL  312



>ref|XP_008241162.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Prunus mume]
Length=313

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMAS+LEVDDC+GHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASVLEVDDCRGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_004168224.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
PP2A-3 catalytic subunit-like [Cucumis sativus]
Length=311

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCK HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  271  CGNMASILEVDDCKAHTFIQFEPAPRRGEPDVTRRTPDYFL  311



>ref|XP_008449804.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit [Cucumis melo]
 ref|XP_008449806.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit [Cucumis melo]
 ref|XP_008449807.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit [Cucumis melo]
Length=311

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCK HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  271  CGNMASILEVDDCKAHTFIQFEPAPRRGEPDVTRRTPDYFL  311



>ref|XP_004142163.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit-like [Cucumis sativus]
 gb|KGN54075.1| hypothetical protein Csa_4G280520 [Cucumis sativus]
Length=311

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCK HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  271  CGNMASILEVDDCKAHTFIQFEPAPRRGEPDVTRRTPDYFL  311



>ref|XP_008789091.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit-like [Phoenix dactylifera]
Length=313

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTF QF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCKGHTFTQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_004144671.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit-like [Cucumis sativus]
 ref|XP_004168734.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit-like [Cucumis sativus]
 gb|KGN54854.1| hypothetical protein Csa_4G551660 [Cucumis sativus]
Length=313

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCK HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCKSHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_008813488.1| PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic 
subunit-like [Phoenix dactylifera]
Length=247

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKG TFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  207  CGNMASILEVDDCKGQTFIQFEPAPRRGEPDVTRRTPDYFL  247



>emb|CDX67746.1| BnaA07g17860D [Brassica napus]
Length=203

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  163  CGNMASILEVDDCRNHTFIQFEPAPRRGEPDVTRRTPDYFL  203



>ref|XP_008813485.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like isoform X1 [Phoenix dactylifera]
Length=310

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKG TFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  270  CGNMASILEVDDCKGQTFIQFEPAPRRGEPDVTRRTPDYFL  310



>ref|XP_008813486.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like isoform X2 [Phoenix dactylifera]
Length=291

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKG TFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  251  CGNMASILEVDDCKGQTFIQFEPAPRRGEPDVTRRTPDYFL  291



>ref|NP_001149212.1| PP2Ac-5 - Phosphatase 2A isoform 5 belonging to family 2 [Zea 
mays]
 gb|ACG34580.1| PP2Ac-5 - Phosphatase 2A isoform 5 belonging to family 2 [Zea 
mays]
Length=313

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC  HTFIQFDPAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCNSHTFIQFDPAPRRGEPDVTRRTPDYFL  313



>ref|XP_006429940.1| hypothetical protein CICLE_v10012259mg [Citrus clementina]
 gb|ESR43180.1| hypothetical protein CICLE_v10012259mg [Citrus clementina]
 gb|KDO70821.1| hypothetical protein CISIN_1g021077mg [Citrus sinensis]
 gb|KDO70822.1| hypothetical protein CISIN_1g021077mg [Citrus sinensis]
Length=227

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  187  CGNMASILEVDDCRSHTFIQFEPAPRRGEPDVTRRTPDYFL  227



>ref|XP_002531165.1| protein phsophatase-2a, putative [Ricinus communis]
 gb|EEF31208.1| protein phsophatase-2a, putative [Ricinus communis]
Length=313

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCRAHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>gb|KCW52393.1| hypothetical protein EUGRSUZ_J01802 [Eucalyptus grandis]
Length=290

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAP+RGEPDVTRR P+YFL
Sbjct  250  CGNMASILEVDDCKGHTFIQFEPAPKRGEPDVTRRMPDYFL  290



>ref|NP_973672.1| serine/threonine-protein phosphatase PP2A-3 catalytic subunit 
[Arabidopsis thaliana]
 gb|AEC10128.1| serine/threonine-protein phosphatase PP2A-3 catalytic subunit 
[Arabidopsis thaliana]
Length=266

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  226  CGNMASILEVDDCRNHTFIQFEPAPRRGEPDVTRRTPDYFL  266



>ref|XP_010032900.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit-like [Eucalyptus grandis]
 gb|KCW52392.1| hypothetical protein EUGRSUZ_J01802 [Eucalyptus grandis]
Length=314

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCKGHTFIQF+PAP+RGEPDVTRR P+YFL
Sbjct  274  CGNMASILEVDDCKGHTFIQFEPAPKRGEPDVTRRMPDYFL  314



>gb|ACF83060.1| unknown [Zea mays]
 gb|AFW89574.1| putative serine/threonine protein phosphatase superfamily protein 
[Zea mays]
Length=227

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC  HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  187  CGNMASILEVDDCNSHTFIQFEPAPRRGEPDVTRRTPDYFL  227



>ref|XP_008442200.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit [Cucumis melo]
Length=313

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCRSHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_010044955.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit [Eucalyptus grandis]
 gb|KCW87086.1| hypothetical protein EUGRSUZ_B03620 [Eucalyptus grandis]
Length=313

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCRAHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>gb|KCW87087.1| hypothetical protein EUGRSUZ_B03620 [Eucalyptus grandis]
 gb|KCW87088.1| hypothetical protein EUGRSUZ_B03620 [Eucalyptus grandis]
Length=270

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  230  CGNMASILEVDDCRAHTFIQFEPAPRRGEPDVTRRTPDYFL  270



>ref|XP_006429942.1| hypothetical protein CICLE_v10012259mg [Citrus clementina]
 gb|ESR43182.1| hypothetical protein CICLE_v10012259mg [Citrus clementina]
Length=313

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCRSHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_006429941.1| hypothetical protein CICLE_v10012259mg [Citrus clementina]
 ref|XP_006481547.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit-like [Citrus sinensis]
 gb|ESR43181.1| hypothetical protein CICLE_v10012259mg [Citrus clementina]
 gb|KDO70819.1| hypothetical protein CISIN_1g021077mg [Citrus sinensis]
Length=313

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCRSHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>sp|P0C5D7.1|PP2A4_ORYSI RecName: Full=Putative serine/threonine-protein phosphatase PP2A-4 
catalytic subunit [Oryza sativa Indica Group]
 gb|AAD48068.1|AF173881_1 serine/threonine protein phosphatase PP2A-4 catalytic subunit 
[Oryza sativa Indica Group]
Length=315

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  275  CGNMASILEVDDCRNHTFIQFEPAPRRGEPDVTRRTPDYFL  315



>ref|XP_002467261.1| hypothetical protein SORBIDRAFT_01g022230 [Sorghum bicolor]
 gb|EER94259.1| hypothetical protein SORBIDRAFT_01g022230 [Sorghum bicolor]
Length=315

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  275  CGNMASILEVDDCRNHTFIQFEPAPRRGEPDVTRRTPDYFL  315



>ref|NP_001150190.1| PP2Ac-4 - Phosphatase 2A isoform 4 belonging to family 2 [Zea 
mays]
 gb|ACG38181.1| PP2Ac-4 - Phosphatase 2A isoform 4 belonging to family 2 [Zea 
mays]
 tpg|DAA50020.1| TPA: putative serine/threonine protein phosphatase superfamily 
protein [Zea mays]
Length=315

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  275  CGNMASILEVDDCRNHTFIQFEPAPRRGEPDVTRRTPDYFL  315



>ref|XP_009142847.1| PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic 
subunit [Brassica rapa]
 emb|CDY55398.1| BnaA05g34330D [Brassica napus]
 emb|CDY51518.1| BnaC04g02330D [Brassica napus]
Length=313

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCRNHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|NP_001064578.1| Os10g0410600 [Oryza sativa Japonica Group]
 sp|A3C4N5.2|PP2A4_ORYSJ RecName: Full=Serine/threonine-protein phosphatase PP2A-4 catalytic 
subunit [Oryza sativa Japonica Group]
 gb|ABB47590.1| Serine/threonine protein phosphatase PP2A-4 catalytic subunit, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF26492.1| Os10g0410600 [Oryza sativa Japonica Group]
 dbj|BAG94218.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE50943.1| hypothetical protein OsJ_31490 [Oryza sativa Japonica Group]
Length=314

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  274  CGNMASILEVDDCRNHTFIQFEPAPRRGEPDVTRRTPDYFL  314



>ref|XP_010506078.1| PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic 
subunit [Camelina sativa]
 ref|XP_010517775.1| PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic 
subunit [Camelina sativa]
Length=313

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCRNHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_006411507.1| hypothetical protein EUTSA_v10016971mg [Eutrema salsugineum]
 gb|ESQ52960.1| hypothetical protein EUTSA_v10016971mg [Eutrema salsugineum]
Length=313

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCRNHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|NP_565974.1| serine/threonine-protein phosphatase PP2A-3 catalytic subunit 
[Arabidopsis thaliana]
 ref|XP_002881857.1| protein phosphatase 2A-4 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006294640.1| hypothetical protein CARUB_v10023677mg [Capsella rubella]
 sp|Q07100.2|PP2A4_ARATH RecName: Full=Serine/threonine-protein phosphatase PP2A-4 catalytic 
subunit; AltName: Full=Protein phosphatase 2A isoform 
4 [Arabidopsis thaliana]
 gb|AAA64742.1| Ser/Thr protein phosphatase [Arabidopsis thaliana]
 gb|AAD23731.1| serine threonine protein phosphatase PP2A-3 catalytic subunit 
[Arabidopsis thaliana]
 gb|AAM15383.1| serine/threonine protein phosphatase PP2A-3 catalytic subunit 
[Arabidopsis thaliana]
 gb|AAQ22635.1| At2g42500/F14N22.23 [Arabidopsis thaliana]
 gb|EFH58116.1| protein phosphatase 2A-4 [Arabidopsis lyrata subsp. lyrata]
 gb|AEC10127.1| serine/threonine-protein phosphatase PP2A-3 catalytic subunit 
[Arabidopsis thaliana]
 gb|EOA27538.1| hypothetical protein CARUB_v10023677mg [Capsella rubella]
 gb|KFK37102.1| hypothetical protein AALP_AA4G213200 [Arabis alpina]
Length=313

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCRNHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>gb|ACT53402.1| protein phosphatase 2Ac [Brassica juncea]
Length=292

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  252  CGNMASILEVDDCRNHTFIQFEPAPRRGEPDVTRRTPDYFL  292



>ref|XP_006661767.1| PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic 
subunit-like [Oryza brachyantha]
Length=314

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  274  CGNMASILEVDDCRNHTFIQFEPAPRRGEPDVTRRTPDYFL  314



>gb|KDO70818.1| hypothetical protein CISIN_1g021077mg [Citrus sinensis]
Length=294

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  254  CGNMASILEVDDCRSHTFIQFEPAPRRGEPDVTRRTPDYFL  294



>ref|XP_009104146.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit-like isoform X1 [Brassica rapa]
Length=311

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  271  CGNMASILEVDDCRNHTFIQFEPAPRRGEPDVTRRTPDYFL  311



>gb|KDO70820.1| hypothetical protein CISIN_1g021077mg [Citrus sinensis]
Length=317

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  277  CGNMASILEVDDCRSHTFIQFEPAPRRGEPDVTRRTPDYFL  317



>gb|KFK35108.1| hypothetical protein AALP_AA5G237100 [Arabis alpina]
Length=313

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCRNHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_006402781.1| hypothetical protein EUTSA_v10006109mg [Eutrema salsugineum]
 gb|ESQ44234.1| hypothetical protein EUTSA_v10006109mg [Eutrema salsugineum]
Length=313

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCRNHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_004983161.1| PREDICTED: putative serine/threonine-protein phosphatase PP2A-4 
catalytic subunit-like [Setaria italica]
Length=315

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  275  CGNMASILEVDDCRNHTFIQFEPAPRRGEPDVTRRTPDYFL  315



>ref|XP_009104147.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit-like isoform X2 [Brassica rapa]
Length=270

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  230  CGNMASILEVDDCRNHTFIQFEPAPRRGEPDVTRRTPDYFL  270



>sp|P23778.2|PP2A_BRANA RecName: Full=Serine/threonine-protein phosphatase PP2A catalytic 
subunit, partial [Brassica napus]
 emb|CAA40687.1| phosphatase 2A [Brassica napus]
Length=309

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  269  CGNMASILEVDDCRNHTFIQFEPAPRRGEPDVTRRTPDYFL  309



>emb|CDY00569.1| BnaC04g23560D [Brassica napus]
Length=313

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCRNHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_009138958.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit [Brassica rapa]
 ref|XP_009116529.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit [Brassica rapa]
 emb|CDY06035.1| BnaA09g37450D [Brassica napus]
 emb|CDX88988.1| BnaA04g01980D [Brassica napus]
 emb|CDX71949.1| BnaC08g29250D [Brassica napus]
Length=313

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCRNHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|NP_567066.1| serine/threonine-protein phosphatase PP2A-3 catalytic subunit 
[Arabidopsis thaliana]
 ref|XP_002878224.1| protein phosphatase 2A-3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006291524.1| hypothetical protein CARUB_v10017673mg [Capsella rubella]
 ref|XP_010504806.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit [Camelina sativa]
 ref|XP_010516501.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit isoform X1 [Camelina sativa]
 ref|XP_010427757.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit [Camelina sativa]
 sp|P48578.1|PP2A3_ARATH RecName: Full=Serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit; AltName: Full=Protein phosphatase 2A isoform 
3 [Arabidopsis thaliana]
 gb|AAA64941.1| Ser/Thr protein phosphatase [Arabidopsis thaliana]
 gb|AAD10855.1| serine/threonine protein phosphatase 2A-4 catalytic subunit [Arabidopsis 
thaliana]
 gb|AAL07071.1| putative phosphoprotein phosphatase 2A isoform 4 [Arabidopsis 
thaliana]
 gb|AAL14399.1| AT3g58500/F14P22_90 [Arabidopsis thaliana]
 gb|AAM47331.1| AT3g58500/F14P22_90 [Arabidopsis thaliana]
 gb|EFH54483.1| protein phosphatase 2A-3 [Arabidopsis lyrata subsp. lyrata]
 gb|AEE79790.1| serine/threonine-protein phosphatase PP2A-3 catalytic subunit 
[Arabidopsis thaliana]
 gb|EOA24422.1| hypothetical protein CARUB_v10017673mg [Capsella rubella]
Length=313

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCRNHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_007029090.1| Phosphatase 2A-4 [Theobroma cacao]
 gb|EOY09592.1| Phosphatase 2A-4 [Theobroma cacao]
Length=313

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCQSHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>prf||1702228B protein phosphatase 2A
Length=309

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  269  CGNMASILEVDDCRNHTFIQFEPAPRRGEPDVTRRTPDYFL  309



>tpg|DAA52017.1| TPA: putative serine/threonine protein phosphatase superfamily 
protein [Zea mays]
Length=227

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  187  CGNMASILEVDDCREHTFIQFEPAPRRGEPDVTRRTPDYFL  227



>gb|ABK24697.1| unknown [Picea sitchensis]
Length=314

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDD KGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  274  CGNMASILEVDDTKGHTFIQFEPAPRRGEPDVTRRTPDYFL  314



>ref|XP_010516502.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit isoform X2 [Camelina sativa]
Length=300

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  260  CGNMASILEVDDCRNHTFIQFEPAPRRGEPDVTRRTPDYFL  300



>gb|KHN00026.1| Serine/threonine-protein phosphatase PP2A-3 catalytic subunit 
[Glycine soja]
Length=314

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDD  GHTFIQFDPAPRRGEPDVTRRTP+YFL
Sbjct  274  CGNMASILEVDDSMGHTFIQFDPAPRRGEPDVTRRTPDYFL  314



>ref|XP_003519014.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit-like isoform X1 [Glycine max]
Length=314

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDD  GHTFIQFDPAPRRGEPDVTRRTP+YFL
Sbjct  274  CGNMASILEVDDSMGHTFIQFDPAPRRGEPDVTRRTPDYFL  314



>ref|XP_006575178.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit-like isoform X2 [Glycine max]
Length=247

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDD  GHTFIQFDPAPRRGEPDVTRRTP+YFL
Sbjct  207  CGNMASILEVDDSMGHTFIQFDPAPRRGEPDVTRRTPDYFL  247



>ref|XP_011089122.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit-like [Sesamum indicum]
Length=317

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC GH FIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  277  CGNMASILEVDDCNGHNFIQFEPAPRRGEPDVTRRTPDYFL  317



>emb|CAA07471.1| PP2A1 protein [Catharanthus roseus]
Length=314

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  274  CGNMASILEVDDCRQHTFIQFEPAPRRGEPDVTRRTPDYFL  314



>gb|AAF86353.1|AF283668_1 serine/threonine protein phosphatase PP2A-5 catalytic subunit 
[Oryza sativa Indica Group]
Length=308

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC  HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  268  CGNMASILEVDDCNSHTFIQFEPAPRRGEPDVTRRTPDYFL  308



>gb|ABO16371.1| serine/threonine-protein phosphatase PP2A-1 catalytic subunit 
[Triticum aestivum]
Length=313

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC  HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCNAHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|NP_001049084.1| Os03g0167700 [Oryza sativa Japonica Group]
 gb|ABF94175.1| Serine/threonine protein phosphatase PP2A-4 catalytic subunit, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10998.1| Os03g0167700 [Oryza sativa Japonica Group]
 dbj|BAG91656.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92783.1| unnamed protein product [Oryza sativa Japonica Group]
Length=314

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC  HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  274  CGNMASILEVDDCNSHTFIQFEPAPRRGEPDVTRRTPDYFL  314



>ref|XP_011039507.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like isoform X2 [Populus euphratica]
Length=227

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDD  GHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  187  CGNMASILEVDDWNGHTFIQFEPAPRRGEPDVTRRTPDYFL  227



>gb|AAL84295.1|AC073556_12 serine/threonine protein phosphatase PP2A-4 catalytic subunit 
[Oryza sativa Japonica Group]
 gb|EEC74589.1| hypothetical protein OsI_10169 [Oryza sativa Indica Group]
Length=340

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC  HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  300  CGNMASILEVDDCNSHTFIQFEPAPRRGEPDVTRRTPDYFL  340



>ref|XP_011086859.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit [Sesamum indicum]
Length=313

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCREHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_010036522.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit [Eucalyptus grandis]
 gb|KCW48135.1| hypothetical protein EUGRSUZ_K01869 [Eucalyptus grandis]
 gb|KCW48136.1| hypothetical protein EUGRSUZ_K01869 [Eucalyptus grandis]
Length=313

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDD KGHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDFKGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|NP_001130096.1| uncharacterized protein LOC100191189 [Zea mays]
 gb|ACF78223.1| unknown [Zea mays]
 gb|AFW89573.1| putative serine/threonine protein phosphatase superfamily protein 
[Zea mays]
Length=313

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC  HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCNSHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_011087915.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit-like [Sesamum indicum]
Length=316

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  276  CGNMASILEVDDCRDHTFIQFEPAPRRGEPDVTRRTPDYFL  316



>ref|XP_006649459.1| PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic 
subunit-like [Oryza brachyantha]
Length=314

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC  HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  274  CGNMASILEVDDCNSHTFIQFEPAPRRGEPDVTRRTPDYFL  314



>ref|XP_003558732.1| PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic 
subunit-like [Brachypodium distachyon]
Length=315

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC  HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  275  CGNMASILEVDDCNSHTFIQFEPAPRRGEPDVTRRTPDYFL  315



>gb|EYU27166.1| hypothetical protein MIMGU_mgv1a010409mg [Erythranthe guttata]
Length=313

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCREHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_004985576.1| PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic 
subunit-like [Setaria italica]
Length=313

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC  HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCNSHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>gb|ACG34764.1| PP2Ac-5 - Phosphatase 2A isoform 5 belonging to family 2 [Zea 
mays]
Length=313

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC  HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCNSHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>gb|EYU42248.1| hypothetical protein MIMGU_mgv1a023841mg, partial [Erythranthe 
guttata]
Length=282

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  242  CGNMASILEVDDCREHTFIQFEPAPRRGEPDVTRRTPDYFL  282



>gb|EPS68420.1| serine/threonine-protein phosphatase [Genlisea aurea]
Length=313

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCREHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_002465801.1| hypothetical protein SORBIDRAFT_01g046020 [Sorghum bicolor]
 gb|EER92799.1| hypothetical protein SORBIDRAFT_01g046020 [Sorghum bicolor]
Length=313

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC  HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCNSHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>gb|EEE58392.1| hypothetical protein OsJ_09554 [Oryza sativa Japonica Group]
Length=403

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC  HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  363  CGNMASILEVDDCNSHTFIQFEPAPRRGEPDVTRRTPDYFL  403



>ref|XP_010238310.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit-like isoform X2 [Brachypodium distachyon]
Length=270

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  230  CGNMASILEVDDCREHTFIQFEPAPRRGEPDVTRRTPDYFL  270



>gb|EMS59473.1| Serine/threonine-protein phosphatase PP2A-2 catalytic subunit 
[Triticum urartu]
Length=333

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  293  CGNMASILEVDDCREHTFIQFEPAPRRGEPDVTRRTPDYFL  333



>ref|NP_001148686.1| LOC100282302 [Zea mays]
 ref|XP_008643660.1| PREDICTED: LOC100282302 isoform X1 [Zea mays]
 gb|ACG32100.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea 
mays]
 gb|ACG32123.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea 
mays]
 gb|ACG32449.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea 
mays]
 gb|ACG32536.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea 
mays]
 gb|ACG32972.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea 
mays]
 gb|ACG33076.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea 
mays]
 gb|ACG34384.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea 
mays]
 gb|ACG34422.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea 
mays]
 gb|ACG34946.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea 
mays]
 gb|ACG38159.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea 
mays]
 gb|ACG38757.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea 
mays]
 gb|ACG41988.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea 
mays]
 gb|ACN34475.1| unknown [Zea mays]
 gb|AFW67296.1| putative serine/threonine protein phosphatase superfamily protein 
isoform 1 [Zea mays]
 gb|AFW67297.1| putative serine/threonine protein phosphatase superfamily protein 
isoform 2 [Zea mays]
Length=307

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  267  CGNMASILEVDDCREHTFIQFEPAPRRGEPDVTRRTPDYFL  307



>ref|NP_001167654.1| putative serine/threonine protein phosphatase superfamily protein 
[Zea mays]
 gb|ACF88272.1| unknown [Zea mays]
 tpg|DAA52016.1| TPA: putative serine/threonine protein phosphatase superfamily 
protein [Zea mays]
Length=307

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  267  CGNMASILEVDDCREHTFIQFEPAPRRGEPDVTRRTPDYFL  307



>gb|ACG38746.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea 
mays]
Length=307

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  267  CGNMASILEVDDCREHTFIQFEPAPRRGEPDVTRRTPDYFL  307



>dbj|BAJ93161.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=307

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  267  CGNMASILEVDDCREHTFIQFEPAPRRGEPDVTRRTPDYFL  307



>ref|XP_003564197.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit [Brachypodium distachyon]
Length=307

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  267  CGNMASILEVDDCREHTFIQFEPAPRRGEPDVTRRTPDYFL  307



>emb|CDY66916.1| BnaC03g72670D [Brassica napus]
Length=313

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ H+FIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCRNHSFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_003578345.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit-like isoform X1 [Brachypodium distachyon]
Length=307

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  267  CGNMASILEVDDCREHTFIQFEPAPRRGEPDVTRRTPDYFL  307



>gb|ACO57639.1| protein phosphatase 2A catalytic subunit [Castanea mollissima]
Length=311

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCK HTFIQF+PAPRRGEP VTRRTP+YFL
Sbjct  271  CGNMASILEVDDCKAHTFIQFEPAPRRGEPGVTRRTPDYFL  311



>emb|CDY69521.1| BnaCnng63970D [Brassica napus]
Length=313

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ H+FIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCRNHSFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|NP_001051627.1| Os03g0805300 [Oryza sativa Japonica Group]
 sp|Q10BT5.1|PP2A2_ORYSJ RecName: Full=Serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit [Oryza sativa Japonica Group]
 sp|A2XN40.2|PP2A2_ORYSI RecName: Full=Serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit [Oryza sativa Indica Group]
 gb|AAD22116.1| serine/threonine protein phosphatase PP2A-2 catalytic subunit 
[Oryza sativa Indica Group]
 gb|AAS07220.1| serine/threonine protein phosphatase PP2A-2 catalytic subunit 
[Oryza sativa Japonica Group]
 gb|ABF99431.1| Serine/threonine protein phosphatase PP2A catalytic subunit, 
putative, expressed [Oryza sativa Japonica Group]
 gb|ABF99432.1| Serine/threonine protein phosphatase PP2A catalytic subunit, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF13541.1| Os03g0805300 [Oryza sativa Japonica Group]
 gb|EAZ28974.1| hypothetical protein OsJ_13018 [Oryza sativa Japonica Group]
 dbj|BAG87595.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94025.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94563.1| unnamed protein product [Oryza sativa Japonica Group]
Length=307

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  267  CGNMASILEVDDCREHTFIQFEPAPRRGEPDVTRRTPDYFL  307



>ref|XP_004981369.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit-like [Setaria italica]
Length=307

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  267  CGNMASILEVDDCREHTFIQFEPAPRRGEPDVTRRTPDYFL  307



>ref|XP_009133540.1| PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic 
subunit-like [Brassica rapa]
Length=313

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ H+FIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCRNHSFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_006650755.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit-like [Oryza brachyantha]
Length=308

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  268  CGNMASILEVDDCREHTFIQFEPAPRRGEPDVTRRTPDYFL  308



>gb|EMT19169.1| Serine/threonine-protein phosphatase PP2A-2 catalytic subunit 
[Aegilops tauschii]
Length=416

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  376  CGNMASILEVDDCREHTFIQFEPAPRRGEPDVTRRTPDYFL  416



>gb|AAM65153.1| phosphoprotein phosphatase 2A isoform 4 [Arabidopsis thaliana]
Length=298

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC  HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  258  CGNMASILEVDDCGNHTFIQFEPAPRRGEPDVTRRTPDYFL  298



>ref|XP_011039506.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit-like isoform X1 [Populus euphratica]
Length=313

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDD  GHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDWNGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>emb|CDX98300.1| BnaC06g16610D [Brassica napus]
Length=313

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC+ H FIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCRNHNFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_009417153.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit-like [Musa acuminata subsp. malaccensis]
Length=314

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASI+EVD+CKG TFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  274  CGNMASIMEVDECKGQTFIQFEPAPRRGEPDVTRRTPDYFL  314



>emb|CDY14840.1| BnaC04g48370D [Brassica napus]
Length=313

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC  H+FIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCMSHSFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_009142071.1| PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic 
subunit-like [Brassica rapa]
 emb|CDY47976.1| BnaA04g24540D [Brassica napus]
Length=313

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDC  H+FIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDCMNHSFIQFEPAPRRGEPDVTRRTPDYFL  313



>gb|KHG13023.1| Serine/threonine-protein phosphatase PP2A catalytic subunit [Gossypium 
arboreum]
Length=270

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDDCK  +FIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  230  CGNMASILEVDDCKNQSFIQFEPAPRRGEPDVTRRTPDYFL  270



>ref|XP_009389048.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit-like [Musa acuminata subsp. malaccensis]
Length=314

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASI EVDDCK HTFIQF+PAPRRGEPDV+RRTP+YFL
Sbjct  274  CGNMASICEVDDCKDHTFIQFEPAPRRGEPDVSRRTPDYFL  314



>ref|XP_002966246.1| hypothetical protein SELMODRAFT_270568 [Selaginella moellendorffii]
 ref|XP_002982317.1| hypothetical protein SELMODRAFT_228841 [Selaginella moellendorffii]
 gb|EFJ16562.1| hypothetical protein SELMODRAFT_228841 [Selaginella moellendorffii]
 gb|EFJ32273.1| hypothetical protein SELMODRAFT_270568 [Selaginella moellendorffii]
Length=313

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDD  GHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMASILEVDDNMGHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_001766048.1| predicted protein [Physcomitrella patens]
 gb|EDQ69107.1| predicted protein [Physcomitrella patens]
Length=311

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDD  GHTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  271  CGNMASILEVDDNMGHTFIQFEPAPRRGEPDVTRRTPDYFL  311



>ref|XP_004228954.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Solanum lycopersicum]
Length=306

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDD K  TFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  266  CGNMASILEVDDAKDRTFIQFEPAPRRGEPDVTRRTPDYFL  306



>ref|XP_006364157.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like [Solanum tuberosum]
Length=306

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDD K  TFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  266  CGNMASILEVDDAKDRTFIQFEPAPRRGEPDVTRRTPDYFL  306



>ref|XP_009612069.1| PREDICTED: serine/threonine-protein phosphatase PP2A-5 catalytic 
subunit isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009804523.1| PREDICTED: serine/threonine-protein phosphatase PP2A-5 catalytic 
subunit isoform X2 [Nicotiana sylvestris]
Length=248

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDD +  TFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  208  CGNMASILEVDDSRERTFIQFEPAPRRGEPDVTRRTPDYFL  248



>ref|XP_009612068.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009804522.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit isoform X1 [Nicotiana sylvestris]
 sp|Q9XGH7.1|PP2A_TOBAC RecName: Full=Serine/threonine-protein phosphatase PP2A catalytic 
subunit [Nicotiana tabacum]
 emb|CAB46506.1| protein phosphatase 2A catalytic subunit [Nicotiana tabacum]
Length=312

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMASILEVDD +  TFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  272  CGNMASILEVDDSRERTFIQFEPAPRRGEPDVTRRTPDYFL  312



>ref|XP_001766933.1| predicted protein [Physcomitrella patens]
 gb|EDQ68335.1| predicted protein [Physcomitrella patens]
Length=313

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMA+ILEV D   HTFIQF+PAPRRGEPDVTRRTP+YFL
Sbjct  273  CGNMAAILEVHDNMAHTFIQFEPAPRRGEPDVTRRTPDYFL  313



>ref|XP_004362124.1| P-type ATPase [Dictyostelium fasciculatum]
 gb|EGG24273.1| P-type ATPase [Dictyostelium fasciculatum]
Length=1139

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL*SSSMKRA  148
            CGN A+I+E+D+   HTF+QFDPAPRRGEP VTRRTP+YFL ++  + A
Sbjct  266  CGNQAAIMEIDEKMKHTFLQFDPAPRRGEPHVTRRTPDYFLFAAESRLA  314



>gb|KFM80898.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Stegodyphus mimosarum]
Length=65

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  25   CGNQAAIMELDDALKYSFLQFDPAPRRGEPHVTRRTPDYFL  65



>gb|AEB61183.1| serine/threonine-protein phosphatase 2a catalytic subunit alpha 
isoform-like protein, partial [Equus caballus]
Length=104

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  64   CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  104



>ref|XP_635791.1| protein phosphatase 2A catalytic subunit [Dictyostelium discoideum 
AX4]
 sp|Q9XZE5.1|PP2AA_DICDI RecName: Full=Serine/threonine-protein phosphatase 2A catalytic 
subunit A; AltName: Full=Protein phosphatase 2A 37 kDa catalytic 
subunit [Dictyostelium discoideum]
 gb|AAD29693.1| protein phosphatase 2A catalytic subunit [Dictyostelium discoideum]
 gb|EAL62258.1| protein phosphatase 2A catalytic subunit [Dictyostelium discoideum 
AX4]
Length=306

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN+A+I+E+D+   HTF+QFDPAPRRGEP VTRRTP+YFL
Sbjct  266  CGNLAAIMEIDEKMKHTFLQFDPAPRRGEPHVTRRTPDYFL  306



>ref|XP_003285474.1| protein phosphatase 2A catalytic subunit [Dictyostelium purpureum]
 gb|EGC37990.1| protein phosphatase 2A catalytic subunit [Dictyostelium purpureum]
Length=306

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN+A+I+E+D+   HTF+QFDPAPRRGEP VTRRTP+YFL
Sbjct  266  CGNLAAIMEIDEKMKHTFLQFDPAPRRGEPHVTRRTPDYFL  306



>gb|ELK28881.1| Testis-expressed sequence 15 protein, partial [Myotis davidii]
Length=3012

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2     CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
             CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  2972  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  3012



>gb|AEB61396.1| serine/threonine-protein phosphatase 2a catalytic subunit alpha 
isoform-like protein, partial [Equus caballus]
Length=124

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  84   CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  124



>gb|EGW12684.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform [Cricetulus griseus]
Length=65

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRG+P VTRRTP+YFL
Sbjct  25   CGNQAAIMELDDTLKYSFLQFDPAPRRGKPHVTRRTPDYFL  65



>ref|XP_003375214.1| serine/threonine-protein phosphatase 2A catalytic subunit beta 
isoform [Trichinella spiralis]
 gb|EFV55230.1| serine/threonine-protein phosphatase 2A catalytic subunit beta 
isoform [Trichinella spiralis]
Length=311

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   H+F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  271  CGNQAAIMELDDLLTHSFLQFDPAPRRGEPHVTRRTPDYFL  311



>emb|CDQ73649.1| unnamed protein product [Oncorhynchus mykiss]
Length=247

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN ASI+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  207  CGNQASIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  247



>dbj|GAM22091.1| hypothetical protein SAMD00019534_052660 [Acytostelium subglobosum 
LB1]
Length=306

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+D+   HTF+QFDPAPRRGEP VTRRTP+YFL
Sbjct  266  CGNQAAIMEIDEKMKHTFLQFDPAPRRGEPHVTRRTPDYFL  306



>dbj|GAM16955.1| hypothetical protein SAMD00019534_001300 [Acytostelium subglobosum 
LB1]
Length=306

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+D+   HTF+QFDPAPRRGEP VTRRTP+YFL
Sbjct  266  CGNQAAIMEIDEKMKHTFLQFDPAPRRGEPHVTRRTPDYFL  306



>gb|EFA78478.1| protein phosphatase 2A catalytic subunit [Polysphondylium pallidum 
PN500]
Length=306

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+D+   HTF+QFDPAPRRGEP VTRRTP+YFL
Sbjct  266  CGNQAAIMEIDEKMKHTFLQFDPAPRRGEPHVTRRTPDYFL  306



>gb|ELV11295.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Tupaia chinensis]
Length=192

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  152  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  192



>gb|ERE80011.1| acyl-coenzyme A synthetase ACSM5 [Cricetulus griseus]
Length=740

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  700  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  740



>gb|EFX62364.1| hypothetical protein DAPPUDRAFT_68048 [Daphnia pulex]
Length=201

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  161  CGNQAAIMELDDSLKYSFLQFDPAPRRGEPHVTRRTPDYFL  201



>ref|XP_008689826.1| PREDICTED: cyclin-dependent kinase-like 3 isoform X1 [Ursus maritimus]
Length=873

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  833  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  873



>ref|XP_007053627.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform-like isoform X1 [Chelonia mydas]
Length=850

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  810  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  850



>ref|XP_002171875.1| serine/threonine protein phosphatase Ppa2 [Schizosaccharomyces 
japonicus yFS275]
 gb|EEB05582.1| serine/threonine protein phosphatase Ppa2 [Schizosaccharomyces 
japonicus yFS275]
Length=319

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+ILEVDD   HTF+QFDPAPR GEP +TRRTP+YFL
Sbjct  279  CGNQAAILEVDDDMNHTFLQFDPAPRTGEPIITRRTPDYFL  319



>gb|AEB61013.1| serine/threonine-protein phosphatase 2a catalytic subunit alpha 
isoform-like protein [Equus caballus]
Length=215

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  175  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  215



>ref|XP_007177066.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform-like [Balaenoptera acutorostrata scammoni]
Length=220

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  180  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  220



>ref|XP_008573329.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform [Galeopterus variegatus]
Length=269

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  229  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  269



>ref|XP_002735017.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit beta isoform-like [Saccoglossus kowalevskii]
Length=279

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  239  CGNQAAIMELDDALKYSFLQFDPAPRRGEPHVTRRTPDYFL  279



>gb|KFQ20777.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Mesitornis unicolor]
Length=209

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  169  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  209



>ref|XP_001107958.2| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform-like isoform 1 [Macaca mulatta]
 ref|XP_001108011.2| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform-like isoform 2 [Macaca mulatta]
 ref|XP_004666618.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform [Jaculus jaculus]
 ref|XP_005053828.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform [Ficedula albicollis]
 ref|XP_005503538.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform [Columba livia]
 ref|XP_005971964.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform [Pantholops hodgsonii]
 ref|XP_006116122.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform [Pelodiscus sinensis]
 ref|XP_006179678.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform-like isoform X3 [Camelus ferus]
 ref|XP_008952896.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform [Pan paniscus]
 ref|XP_009462602.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform [Nipponia nippon]
 ref|XP_009560811.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform [Cuculus canorus]
 ref|XP_009576188.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform-like [Fulmarus glacialis]
 ref|XP_009677536.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform [Struthio camelus australis]
 ref|XP_009806841.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform [Gavia stellata]
 ref|XP_009889182.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform [Charadrius vociferus]
 ref|XP_009889190.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform [Charadrius vociferus]
 ref|XP_009942372.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform [Opisthocomus hoazin]
 ref|XP_010153657.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform [Eurypyga helias]
 ref|XP_010306094.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform-like [Balearica regulorum gibbericeps]
 ref|XP_010577148.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform [Haliaeetus leucocephalus]
 ref|XP_010969920.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform [Camelus bactrianus]
 dbj|BAG51913.1| unnamed protein product [Homo sapiens]
 gb|EGW03025.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform [Cricetulus griseus]
Length=244

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  204  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  244



>emb|CDQ79365.1| unnamed protein product [Oncorhynchus mykiss]
Length=253

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  213  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  253



>ref|XP_010177015.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit beta isoform, partial [Mesitornis unicolor]
Length=210

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  170  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  210



>ref|XP_005888741.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit beta isoform-like [Bos mutus]
Length=192

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  152  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  192



>ref|XP_010590772.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit beta isoform [Loxodonta africana]
 ref|XP_010590773.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit beta isoform [Loxodonta africana]
Length=244

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  204  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  244



>gb|KFO92257.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Buceros rhinoceros silvestris]
Length=246

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  206  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  246



>emb|CDW52230.1| serine:threonine protein phosphatase 2A [Trichuris trichiura]
 gb|KHJ42303.1| Ser/Thr phosphatase family protein [Trichuris suis]
Length=311

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  271  CGNQAAIMELDDMLAYSFLQFDPAPRRGEPHVTRRTPDYFL  311



>ref|XP_004606933.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit beta isoform [Sorex araneus]
 ref|XP_005284025.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit beta isoform [Chrysemys picta bellii]
 ref|XP_005671872.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit beta isoform isoform X3 [Sus scrofa]
 ref|XP_006194642.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit beta isoform isoform X1 [Camelus ferus]
 ref|XP_006194643.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit beta isoform isoform X2 [Camelus ferus]
 ref|XP_006509096.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit beta isoform isoform X1 [Mus musculus]
 ref|XP_006765676.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit beta isoform [Myotis davidii]
 ref|XP_007119094.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit beta isoform [Physeter catodon]
 ref|XP_007174129.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit beta isoform [Balaenoptera acutorostrata scammoni]
 ref|XP_008057281.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit beta isoform [Tarsius syrichta]
 ref|XP_008954437.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit beta isoform [Pan paniscus]
 ref|XP_010369172.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit beta isoform [Rhinopithecus roxellana]
 ref|XP_010346984.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit beta isoform [Saimiri boliviensis boliviensis]
 ref|XP_010707900.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit beta isoform [Meleagris gallopavo]
 ref|XP_010951519.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit beta isoform [Camelus bactrianus]
 gb|EDL35413.1| protein phosphatase 2 (formerly 2A), catalytic subunit, beta 
isoform [Mus musculus]
 gb|EDM09140.1| protein phosphatase 2 (formerly 2A), catalytic subunit, beta 
isoform [Rattus norvegicus]
Length=244

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  204  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  244



>ref|XP_007062900.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit beta isoform [Chelonia mydas]
Length=244

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  204  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  244



>gb|AEB61362.1| serine/threonine-protein phosphatase 2a catalytic subunit alpha 
isoform-like protein, partial [Equus caballus]
Length=252

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  212  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  252



>gb|AAH19161.1| Ppp2cb protein [Mus musculus]
Length=278

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  238  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  278



>ref|XP_010847636.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit beta isoform, partial [Bison bison bison]
Length=292

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+ILE+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  252  CGNQAAILELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  292



>ref|XP_009933773.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit beta isoform [Opisthocomus hoazin]
Length=244

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  204  CGNQAAIMELDDTLQYSFLQFDPAPRRGEPHVTRRTPDYFL  244



>gb|KFM22989.1| Serine/threonine-protein phosphatase PP2A-2 catalytic subunit 
[Auxenochlorella protothecoides]
Length=311

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMA+I+EVD+    TF QFDPAPRRGEP+VTRRTP+YFL
Sbjct  271  CGNMAAIMEVDETMVKTFSQFDPAPRRGEPEVTRRTPDYFL  311



>ref|XP_001602506.2| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform [Nasonia vitripennis]
Length=309

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  269  CGNQAAIMELDDALKYSFLQFDPAPRRGEPHVTRRTPDYFL  309



>gb|ELU08354.1| hypothetical protein CAPTEDRAFT_227677 [Capitella teleta]
Length=309

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  269  CGNQAAIMELDDALKYSFLQFDPAPRRGEPHVTRRTPDYFL  309



>gb|EFN88778.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform [Harpegnathos saltator]
Length=288

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  248  CGNQAAIMELDDALKYSFLQFDPAPRRGEPHVTRRTPDYFL  288



>gb|ENN77718.1| hypothetical protein YQE_05789, partial [Dendroctonus ponderosae]
 gb|ERL86376.1| hypothetical protein D910_03784 [Dendroctonus ponderosae]
Length=311

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  271  CGNQAAIMELDDALKYSFLQFDPAPRRGEPHVTRRTPDYFL  311



>gb|ABE98242.1| protein phosphatase-2A catalytic subunit-like [Oreochromis mossambicus]
Length=309

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  269  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPQVTRRTPDYFL  309



>ref|XP_623105.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform isoform 1 [Apis mellifera]
 ref|XP_003394796.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform-like [Bombus terrestris]
 ref|XP_003485654.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform-like [Bombus impatiens]
 ref|XP_003692429.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform-like [Apis florea]
Length=309

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  269  CGNQAAIMELDDALKYSFLQFDPAPRRGEPHVTRRTPDYFL  309



>ref|XP_004342697.1| serine/threonine-protein phosphatase 2A catalytic subunit beta 
isoform [Capsaspora owczarzaki ATCC 30864]
 gb|EFW42964.1| serine/threonine-protein phosphatase 2A catalytic subunit beta 
isoform [Capsaspora owczarzaki ATCC 30864]
Length=303

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   +TF+QFDPAPRRGEP VTRRTP+YFL
Sbjct  263  CGNQAAIMELDDNLKYTFLQFDPAPRRGEPHVTRRTPDYFL  303



>ref|XP_009872784.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit beta isoform-like [Apaloderma vittatum]
Length=295

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  255  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  295



>emb|CDQ82738.1| unnamed protein product [Oncorhynchus mykiss]
Length=306

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  266  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  306



>ref|XP_009065210.1| hypothetical protein LOTGIDRAFT_184125 [Lottia gigantea]
 gb|ESO84082.1| hypothetical protein LOTGIDRAFT_184125 [Lottia gigantea]
Length=310

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  270  CGNQAAIMELDDALKYSFLQFDPAPRRGEPHVTRRTPDYFL  310



>emb|CAG12590.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=291

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  251  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  291



>ref|XP_002980611.1| hypothetical protein SELMODRAFT_178363 [Selaginella moellendorffii]
 gb|EFJ18262.1| hypothetical protein SELMODRAFT_178363 [Selaginella moellendorffii]
Length=306

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMA+I+E+D+  G TF+QF+PAPR+ EPDVTR+TP+YFL
Sbjct  266  CGNMAAIMEIDETMGRTFLQFEPAPRQSEPDVTRKTPDYFL  306



>gb|KFP22633.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Egretta garzetta]
Length=275

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  235  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  275



>gb|ERE68925.1| serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform-like protein [Cricetulus griseus]
Length=283

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  243  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  283



>gb|EGI68551.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform [Acromyrmex echinatior]
Length=308

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  268  CGNQAAIMELDDALKYSFLQFDPAPRRGEPHVTRRTPDYFL  308



>ref|XP_008934414.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit beta isoform, partial [Merops nubicus]
 ref|XP_009070409.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform, partial [Acanthisitta chloris]
 ref|XP_009491981.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform, partial [Pelecanus crispus]
 ref|XP_009946674.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform, partial [Leptosomus discolor]
 ref|XP_010076168.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform, partial [Pterocles gutturalis]
 ref|XP_010206078.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform, partial [Colius striatus]
 gb|EHH26790.1| hypothetical protein EGK_16857, partial [Macaca mulatta]
 gb|EMC78173.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Columba livia]
 gb|KFM12086.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Aptenodytes forsteri]
 gb|KFO13534.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Balearica regulorum gibbericeps]
 gb|KFO58305.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Corvus brachyrhynchos]
 gb|KFO70045.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Cuculus canorus]
 gb|KFO91875.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Buceros rhinoceros silvestris]
 gb|KFP28143.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Colius striatus]
 gb|KFP59097.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Cariama cristata]
 gb|KFQ03818.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Haliaeetus albicilla]
 gb|KFQ27321.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Mesitornis unicolor]
 gb|KFQ58571.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Pelecanus crispus]
 gb|KFQ68635.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Phaethon lepturus]
 gb|KFQ87225.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Phoenicopterus ruber ruber]
 gb|KFQ96378.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Nipponia nippon]
 gb|KFR01821.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Opisthocomus hoazin]
 gb|KFU83930.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Chaetura pelagica]
 gb|KFV10325.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Tauraco erythrolophus]
 gb|KFV41447.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Gavia stellata]
 gb|KFV55963.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Tyto alba]
 gb|KFV73553.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Struthio camelus australis]
 gb|KFV97120.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Fulmarus glacialis]
 gb|KFW66182.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Pygoscelis adeliae]
 gb|KFW79531.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Manacus vitellinus]
 gb|KFZ67737.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Podiceps cristatus]
 gb|KGL86983.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Charadrius vociferus]
Length=275

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  235  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  275



>ref|XP_002976892.1| hypothetical protein SELMODRAFT_175936 [Selaginella moellendorffii]
 gb|EFJ22002.1| hypothetical protein SELMODRAFT_175936 [Selaginella moellendorffii]
Length=308

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGNMA+I+E+D+  G TF+QF+PAPR+ EPDVTR+TP+YFL
Sbjct  268  CGNMAAIMEIDETMGRTFLQFEPAPRQSEPDVTRKTPDYFL  308



>ref|XP_011049527.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
2A catalytic subunit alpha isoform [Acromyrmex echinatior]
Length=310

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  270  CGNQAAIMELDDALKYSFLQFDPAPRRGEPHVTRRTPDYFL  310



>ref|XP_005343168.1| PREDICTED: LOW QUALITY PROTEIN: protein phosphatase 2, catalytic 
subunit, beta isozyme [Ictidomys tridecemlineatus]
Length=277

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  237  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  277



>ref|XP_010887912.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit beta isoform isoform X2 [Esox lucius]
Length=279

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  239  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  279



>gb|KFP73348.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Apaloderma vittatum]
Length=279

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  239  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  279



>ref|XP_008553427.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit beta isoform [Microplitis demolitor]
 ref|XP_008553428.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit beta isoform [Microplitis demolitor]
Length=309

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  269  CGNQAAIMELDDALKYSFLQFDPAPRRGEPHVTRRTPDYFL  309



>ref|XP_002426726.1| serine/threonine-protein phosphatase PP-V, putative [Pediculus 
humanus corporis]
 gb|EEB13988.1| serine/threonine-protein phosphatase PP-V, putative [Pediculus 
humanus corporis]
Length=309

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  269  CGNQAAIMELDDALKYSFLQFDPAPRRGEPHVTRRTPDYFL  309



>gb|KFP40133.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Chlamydotis macqueenii]
 gb|KFP77845.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Acanthisitta chloris]
 gb|KFQ08545.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Leptosomus discolor]
 gb|KFQ25946.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Merops nubicus]
 gb|KFQ41778.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Nestor notabilis]
 gb|KFV10660.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Pterocles gutturalis]
 gb|KFV61256.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Picoides pubescens]
 gb|KFV98045.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Eurypyga helias]
 gb|KFW73854.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Phalacrocorax carbo]
 gb|KFZ47128.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Caprimulgus carolinensis]
 gb|KGL81007.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Tinamus guttatus]
Length=276

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  236  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  276



>gb|ETE70021.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Ophiophagus hannah]
Length=276

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  236  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  276



>ref|XP_003133430.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit beta isoform isoform X1 [Sus scrofa]
Length=287

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  247  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  287



>ref|XP_002197656.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform, partial [Taeniopygia guttata]
 gb|EHH54524.1| hypothetical protein EGM_15385, partial [Macaca fascicularis]
Length=274

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  234  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  274



>ref|XP_009876544.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit alpha isoform, partial [Apaloderma vittatum]
Length=283

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  243  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  283



>gb|ACI67354.1| Serine/threonine-protein phosphatase 2A catalytic subunit beta 
isoform [Salmo salar]
 emb|CDQ77255.1| unnamed protein product [Oncorhynchus mykiss]
Length=309

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  269  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  309



>gb|EKC38582.1| Serine/threonine-protein phosphatase 2A catalytic subunit beta 
isoform [Crassostrea gigas]
Length=312

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  272  CGNQAAIMELDDSLKYSFLQFDPAPRRGEPHVTRRTPDYFL  312



>gb|EHH28397.1| Serine/threonine-protein phosphatase 2A catalytic subunit beta 
isoform, partial [Macaca mulatta]
 gb|EHH61991.1| Serine/threonine-protein phosphatase 2A catalytic subunit beta 
isoform, partial [Macaca fascicularis]
 gb|KFO61984.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Corvus brachyrhynchos]
 gb|KFU93112.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Chaetura pelagica]
 gb|KFV39541.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Gavia stellata]
 gb|KFW81589.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha 
isoform, partial [Manacus vitellinus]
Length=276

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    CGNMASILEVDDCKGHTFIQFDPAPRRGEPDVTRRTPEYFL  124
            CGN A+I+E+DD   ++F+QFDPAPRRGEP VTRRTP+YFL
Sbjct  236  CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL  276



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1259863733868