BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c120098_g1_i1 len=115 path=[1:0-114]

Length=115
                                                                      Score     E

gb|EMT12108.1|  hypothetical protein F775_04960                       79.7    5e-16   
gb|EMS47553.1|  Glutamyl-tRNA reductase 1, chloroplastic              78.6    2e-15   
gb|EMT06479.1|  hypothetical protein F775_22266                       79.0    2e-15   
gb|EMT27510.1|  hypothetical protein F775_52220                       76.6    1e-14   
gb|AAB42154.1|  ORF                                                   72.0    2e-14   Hordeum vulgare [barley]
gb|EMS50467.1|  Retrovirus-related Pol polyprotein from transposo...  73.9    1e-13   
gb|EMT27558.1|  Putative kinase-like protein TMKL1                    70.9    1e-12   
gb|AAR06328.1|  putative polyprotein                                  70.9    1e-12   Oryza sativa Japonica Group [Japonica rice]
gb|ABF97393.1|  retrotransposon protein, putative, Ty1-copia subc...  70.9    1e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EMT21951.1|  ABC transporter C family member 10                    70.9    1e-12   
gb|ABA99022.2|  retrotransposon protein, putative, Ty1-copia subc...  69.3    4e-12   Oryza sativa Japonica Group [Japonica rice]
gb|ABF97213.1|  retrotransposon protein, putative, Ty1-copia subc...  68.6    7e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAM74249.1|AC074355_11  Putative retroelement                      68.2    7e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAS01945.1|  putative polyprotein                                  68.6    7e-12   Oryza sativa Japonica Group [Japonica rice]
gb|ABA97342.2|  retrotransposon protein, putative, Ty1-copia subc...  68.6    8e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAL83352.1|AC074282_19  Putative polyprotein                       66.6    8e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAP52343.2|  retrotransposon protein, putative, Ty1-copia subc...  67.8    1e-11   Oryza sativa Japonica Group [Japonica rice]
gb|AAX96621.1|  retrotransposon protein, putative, Ty1-copia sub-...  67.0    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004978922.1|  PREDICTED: uncharacterized protein LOC101776990  67.0    3e-11   
gb|ABA97705.1|  retrotransposon protein, putative, Ty1-copia subc...  66.6    3e-11   Oryza sativa Japonica Group [Japonica rice]
emb|CAE02400.1|  OSJNBa0024J22.4                                      66.2    4e-11   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA22288.1|  polyprotein                                          66.2    5e-11   Oryza australiensis
gb|ABA98367.2|  retrotransposon protein, putative, Ty1-copia subc...  65.9    7e-11   Oryza sativa Japonica Group [Japonica rice]
gb|EMS45473.1|  Retrovirus-related Pol polyprotein from transposo...  65.1    1e-10   
gb|ADB85429.1|  putative retrotransposon protein                      65.1    1e-10   Phyllostachys edulis [kikko-chiku]
emb|CAE04999.2|  OSJNBb0093G06.7                                      65.1    1e-10   Oryza sativa Japonica Group [Japonica rice]
gb|ABG22008.1|  retrotransposon protein, putative, Ty1-copia subc...  64.7    2e-10   
gb|ABF97047.1|  retrotransposon protein, putative, Ty1-copia subc...  64.3    2e-10   Oryza sativa Japonica Group [Japonica rice]
gb|AAP44605.1|  putative polyprotein                                  64.3    3e-10   Oryza sativa Japonica Group [Japonica rice]
gb|AAC26250.1|  contains similarity to reverse transcriptase (Pfa...  63.5    3e-10   Arabidopsis thaliana [mouse-ear cress]
gb|EMT33737.1|  hypothetical protein F775_00472                       63.2    5e-10   
ref|XP_010695340.1|  PREDICTED: uncharacterized protein LOC104908001  58.9    1e-09   
emb|CAE03845.1|  OSJNBb0089K06.4                                      59.7    8e-09   Oryza sativa Japonica Group [Japonica rice]
gb|AAV85747.1|  Integrase core domain, putative                       59.7    1e-08   Oryza sativa Japonica Group [Japonica rice]
gb|ABA92210.1|  retrotransposon protein, putative, unclassified       58.9    1e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006465491.1|  PREDICTED: uncharacterized protein LOC102624640  58.5    3e-08   
gb|AAS90682.1|  pupative polyprotein                                  58.5    3e-08   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001174195.1|  Os05g0126900                                     58.2    3e-08   
gb|EJT45287.1|  Gag-Pol                                               57.8    4e-08   
ref|NP_001059496.1|  Os07g0434200                                     57.8    4e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008674202.1|  PREDICTED: retrovirus-related Pol polyprotei...  57.4    4e-08   
ref|XP_008651726.1|  PREDICTED: hypothetical protein isoform X1       57.4    5e-08   
ref|XP_004516035.1|  PREDICTED: uncharacterized protein LOC101492305  57.4    5e-08   
ref|XP_008647645.1|  PREDICTED: uncharacterized protein LOC100502...  57.4    5e-08   
ref|XP_008674201.1|  PREDICTED: uncharacterized protein LOC100279...  57.4    5e-08   
ref|XP_002447738.1|  hypothetical protein SORBIDRAFT_06g014835        54.3    6e-08   Sorghum bicolor [broomcorn]
emb|CAN63522.1|  hypothetical protein VITISV_044155                   53.9    8e-08   Vitis vinifera
emb|CCA77399.1|  hypothetical protein PIIN_11376                      55.5    8e-08   
gb|EXX50149.1|  gag-pol fusion protein                                57.0    8e-08   
emb|CAN79140.1|  hypothetical protein VITISV_040800                   53.5    9e-08   Vitis vinifera
emb|CAN63905.1|  hypothetical protein VITISV_044215                   53.5    1e-07   Vitis vinifera
ref|XP_006596772.1|  PREDICTED: uncharacterized mitochondrial pro...  53.5    1e-07   
emb|CAN82083.1|  hypothetical protein VITISV_015205                   53.5    1e-07   Vitis vinifera
ref|XP_008342037.1|  PREDICTED: uncharacterized protein LOC103404844  54.7    1e-07   
ref|XP_007034104.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  56.6    1e-07   
ref|XP_008350712.1|  PREDICTED: uncharacterized protein LOC103414077  54.7    1e-07   
ref|XP_008341769.1|  PREDICTED: uncharacterized protein LOC103404622  54.7    1e-07   
ref|NP_001061718.1|  Os08g0389500                                     56.2    2e-07   Oryza sativa Japonica Group [Japonica rice]
emb|CDF77009.1|  hypothetical transposable element-related protein    55.8    2e-07   
ref|XP_007044242.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  55.8    2e-07   
ref|XP_002464673.1|  hypothetical protein SORBIDRAFT_01g023130        55.8    2e-07   Sorghum bicolor [broomcorn]
ref|XP_002386126.1|  hypothetical protein MPER_15768                  52.4    2e-07   Moniliophthora perniciosa FA553
gb|EMT19664.1|  Putative LRR receptor-like serine/threonine-prote...  55.5    2e-07   
ref|XP_009602039.1|  PREDICTED: uncharacterized protein LOC104097202  55.5    2e-07   
ref|XP_011081378.1|  PREDICTED: uncharacterized protein LOC105164425  55.5    2e-07   
emb|CAN72518.1|  hypothetical protein VITISV_022708                   52.4    3e-07   Vitis vinifera
emb|CAN73613.1|  hypothetical protein VITISV_023299                   55.5    3e-07   Vitis vinifera
emb|CAN75761.1|  hypothetical protein VITISV_037422                   52.4    3e-07   Vitis vinifera
ref|XP_008342064.1|  PREDICTED: uncharacterized protein LOC103404876  53.9    3e-07   
emb|CAN66722.1|  hypothetical protein VITISV_003329                   55.5    3e-07   Vitis vinifera
emb|CAN61695.1|  hypothetical protein VITISV_029441                   55.5    3e-07   Vitis vinifera
emb|CAN80206.1|  hypothetical protein VITISV_039290                   54.7    3e-07   Vitis vinifera
ref|XP_008390461.1|  PREDICTED: uncharacterized protein LOC103452707  55.1    3e-07   
ref|XP_007022140.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  55.1    3e-07   
gb|AAF18630.1|AC006228_1  F5J5.1                                      55.5    3e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010027392.1|  PREDICTED: uncharacterized protein LOC104417889  54.7    3e-07   
emb|CCA76865.1|  hypothetical protein PIIN_10850                      54.7    3e-07   
ref|XP_008387315.1|  PREDICTED: uncharacterized protein LOC103449768  55.5    3e-07   
emb|CCA74168.1|  related to TY4B-Putative pseudo-TY4B                 54.7    4e-07   
ref|XP_007033041.1|  Uncharacterized protein TCM_019200               51.6    4e-07   
emb|CAN74826.1|  hypothetical protein VITISV_043646                   54.3    4e-07   Vitis vinifera
gb|AAD12997.1|  gag-pol polyprotein                                   55.1    4e-07   Zea mays [maize]
ref|XP_010026606.1|  PREDICTED: uncharacterized protein LOC104416977  54.7    4e-07   
emb|CAN69037.1|  hypothetical protein VITISV_026270                   54.7    4e-07   Vitis vinifera
ref|XP_008351447.1|  PREDICTED: dynamin-related protein 4C-like       55.1    4e-07   
emb|CAN71108.1|  hypothetical protein VITISV_001478                   55.1    4e-07   Vitis vinifera
emb|CAX68207.1|  Copia-like retrotransposon                           55.1    4e-07   
emb|CCA74619.1|  related to retrotransposon HobS hobase (N-termin...  52.8    4e-07   
emb|CAN78447.1|  hypothetical protein VITISV_026810                   55.1    4e-07   Vitis vinifera
emb|CAN80422.1|  hypothetical protein VITISV_008674                   51.6    4e-07   Vitis vinifera
ref|XP_008791387.1|  PREDICTED: uncharacterized protein LOC103708304  55.1    4e-07   
ref|XP_008363538.1|  PREDICTED: L-type lectin-domain containing r...  54.3    4e-07   
emb|CAN62509.1|  hypothetical protein VITISV_039839                   54.7    4e-07   Vitis vinifera
gb|AAD12998.1|  pol polyprotein                                       54.7    4e-07   Zea mays [maize]
emb|CAN65518.1|  hypothetical protein VITISV_004207                   52.0    4e-07   Vitis vinifera
emb|CAN74511.1|  hypothetical protein VITISV_011891                   54.7    4e-07   Vitis vinifera
emb|CCA73702.1|  hypothetical protein PIIN_07656                      54.7    4e-07   
gb|KFD67531.1|  hypothetical protein M514_20208                       53.5    4e-07   
emb|CAN64073.1|  hypothetical protein VITISV_038270                   54.7    5e-07   Vitis vinifera
ref|XP_010314349.1|  PREDICTED: uncharacterized protein LOC104645039  54.7    5e-07   
gb|ACZ04926.1|  polyprotein                                           54.7    5e-07   Agaricus bisporus var. bisporus
emb|CCA75805.1|  hypothetical protein PIIN_09793                      54.7    5e-07   
ref|XP_010030630.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  54.7    5e-07   
emb|CAN80084.1|  hypothetical protein VITISV_011294                   52.0    5e-07   Vitis vinifera
gb|KHN05285.1|  Retrovirus-related Pol polyprotein from transposo...  54.7    5e-07   
ref|XP_002442065.1|  hypothetical protein SORBIDRAFT_08g008672        54.3    5e-07   Sorghum bicolor [broomcorn]
ref|XP_011078646.1|  PREDICTED: uncharacterized protein LOC105162338  54.3    5e-07   
emb|CAN78764.1|  hypothetical protein VITISV_003317                   54.7    5e-07   Vitis vinifera
ref|XP_007028363.1|  Uncharacterized protein TCM_024129               53.9    5e-07   
ref|XP_010252449.1|  PREDICTED: uncharacterized protein LOC104594032  53.5    5e-07   
emb|CAN66083.1|  hypothetical protein VITISV_028833                   54.7    5e-07   Vitis vinifera
emb|CAN83623.1|  hypothetical protein VITISV_010870                   54.7    5e-07   Vitis vinifera
emb|CDO76034.1|  hypothetical protein BN946_scf184818.g2              54.7    6e-07   
ref|XP_008340360.1|  PREDICTED: uncharacterized protein LOC103403325  54.3    6e-07   
emb|CAN73096.1|  hypothetical protein VITISV_038066                   53.5    6e-07   Vitis vinifera
emb|CCA74092.1|  hypothetical protein PIIN_08046                      54.3    6e-07   
emb|CAN81793.1|  hypothetical protein VITISV_020571                   54.3    6e-07   Vitis vinifera
emb|CAN62045.1|  hypothetical protein VITISV_040357                   54.3    6e-07   Vitis vinifera
ref|XP_008352218.1|  PREDICTED: uncharacterized protein LOC103415694  54.3    6e-07   
emb|CAN65627.1|  hypothetical protein VITISV_032735                   54.3    6e-07   Vitis vinifera
emb|CAN64237.1|  hypothetical protein VITISV_042666                   51.6    6e-07   Vitis vinifera
ref|XP_008340383.1|  PREDICTED: uncharacterized protein LOC103403351  54.3    6e-07   
ref|XP_008675670.1|  PREDICTED: uncharacterized protein LOC103651749  53.9    6e-07   
emb|CAN78069.1|  hypothetical protein VITISV_032701                   54.3    6e-07   Vitis vinifera
gb|AAB61111.1|  Strong similarity to Zea mays retrotransposon Hop...  54.3    7e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006367551.1|  PREDICTED: uncharacterized protein LOC102604059  54.3    7e-07   
ref|XP_010068635.1|  PREDICTED: uncharacterized protein LOC104455561  53.9    7e-07   
ref|XP_002461816.1|  hypothetical protein SORBIDRAFT_02g008720        54.3    7e-07   Sorghum bicolor [broomcorn]
emb|CCA73545.1|  hypothetical protein PIIN_07498                      54.3    7e-07   
gb|EEC81933.1|  hypothetical protein OsI_25798                        54.3    7e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_006596648.1|  PREDICTED: uncharacterized protein DDB_G0271...  53.5    7e-07   
gb|AGW47867.1|  polyprotein                                           54.3    7e-07   
ref|NP_001176374.1|  Os11g0170700                                     53.9    7e-07   
ref|XP_002445775.1|  hypothetical protein SORBIDRAFT_07g025585        53.9    7e-07   Sorghum bicolor [broomcorn]
ref|XP_010526684.1|  PREDICTED: retrovirus-related Pol polyprotei...  53.9    7e-07   
ref|XP_002449917.1|  hypothetical protein SORBIDRAFT_05g025655        53.9    7e-07   Sorghum bicolor [broomcorn]
emb|CAN59916.1|  hypothetical protein VITISV_016016                   53.1    7e-07   Vitis vinifera
ref|XP_010526683.1|  PREDICTED: retrovirus-related Pol polyprotei...  53.9    7e-07   
ref|XP_010526682.1|  PREDICTED: retrovirus-related Pol polyprotei...  53.9    7e-07   
emb|CAN66999.1|  hypothetical protein VITISV_019171                   53.9    7e-07   Vitis vinifera
gb|AAX95066.1|  retrotransposon protein, putative, unclassified       54.3    8e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002459428.1|  hypothetical protein SORBIDRAFT_02g004525        53.9    8e-07   Sorghum bicolor [broomcorn]
emb|CAN63597.1|  hypothetical protein VITISV_019450                   50.8    8e-07   Vitis vinifera
ref|XP_008388960.1|  PREDICTED: DNA polymerase zeta catalytic sub...  54.3    8e-07   
emb|CAN82483.1|  hypothetical protein VITISV_006799                   53.9    8e-07   Vitis vinifera
emb|CAN70156.1|  hypothetical protein VITISV_016168                   53.9    8e-07   Vitis vinifera
gb|AAO52668.1|  putative gag-pol polyprotein                          52.8    8e-07   Aster yellows phytoplasma
ref|XP_010058883.1|  PREDICTED: uncharacterized protein LOC104446775  53.9    8e-07   
ref|XP_008229173.1|  PREDICTED: uncharacterized protein LOC103328554  54.3    8e-07   
ref|XP_010526681.1|  PREDICTED: retrovirus-related Pol polyprotei...  53.9    8e-07   
ref|XP_010526680.1|  PREDICTED: retrovirus-related Pol polyprotei...  53.9    8e-07   
gb|ABE88097.1|  Reverse transcriptase (RNA-dependent DNA polymerase)  52.8    8e-07   Medicago truncatula
ref|XP_010526678.1|  PREDICTED: retrovirus-related Pol polyprotei...  53.9    8e-07   
ref|XP_007002288.1|  hypothetical protein TREMEDRAFT_27029            53.9    8e-07   
ref|XP_007014182.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  53.5    8e-07   
emb|CCF52167.1|  related to retrotransposon HobS hobase               52.8    8e-07   
ref|XP_010662484.1|  PREDICTED: uncharacterized protein LOC104882143  53.9    8e-07   
gb|AAL56548.1|AF387862_2  pol polyprotein                             53.9    8e-07   Anopheles gambiae
emb|CAN83392.1|  hypothetical protein VITISV_041406                   53.9    9e-07   Vitis vinifera
emb|CAN81238.1|  hypothetical protein VITISV_031073                   53.9    9e-07   Vitis vinifera
emb|CAN71595.1|  hypothetical protein VITISV_010143                   53.9    9e-07   Vitis vinifera
emb|CAN71183.1|  hypothetical protein VITISV_033416                   53.9    9e-07   Vitis vinifera
emb|CAN78400.1|  hypothetical protein VITISV_000778                   51.2    9e-07   Vitis vinifera
emb|CAN66092.1|  hypothetical protein VITISV_006453                   51.2    9e-07   Vitis vinifera
emb|CAN66418.1|  hypothetical protein VITISV_029181                   51.2    9e-07   Vitis vinifera
emb|CCA72510.1|  hypothetical protein PIIN_06447                      53.5    9e-07   
emb|CAN66447.1|  hypothetical protein VITISV_043080                   50.8    9e-07   Vitis vinifera
gb|KFD64006.1|  hypothetical protein M514_23854                       53.9    9e-07   
emb|CAN61645.1|  hypothetical protein VITISV_036929                   53.9    9e-07   Vitis vinifera
emb|CAN62431.1|  hypothetical protein VITISV_015835                   53.9    9e-07   Vitis vinifera
emb|CAD39978.2|  OSJNBa0032B23.6                                      53.9    1e-06   Oryza sativa Japonica Group [Japonica rice]
emb|CAN74032.1|  hypothetical protein VITISV_042676                   50.8    1e-06   Vitis vinifera
emb|CAN67821.1|  hypothetical protein VITISV_025855                   53.9    1e-06   Vitis vinifera
emb|CAN82526.1|  hypothetical protein VITISV_028058                   53.9    1e-06   Vitis vinifera
emb|CAN73624.1|  hypothetical protein VITISV_042460                   53.9    1e-06   Vitis vinifera
ref|XP_002443869.1|  hypothetical protein SORBIDRAFT_07g003556        53.5    1e-06   Sorghum bicolor [broomcorn]
emb|CAN70862.1|  hypothetical protein VITISV_027144                   50.8    1e-06   Vitis vinifera
ref|XP_007028235.1|  Uncharacterized protein TCM_023856               50.8    1e-06   
emb|CAN69578.1|  hypothetical protein VITISV_030677                   50.8    1e-06   Vitis vinifera
ref|XP_006595312.1|  PREDICTED: uncharacterized protein LOC102668660  53.5    1e-06   
emb|CAN63452.1|  hypothetical protein VITISV_021405                   53.1    1e-06   Vitis vinifera
ref|XP_011070841.1|  PREDICTED: uncharacterized protein LOC105156417  53.5    1e-06   
gb|EMT25451.1|  hypothetical protein F775_09534                       53.5    1e-06   
gb|KFK27502.1|  hypothetical protein AALP_AA8G391300                  53.5    1e-06   
emb|CAN61004.1|  hypothetical protein VITISV_015023                   53.5    1e-06   Vitis vinifera
ref|XP_010273170.1|  PREDICTED: uncharacterized protein LOC104608783  53.5    1e-06   
emb|CAN76841.1|  hypothetical protein VITISV_004490                   53.5    1e-06   Vitis vinifera
ref|XP_004972302.1|  PREDICTED: uncharacterized protein LOC101778040  53.1    1e-06   
emb|CAN64686.1|  hypothetical protein VITISV_013732                   50.8    1e-06   Vitis vinifera
ref|XP_010270824.1|  PREDICTED: uncharacterized protein LOC104607033  53.1    1e-06   
emb|CAN60516.1|  hypothetical protein VITISV_010847                   50.8    1e-06   Vitis vinifera
ref|XP_009357571.1|  PREDICTED: uncharacterized protein LOC103948287  53.5    1e-06   
emb|CAN76768.1|  hypothetical protein VITISV_022901                   50.8    1e-06   Vitis vinifera
emb|CAN74499.1|  hypothetical protein VITISV_013001                   53.5    1e-06   Vitis vinifera
emb|CAN70361.1|  hypothetical protein VITISV_033646                   53.5    1e-06   Vitis vinifera
ref|XP_010233157.1|  PREDICTED: protein CHROMATIN REMODELING 24-like  53.5    1e-06   
ref|XP_008357351.1|  PREDICTED: uncharacterized protein LOC103421092  53.1    1e-06   
emb|CCA76306.1|  hypothetical protein PIIN_10301                      52.8    1e-06   
ref|XP_010662546.1|  PREDICTED: uncharacterized protein LOC104882159  53.5    1e-06   
emb|CAN68132.1|  hypothetical protein VITISV_027227                   52.0    1e-06   Vitis vinifera
emb|CAN68711.1|  hypothetical protein VITISV_015847                   53.5    1e-06   Vitis vinifera
emb|CAN80320.1|  hypothetical protein VITISV_034560                   53.5    1e-06   Vitis vinifera
emb|CAN61929.1|  hypothetical protein VITISV_014855                   53.5    1e-06   Vitis vinifera
ref|XP_007048694.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  51.2    1e-06   
emb|CAN62394.1|  hypothetical protein VITISV_021305                   53.5    1e-06   Vitis vinifera
emb|CAN79142.1|  hypothetical protein VITISV_040460                   53.5    1e-06   Vitis vinifera
gb|AAD22155.1|AF061282_8  polyprotein                                 53.5    1e-06   Sorghum bicolor [broomcorn]
emb|CAN64963.1|  hypothetical protein VITISV_002891                   53.5    1e-06   Vitis vinifera
gb|KFD67433.1|  hypothetical protein M514_20469                       53.5    1e-06   
ref|XP_007002292.1|  hypothetical protein TREMEDRAFT_27045            53.1    1e-06   
emb|CAN78154.1|  hypothetical protein VITISV_032622                   53.5    1e-06   Vitis vinifera
emb|CAN75041.1|  hypothetical protein VITISV_027174                   53.5    1e-06   Vitis vinifera
emb|CAN82851.1|  hypothetical protein VITISV_027998                   53.5    1e-06   Vitis vinifera
emb|CAN69715.1|  hypothetical protein VITISV_011263                   53.5    1e-06   Vitis vinifera
emb|CAN63908.1|  hypothetical protein VITISV_044218                   53.5    1e-06   Vitis vinifera
emb|CAN65808.1|  hypothetical protein VITISV_033389                   53.5    1e-06   Vitis vinifera
emb|CAN73437.1|  hypothetical protein VITISV_031733                   53.5    1e-06   Vitis vinifera
ref|XP_010108259.1|  Retrovirus-related Pol polyprotein from tran...  52.8    1e-06   
emb|CAN72447.1|  hypothetical protein VITISV_027001                   53.1    1e-06   Vitis vinifera
emb|CAN74430.1|  hypothetical protein VITISV_010987                   53.5    1e-06   Vitis vinifera
emb|CAN63912.1|  hypothetical protein VITISV_044222                   53.1    1e-06   Vitis vinifera
ref|XP_007031516.1|  Uncharacterized protein TCM_016911               52.4    1e-06   
emb|CAN61034.1|  hypothetical protein VITISV_041749                   52.8    1e-06   Vitis vinifera
ref|XP_009792311.1|  PREDICTED: uncharacterized protein LOC104239381  53.1    1e-06   
ref|XP_007024187.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  53.1    1e-06   
emb|CAN70474.1|  hypothetical protein VITISV_022082                   50.4    1e-06   Vitis vinifera
gb|KFK32854.1|  hypothetical protein AALP_AA6G295700                  53.1    1e-06   
ref|XP_011073063.1|  PREDICTED: uncharacterized protein LOC105158123  52.8    1e-06   
ref|XP_007010988.1|  Uncharacterized protein TCM_045138               51.2    1e-06   
ref|XP_010045532.1|  PREDICTED: uncharacterized protein LOC104434266  52.0    1e-06   
emb|CAN68148.1|  hypothetical protein VITISV_035665                   53.5    1e-06   Vitis vinifera
ref|XP_010099335.1|  hypothetical protein L484_000113                 52.0    1e-06   
emb|CAN65078.1|  hypothetical protein VITISV_009543                   52.8    2e-06   Vitis vinifera
emb|CAN73953.1|  hypothetical protein VITISV_025588                   53.1    2e-06   Vitis vinifera
ref|XP_009789396.1|  PREDICTED: uncharacterized protein LOC104237026  50.4    2e-06   
emb|CAN74984.1|  hypothetical protein VITISV_035210                   53.1    2e-06   Vitis vinifera
emb|CAN74421.1|  hypothetical protein VITISV_010977                   53.1    2e-06   Vitis vinifera
ref|XP_007000815.1|  hypothetical protein TREMEDRAFT_26944            52.8    2e-06   
gb|AAB51275.1|  reverse transcriptase, gag, polyprotein               53.1    2e-06   Volvox carteri f. nagariensis
emb|CAN81384.1|  hypothetical protein VITISV_000819                   50.1    2e-06   Vitis vinifera
emb|CAN65591.1|  hypothetical protein VITISV_042091                   53.1    2e-06   Vitis vinifera
ref|XP_008238300.1|  PREDICTED: uncharacterized protein LOC103336939  53.1    2e-06   
ref|XP_011014816.1|  PREDICTED: uncharacterized protein LOC105118536  53.1    2e-06   
ref|XP_010068692.1|  PREDICTED: uncharacterized protein LOC104455629  53.1    2e-06   
emb|CAN74165.1|  hypothetical protein VITISV_026445                   52.4    2e-06   Vitis vinifera
ref|XP_004240848.2|  PREDICTED: uncharacterized protein LOC101249647  53.1    2e-06   
emb|CAC95126.1|  gag-pol polyprotein                                  53.1    2e-06   Populus deltoides
emb|CAN77322.1|  hypothetical protein VITISV_002172                   52.8    2e-06   Vitis vinifera
emb|CAN64613.1|  hypothetical protein VITISV_030850                   52.8    2e-06   Vitis vinifera
ref|XP_004153049.1|  PREDICTED: uncharacterized mitochondrial pro...  52.4    2e-06   
ref|XP_008240661.1|  PREDICTED: uncharacterized protein LOC103339149  53.1    2e-06   
emb|CAN79309.1|  hypothetical protein VITISV_020559                   53.1    2e-06   Vitis vinifera
ref|XP_004243080.1|  PREDICTED: uncharacterized protein LOC101259058  53.1    2e-06   
ref|XP_010451614.1|  PREDICTED: (Z)-gamma-bisabolene synthase 1-like  52.8    2e-06   
emb|CAB10526.1|  retrotransposon like protein                         53.1    2e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AAP44677.1|  putative gag-pol polyprotein                          53.1    2e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008223145.1|  PREDICTED: uncharacterized protein LOC103322965  53.1    2e-06   
emb|CAN60373.1|  hypothetical protein VITISV_034932                   53.1    2e-06   Vitis vinifera
ref|XP_008375643.1|  PREDICTED: uncharacterized protein LOC103438878  52.8    2e-06   
ref|XP_009374077.1|  PREDICTED: uncharacterized protein LOC103963017  52.4    2e-06   
gb|ABF99351.1|  retrotransposon protein, putative, unclassified       52.8    2e-06   Oryza sativa Japonica Group [Japonica rice]
emb|CAN65095.1|  hypothetical protein VITISV_011639                   53.1    2e-06   Vitis vinifera
emb|CAN76634.1|  hypothetical protein VITISV_019994                   52.4    2e-06   Vitis vinifera
emb|CAN80566.1|  hypothetical protein VITISV_029672                   53.1    2e-06   Vitis vinifera
ref|XP_008441937.1|  PREDICTED: uncharacterized protein LOC103485932  52.4    2e-06   
emb|CAN68398.1|  hypothetical protein VITISV_007896                   52.8    2e-06   Vitis vinifera
ref|XP_009787038.1|  PREDICTED: uncharacterized protein LOC104235061  52.0    2e-06   
emb|CAN79747.1|  hypothetical protein VITISV_008704                   50.1    2e-06   Vitis vinifera
ref|XP_010039830.1|  PREDICTED: uncharacterized protein LOC104428559  52.8    2e-06   
emb|CAN83798.1|  hypothetical protein VITISV_039072                   52.8    2e-06   Vitis vinifera
ref|XP_009621229.1|  PREDICTED: uncharacterized protein LOC104112894  52.8    2e-06   
gb|AAU93584.2|  Polyprotein, putative                                 52.8    2e-06   Solanum demissum
ref|XP_010064534.1|  PREDICTED: uncharacterized protein LOC104451617  51.2    2e-06   
emb|CAN67064.1|  hypothetical protein VITISV_017541                   52.8    2e-06   Vitis vinifera
emb|CAN73399.1|  hypothetical protein VITISV_006541                   52.8    2e-06   Vitis vinifera
ref|XP_010474159.1|  PREDICTED: uncharacterized protein LOC104753632  52.0    2e-06   
ref|XP_008352732.1|  PREDICTED: uncharacterized protein LOC103416253  52.8    2e-06   
emb|CAN64925.1|  hypothetical protein VITISV_039686                   50.1    2e-06   Vitis vinifera
emb|CAN76465.1|  hypothetical protein VITISV_007267                   52.8    2e-06   Vitis vinifera
emb|CAN73567.1|  hypothetical protein VITISV_003451                   52.8    2e-06   
emb|CAN66637.1|  hypothetical protein VITISV_011340                   52.8    2e-06   
emb|CAN83369.1|  hypothetical protein VITISV_011463                   52.8    2e-06   
ref|XP_007037406.1|  Uncharacterized protein TCM_014078               51.6    2e-06   
ref|XP_008363252.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  52.4    2e-06   
ref|XP_009344163.1|  PREDICTED: uncharacterized protein LOC103936058  50.8    2e-06   
ref|XP_004305316.1|  PREDICTED: uncharacterized protein LOC101302857  52.4    2e-06   
ref|XP_006493639.1|  PREDICTED: LRR receptor-like serine/threonin...  52.8    2e-06   
ref|XP_011093964.1|  PREDICTED: uncharacterized protein LOC105173784  50.8    2e-06   
ref|XP_008223780.1|  PREDICTED: LIM domain kinase 1-like              52.4    2e-06   
emb|CAN75466.1|  hypothetical protein VITISV_025054                   52.8    2e-06   
emb|CAN64190.1|  hypothetical protein VITISV_002428                   52.8    2e-06   
ref|XP_010236748.1|  PREDICTED: uncharacterized protein LOC104584242  52.4    2e-06   
gb|AAD32906.1|  putative retroelement pol polyprotein                 52.4    2e-06   
gb|AAU90089.1|  putative polyprotein                                  52.8    2e-06   
dbj|BAG72096.1|  Gag-protease-integrase-RT-RNaseH polyprotein         52.8    3e-06   
ref|XP_008369700.1|  PREDICTED: uncharacterized protein LOC103433244  52.4    3e-06   
emb|CAN69396.1|  hypothetical protein VITISV_021034                   52.8    3e-06   
dbj|BAG94704.1|  unnamed protein product                              52.4    3e-06   
emb|CAN65883.1|  hypothetical protein VITISV_017046                   51.6    3e-06   
emb|CAN78876.1|  hypothetical protein VITISV_033245                   51.6    3e-06   
dbj|BAK41512.1|  C-end truncated polyprotein                          52.4    3e-06   
ref|XP_010025850.1|  PREDICTED: uncharacterized protein LOC104416112  52.8    3e-06   
ref|XP_007036176.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  50.8    3e-06   
gb|AAM18738.1|AC092548_16  putative gag-pol polyprotein               52.8    3e-06   
ref|XP_008357860.1|  PREDICTED: uncharacterized protein LOC103421593  52.4    3e-06   
gb|EGU72538.1|  hypothetical protein FOXB_16953                       49.7    3e-06   
ref|XP_009796879.1|  PREDICTED: uncharacterized protein LOC104243397  52.4    3e-06   
ref|XP_010656794.1|  PREDICTED: uncharacterized protein LOC104880778  52.4    3e-06   
emb|CAN76494.1|  hypothetical protein VITISV_024984                   52.4    3e-06   
ref|XP_011070687.1|  PREDICTED: uncharacterized protein LOC105156289  52.4    3e-06   
gb|AAK62788.1|AC027036_9  polyprotein, putative                       52.4    3e-06   
ref|XP_010059512.1|  PREDICTED: uncharacterized protein LOC104447480  52.4    3e-06   
ref|XP_007044444.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  52.0    3e-06   
gb|KFL89552.1|  hypothetical protein AmDm5_1575                       52.4    3e-06   
gb|AAP53325.2|  retrotransposon protein, putative, Ty1-copia subc...  52.4    3e-06   
ref|XP_008382206.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  52.4    3e-06   
gb|AAG10817.1|AC011808_5  Putative retroelement polyprotein           52.4    3e-06   
ref|XP_008385226.1|  PREDICTED: uncharacterized protein LOC103447800  52.4    3e-06   
emb|CAN73466.1|  hypothetical protein VITISV_044336                   49.7    3e-06   
emb|CAN74229.1|  hypothetical protein VITISV_000584                   52.4    3e-06   
ref|XP_009789097.1|  PREDICTED: uncharacterized protein LOC104236787  52.4    3e-06   
emb|CAN72141.1|  hypothetical protein VITISV_017108                   52.4    3e-06   
ref|XP_010648882.1|  PREDICTED: uncharacterized protein LOC100245431  52.4    3e-06   
ref|XP_007050318.1|  Uncharacterized protein TCM_004065               52.4    3e-06   
ref|XP_008380982.1|  PREDICTED: uncharacterized protein LOC103443863  51.2    3e-06   
ref|XP_010531643.1|  PREDICTED: uncharacterized protein LOC104807900  52.4    3e-06   
dbj|BAB10503.1|  retroelement pol polyprotein-like                    52.4    3e-06   
ref|XP_008358405.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  52.4    3e-06   
ref|XP_008779710.1|  PREDICTED: uncharacterized protein LOC103699470  50.8    3e-06   
emb|CAN81016.1|  hypothetical protein VITISV_025518                   52.4    3e-06   
dbj|BAA78424.1|  polyprotein                                          52.4    3e-06   
ref|XP_009803862.1|  PREDICTED: uncharacterized protein LOC104249184  52.0    3e-06   
dbj|BAA78427.1|  polyprotein                                          52.4    3e-06   
dbj|BAM44532.1|  polyprotein                                          52.4    3e-06   
dbj|BAM44531.1|  polyprotein                                          52.4    3e-06   
dbj|BAM44530.1|  polyprotein                                          52.4    3e-06   
dbj|BAM44529.1|  polyprotein                                          52.4    3e-06   
gb|AAC79110.1|  putative polyprotein of LTR transposon                52.4    3e-06   
dbj|BAA78426.1|  polyprotein                                          52.4    3e-06   
dbj|BAM44535.1|  polyprotein                                          52.4    3e-06   
dbj|BAM44534.1|  polyprotein                                          52.4    3e-06   
dbj|BAM42650.1|  Polyprotein                                          52.4    3e-06   
dbj|BAM42649.1|  Polyprotein                                          52.4    3e-06   
dbj|BAM42647.1|  polyprotein                                          52.4    3e-06   
dbj|BAM42646.1|  polyprotein                                          52.4    3e-06   
emb|CAN78448.1|  hypothetical protein VITISV_026811                   51.6    3e-06   
emb|CAN76029.1|  hypothetical protein VITISV_016069                   52.4    3e-06   
ref|XP_006477890.1|  PREDICTED: uncharacterized protein LOC102616497  52.0    4e-06   
gb|KHN39056.1|  Retrovirus-related Pol polyprotein from transposo...  49.3    4e-06   
gb|AAF18643.1|AC006228_14  F5J5.14                                    52.0    4e-06   
ref|NP_001059837.1|  Os07g0528100                                     52.0    4e-06   
ref|XP_010646000.1|  PREDICTED: uncharacterized protein LOC104878021  52.0    4e-06   
gb|ABR67407.1|  integrase                                             52.0    4e-06   
emb|CCA77031.1|  hypothetical protein PIIN_11016                      51.6    4e-06   
ref|XP_009338880.1|  PREDICTED: uncharacterized protein LOC103931184  52.0    4e-06   
emb|CDO72947.1|  hypothetical protein BN946_scf185002.g132            52.0    4e-06   
emb|CAN75475.1|  hypothetical protein VITISV_006889                   52.0    4e-06   
gb|ABV72583.1|  unknown                                               51.6    4e-06   
emb|CAN63402.1|  hypothetical protein VITISV_030427                   52.0    4e-06   
emb|CAN83069.1|  hypothetical protein VITISV_008960                   51.6    4e-06   
ref|XP_010110245.1|  ABC transporter C family member 2                52.0    4e-06   
gb|EKD00935.1|  hypothetical protein A1Q2_04808                       52.0    4e-06   
gb|EJT52847.1|  hypothetical protein A1Q1_01120                       52.0    4e-06   
gb|KFD59289.1|  hypothetical protein M514_28532                       49.7    4e-06   
ref|XP_008369089.1|  PREDICTED: uncharacterized protein LOC103432662  52.0    4e-06   
ref|XP_010097678.1|  hypothetical protein L484_023818                 52.0    4e-06   
gb|ACB45089.1|  putative polyprotein                                  52.0    4e-06   
ref|XP_004487252.1|  PREDICTED: uncharacterized protein LOC101509015  51.2    4e-06   
gb|ABA91088.1|  retrotransposon protein, putative, Ty1-copia subc...  52.0    4e-06   
ref|XP_007024404.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  50.8    4e-06   
ref|XP_009354183.1|  PREDICTED: uncharacterized protein LOC103945350  52.0    4e-06   
ref|XP_010059700.1|  PREDICTED: uncharacterized protein LOC104447686  51.6    4e-06   
gb|AIC77183.1|  polyprotein                                           52.0    4e-06   
emb|CAN76606.1|  hypothetical protein VITISV_012935                   52.0    4e-06   
emb|CAN70298.1|  hypothetical protein VITISV_001396                   52.0    4e-06   
gb|ABA95230.1|  retrotransposon protein, putative, unclassified       52.0    4e-06   
ref|XP_010107342.1|  hypothetical protein L484_008148                 50.4    4e-06   
gb|AFG24185.1|  gag-pol polyprotein                                   52.0    4e-06   
ref|XP_772253.1|  hypothetical protein CNBM0210                       52.0    4e-06   
emb|CAN74695.1|  hypothetical protein VITISV_024648                   52.0    4e-06   
ref|XP_010265970.1|  PREDICTED: uncharacterized protein LOC104603606  51.6    4e-06   
emb|CAN83990.1|  hypothetical protein VITISV_018454                   52.0    4e-06   
emb|CAE75905.1|  OSJNBa0088I22.18                                     51.6    4e-06   
ref|XP_010066627.1|  PREDICTED: uncharacterized protein LOC104453715  51.6    4e-06   
ref|XP_008356672.1|  PREDICTED: uncharacterized protein LOC103420386  52.0    5e-06   
gb|ABF81447.1|  NBS type disease resistance protein                   51.6    5e-06   
ref|XP_007027564.1|  Uncharacterized protein TCM_022381               50.8    5e-06   
dbj|BAA78425.1|  polyprotein                                          52.0    5e-06   
dbj|BAK41507.1|  polyprotein                                          52.0    5e-06   
emb|CAN71447.1|  hypothetical protein VITISV_040904                   51.6    5e-06   
gb|ABA95721.1|  retrotransposon protein, putative, Ty1-copia subc...  51.6    5e-06   
emb|CAN64450.1|  hypothetical protein VITISV_023114                   51.6    5e-06   
ref|XP_010250373.1|  PREDICTED: uncharacterized protein LOC104592631  51.6    5e-06   
gb|ABA95567.1|  retrotransposon protein, putative, Ty1-copia subc...  52.0    5e-06   
emb|CAN81845.1|  hypothetical protein VITISV_037891                   51.6    5e-06   
ref|XP_009379511.1|  PREDICTED: uncharacterized protein LOC103967909  51.2    5e-06   
emb|CAN64861.1|  hypothetical protein VITISV_015433                   48.9    5e-06   
ref|XP_007011166.1|  Retrotransposon protein, unclassified, putative  51.6    5e-06   
ref|XP_008369774.1|  PREDICTED: probable E3 ubiquitin-protein lig...  51.2    5e-06   
ref|XP_007044560.1|  Retroelement polyprotein, putative               48.9    5e-06   
ref|XP_008677438.1|  PREDICTED: uncharacterized protein LOC100304...  51.6    5e-06   
ref|XP_009600361.1|  PREDICTED: uncharacterized protein LOC104095845  48.9    5e-06   
ref|XP_006347867.1|  PREDICTED: uncharacterized mitochondrial pro...  48.5    5e-06   
emb|CAN80438.1|  hypothetical protein VITISV_029932                   48.9    5e-06   
ref|XP_011100172.1|  PREDICTED: uncharacterized protein LOC105178407  51.2    5e-06   
gb|AGJ83729.1|  gag-pol polyprotein                                   51.6    5e-06   
ref|XP_008349811.1|  PREDICTED: uncharacterized protein LOC103413098  51.6    5e-06   
emb|CAN80368.1|  hypothetical protein VITISV_014720                   51.6    5e-06   
ref|XP_011045946.1|  PREDICTED: uncharacterized protein LOC105140704  50.8    5e-06   
ref|XP_007048348.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  50.1    5e-06   
ref|XP_010650252.1|  PREDICTED: uncharacterized protein LOC104879339  51.2    5e-06   
emb|CAN65233.1|  hypothetical protein VITISV_022975                   51.6    5e-06   
ref|XP_010531095.1|  PREDICTED: retrovirus-related Pol polyprotei...  51.2    5e-06   
gb|EPS67678.1|  hypothetical protein M569_07096                       51.6    6e-06   
ref|XP_008356319.1|  PREDICTED: uncharacterized protein LOC103420023  51.6    6e-06   
ref|XP_010495906.1|  PREDICTED: uncharacterized protein LOC104773055  51.2    6e-06   
emb|CAN71749.1|  hypothetical protein VITISV_029582                   48.9    6e-06   
emb|CCF47948.1|  uncharacterized protein UHOR_12258                   50.4    6e-06   
emb|CAN83377.1|  hypothetical protein VITISV_032772                   48.9    6e-06   
ref|XP_007019350.1|  Uncharacterized protein TCM_035373               51.2    6e-06   
emb|CAN64685.1|  hypothetical protein VITISV_020338                   51.6    6e-06   
ref|XP_003370196.1|  putative integrase core domain protein           51.6    6e-06   
emb|CAN82452.1|  hypothetical protein VITISV_003326                   51.6    6e-06   
gb|AFP55537.1|  retrotransposon polyprotein                           51.6    6e-06   
emb|CAN77295.1|  hypothetical protein VITISV_005638                   51.6    6e-06   
emb|CAN67762.1|  hypothetical protein VITISV_040650                   51.6    6e-06   
ref|XP_008229790.1|  PREDICTED: uncharacterized protein LOC103329135  51.2    6e-06   
emb|CAN61322.1|  hypothetical protein VITISV_012106                   51.6    6e-06   
emb|CAN62491.1|  hypothetical protein VITISV_031832                   51.2    6e-06   
emb|CAN79734.1|  hypothetical protein VITISV_039266                   50.4    6e-06   
ref|XP_010265038.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  51.6    6e-06   
emb|CAN79529.1|  hypothetical protein VITISV_026262                   51.2    6e-06   
ref|XP_003375245.1|  putative integrase core domain protein           51.6    6e-06   
ref|XP_010520610.1|  PREDICTED: uncharacterized protein LOC104799668  50.4    6e-06   
ref|XP_003376316.1|  retrovirus-related Pol polyprotein from tran...  51.2    6e-06   
ref|XP_008348733.1|  PREDICTED: uncharacterized protein LOC103411898  51.2    6e-06   
gb|EKD00102.1|  hypothetical protein A1Q2_05626                       51.6    6e-06   
emb|CAN65812.1|  hypothetical protein VITISV_002449                   48.5    6e-06   
emb|CAN82268.1|  hypothetical protein VITISV_009286                   51.2    6e-06   
ref|XP_008238972.1|  PREDICTED: uncharacterized protein LOC103337585  51.2    6e-06   
emb|CAN61065.1|  hypothetical protein VITISV_004411                   51.2    6e-06   
emb|CAN66376.1|  hypothetical protein VITISV_024110                   51.2    6e-06   
ref|XP_008237389.1|  PREDICTED: uncharacterized protein LOC103336134  51.2    6e-06   
emb|CAN82769.1|  hypothetical protein VITISV_037882                   51.6    7e-06   
ref|XP_009587582.1|  PREDICTED: uncharacterized protein LOC104085284  51.2    7e-06   
emb|CAN81833.1|  hypothetical protein VITISV_012250                   50.4    7e-06   
gb|ABB47665.1|  retrotransposon protein, putative, unclassified, ...  51.6    7e-06   
gb|ABA97777.1|  transposon protein, putative, unclassified            51.2    7e-06   
ref|YP_002000554.1|  orf490                                           50.8    7e-06   
emb|CAN69435.1|  hypothetical protein VITISV_004438                   48.5    7e-06   
emb|CAN78266.1|  hypothetical protein VITISV_006708                   50.8    7e-06   
ref|XP_008381548.1|  PREDICTED: uncharacterized protein LOC103444402  51.2    7e-06   
gb|KFD60116.1|  hypothetical protein M514_27697                       48.5    7e-06   
emb|CAN81674.1|  hypothetical protein VITISV_000590                   51.2    7e-06   
ref|XP_009844962.1|  hypothetical protein H257_17769                  51.2    7e-06   
emb|CAN69815.1|  hypothetical protein VITISV_010421                   50.8    7e-06   
gb|AAV44026.1|  hypothetical protein                                  51.2    7e-06   
emb|CAN71504.1|  hypothetical protein VITISV_021017                   50.8    7e-06   
ref|XP_004293019.1|  PREDICTED: L-type lectin-domain containing r...  50.8    7e-06   
ref|XP_007226724.1|  hypothetical protein PRUPE_ppa019750mg           50.8    7e-06   
ref|XP_010038913.1|  PREDICTED: uncharacterized protein LOC104427531  51.2    7e-06   
ref|YP_514636.1|  hypothetical protein OrsaiPp07                      50.8    7e-06   
ref|XP_006359484.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  51.2    7e-06   
emb|CAN61815.1|  hypothetical protein VITISV_009920                   51.2    7e-06   
ref|XP_010532348.1|  PREDICTED: uncharacterized protein LOC104808371  51.2    7e-06   
ref|XP_009758876.1|  PREDICTED: uncharacterized protein LOC104211510  50.4    8e-06   
ref|XP_007027404.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  51.2    8e-06   
dbj|BAB02990.1|  retroelement pol polyprotein-like                    51.2    8e-06   
ref|XP_008777490.1|  PREDICTED: uncharacterized protein LOC103697418  50.1    8e-06   
emb|CAN65108.1|  hypothetical protein VITISV_036622                   50.8    8e-06   
ref|XP_008664483.1|  PREDICTED: rho GTPase-activating protein REN...  51.2    8e-06   
ref|XP_008185344.1|  PREDICTED: uncharacterized protein LOC100166029  51.2    8e-06   
ref|XP_010274494.1|  PREDICTED: uncharacterized protein LOC104609809  50.8    8e-06   
ref|XP_009343023.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  51.2    8e-06   
emb|CAN73802.1|  hypothetical protein VITISV_001401                   51.2    8e-06   
ref|XP_004308668.1|  PREDICTED: uncharacterized protein LOC101303284  51.2    8e-06   
ref|XP_007046012.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  50.4    8e-06   
ref|XP_003368986.1|  retrovirus-related Pol polyprotein from tran...  50.8    8e-06   
emb|CAN59949.1|  hypothetical protein VITISV_043423                   51.2    8e-06   
ref|XP_010476033.1|  PREDICTED: uncharacterized protein LOC104755364  50.1    8e-06   
ref|XP_002442174.1|  hypothetical protein SORBIDRAFT_08g015513        50.8    8e-06   
gb|KHN01991.1|  Retrovirus-related Pol polyprotein from transposo...  51.2    8e-06   
ref|XP_007021177.1|  Uncharacterized protein TCM_031224               51.2    8e-06   
ref|XP_007022430.1|  Uncharacterized protein TCM_032871               50.1    9e-06   
emb|CAN64327.1|  hypothetical protein VITISV_039129                   50.8    9e-06   
gb|KFK44388.1|  hypothetical protein AALP_AA1G251100                  51.2    9e-06   
dbj|BAA78423.1|  polyprotein                                          51.2    9e-06   
gb|AAK62793.1|AC027036_14  polyprotein, putative                      51.2    9e-06   
ref|XP_008231793.1|  PREDICTED: uncharacterized protein LOC103330967  50.8    9e-06   
emb|CAN73102.1|  hypothetical protein VITISV_042891                   51.2    9e-06   
emb|CAH66391.1|  OSIGBa0134J07.9                                      51.2    9e-06   
gb|AAP46257.1|  putative polyprotein                                  51.2    9e-06   
ref|XP_010274374.1|  PREDICTED: uncharacterized protein LOC104609701  50.8    9e-06   
emb|CAN67546.1|  hypothetical protein VITISV_027734                   51.2    9e-06   
emb|CAN70817.1|  hypothetical protein VITISV_029336                   50.8    9e-06   
gb|AAT47077.1|  putative polyprotein                                  50.8    9e-06   
emb|CAN73795.1|  hypothetical protein VITISV_036649                   50.8    9e-06   
ref|XP_009601630.1|  PREDICTED: uncharacterized protein LOC104096885  50.1    9e-06   
emb|CBL94154.1|  putative polyprotein (retrotrasposon protein)        50.8    9e-06   
gb|ABA99232.1|  retrotransposon protein, putative, Ty1-copia subc...  50.1    9e-06   



>gb|EMT12108.1| hypothetical protein F775_04960 [Aegilops tauschii]
Length=610

 Score = 79.7 bits (195),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 35/38 (92%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            ENKWIFKKKTDADGNVT+YKARLVAKG+RQVQGIDY E
Sbjct  39   ENKWIFKKKTDADGNVTVYKARLVAKGFRQVQGIDYDE  76



>gb|EMS47553.1| Glutamyl-tRNA reductase 1, chloroplastic [Triticum urartu]
Length=637

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/38 (92%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            ENKWIFKKKTDADGN+TIYKARLVAKG+RQVQGIDY E
Sbjct  56   ENKWIFKKKTDADGNITIYKARLVAKGFRQVQGIDYDE  93



>gb|EMT06479.1| hypothetical protein F775_22266 [Aegilops tauschii]
Length=898

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/38 (92%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            ENKWIFKKKTDADGNVT+YKARLVAKG+RQVQGIDY E
Sbjct  798  ENKWIFKKKTDADGNVTVYKARLVAKGFRQVQGIDYDE  835



>gb|EMT27510.1| hypothetical protein F775_52220 [Aegilops tauschii]
Length=1712

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            ENKWIFKKKT+ADGNVT+YKARLVA G+RQVQGIDY E
Sbjct  222  ENKWIFKKKTEADGNVTVYKARLVAMGFRQVQGIDYDE  259



>gb|AAB42154.1| ORF [Hordeum vulgare subsp. vulgare]
Length=153

 Score = 72.0 bits (175),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            ENKWIFKKKTDA+ NVT+YKARLVAKG+RQ+QG+DY E
Sbjct  56   ENKWIFKKKTDANDNVTVYKARLVAKGFRQIQGVDYEE  93



>gb|EMS50467.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Triticum 
urartu]
Length=1808

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2     ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
             ENKWIFKKK DADGN  +YKARLVAKG+RQVQG+DY E
Sbjct  1424  ENKWIFKKKIDADGNAIVYKARLVAKGFRQVQGVDYGE  1461



>gb|EMT27558.1| Putative kinase-like protein TMKL1 [Aegilops tauschii]
Length=853

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDY  109
            ENKWIFK+KTDAD +VTIYKAR+V KG+RQVQG+DY
Sbjct  661  ENKWIFKRKTDADSSVTIYKARIVEKGFRQVQGVDY  696



>gb|AAR06328.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1063

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            E KW+FKKKTD DGNV IYKARLVAKG+RQ+QG+DY E
Sbjct  760  ECKWVFKKKTDVDGNVHIYKARLVAKGFRQIQGVDYDE  797



>gb|ABF97393.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1073

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            E KW+FKKKTD DGNV IYKARLVAKG+RQ+QG+DY E
Sbjct  770  ECKWVFKKKTDVDGNVHIYKARLVAKGFRQIQGVDYDE  807



>gb|EMT21951.1| ABC transporter C family member 10 [Aegilops tauschii]
Length=2297

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            ENKWIFK KTDAD +VTIYKAR+VAK +RQVQG+DY E
Sbjct  235  ENKWIFKTKTDADSSVTIYKARIVAKSFRQVQGVDYDE  272



>gb|ABA99022.2| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=829

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            E KW+FKKKTD DGNV IYKARLVAKG+RQ+QG+DY E
Sbjct  625  ECKWVFKKKTDVDGNVHIYKARLVAKGFRQIQGVDYDE  662



>gb|ABF97213.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1142

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            E KW FKKKTD DGNV IYKARLVAKG+RQ+QG+DY E
Sbjct  763  ECKWFFKKKTDVDGNVHIYKARLVAKGFRQIQGVDYDE  800



>gb|AAM74249.1|AC074355_11 Putative retroelement [Oryza sativa Japonica Group]
Length=700

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            E KW+FKKKTD DGNV IYKARLVAKG+RQ+QG++Y E
Sbjct  394  ECKWVFKKKTDVDGNVHIYKARLVAKGFRQIQGVNYDE  431



>gb|AAS01945.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1084

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            E KW FKKKTD DGNV IYKARLVAKG+RQ+QG+DY E
Sbjct  705  ECKWFFKKKTDVDGNVHIYKARLVAKGFRQIQGVDYDE  742



>gb|ABA97342.2| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1050

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            E KW+FKKKTD DGNV IYKARLVAKG+RQ+QG+DY E
Sbjct  588  EWKWVFKKKTDVDGNVHIYKARLVAKGFRQIQGVDYDE  625



>gb|AAL83352.1|AC074282_19 Putative polyprotein [Oryza sativa Japonica Group]
 gb|AAN04499.1| Putative polyprotein [Oryza sativa Japonica Group]
 gb|AAP51930.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=309

 Score = 66.6 bits (161),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            E KW+FKKKTD DGN+ IYK RLVAKG+RQ+QG+DY E
Sbjct  27   ECKWVFKKKTDVDGNIQIYKTRLVAKGFRQIQGVDYDE  64



>gb|AAP52343.2| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=655

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            E KW+FKKKTD DGNV IYKARLVAKG+RQ+QG++Y E
Sbjct  349  ECKWVFKKKTDVDGNVHIYKARLVAKGFRQIQGVNYDE  386



>gb|AAX96621.1| retrotransposon protein, putative, Ty1-copia sub-class [Oryza 
sativa Japonica Group]
 gb|ABA92973.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=591

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            E KW+FKKKTD DGNV IYK RLVAK YRQ+QG+DY E
Sbjct  473  ECKWVFKKKTDVDGNVHIYKIRLVAKSYRQIQGVDYDE  510



>ref|XP_004978922.1| PREDICTED: uncharacterized protein LOC101776990, partial [Setaria 
italica]
Length=1686

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            E KWI+KKK D DGNV IYKARLVAKG+RQVQG+DY E
Sbjct  251  ECKWIYKKKKDMDGNVHIYKARLVAKGFRQVQGVDYDE  288



>gb|ABA97705.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=810

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FKK TD DGNV IYKARLVAKG+RQ+QG+DY E
Sbjct  548  KWVFKKNTDVDGNVHIYKARLVAKGFRQIQGVDYDE  583



>emb|CAE02400.1| OSJNBa0024J22.4 [Oryza sativa Japonica Group]
 emb|CAD40526.2| OSJNBa0023J03.14 [Oryza sativa Japonica Group]
 emb|CAH66059.1| OSIGBa0125J07.8 [Oryza sativa Indica Group]
 emb|CAH66155.1| OSIGBa0113B06.1 [Oryza sativa Indica Group]
Length=704

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            E KW+FKKK D DGNV IYKARLVAKG+RQ+QG+DY E
Sbjct  346  ECKWVFKKKIDVDGNVHIYKARLVAKGFRQIQGVDYDE  383



>dbj|BAA22288.1| polyprotein [Oryza australiensis]
Length=1317

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            E KW+FKKK D DGNV IYKARLVAKG++Q+QG+DY E
Sbjct  840  ECKWLFKKKADMDGNVHIYKARLVAKGFKQIQGVDYDE  877



>gb|ABA98367.2| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1745

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2     ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
             E KW+FKKKT  DGNV IYKARLVAKG+RQ+QG+DY E
Sbjct  1326  ECKWVFKKKTYVDGNVHIYKARLVAKGFRQIQGVDYDE  1363



>gb|EMS45473.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Triticum 
urartu]
Length=914

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FKKKTD DGNV I+KARLVA GY QVQGIDY E
Sbjct  128  KWVFKKKTDVDGNVQIHKARLVAMGYGQVQGIDYDE  163



>gb|ADB85429.1| putative retrotransposon protein [Phyllostachys edulis]
Length=1313

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            E KWI+KKK D DGNV I+KARLVAKG+RQVQG+DY E
Sbjct  836  ECKWIYKKKIDMDGNVHIHKARLVAKGFRQVQGVDYDE  873



>emb|CAE04999.2| OSJNBb0093G06.7 [Oryza sativa Japonica Group]
Length=923

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            E KW+FKKK D DGNV +YKA+LVAKG+RQ+QG+DY E
Sbjct  723  ECKWVFKKKIDIDGNVHMYKAQLVAKGFRQIQGVDYDE  760



>gb|ABG22008.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=932

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDY  109
            E KW+FKKKTD DGNV IYKARLVAKG+RQ+Q +DY
Sbjct  521  ECKWVFKKKTDLDGNVHIYKARLVAKGFRQIQSVDY  556



>gb|ABF97047.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1248

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            E KWIFKK TD DG V IY ARLVAKG+RQ+QG+DY E
Sbjct  789  ECKWIFKKMTDVDGTVHIYNARLVAKGFRQIQGVDYDE  826



>gb|AAP44605.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1161

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            E KWIFKK TD DG V IY ARLVAKG+RQ+QG+DY E
Sbjct  702  ECKWIFKKMTDVDGTVHIYNARLVAKGFRQIQGVDYDE  739



>gb|AAC26250.1| contains similarity to reverse transcriptase (Pfam: rvt.hmm, 
score 19.29) [Arabidopsis thaliana]
 emb|CAB80804.1| putative retrotransposon protein [Arabidopsis thaliana]
Length=964

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            E KWIFKKK D DGN+ IYKA LVAKGY+QV GIDY E
Sbjct  487  ECKWIFKKKIDMDGNIQIYKAGLVAKGYKQVHGIDYDE  524



>gb|EMT33737.1| hypothetical protein F775_00472 [Aegilops tauschii]
Length=1111

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDY  109
            ENKWIFK  TDAD +VTIYKAR VAK +RQVQG+ Y
Sbjct  761  ENKWIFKSNTDADSSVTIYKARTVAKSFRQVQGVHY  796



>ref|XP_010695340.1| PREDICTED: uncharacterized protein LOC104908001 [Beta vulgaris 
subsp. vulgaris]
Length=139

 Score = 58.9 bits (141),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDY  109
            KWIFK KTD DGNV +YKARLVAKG+++V GI Y
Sbjct  96   KWIFKVKTDKDGNVQVYKARLVAKGFKKVHGIHY  129



>emb|CAE03845.1| OSJNBb0089K06.4 [Oryza sativa Japonica Group]
Length=873

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  14   IFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            +FKKKTD DGNV IYKARLV KG+RQ+QG+DY E
Sbjct  553  VFKKKTDVDGNVYIYKARLVVKGFRQIQGVDYDE  586



>gb|AAV85747.1| Integrase core domain, putative [Oryza sativa Japonica Group]
 gb|AAX92956.1| retrotransposon protein, putative, Ty1-copia sub-class [Oryza 
sativa Japonica Group]
 gb|ABA92827.2| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1184

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  20   KKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KKKTD DGNV IYKARLVAKG+RQ+QG+DY E
Sbjct  717  KKKTDVDGNVHIYKARLVAKGFRQIQGVDYDE  748



>gb|ABA92210.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=588

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K DA GNVT YKARLVAKGY Q QGID+ E
Sbjct  204  KWVFKTKKDAAGNVTRYKARLVAKGYVQRQGIDFDE  239



>ref|XP_006465491.1| PREDICTED: uncharacterized protein LOC102624640 [Citrus sinensis]
Length=1682

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    NKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            NKWIFK K  ADG ++ YKARLVAKG+ Q QG+DY E
Sbjct  367  NKWIFKIKYHADGTISRYKARLVAKGFHQTQGVDYTE  403



>gb|AAS90682.1| pupative polyprotein [Oryza sativa Japonica Group]
Length=1404

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K DA GN+T +KARLVAKGY Q QGIDY E
Sbjct  935  KWVFKTKKDAAGNITKHKARLVAKGYVQRQGIDYDE  970



>ref|NP_001174195.1| Os05g0126900 [Oryza sativa Japonica Group]
 dbj|BAH92923.1| Os05g0126900 [Oryza sativa Japonica Group]
Length=742

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K DA GN+T +KARLVAKGY Q QGIDY E
Sbjct  273  KWVFKTKKDAAGNITKHKARLVAKGYVQRQGIDYDE  308



>gb|EJT45287.1| Gag-Pol [Trichosporon asahii var. asahii CBS 2479]
Length=1411

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK+K DADGNV  YKARLV +G+ Q+ G+D+ E
Sbjct  938  KWVFKRKRDADGNVVKYKARLVGRGFSQIPGVDFEE  973



>ref|NP_001059496.1| Os07g0434200 [Oryza sativa Japonica Group]
 dbj|BAF21410.1| Os07g0434200, partial [Oryza sativa Japonica Group]
Length=1212

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW++K K DA GN+T YKARLVAKGY Q QGID+ E
Sbjct  744  KWVYKAKKDAAGNITKYKARLVAKGYVQRQGIDFDE  779



>ref|XP_008674202.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X2 [Zea mays]
Length=756

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK KT +DG++  YKARLVA+G++Q QGIDY E
Sbjct  533  KWVFKVKTKSDGSIERYKARLVARGFQQTQGIDYDE  568



>ref|XP_008651726.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=989

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK KT +DG++  YKARLVA+G++Q QGIDY E
Sbjct  525  KWVFKVKTKSDGSIERYKARLVARGFQQTQGIDYDE  560



>ref|XP_004516035.1| PREDICTED: uncharacterized protein LOC101492305, partial [Cicer 
arietinum]
Length=1216

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D++GNV  YKARLVAKGY Q +GIDY E
Sbjct  365  KWIFKTKRDSNGNVERYKARLVAKGYTQKEGIDYKE  400



>ref|XP_008647645.1| PREDICTED: uncharacterized protein LOC100502300 isoform X2 [Zea 
mays]
Length=1180

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK KT +DG++  YKARLVA+G++Q QGIDY E
Sbjct  716  KWVFKVKTKSDGSIERYKARLVARGFQQTQGIDYDE  751



>ref|XP_008674201.1| PREDICTED: uncharacterized protein LOC100279087 isoform X1 [Zea 
mays]
Length=1376

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  8     KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
             KW+FK KT +DG++  YKARLVA+G++Q QGIDY E
Sbjct  1200  KWVFKVKTKSDGSIERYKARLVARGFQQTQGIDYDE  1235



>ref|XP_002447738.1| hypothetical protein SORBIDRAFT_06g014835 [Sorghum bicolor]
 gb|EES12066.1| hypothetical protein SORBIDRAFT_06g014835 [Sorghum bicolor]
Length=194

 Score = 54.3 bits (129),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K DA G VT +KARLVAKGY Q QGID+ E
Sbjct  149  KWVFKAKKDAAGIVTKHKARLVAKGYVQRQGIDFDE  184



>emb|CAN63522.1| hypothetical protein VITISV_044155 [Vitis vinifera]
Length=134

 Score = 53.9 bits (128),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D+ GNV  YKARLVAKGY Q +GIDY E
Sbjct  29   KWIFKTKHDSKGNVERYKARLVAKGYTQKEGIDYKE  64



>emb|CCA77399.1| hypothetical protein PIIN_11376, partial [Piriformospora indica 
DSM 11827]
Length=285

 Score = 55.5 bits (132),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    NKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            ++W+FK K DADG+++ YK R+VAKGY Q +GIDY E
Sbjct  222  SRWVFKIKRDADGSISKYKGRIVAKGYAQREGIDYTE  258



>gb|EXX50149.1| gag-pol fusion protein [Rhizophagus irregularis DAOM 197198w]
Length=1303

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFKKKTD DG V  +KARLVAKG+ Q  G+DY E
Sbjct  825  KWIFKKKTDMDGKVHTFKARLVAKGFTQTPGVDYDE  860



>emb|CAN79140.1| hypothetical protein VITISV_040800 [Vitis vinifera]
Length=135

 Score = 53.5 bits (127),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K D+ GN+ IYKARLVAKG+   +GIDYH+
Sbjct  29   KWVFKTKRDSLGNIKIYKARLVAKGFTLQEGIDYHD  64



>emb|CAN63905.1| hypothetical protein VITISV_044215 [Vitis vinifera]
Length=125

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D+ GNV  YKARLVAKGY Q +GIDY E
Sbjct  29   KWIFKTKHDSKGNVERYKARLVAKGYTQKEGIDYKE  64



>ref|XP_006596772.1| PREDICTED: uncharacterized mitochondrial protein AtMg00820-like 
[Glycine max]
Length=131

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K + DG++  +KARLVAKG+ QV G D+HE
Sbjct  69   KWVFKVKENVDGSINRFKARLVAKGFHQVHGFDFHE  104



>emb|CAN82083.1| hypothetical protein VITISV_015205 [Vitis vinifera]
Length=133

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D+ GNV  YKARLVAKGY Q +GIDY E
Sbjct  29   KWIFKTKHDSKGNVEKYKARLVAKGYTQKEGIDYKE  64



>ref|XP_008342037.1| PREDICTED: uncharacterized protein LOC103404844 [Malus domestica]
Length=249

 Score = 54.7 bits (130),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            +W++K K  +DG +  YKARLVAKGY Q++GIDYH+
Sbjct  185  RWVYKIKRRSDGTIERYKARLVAKGYTQMEGIDYHD  220



>ref|XP_007034104.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
 gb|EOY05030.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
Length=1141

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    NKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            +KW++K K + DG+V  YKARLVAKGY Q++G+D+HE
Sbjct  755  SKWVYKIKYNPDGSVERYKARLVAKGYTQIEGVDFHE  791



>ref|XP_008350712.1| PREDICTED: uncharacterized protein LOC103414077 [Malus domestica]
Length=255

 Score = 54.7 bits (130),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K +ADG V  YKARLVAKG+ Q +GIDY E
Sbjct  174  KWVFKIKKNADGTVGRYKARLVAKGFSQEEGIDYGE  209



>ref|XP_008341769.1| PREDICTED: uncharacterized protein LOC103404622 [Malus domestica]
Length=265

 Score = 54.7 bits (130),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWI+K K   DG+V  YKARLVAKGY Q++G+DY E
Sbjct  202  KWIYKVKLKPDGSVERYKARLVAKGYSQIKGLDYRE  237



>ref|NP_001061718.1| Os08g0389500 [Oryza sativa Japonica Group]
 dbj|BAF23632.1| Os08g0389500 [Oryza sativa Japonica Group]
Length=1453

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8     KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
             KW+FK K D  GN+T +KARLVAKGY Q QGIDY E
Sbjct  989   KWVFKIKKDEHGNITKHKARLVAKGYVQRQGIDYEE  1024



>emb|CDF77009.1| hypothetical transposable element-related protein, partial [Boechera 
divaricarpa]
Length=1350

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D+ GNV  YKARLVAKGY Q +GIDY E
Sbjct  875  KWIFKTKRDSSGNVQRYKARLVAKGYTQKEGIDYKE  910



>ref|XP_007044242.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
 gb|EOY00074.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
Length=1494

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            ++KW++K K + DG+V  YKARLVAKGY Q++G+D+HE
Sbjct  928  DSKWVYKIKYNLDGSVERYKARLVAKGYTQIEGVDFHE  965



>ref|XP_002464673.1| hypothetical protein SORBIDRAFT_01g023130 [Sorghum bicolor]
 gb|EER91671.1| hypothetical protein SORBIDRAFT_01g023130 [Sorghum bicolor]
Length=885

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW++K K DA G +T YKARLVAKGY Q QGID+ E
Sbjct  387  KWVYKTKKDASGVITKYKARLVAKGYVQQQGIDFEE  422



>ref|XP_002386126.1| hypothetical protein MPER_15768 [Moniliophthora perniciosa FA553]
 gb|EEB87056.1| hypothetical protein MPER_15768 [Moniliophthora perniciosa FA553]
Length=94

 Score = 52.4 bits (124),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  5    NKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDY  109
            NKW+F+ K +  GN+T YKARLVAKG+ Q+ GIDY
Sbjct  28   NKWVFRLKHNNAGNITRYKARLVAKGFSQIPGIDY  62



>gb|EMT19664.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=963

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            ++KW+FK K  ADG++  YKARLVAKG++Q QG+DY +
Sbjct  36   DSKWVFKVKKHADGSIERYKARLVAKGFKQRQGLDYED  73



>ref|XP_009602039.1| PREDICTED: uncharacterized protein LOC104097202 [Nicotiana tomentosiformis]
Length=770

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    NKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            +KW++K K  ADG V I+KARLVAKGY Q +G+DYHE
Sbjct  726  SKWMYKIKFKADGEVEIFKARLVAKGYSQKEGLDYHE  762



>ref|XP_011081378.1| PREDICTED: uncharacterized protein LOC105164425 [Sesamum indicum]
Length=767

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    NKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            +KW+FK K  ADG++  YKARLVAKG+ Q++G+DY E
Sbjct  657  SKWVFKVKLRADGSIERYKARLVAKGFNQIEGVDYTE  693



>emb|CAN72518.1| hypothetical protein VITISV_022708 [Vitis vinifera]
Length=115

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D  GNV  YKARLVAKGY Q +GIDY E
Sbjct  29   KWIFKTKHDFKGNVEKYKARLVAKGYTQKEGIDYKE  64



>emb|CAN73613.1| hypothetical protein VITISV_023299 [Vitis vinifera]
Length=1815

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D++GNV  YKARLVAKG+ Q +GID+ E
Sbjct  848  KWIFKTKRDSNGNVERYKARLVAKGFTQKEGIDFKE  883



>emb|CAN75761.1| hypothetical protein VITISV_037422 [Vitis vinifera]
Length=162

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K D+ GN+ IYKAR VAKG+ Q +GIDY E
Sbjct  29   KWVFKTKKDSLGNIEIYKARFVAKGFTQKEGIDYTE  64



>ref|XP_008342064.1| PREDICTED: uncharacterized protein LOC103404876 [Malus domestica]
Length=267

 Score = 53.9 bits (128),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            +W++K K  +DG +  YKARLVAKGY Q++GIDYH+
Sbjct  218  RWVYKIKRRSDGTIERYKARLVAKGYTQMEGIDYHD  253



>emb|CAN66722.1| hypothetical protein VITISV_003329 [Vitis vinifera]
Length=1486

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D+ GN+  YKARLVAKG+ Q +GIDY +
Sbjct  119  KWIFKTKRDSKGNIVRYKARLVAKGFTQKEGIDYKD  154



>emb|CAN61695.1| hypothetical protein VITISV_029441 [Vitis vinifera]
Length=1581

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8     KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
             KWIFK K D+ GN+  YKARLVAKG+ Q +GIDY E
Sbjct  1122  KWIFKTKXDSKGNIVRYKARLVAKGFTQKEGIDYKE  1157



>emb|CAN80206.1| hypothetical protein VITISV_039290 [Vitis vinifera]
Length=446

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D+ GNV  YKARLVAKGY Q +GIDY E
Sbjct  66   KWIFKTKHDSKGNVERYKARLVAKGYTQKEGIDYXE  101



>ref|XP_008390461.1| PREDICTED: uncharacterized protein LOC103452707 [Malus domestica]
Length=936

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW++K K   DG+V  YKARLV KGYRQ++G+DY E
Sbjct  542  KWVYKVKLKPDGSVERYKARLVTKGYRQIEGLDYRE  577



>ref|XP_007022140.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
 gb|EOY13665.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
Length=624

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW++K K +ADG V  YKARLVAKGY Q++G DY E
Sbjct  204  KWVYKVKLNADGKVERYKARLVAKGYNQIEGFDYQE  239



>gb|AAF18630.1|AC006228_1 F5J5.1 [Arabidopsis thaliana]
Length=1463

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  8     KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
             KWIFK KTD +GNVT  +ARLVA+GY QV+GID+ E
Sbjct  1056  KWIFKNKTDEEGNVTRNRARLVAQGYSQVEGIDFDE  1091



>ref|XP_010027392.1| PREDICTED: uncharacterized protein LOC104417889 [Eucalyptus grandis]
Length=421

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW++K K  ADG++  YKARLVAKGY Q +G DYHE
Sbjct  135  KWVYKIKYRADGSIERYKARLVAKGYTQREGFDYHE  170



>emb|CCA76865.1| hypothetical protein PIIN_10850, partial [Piriformospora indica 
DSM 11827]
Length=511

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    NKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            ++W+FK K DADG+++ YK R+VAKGY Q +GIDY E
Sbjct  433  SRWVFKIKRDADGSISKYKGRIVAKGYAQREGIDYTE  469



>ref|XP_008387315.1| PREDICTED: uncharacterized protein LOC103449768 [Malus domestica]
Length=2699

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  5     NKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
             +KWIFKKK  ADG +  +KARLVAKGYRQ +G+DY +
Sbjct  2289  HKWIFKKKLKADGTIDKFKARLVAKGYRQKEGLDYFD  2325



>emb|CCA74168.1| related to TY4B-Putative pseudo-TY4B, partial [Piriformospora 
indica DSM 11827]
Length=708

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    NKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            ++W+FK K DADG+++ YK R+VAKGY Q +GIDY E
Sbjct  270  SRWVFKIKRDADGSISKYKGRIVAKGYAQREGIDYTE  306



>ref|XP_007033041.1| Uncharacterized protein TCM_019200 [Theobroma cacao]
 gb|EOY03967.1| Uncharacterized protein TCM_019200 [Theobroma cacao]
Length=101

 Score = 51.6 bits (122),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K + DG +  YKARLVAKGY Q++G DY E
Sbjct  29   KWVFKVKMNVDGTMERYKARLVAKGYNQIEGFDYQE  64



>emb|CAN74826.1| hypothetical protein VITISV_043646 [Vitis vinifera]
Length=467

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D+ GN+  YKARLVAKG+ Q +GIDY E
Sbjct  210  KWIFKTKRDSKGNIVRYKARLVAKGFTQKEGIDYKE  245



>gb|AAD12997.1| gag-pol polyprotein [Zea mays]
Length=1406

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW++K K D+ GN+  YKARLVAKG+ Q +GIDYHE
Sbjct  932  KWVYKTKRDSRGNIERYKARLVAKGFTQREGIDYHE  967



>ref|XP_010026606.1| PREDICTED: uncharacterized protein LOC104416977 [Eucalyptus grandis]
Length=513

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW++K K  ADG+V  YKARLVAKG+ Q +G DYHE
Sbjct  226  KWVYKIKYKADGSVERYKARLVAKGFTQREGFDYHE  261



>emb|CAN69037.1| hypothetical protein VITISV_026270 [Vitis vinifera]
Length=492

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K DA GN+  YKARLVAKG+ Q +GIDY +
Sbjct  91   KWIFKTKRDAKGNIERYKARLVAKGFTQKEGIDYKD  126



>ref|XP_008351447.1| PREDICTED: dynamin-related protein 4C-like [Malus domestica]
Length=872

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    NKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            +KWIFK+K   DG +  YKARLVAKGYRQ +G+DY +
Sbjct  37   HKWIFKRKLRPDGTIAKYKARLVAKGYRQKEGLDYFD  73



>emb|CAN71108.1| hypothetical protein VITISV_001478 [Vitis vinifera]
Length=1354

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIF+ K ++DG++  YKARLVAKG+ Q  G+DYHE
Sbjct  890  KWIFRIKRNSDGSIDRYKARLVAKGFHQRPGVDYHE  925



>emb|CAX68207.1| Copia-like retrotransposon [Helianthus annuus]
Length=1358

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    NKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            +KWIFK+K   DG+++ YKARLVAKGYRQ +G+DY +
Sbjct  894  SKWIFKRKYHPDGSISAYKARLVAKGYRQREGVDYFD  930



>emb|CCA74619.1| related to retrotransposon HobS hobase (N-terminal fragment), 
partial [Piriformospora indica DSM 11827]
Length=216

 Score = 52.8 bits (125),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    NKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            ++W+FK K DADG+++ YK R+VAKGY Q +GIDY E
Sbjct  50   SRWVFKIKRDADGSISKYKGRIVAKGYAQREGIDYTE  86



>emb|CAN78447.1| hypothetical protein VITISV_026810 [Vitis vinifera]
Length=1171

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    NKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            NKW++K K   DG++  +KARLVAKGY Q  G+DYHE
Sbjct  854  NKWVYKIKXRPDGSIERFKARLVAKGYDQKSGVDYHE  890



>emb|CAN80422.1| hypothetical protein VITISV_008674 [Vitis vinifera]
Length=122

 Score = 51.6 bits (122),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D+ GN+  Y+ARLVAKG+ Q +GIDY E
Sbjct  25   KWIFKTKRDSKGNIVRYEARLVAKGFTQKEGIDYKE  60



>ref|XP_008791387.1| PREDICTED: uncharacterized protein LOC103708304 [Phoenix dactylifera]
Length=1278

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFKKK   DG++  YKARLVAKG+RQ +GIDY +
Sbjct  359  KWIFKKKLRPDGSIDKYKARLVAKGFRQSKGIDYFD  394



>ref|XP_008363538.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Malus domestica]
Length=398

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW++K K  ADG++  YKARLVAKG+ Q +GIDYH+
Sbjct  73   KWVYKIKHHADGSIERYKARLVAKGFTQEEGIDYHD  108



>emb|CAN62509.1| hypothetical protein VITISV_039839 [Vitis vinifera]
Length=1154

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D+ GNV  YKARLVAKGY Q +G DY E
Sbjct  404  KWIFKTKHDSKGNVKRYKARLVAKGYTQKEGSDYKE  439



>gb|AAD12998.1| pol polyprotein [Zea mays]
Length=998

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW++K K D+ GN+  YKARLVAKG+ Q +GIDYHE
Sbjct  524  KWVYKTKRDSRGNIERYKARLVAKGFTQREGIDYHE  559



>emb|CAN65518.1| hypothetical protein VITISV_004207 [Vitis vinifera]
Length=162

 Score = 52.0 bits (123),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K D+ GN+  YKARLVAKG+ Q +GIDY E
Sbjct  29   KWVFKTKKDSSGNIERYKARLVAKGFTQKEGIDYTE  64



>emb|CAN74511.1| hypothetical protein VITISV_011891 [Vitis vinifera]
Length=1283

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D+ GN+  YKARLVAKG+ Q +GIDY E
Sbjct  805  KWIFKTKRDSKGNIVKYKARLVAKGFTQKEGIDYKE  840



>emb|CCA73702.1| hypothetical protein PIIN_07656 [Piriformospora indica DSM 11827]
Length=1557

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  5     NKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
             NKW+FK K DA GNV  +K RLVAKG+ Q QG+D+ E
Sbjct  1077  NKWVFKTKKDATGNVERHKVRLVAKGFLQKQGVDFDE  1113



>gb|KFD67531.1| hypothetical protein M514_20208 [Trichuris suis]
Length=312

 Score = 53.5 bits (127),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+F+KKT+A G V  YKARLVAKGY Q +G+DY +
Sbjct  29   KWVFQKKTNALGEVVRYKARLVAKGYSQQEGVDYED  64



>emb|CAN64073.1| hypothetical protein VITISV_038270 [Vitis vinifera]
Length=1181

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D+ GN+  YKARLVAKG+ Q +GIDY E
Sbjct  703  KWIFKTKRDSKGNIVRYKARLVAKGFTQKEGIDYKE  738



>ref|XP_010314349.1| PREDICTED: uncharacterized protein LOC104645039 [Solanum lycopersicum]
Length=717

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    NKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            +KW++K K  A+G++  YKARLVAKGY Q +G+DYHE
Sbjct  655  SKWVYKIKHKANGDIERYKARLVAKGYNQQEGLDYHE  691



>gb|ACZ04926.1| polyprotein [Agaricus bisporus var. bisporus]
Length=1400

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    NKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            +KW+FK K DA GN+  YKARLVA+GY Q+ G+DY +
Sbjct  927  SKWVFKAKKDAAGNIVRYKARLVAQGYSQIPGVDYFD  963



>emb|CCA75805.1| hypothetical protein PIIN_09793 [Piriformospora indica DSM 11827]
Length=1315

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    NKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            ++W+FK K DADG+++ YK R+VAKGY Q +GIDY E
Sbjct  850  SRWVFKIKRDADGSISKYKGRIVAKGYAQREGIDYTE  886



>ref|XP_010030630.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104420491 
[Eucalyptus grandis]
Length=1191

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8     KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
             KW++K K  ADG+V  YKARLVAKG+ Q +G DYHE
Sbjct  1116  KWVYKIKYKADGSVERYKARLVAKGFTQREGFDYHE  1151



>emb|CAN80084.1| hypothetical protein VITISV_011294 [Vitis vinifera]
Length=180

 Score = 52.0 bits (123),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWI+K KT +DG+V  YKARLVAKG+ Q  GIDY E
Sbjct  104  KWIYKIKTRSDGSVERYKARLVAKGFTQEYGIDYEE  139



>gb|KHN05285.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1346

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW++K K  A+G +  YKARLVAKGY QV+GIDY E
Sbjct  902  KWVYKVKHKANGQIERYKARLVAKGYNQVEGIDYFE  937



>ref|XP_002442065.1| hypothetical protein SORBIDRAFT_08g008672 [Sorghum bicolor]
 gb|EES15903.1| hypothetical protein SORBIDRAFT_08g008672 [Sorghum bicolor]
Length=831

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K DA G VT +KARLVAKGY Q QGID+ E
Sbjct  379  KWVFKAKKDAAGIVTKHKARLVAKGYVQRQGIDFDE  414



>ref|XP_011078646.1| PREDICTED: uncharacterized protein LOC105162338 [Sesamum indicum]
Length=782

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K   DG+V  +KARLVAKGY QV+G+DY+E
Sbjct  398  KWVFKTKLREDGSVERHKARLVAKGYTQVEGVDYNE  433



>emb|CAN78764.1| hypothetical protein VITISV_003317 [Vitis vinifera]
Length=1375

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D+ GN+  YKARLVAKG+ Q +GIDY E
Sbjct  844  KWIFKTKRDSKGNIVRYKARLVAKGFTQKEGIDYKE  879



>ref|XP_007028363.1| Uncharacterized protein TCM_024129 [Theobroma cacao]
 gb|EOY08865.1| Uncharacterized protein TCM_024129 [Theobroma cacao]
Length=475

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K  ADG++  +KARLVAK Y Q++G DY E
Sbjct  344  KWVFKNKMKADGSIERFKARLVAKAYNQIEGFDYQE  379



>ref|XP_010252449.1| PREDICTED: uncharacterized protein LOC104594032 [Nelumbo nucifera]
Length=342

 Score = 53.5 bits (127),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW++K KT ADG+V  YKARL+AKG+ Q  GIDY E
Sbjct  281  KWVYKIKTRADGSVERYKARLIAKGFTQKYGIDYEE  316



>emb|CAN66083.1| hypothetical protein VITISV_028833 [Vitis vinifera]
Length=1090

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D++GNV  YKARLVAKG+ Q +GID++E
Sbjct  666  KWIFKTKRDSNGNVERYKARLVAKGFTQKEGIDFNE  701



>emb|CAN83623.1| hypothetical protein VITISV_010870 [Vitis vinifera]
Length=1601

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8     KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
             KWIFK K D++GNV  YKARLVAKG+ Q +GID+ E
Sbjct  1189  KWIFKTKRDSNGNVERYKARLVAKGFTQKEGIDFKE  1224



>emb|CDO76034.1| hypothetical protein BN946_scf184818.g2 [Trametes cinnabarina]
Length=1183

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8     KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
             KW+F+ K  ADG+V  YKARLVA+G+ QV+GIDY E
Sbjct  977   KWVFRLKRGADGSVERYKARLVAQGFTQVEGIDYSE  1012



>ref|XP_008340360.1| PREDICTED: uncharacterized protein LOC103403325 [Malus domestica]
Length=925

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K +ADG++  YKARLVAKG+ Q +GIDY E
Sbjct  778  KWVFKIKKNADGSIGRYKARLVAKGFNQEEGIDYGE  813



>emb|CAN73096.1| hypothetical protein VITISV_038066 [Vitis vinifera]
Length=331

 Score = 53.5 bits (127),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWI+K KT +DG+V  YKARLVAKG+ Q  GIDY E
Sbjct  153  KWIYKIKTRSDGSVERYKARLVAKGFTQEYGIDYEE  188



>emb|CCA74092.1| hypothetical protein PIIN_08046 [Piriformospora indica DSM 11827]
Length=1227

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    NKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            ++W+FK K DADG+++ YK R+VAKGY Q +GIDY E
Sbjct  935  SRWVFKIKRDADGSISKYKGRIVAKGYAQREGIDYTE  971



>emb|CAN81793.1| hypothetical protein VITISV_020571 [Vitis vinifera]
Length=1193

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D+ GN+  YKARLVAKG+ Q +GIDY E
Sbjct  750  KWIFKTKRDSKGNIVRYKARLVAKGFTQKEGIDYKE  785



>emb|CAN62045.1| hypothetical protein VITISV_040357 [Vitis vinifera]
Length=1290

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D+ GN+  YKARLVAKG+ Q +GIDY E
Sbjct  829  KWIFKTKRDSKGNIVRYKARLVAKGFTQKEGIDYKE  864



>ref|XP_008352218.1| PREDICTED: uncharacterized protein LOC103415694 [Malus domestica]
Length=664

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K  ADG ++ YKARLVAKG+ Q +GIDY E
Sbjct  259  KWVFKLKRXADGTISRYKARLVAKGFNQEEGIDYGE  294



>emb|CAN65627.1| hypothetical protein VITISV_032735 [Vitis vinifera]
Length=1285

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWI+KKK   DG V  YKA+LVAKGY Q +GIDY E
Sbjct  835  KWIYKKKRGIDGKVQTYKAKLVAKGYTQKEGIDYEE  870



>emb|CAN64237.1| hypothetical protein VITISV_042666 [Vitis vinifera]
Length=162

 Score = 51.6 bits (122),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K D+ GNV  YK RLVAKG+ Q +GIDY E
Sbjct  29   KWVFKTKKDSSGNVERYKVRLVAKGFNQKEGIDYTE  64



>ref|XP_008340383.1| PREDICTED: uncharacterized protein LOC103403351 [Malus domestica]
Length=946

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K  ADG ++ YKARLVAKG+ Q +GIDY E
Sbjct  758  KWVFKLKRHADGTISRYKARLVAKGFNQEEGIDYGE  793



>ref|XP_008675670.1| PREDICTED: uncharacterized protein LOC103651749 [Zea mays]
Length=531

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK KT +DG+V  YKARLVA+G++Q QG DY E
Sbjct  378  KWVFKVKTKSDGSVERYKARLVARGFQQSQGRDYDE  413



>emb|CAN78069.1| hypothetical protein VITISV_032701 [Vitis vinifera]
Length=1381

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D+ GN+  YKARLVAKG+ Q +GIDY E
Sbjct  923  KWIFKTKRDSKGNIVRYKARLVAKGFTQKEGIDYKE  958



>gb|AAB61111.1| Strong similarity to Zea mays retrotransposon Hopscotch polyprotein 
(gb|U12626) [Arabidopsis thaliana]
Length=1315

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            +WIFK K ++DG+V  YKARLVA+GY Q +GIDY+E
Sbjct  845  RWIFKIKYNSDGSVERYKARLVAQGYTQKEGIDYNE  880



>ref|XP_006367551.1| PREDICTED: uncharacterized protein LOC102604059 [Solanum tuberosum]
Length=1014

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K  A+G +  +KARLVAKGY Q +G+DYHE
Sbjct  756  KWIFKIKYKANGQIERFKARLVAKGYNQREGLDYHE  791



>ref|XP_010068635.1| PREDICTED: uncharacterized protein LOC104455561 [Eucalyptus grandis]
Length=553

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW++K K  ADG+V  YKARLVAKG+ Q +G DYHE
Sbjct  221  KWVYKIKYRADGSVERYKARLVAKGFTQREGFDYHE  256



>ref|XP_002461816.1| hypothetical protein SORBIDRAFT_02g008720 [Sorghum bicolor]
 gb|EER98337.1| hypothetical protein SORBIDRAFT_02g008720 [Sorghum bicolor]
Length=859

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW++K K DA G VT +KARLVAKGY Q QGIDY E
Sbjct  405  KWVYKVKKDASGIVTKHKARLVAKGYVQRQGIDYDE  440



>emb|CCA73545.1| hypothetical protein PIIN_07498 [Piriformospora indica DSM 11827]
Length=1391

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    NKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            ++W+FK K DADG+++ YK R+VAKGY Q +GIDY E
Sbjct  926  SRWVFKIKRDADGSISKYKGRIVAKGYAQREGIDYTE  962



>gb|EEC81933.1| hypothetical protein OsI_25798 [Oryza sativa Indica Group]
Length=1104

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW++K K DA GN+T YKARLVAKGY Q QGI + E
Sbjct  636  KWVYKAKKDAAGNITKYKARLVAKGYVQRQGIYFDE  671



>ref|XP_006596648.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Glycine 
max]
Length=444

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+F+ K +ADG++  YKARLVAKG+  V G D+HE
Sbjct  268  KWVFRIKENADGSINRYKARLVAKGFHLVHGFDFHE  303



>gb|AGW47867.1| polyprotein [Phaseolus vulgaris]
Length=1471

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFKKK +A G +  YKARLVAKGY+Q +GIDY E
Sbjct  881  KWIFKKKMNAQGEIERYKARLVAKGYKQKEGIDYDE  916



>ref|NP_001176374.1| Os11g0170700 [Oryza sativa Japonica Group]
 dbj|BAH95102.1| Os11g0170700, partial [Oryza sativa Japonica Group]
Length=719

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW++K K DA GN+T YKA LVAKGY Q QGID+ E
Sbjct  251  KWVYKAKKDAAGNITKYKACLVAKGYVQRQGIDFDE  286



>ref|XP_002445775.1| hypothetical protein SORBIDRAFT_07g025585 [Sorghum bicolor]
 gb|EES15270.1| hypothetical protein SORBIDRAFT_07g025585 [Sorghum bicolor]
Length=841

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K DA G VT +KARLVAKGY Q QGID+ E
Sbjct  373  KWVFKTKKDASGIVTKHKARLVAKGYVQRQGIDFDE  408



>ref|XP_010526684.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X6 [Tarenaya hassleriana]
Length=789

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K +ADG++  +KARLVAKGY Q++G+D+ E
Sbjct  551  KWVFKTKYNADGSIERHKARLVAKGYTQLEGVDFSE  586



>ref|XP_002449917.1| hypothetical protein SORBIDRAFT_05g025655 [Sorghum bicolor]
 gb|EES08905.1| hypothetical protein SORBIDRAFT_05g025655 [Sorghum bicolor]
Length=846

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW++K K DA G VT +KARLVAKGY Q QGIDY E
Sbjct  400  KWVYKVKKDASGIVTKHKARLVAKGYVQRQGIDYDE  435



>emb|CAN59916.1| hypothetical protein VITISV_016016 [Vitis vinifera]
Length=310

 Score = 53.1 bits (126),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK + D+ GN+  YKARLVAKG+ Q +GIDY E
Sbjct  232  KWIFKTRRDSKGNIVRYKARLVAKGFTQKEGIDYKE  267



>ref|XP_010526683.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X5 [Tarenaya hassleriana]
Length=886

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K +ADG++  +KARLVAKGY Q++G+D+ E
Sbjct  648  KWVFKTKYNADGSIERHKARLVAKGYTQLEGVDFSE  683



>ref|XP_010526682.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X4 [Tarenaya hassleriana]
Length=940

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K +ADG++  +KARLVAKGY Q++G+D+ E
Sbjct  702  KWVFKTKYNADGSIERHKARLVAKGYTQLEGVDFSE  737



>emb|CAN66999.1| hypothetical protein VITISV_019171 [Vitis vinifera]
Length=955

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            +W+FK K + DG+V+ YKARLVAKGY QV G D++E
Sbjct  582  RWVFKLKRNPDGSVSRYKARLVAKGYSQVPGFDFYE  617



>gb|AAX95066.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|ABA91624.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1385

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW++K K DA GN+T YKA LVAKGY Q QGID+ E
Sbjct  917  KWVYKAKKDAAGNITKYKACLVAKGYVQRQGIDFDE  952



>ref|XP_002459428.1| hypothetical protein SORBIDRAFT_02g004525 [Sorghum bicolor]
 gb|EER95949.1| hypothetical protein SORBIDRAFT_02g004525 [Sorghum bicolor]
Length=868

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW++K K DA G VT +KARLVAKGY Q QGIDY E
Sbjct  400  KWVYKVKKDASGIVTKHKARLVAKGYVQRQGIDYDE  435



>emb|CAN63597.1| hypothetical protein VITISV_019450 [Vitis vinifera]
Length=117

 Score = 50.8 bits (120),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K D+ GN+  YKARLVAKG+ Q +GIDY E
Sbjct  29   KWVFKTKKDSLGNIERYKARLVAKGFTQNEGIDYTE  64



>ref|XP_008388960.1| PREDICTED: DNA polymerase zeta catalytic subunit-like [Malus 
domestica]
Length=2068

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  5     NKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
             +KWIFKKK  ADG +  +KARLVAKGY Q +G+DY +
Sbjct  1956  HKWIFKKKLKADGTIDKFKARLVAKGYHQKEGLDYFD  1992



>emb|CAN82483.1| hypothetical protein VITISV_006799 [Vitis vinifera]
Length=1180

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIF  K  ADGNV  YKARLVAKG+ Q  GIDY E
Sbjct  713  KWIFTVKYKADGNVDRYKARLVAKGFTQSYGIDYQE  748



>emb|CAN70156.1| hypothetical protein VITISV_016168 [Vitis vinifera]
Length=1015

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D++GNV  YKARLVAKG+ Q +GID+ E
Sbjct  737  KWIFKTKRDSNGNVERYKARLVAKGFTQKEGIDFKE  772



>gb|AAO52668.1| putative gag-pol polyprotein [Aster yellows phytoplasma]
Length=291

 Score = 52.8 bits (125),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    NKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            +KW+FK K DADGNV  +KARLV KG  Q +GIDY E
Sbjct  122  SKWVFKTKRDADGNVICHKARLVVKGCAQRKGIDYDE  158



>ref|XP_010058883.1| PREDICTED: uncharacterized protein LOC104446775 [Eucalyptus grandis]
Length=766

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW++K K  ADG+V  YKARLVAKG+ Q +G DYHE
Sbjct  228  KWVYKTKYRADGSVERYKARLVAKGFTQREGFDYHE  263



>ref|XP_008229173.1| PREDICTED: uncharacterized protein LOC103328554 [Prunus mume]
Length=1574

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK KTD  GNV   KARLVA+GY Q++GID+ E
Sbjct  260  KWIFKNKTDEQGNVVRNKARLVAQGYTQMEGIDFDE  295



>ref|XP_010526681.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X3 [Tarenaya hassleriana]
Length=1238

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  8     KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
             KW+FK K +ADG++  +KARLVAKGY Q++G+D+ E
Sbjct  1037  KWVFKTKYNADGSIERHKARLVAKGYTQLEGVDFSE  1072



>ref|XP_010526680.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X2 [Tarenaya hassleriana]
Length=1244

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  8     KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
             KW+FK K +ADG++  +KARLVAKGY Q++G+D+ E
Sbjct  1006  KWVFKTKYNADGSIERHKARLVAKGYTQLEGVDFSE  1041



>gb|ABE88097.1| Reverse transcriptase (RNA-dependent DNA polymerase) [Medicago 
truncatula]
Length=293

 Score = 52.8 bits (125),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            +WIFK K + DG++  YKARLVAKGY Q++G+DY +
Sbjct  29   RWIFKIKHNVDGSIERYKARLVAKGYNQIEGLDYFD  64



>ref|XP_010526678.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X1 [Tarenaya hassleriana]
Length=1275

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  8     KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
             KW+FK K +ADG++  +KARLVAKGY Q++G+D+ E
Sbjct  1037  KWVFKTKYNADGSIERHKARLVAKGYTQLEGVDFSE  1072



>ref|XP_007002288.1| hypothetical protein TREMEDRAFT_27029, partial [Tremella mesenterica 
DSM 1558]
 gb|EIW71771.1| hypothetical protein TREMEDRAFT_27029, partial [Tremella mesenterica 
DSM 1558]
Length=676

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK KTD++GN+  YK+RLVA+G+ QV G+DY E
Sbjct  389  KWVFKVKTDSEGNLLKYKSRLVAQGFSQVPGVDYEE  424



>ref|XP_007014182.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
 gb|EOY31801.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
Length=502

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK+K ++DG++  YKARLV KGY Q+ GIDY E
Sbjct  33   KWIFKRKLNSDGSLNKYKARLVVKGYSQMAGIDYQE  68



>emb|CCF52167.1| related to retrotransposon HobS hobase [Ustilago hordei]
Length=290

 Score = 52.8 bits (125),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYH  112
            +W+FK K DAD N++ +KA+LVA GY QV  IDYH
Sbjct  178  RWVFKMKHDADNNISKFKAQLVACGYSQVHSIDYH  212



>ref|XP_010662484.1| PREDICTED: uncharacterized protein LOC104882143 [Vitis vinifera]
Length=1207

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW++K K + DG +  YKARLVAKG+ QV+GIDY E
Sbjct  771  KWVYKIKYNPDGTIERYKARLVAKGFSQVEGIDYRE  806



>gb|AAL56548.1|AF387862_2 pol polyprotein [Anopheles gambiae]
Length=942

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    NKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            +KW+FK+K D DG +  YKARLVAKG+ QV G DY E
Sbjct  475  SKWVFKRKMDGDGKIVQYKARLVAKGFSQVYGADYDE  511



>emb|CAN83392.1| hypothetical protein VITISV_041406 [Vitis vinifera]
Length=1262

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            +W+FK K + DG+V+ YKARLVAKGY QV G D++E
Sbjct  791  RWVFKLKRNPDGSVSRYKARLVAKGYSQVPGFDFYE  826



>emb|CAN81238.1| hypothetical protein VITISV_031073 [Vitis vinifera]
Length=1354

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D++GNV  YKARLVAKG+ Q +GID+ E
Sbjct  904  KWIFKTKRDSNGNVERYKARLVAKGFTQKEGIDFKE  939



>emb|CAN71595.1| hypothetical protein VITISV_010143 [Vitis vinifera]
Length=1523

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8     KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
             KW++K K + DG +  YKARLVAKG+ QV+GIDY E
Sbjct  1013  KWVYKIKYNPDGTIERYKARLVAKGFSQVEGIDYRE  1048



>emb|CAN71183.1| hypothetical protein VITISV_033416 [Vitis vinifera]
Length=1255

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K D+ GN+  YKARLVAKG+ Q +GIDY E
Sbjct  945  KWVFKTKKDSSGNIERYKARLVAKGFTQKEGIDYTE  980



>emb|CAN78400.1| hypothetical protein VITISV_000778 [Vitis vinifera]
Length=162

 Score = 51.2 bits (121),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K D+ GN+  YKARLVAKG+ Q +GIDY E
Sbjct  29   KWVFKTKKDSLGNIERYKARLVAKGFTQKEGIDYTE  64



>emb|CAN66092.1| hypothetical protein VITISV_006453 [Vitis vinifera]
Length=162

 Score = 51.2 bits (121),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K D+ GN+  YKARLVAKG+ Q +GIDY E
Sbjct  29   KWVFKTKKDSLGNIERYKARLVAKGFTQKEGIDYTE  64



>emb|CAN66418.1| hypothetical protein VITISV_029181 [Vitis vinifera]
 emb|CAN79482.1| hypothetical protein VITISV_038969 [Vitis vinifera]
 emb|CAN80652.1| hypothetical protein VITISV_042247 [Vitis vinifera]
 emb|CAN79618.1| hypothetical protein VITISV_043159 [Vitis vinifera]
Length=162

 Score = 51.2 bits (121),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K D+ GN+  YKARLVAKG+ Q +GIDY E
Sbjct  29   KWVFKTKKDSLGNIERYKARLVAKGFTQKEGIDYTE  64



>emb|CCA72510.1| hypothetical protein PIIN_06447 [Piriformospora indica DSM 11827]
Length=504

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    NKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            ++W+FK K DADG+++ YK R+VAKGY Q +GIDY E
Sbjct  101  SRWVFKIKRDADGSISKYKGRIVAKGYAQREGIDYTE  137



>emb|CAN66447.1| hypothetical protein VITISV_043080 [Vitis vinifera]
Length=162

 Score = 50.8 bits (120),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K D+ GNV  YKARLVAKG+ Q +GIDY E
Sbjct  29   KWVFKTKKDSLGNVERYKARLVAKGFTQKEGIDYTE  64



>gb|KFD64006.1| hypothetical protein M514_23854 [Trichuris suis]
Length=824

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+F+KKT+A G V  YKARLVAKGY Q +G+DY +
Sbjct  322  KWVFQKKTNALGEVVRYKARLVAKGYSQQEGVDYED  357



>emb|CAN61645.1| hypothetical protein VITISV_036929 [Vitis vinifera]
Length=1014

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D++GNV  YKARLVAKG+ Q +GID+ E
Sbjct  736  KWIFKTKRDSNGNVERYKARLVAKGFTQKEGIDFKE  771



>emb|CAN62431.1| hypothetical protein VITISV_015835 [Vitis vinifera]
Length=1217

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D++GNV  YKARLVAKG+ Q +GID+ E
Sbjct  836  KWIFKTKRDSNGNVERYKARLVAKGFTQKEGIDFKE  871



>emb|CAD39978.2| OSJNBa0032B23.6 [Oryza sativa Japonica Group]
Length=1149

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K D  GN+T YKA LVAKGY Q QGID+ E
Sbjct  768  KWVFKTKKDVAGNITRYKAYLVAKGYVQRQGIDFDE  803



>emb|CAN74032.1| hypothetical protein VITISV_042676 [Vitis vinifera]
Length=162

 Score = 50.8 bits (120),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K D+ GN+  YKARLVAKG+ Q +GIDY E
Sbjct  29   KWVFKTKKDSLGNIERYKARLVAKGFTQKEGIDYTE  64



>emb|CAN67821.1| hypothetical protein VITISV_025855 [Vitis vinifera]
Length=1356

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D++GNV  YKARLVAKG+ Q +GID+ E
Sbjct  878  KWIFKTKRDSNGNVERYKARLVAKGFTQKEGIDFKE  913



>emb|CAN82526.1| hypothetical protein VITISV_028058 [Vitis vinifera]
Length=1125

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            +W++K K  +DG +  +KARLVAKGY Q++GIDYH+
Sbjct  674  RWVYKIKXHSDGTIERFKARLVAKGYTQLEGIDYHD  709



>emb|CAN73624.1| hypothetical protein VITISV_042460 [Vitis vinifera]
Length=1287

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIF  K  ADGNV  YKARLVAKG+ Q  GIDY E
Sbjct  844  KWIFTVKYKADGNVDRYKARLVAKGFTQSYGIDYQE  879



>ref|XP_002443869.1| hypothetical protein SORBIDRAFT_07g003556 [Sorghum bicolor]
 gb|EES13364.1| hypothetical protein SORBIDRAFT_07g003556 [Sorghum bicolor]
Length=655

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW++K K D+ GN+  YKARLVAKG+ Q +GIDY+E
Sbjct  167  KWVYKTKCDSQGNIERYKARLVAKGFTQREGIDYNE  202



>emb|CAN70862.1| hypothetical protein VITISV_027144 [Vitis vinifera]
Length=162

 Score = 50.8 bits (120),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K D+ GN+  YKARLVAKG+ Q +GIDY E
Sbjct  29   KWVFKTKKDSLGNIKRYKARLVAKGFTQKEGIDYTE  64



>ref|XP_007028235.1| Uncharacterized protein TCM_023856 [Theobroma cacao]
 gb|EOY08737.1| Uncharacterized protein TCM_023856 [Theobroma cacao]
Length=150

 Score = 50.8 bits (120),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K D DG++   KARLVAKGY Q +GID+ E
Sbjct  89   KWVFKNKMDGDGDIIRNKARLVAKGYSQKEGIDFDE  124



>emb|CAN69578.1| hypothetical protein VITISV_030677 [Vitis vinifera]
 emb|CAN68021.1| hypothetical protein VITISV_003622 [Vitis vinifera]
 emb|CAN68186.1| hypothetical protein VITISV_031825 [Vitis vinifera]
 emb|CAN82108.1| hypothetical protein VITISV_007929 [Vitis vinifera]
Length=158

 Score = 50.8 bits (120),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K DA GN+  +KARLVAKG+ Q +GIDY +
Sbjct  29   KWVFKTKRDAKGNIERFKARLVAKGFTQKEGIDYKD  64



>ref|XP_006595312.1| PREDICTED: uncharacterized protein LOC102668660 [Glycine max]
Length=554

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+F+ K +A+G++  YK RLVAKG+ QV G D+HE
Sbjct  497  KWVFRIKENANGSINKYKTRLVAKGFHQVHGFDFHE  532



>emb|CAN63452.1| hypothetical protein VITISV_021405 [Vitis vinifera]
Length=397

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D+ GN+  YK+RLVAKG+ Q +GIDY E
Sbjct  37   KWIFKTKRDSKGNIVRYKSRLVAKGFTQKKGIDYKE  72



>ref|XP_011070841.1| PREDICTED: uncharacterized protein LOC105156417 [Sesamum indicum]
Length=907

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            +W+FK K + DG++  YKARLVAKGY Q++G+DY +
Sbjct  553  RWVFKLKLNPDGSIQRYKARLVAKGYNQIEGVDYFD  588



>gb|EMT25451.1| hypothetical protein F775_09534 [Aegilops tauschii]
Length=705

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW++K K D +GNV  YKARLVAKG+ Q +GIDY+E
Sbjct  41   KWVYKTKYDPNGNVEKYKARLVAKGFTQREGIDYNE  76



>gb|KFK27502.1| hypothetical protein AALP_AA8G391300 [Arabis alpina]
Length=1347

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K + +G++  +KARLVAKGY Q QG+D+HE
Sbjct  260  KWIFKTKLNENGDIDKFKARLVAKGYHQKQGVDFHE  295



>emb|CAN61004.1| hypothetical protein VITISV_015023 [Vitis vinifera]
Length=1010

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIF  K  ADGNV  YKARLVAKG+ Q  GIDY E
Sbjct  543  KWIFTVKYKADGNVDRYKARLVAKGFTQSYGIDYQE  578



>ref|XP_010273170.1| PREDICTED: uncharacterized protein LOC104608783 [Nelumbo nucifera]
Length=602

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+F+ K + +G+++ YKARLVAKG+ Q +G+DYHE
Sbjct  416  KWVFRLKHNPNGSISRYKARLVAKGFNQREGLDYHE  451



>emb|CAN76841.1| hypothetical protein VITISV_004490 [Vitis vinifera]
Length=906

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K D+ GN+  YKARLVAKG+ Q +GIDY E
Sbjct  708  KWVFKTKKDSSGNIERYKARLVAKGFTQKEGIDYTE  743



>ref|XP_004972302.1| PREDICTED: uncharacterized protein LOC101778040 [Setaria italica]
Length=446

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K  ADG++  YKARLVAKG++Q  GIDY +
Sbjct  218  KWIFKLKRKADGSIDRYKARLVAKGFKQQYGIDYDD  253



>emb|CAN64686.1| hypothetical protein VITISV_013732 [Vitis vinifera]
Length=162

 Score = 50.8 bits (120),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K D+ GN+  YKARLVAKG+ Q +GIDY E
Sbjct  29   KWVFKTKKDSLGNIERYKARLVAKGFTQKEGIDYTE  64



>ref|XP_010270824.1| PREDICTED: uncharacterized protein LOC104607033 [Nelumbo nucifera]
Length=482

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW++K KT ADG++  YKARLVAKG+ Q  GIDY E
Sbjct  424  KWVYKIKTRADGSIERYKARLVAKGFTQEYGIDYDE  459



>emb|CAN60516.1| hypothetical protein VITISV_010847 [Vitis vinifera]
Length=158

 Score = 50.8 bits (120),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K DA GN+  +KARLVAKG+ Q +GIDY +
Sbjct  29   KWVFKTKRDAKGNIERFKARLVAKGFTQKEGIDYKD  64



>ref|XP_009357571.1| PREDICTED: uncharacterized protein LOC103948287 [Pyrus x bretschneideri]
Length=957

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW++K K + DG +  YKARLVAKGY QV+G+DY E
Sbjct  517  KWVYKIKYNPDGTIERYKARLVAKGYSQVEGLDYKE  552



>emb|CAN76768.1| hypothetical protein VITISV_022901 [Vitis vinifera]
Length=162

 Score = 50.8 bits (120),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K D+ GN+  YKARLVAKG+ Q +GIDY E
Sbjct  29   KWVFKTKKDSLGNIERYKARLVAKGFTQKEGIDYTE  64



>emb|CAN74499.1| hypothetical protein VITISV_013001 [Vitis vinifera]
Length=993

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWI+K KT +DG+V  YKARLVAKG+ Q  GIDY E
Sbjct  531  KWIYKIKTRSDGSVERYKARLVAKGFTQEYGIDYEE  566



>emb|CAN70361.1| hypothetical protein VITISV_033646 [Vitis vinifera]
Length=1013

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWI+K KT +DG+V  YKARLVAKG+ Q  GIDY E
Sbjct  551  KWIYKIKTRSDGSVERYKARLVAKGFTQEYGIDYEE  586



>ref|XP_010233157.1| PREDICTED: protein CHROMATIN REMODELING 24-like [Brachypodium 
distachyon]
Length=1108

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K D++GNV  +KARLVAKGY Q QG+D+ E
Sbjct  29   KWVFKVKKDSNGNVVKHKARLVAKGYVQQQGVDFEE  64



>ref|XP_008357351.1| PREDICTED: uncharacterized protein LOC103421092 [Malus domestica]
Length=536

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW++K K ++DG++  YKARLVAKGY Q++G+DY E
Sbjct  29   KWVYKIKYNSDGSIERYKARLVAKGYTQIEGVDYLE  64



>emb|CCA76306.1| hypothetical protein PIIN_10301 [Piriformospora indica DSM 11827]
Length=379

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    NKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            ++W+FK K DADG+++ YK R+VAKGY Q +GIDY E
Sbjct  34   SRWVFKIKRDADGSISKYKGRIVAKGYAQREGIDYTE  70



>ref|XP_010662546.1| PREDICTED: uncharacterized protein LOC104882159 [Vitis vinifera]
Length=1125

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWI+K KT +DG+V  YKARLVAKG+ Q  GIDY E
Sbjct  897  KWIYKIKTRSDGSVERYKARLVAKGFTQEYGIDYEE  932



>emb|CAN68132.1| hypothetical protein VITISV_027227 [Vitis vinifera]
Length=248

 Score = 52.0 bits (123),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D+ GN+  YKARLV KG+ Q +G+DY E
Sbjct  90   KWIFKTKRDSKGNIVKYKARLVVKGFTQKKGVDYTE  125



>emb|CAN68711.1| hypothetical protein VITISV_015847 [Vitis vinifera]
Length=1168

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWI+K KT +DG+V  YKARLVAKG+ Q  GIDY E
Sbjct  706  KWIYKIKTRSDGSVERYKARLVAKGFTQEYGIDYEE  741



>emb|CAN80320.1| hypothetical protein VITISV_034560 [Vitis vinifera]
Length=1261

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWI+K KT +DG+V  YKARLVAKG+ Q  GIDY E
Sbjct  829  KWIYKIKTRSDGSVERYKARLVAKGFTQEYGIDYEE  864



>emb|CAN61929.1| hypothetical protein VITISV_014855 [Vitis vinifera]
Length=1271

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWI+K KT +DG+V  YKARLVAKG+ Q  GIDY E
Sbjct  853  KWIYKIKTRSDGSVERYKARLVAKGFTQEYGIDYEE  888



>ref|XP_007048694.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
 gb|EOX92851.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
Length=214

 Score = 51.2 bits (121),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    NKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            +KW++K K  ADG +  +KARLVAKGY +V+G DY E
Sbjct  130  HKWVYKTKMKADGPMERFKARLVAKGYSRVEGFDYQE  166



>emb|CAN62394.1| hypothetical protein VITISV_021305 [Vitis vinifera]
Length=1287

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWI+K KT +DG+V  YKARLVAKG+ Q  GIDY E
Sbjct  825  KWIYKIKTRSDGSVERYKARLVAKGFTQEYGIDYEE  860



>emb|CAN79142.1| hypothetical protein VITISV_040460 [Vitis vinifera]
Length=1293

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWI+K KT +DG+V  YKARLVAKG+ Q  GIDY E
Sbjct  660  KWIYKIKTRSDGSVERYKARLVAKGFTQEYGIDYEE  695



>gb|AAD22155.1|AF061282_8 polyprotein [Sorghum bicolor]
Length=1012

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW++K K  ADG V  YKARLVAKGYRQ  G+DY +
Sbjct  638  KWVYKIKKRADGQVERYKARLVAKGYRQRYGLDYED  673



>emb|CAN64963.1| hypothetical protein VITISV_002891 [Vitis vinifera]
Length=1318

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWI+K KT +DG+V  YKARLVAKG+ Q  GIDY E
Sbjct  877  KWIYKIKTRSDGSVERYKARLVAKGFTQEYGIDYEE  912



>gb|KFD67433.1| hypothetical protein M514_20469 [Trichuris suis]
Length=1272

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+F+KKT+A G V  YKARLVAKGY Q +G+DY +
Sbjct  822  KWVFQKKTNALGEVVRYKARLVAKGYSQQEGVDYED  857



>ref|XP_007002292.1| hypothetical protein TREMEDRAFT_27045, partial [Tremella mesenterica 
DSM 1558]
 gb|EIW70982.1| hypothetical protein TREMEDRAFT_27045, partial [Tremella mesenterica 
DSM 1558]
Length=655

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK KTD++GN+  YK+RLVA+G+ Q+ G+DY E
Sbjct  199  KWVFKVKTDSEGNLLKYKSRLVAQGFSQIPGVDYEE  234



>emb|CAN78154.1| hypothetical protein VITISV_032622 [Vitis vinifera]
Length=1250

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D++GNV  YKARLVAKG+ Q +GID+ E
Sbjct  772  KWIFKTKRDSNGNVERYKARLVAKGFTQKEGIDFKE  807



>emb|CAN75041.1| hypothetical protein VITISV_027174 [Vitis vinifera]
Length=1381

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWI+K KT +DG+V  YKARLVAKG+ Q  GIDY E
Sbjct  919  KWIYKIKTRSDGSVERYKARLVAKGFTQEYGIDYEE  954



>emb|CAN82851.1| hypothetical protein VITISV_027998 [Vitis vinifera]
Length=1239

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIF  K  ADGNV  YKARLVAKG+ Q  GIDY E
Sbjct  788  KWIFTVKYKADGNVDRYKARLVAKGFTQSYGIDYQE  823



>emb|CAN69715.1| hypothetical protein VITISV_011263 [Vitis vinifera]
Length=1040

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+F  K  ADGNV  YKARLVAKG+ Q  GIDY E
Sbjct  573  KWVFTVKYKADGNVDRYKARLVAKGFTQSYGIDYQE  608



>emb|CAN63908.1| hypothetical protein VITISV_044218 [Vitis vinifera]
Length=1236

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            +W++K K  +DG +  +KARLVAKGY Q++GIDYH+
Sbjct  926  RWVYKIKRHSDGTIERFKARLVAKGYTQLEGIDYHD  961



>emb|CAN65808.1| hypothetical protein VITISV_033389 [Vitis vinifera]
Length=1279

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            +W++K K  +DG +  +KARLVAKGY Q++GIDYH+
Sbjct  856  RWVYKIKRHSDGTIERFKARLVAKGYTQLEGIDYHD  891



>emb|CAN73437.1| hypothetical protein VITISV_031733 [Vitis vinifera]
Length=1322

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            +W++K K  +DG +  +KARLVAKGY Q++GIDYH+
Sbjct  879  RWVYKIKRHSDGTIERFKARLVAKGYTQLEGIDYHD  914



>ref|XP_010108259.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Morus 
notabilis]
 gb|EXC18499.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Morus 
notabilis]
Length=414

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWI+K+K   DG V  YKARLVAKGY Q +G+DY E
Sbjct  329  KWIYKRKRGVDGKVETYKARLVAKGYTQKEGVDYEE  364



>emb|CAN72447.1| hypothetical protein VITISV_027001 [Vitis vinifera]
Length=1051

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D+ GN+  YKARLVAKG+ Q +G+DY E
Sbjct  668  KWIFKTKRDSKGNIIWYKARLVAKGFTQKEGVDYKE  703



>emb|CAN74430.1| hypothetical protein VITISV_010987 [Vitis vinifera]
Length=2471

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8     KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
             KWI+K KT +DG+V  YKARLVAKG+ Q  GIDY E
Sbjct  1166  KWIYKIKTRSDGSVERYKARLVAKGFTQEYGIDYEE  1201



>emb|CAN63912.1| hypothetical protein VITISV_044222 [Vitis vinifera]
Length=1100

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D+ GNV  YKA LVAKGY Q +GIDY E
Sbjct  673  KWIFKTKHDSKGNVERYKAMLVAKGYTQKEGIDYKE  708



>ref|XP_007031516.1| Uncharacterized protein TCM_016911 [Theobroma cacao]
 gb|EOY02442.1| Uncharacterized protein TCM_016911 [Theobroma cacao]
Length=372

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW++K K + DG +  YKARLVAKGY Q+ G DY E
Sbjct  29   KWVYKVKLNVDGQIERYKARLVAKGYNQIAGFDYKE  64



>emb|CAN61034.1| hypothetical protein VITISV_041749 [Vitis vinifera]
Length=434

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+F  K  ADG++  YKARLVAKG+ Q  GIDYHE
Sbjct  121  KWVFIVKCKADGSIERYKARLVAKGFTQTYGIDYHE  156



>ref|XP_009792311.1| PREDICTED: uncharacterized protein LOC104239381 [Nicotiana sylvestris]
Length=720

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    NKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            +KWI+K K  A+G +  YKARLVAKGY Q +G+DYHE
Sbjct  659  SKWIYKIKYKANGEIDKYKARLVAKGYTQREGLDYHE  695



>ref|XP_007024187.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
 gb|EOY26809.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
Length=1255

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW++K K +ADG +  YKARLVAKGY Q+ G DY E
Sbjct  783  KWVYKVKLNADGQIERYKARLVAKGYNQIAGFDYKE  818



>emb|CAN70474.1| hypothetical protein VITISV_022082 [Vitis vinifera]
Length=158

 Score = 50.4 bits (119),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K DA GN+  +KARLVAKG+ Q +GIDY +
Sbjct  29   KWVFKTKRDAKGNIERFKARLVAKGFTQKEGIDYKD  64



>gb|KFK32854.1| hypothetical protein AALP_AA6G295700 [Arabis alpina]
Length=702

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK KTD  G V   KARLVA+GY Q++GID+ E
Sbjct  57   KWIFKNKTDGRGAVVRNKARLVAQGYSQIEGIDFDE  92



>ref|XP_011073063.1| PREDICTED: uncharacterized protein LOC105158123 [Sesamum indicum]
Length=405

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDY  109
            KW+FK K   DG+V  YKARLVAKG+ Q+ G+DY
Sbjct  29   KWVFKTKLQVDGSVERYKARLVAKGFNQIAGVDY  62



>ref|XP_007010988.1| Uncharacterized protein TCM_045138 [Theobroma cacao]
 gb|EOY19798.1| Uncharacterized protein TCM_045138 [Theobroma cacao]
Length=223

 Score = 51.2 bits (121),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW++K K +A+G V  YKA+LVAKGY QV G+DY E
Sbjct  71   KWVYKVKLNANGTVERYKAQLVAKGYNQVAGLDYQE  106



>ref|XP_010045532.1| PREDICTED: uncharacterized protein LOC104434266 [Eucalyptus grandis]
Length=276

 Score = 52.0 bits (123),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW++K K  ADG++  YKA LVAKGY Q +G DYHE
Sbjct  227  KWVYKIKYRADGSIEQYKAWLVAKGYTQREGFDYHE  262



>emb|CAN68148.1| hypothetical protein VITISV_035665 [Vitis vinifera]
Length=1813

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  8     KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
             +W++K K  +DG +  YKARLVAKGY QV GIDY E
Sbjct  1264  RWVYKIKYHSDGTIERYKARLVAKGYTQVAGIDYQE  1299



>ref|XP_010099335.1| hypothetical protein L484_000113 [Morus notabilis]
 gb|EXB77770.1| hypothetical protein L484_000113 [Morus notabilis]
Length=294

 Score = 52.0 bits (123),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWI++KK   DGNV  +KAR+VAKGY Q +GIDY +
Sbjct  213  KWIYRKKRGPDGNVETFKARVVAKGYAQKEGIDYED  248



>emb|CAN65078.1| hypothetical protein VITISV_009543 [Vitis vinifera]
Length=495

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D+ GNV  YKARLVAKGY Q +GI+Y E
Sbjct  273  KWIFKTKHDSKGNVERYKARLVAKGYTQKEGINYEE  308



>emb|CAN73953.1| hypothetical protein VITISV_025588 [Vitis vinifera]
Length=715

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+F+ K+ ADG+V  YKARLVAKG+ Q  GIDY E
Sbjct  401  KWVFRIKSKADGSVERYKARLVAKGFTQTYGIDYQE  436



>ref|XP_009789396.1| PREDICTED: uncharacterized protein LOC104237026 [Nicotiana sylvestris]
Length=158

 Score = 50.4 bits (119),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWI+KKK   DG V  +KARLV KG+ Q +GIDY E
Sbjct  98   KWIYKKKRGVDGKVQTFKARLVVKGFTQKEGIDYEE  133



>emb|CAN74984.1| hypothetical protein VITISV_035210 [Vitis vinifera]
Length=2408

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8     KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
             KWI+K KT +DG+V  YKARLVAKG+ Q  GIDY E
Sbjct  2013  KWIYKIKTRSDGSVERYKARLVAKGFTQEYGIDYEE  2048



>emb|CAN74421.1| hypothetical protein VITISV_010977 [Vitis vinifera]
Length=972

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D++GNV  YKARLVAKG+ Q +GID+ E
Sbjct  688  KWIFKTKRDSNGNVERYKARLVAKGFTQKEGIDFXE  723



>ref|XP_007000815.1| hypothetical protein TREMEDRAFT_26944, partial [Tremella mesenterica 
DSM 1558]
 gb|EIW72190.1| hypothetical protein TREMEDRAFT_26944, partial [Tremella mesenterica 
DSM 1558]
Length=503

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ENKWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            +++W+F  K DADGNV  YKARLVAKG+ Q  GID+ E
Sbjct  53   DSRWVFAIKHDADGNVIKYKARLVAKGFSQQPGIDFEE  90



>gb|AAB51275.1| reverse transcriptase, gag, polyprotein [Volvox carteri f. nagariensis]
Length=1350

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            +W++K K+ ADG V  YKAR VAKGY QV+G+DY E
Sbjct  891  RWVYKVKSGADGEVERYKARFVAKGYMQVEGVDYDE  926



>emb|CAN81384.1| hypothetical protein VITISV_000819 [Vitis vinifera]
Length=121

 Score = 50.1 bits (118),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK K D+ GN+  YKARLVAKG+ Q + IDY E
Sbjct  29   KWIFKTKRDSKGNIVRYKARLVAKGFTQKEDIDYKE  64



>emb|CAN65591.1| hypothetical protein VITISV_042091 [Vitis vinifera]
Length=1427

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+F+ K + DG+++ YKARLVAKG+ Q  G+DYH+
Sbjct  941  KWVFRIKRNPDGSISRYKARLVAKGFHQRPGVDYHD  976



>ref|XP_008238300.1| PREDICTED: uncharacterized protein LOC103336939 [Prunus mume]
Length=753

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFKKK   DG +  YKARLVAKGYRQ +G+D+ +
Sbjct  590  KWIFKKKLKPDGTIDKYKARLVAKGYRQKEGLDFFD  625



>ref|XP_011014816.1| PREDICTED: uncharacterized protein LOC105118536 [Populus euphratica]
Length=1202

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            +W++K KT++DG++  YKARLVAKGY Q  G+DY E
Sbjct  451  RWVYKIKTNSDGSIERYKARLVAKGYSQQYGMDYEE  486



>ref|XP_010068692.1| PREDICTED: uncharacterized protein LOC104455629 [Eucalyptus grandis]
Length=817

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW++K K  ADG++  YKARLVAKG+ Q +G DYHE
Sbjct  537  KWVYKIKYCADGSIERYKARLVAKGFTQREGFDYHE  572



>emb|CAN74165.1| hypothetical protein VITISV_026445 [Vitis vinifera]
Length=378

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+FK K D+ GN+  YKARLVAKG+ Q +GIDY E
Sbjct  29   KWVFKTKKDSLGNIERYKARLVAKGFTQKEGIDYTE  64



>ref|XP_004240848.2| PREDICTED: uncharacterized protein LOC101249647 [Solanum lycopersicum]
Length=982

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KW+ K K  ADG V  +KARLVA+GY Q++G+DYH+
Sbjct  167  KWVLKIKYKADGTVDRFKARLVARGYSQLEGLDYHD  202



>emb|CAC95126.1| gag-pol polyprotein [Populus deltoides]
Length=1382

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            +W++K KT++DG++  YKARLVAKGY Q  G+DY E
Sbjct  919  RWVYKIKTNSDGSIERYKARLVAKGYSQQYGMDYEE  954



>emb|CAN77322.1| hypothetical protein VITISV_002172 [Vitis vinifera]
Length=776

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIF  K  ADG++  YKARLVAKGY Q  GIDY E
Sbjct  362  KWIFSIKYKADGSIDRYKARLVAKGYTQKHGIDYQE  397



>emb|CAN64613.1| hypothetical protein VITISV_030850 [Vitis vinifera]
Length=598

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIF  K  ADG++  YKARLVAKGY Q  GIDY E
Sbjct  167  KWIFSIKYKADGSIDRYKARLVAKGYTQKHGIDYQE  202



>ref|XP_004153049.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Cucumis sativus]
Length=354

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    KWIFKKKTDADGNVTIYKARLVAKGYRQVQGIDYHE  115
            KWIFK KT  DG++  YK RLVAKGY Q  GIDY E
Sbjct  29   KWIFKIKTHFDGSIERYKTRLVAKGYSQEYGIDYKE  64



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 521190666984