BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c12003_g1_i1 len=1459 path=[1:0-1194 1196:1195-1458]

Length=1459
                                                                      Score     E

ref|XP_009630714.1|  PREDICTED: protein IQ-DOMAIN 14                    401   6e-131   
ref|XP_009768838.1|  PREDICTED: uncharacterized protein LOC104219797    387   7e-128   
ref|XP_004245642.1|  PREDICTED: protein IQ-DOMAIN 14                    392   2e-127   
ref|XP_011073931.1|  PREDICTED: protein IQ-DOMAIN 14-like               382   3e-124   
ref|XP_006358875.1|  PREDICTED: protein IQ-DOMAIN 14-like               381   2e-123   
ref|XP_011081019.1|  PREDICTED: uncharacterized protein LOC105164138    371   2e-119   
ref|XP_002276651.1|  PREDICTED: uncharacterized protein LOC100254717    371   2e-119   Vitis vinifera
emb|CAN75939.1|  hypothetical protein VITISV_040960                     351   4e-111   Vitis vinifera
ref|XP_011029204.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X1    330   7e-104   
ref|XP_002299555.2|  hypothetical protein POPTR_0001s08910g             329   2e-103   Populus trichocarpa [western balsam poplar]
ref|XP_008238822.1|  PREDICTED: protein IQ-DOMAIN 14                    323   3e-102   
ref|XP_007040139.1|  IQ-domain 22, putative                             327   4e-102   
ref|XP_007210506.1|  hypothetical protein PRUPE_ppa005786mg             323   2e-101   
ref|XP_010112558.1|  Protein IQ-DOMAIN 31                               322   2e-100   
gb|KDP25495.1|  hypothetical protein JCGZ_20651                         320   2e-99    
ref|XP_011029205.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X2    307   6e-95    
ref|XP_004298748.1|  PREDICTED: uncharacterized protein LOC101291430    303   2e-93    
ref|XP_002509726.1|  calmodulin binding protein, putative               303   3e-93    Ricinus communis
emb|CBI34723.3|  unnamed protein product                                302   4e-93    
emb|CDP09797.1|  unnamed protein product                                295   2e-92    
gb|KDO63544.1|  hypothetical protein CISIN_1g011616mg                   300   5e-92    
ref|XP_010055603.1|  PREDICTED: protein IQ-DOMAIN 14                    300   6e-92    
gb|KHG04847.1|  Protein IQ-DOMAIN 31 -like protein                      299   8e-92    
ref|XP_006477414.1|  PREDICTED: protein IQ-DOMAIN 14-like               299   1e-91    
ref|XP_006440555.1|  hypothetical protein CICLE_v10019930mg             298   2e-91    
emb|CAK18867.1|  putative calmodulin binding protein precursor          286   3e-90    Phillyrea latifolia
ref|XP_010676531.1|  PREDICTED: protein IQ-DOMAIN 14                    295   1e-89    
ref|XP_008345351.1|  PREDICTED: protein IQ-DOMAIN 14-like               290   9e-89    
ref|XP_002303569.2|  hypothetical protein POPTR_0003s12300g             275   2e-82    Populus trichocarpa [western balsam poplar]
ref|XP_010278570.1|  PREDICTED: protein IQ-DOMAIN 14-like               273   8e-82    
ref|XP_011033789.1|  PREDICTED: protein IQ-DOMAIN 14-like               271   4e-81    
ref|XP_009628884.1|  PREDICTED: protein IQ-DOMAIN 14-like               253   6e-75    
ref|XP_010255505.1|  PREDICTED: protein IQ-DOMAIN 1-like                249   2e-72    
ref|XP_009615885.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X1    245   7e-72    
ref|XP_009762655.1|  PREDICTED: protein IQ-DOMAIN 14-like               240   6e-70    
ref|XP_009792336.1|  PREDICTED: uncharacterized protein LOC104239404    234   2e-69    
ref|XP_010933871.1|  PREDICTED: protein IQ-DOMAIN 1-like                240   6e-69    
ref|XP_003550875.1|  PREDICTED: protein IQ-DOMAIN 14-like               236   6e-68    
ref|XP_008799524.1|  PREDICTED: protein IQ-DOMAIN 1                     236   1e-67    
gb|KEH31712.1|  calmodulin-binding protein                              233   3e-67    
ref|XP_003525537.1|  PREDICTED: protein IQ-DOMAIN 14-like               232   1e-66    
ref|XP_007155556.1|  hypothetical protein PHAVU_003G211800g             231   3e-66    
ref|XP_004515805.1|  PREDICTED: protein IQ-DOMAIN 14-like               228   3e-65    
gb|KHN34427.1|  hypothetical protein glysoja_016755                     223   3e-64    
gb|KHN14115.1|  hypothetical protein glysoja_033342                     224   6e-64    
ref|XP_008795399.1|  PREDICTED: protein IQ-DOMAIN 1-like                225   2e-63    
ref|XP_009615886.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X2    220   2e-62    
ref|XP_010919244.1|  PREDICTED: protein IQ-DOMAIN 14                    221   4e-62    
ref|XP_003516692.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X1    215   1e-60    
gb|EYU29831.1|  hypothetical protein MIMGU_mgv1a006306mg                213   2e-59    
ref|XP_008369498.1|  PREDICTED: protein IQ-DOMAIN 14                    210   9e-59    
ref|XP_006573764.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X2    205   4e-57    
gb|KHN25723.1|  Protein IQ-DOMAIN 14                                    203   7e-56    
gb|EYU38984.1|  hypothetical protein MIMGU_mgv1a008113mg                192   2e-52    
ref|XP_002448359.1|  hypothetical protein SORBIDRAFT_06g025790          193   1e-51    Sorghum bicolor [broomcorn]
ref|XP_009401769.1|  PREDICTED: protein IQ-DOMAIN 31-like               191   4e-51    
emb|CAH67037.1|  OSIGBa0139P06.10                                       186   3e-49    Oryza sativa [red rice]
ref|XP_007158468.1|  hypothetical protein PHAVU_002G154900g             184   7e-49    
ref|NP_001053598.1|  Os04g0569900                                       185   8e-49    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004976532.1|  PREDICTED: protein IQ-DOMAIN 1-like                183   3e-48    
dbj|BAJ88194.1|  predicted protein                                      179   2e-46    
ref|XP_006653689.1|  PREDICTED: protein IQ-DOMAIN 14-like               174   2e-45    
ref|XP_002318230.2|  hypothetical protein POPTR_0012s13350g             174   4e-45    Populus trichocarpa [western balsam poplar]
ref|XP_006857873.1|  hypothetical protein AMTR_s00069p00100460          169   3e-43    
ref|XP_010555545.1|  PREDICTED: protein IQ-DOMAIN 14                    166   4e-43    
ref|XP_007038616.1|  IQ-domain 24, putative                             169   4e-43    
ref|XP_008663478.1|  PREDICTED: protein IQ-DOMAIN 1-like                167   1e-42    
ref|XP_011030086.1|  PREDICTED: protein IQ-DOMAIN 14 isoform X2         166   4e-42    
ref|XP_010107408.1|  Protein IQ-DOMAIN 14                               166   5e-42    
gb|KDP22315.1|  hypothetical protein JCGZ_26146                         166   9e-42    
ref|XP_002510825.1|  conserved hypothetical protein                     165   1e-41    Ricinus communis
ref|XP_003580351.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X2          164   2e-41    
ref|XP_002869792.1|  IQ-domain 22                                       165   2e-41    
emb|CDP05236.1|  unnamed protein product                                165   2e-41    
ref|XP_009393924.1|  PREDICTED: protein IQ-DOMAIN 1-like                164   3e-41    
ref|XP_011030085.1|  PREDICTED: protein IQ-DOMAIN 14 isoform X1         164   3e-41    
ref|NP_001147670.1|  LOC100281279                                       163   5e-41    Zea mays [maize]
ref|XP_010240279.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X1          163   5e-41    
gb|KEH17374.1|  calmodulin-binding protein                              163   6e-41    
ref|XP_007152324.1|  hypothetical protein PHAVU_004G120200g             162   2e-40    
ref|XP_003549118.1|  PREDICTED: protein IQ-DOMAIN 14-like               161   3e-40    
gb|KFK28871.1|  hypothetical protein AALP_AA7G059200                    158   4e-39    
ref|NP_194037.2|  protein IQ-domain 22                                  158   4e-39    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008437216.1|  PREDICTED: protein IQ-DOMAIN 14 isoform X1         155   5e-39    
ref|XP_003533215.1|  PREDICTED: protein IQ-DOMAIN 14-like               157   7e-39    
ref|XP_006283627.1|  hypothetical protein CARUB_v10004684mg             157   9e-39    
ref|XP_006413583.1|  hypothetical protein EUTSA_v10025012mg             157   1e-38    
ref|XP_004143989.1|  PREDICTED: protein IQ-DOMAIN 14-like               154   2e-38    
ref|XP_008437217.1|  PREDICTED: protein IQ-DOMAIN 14 isoform X2         152   4e-38    
gb|KHG15436.1|  Protein IQ-DOMAIN 14 -like protein                      154   6e-38    
ref|XP_003592300.1|  hypothetical protein MTR_1g101330                  154   6e-38    
ref|XP_011048685.1|  PREDICTED: protein IQ-DOMAIN 14-like               154   8e-38    
ref|XP_010439237.1|  PREDICTED: uncharacterized protein LOC104722723    154   2e-37    
gb|AFW59282.1|  hypothetical protein ZEAMMB73_392897                    150   2e-37    
ref|XP_002322461.1|  calmodulin-binding family protein                  152   3e-37    Populus trichocarpa [western balsam poplar]
ref|XP_010448780.1|  PREDICTED: protein IQ-DOMAIN 14-like               152   6e-37    
ref|XP_006421869.1|  hypothetical protein CICLE_v10004956mg             150   1e-36    
ref|XP_010433947.1|  PREDICTED: uncharacterized protein LOC104717998    150   3e-36    
ref|XP_007219045.1|  hypothetical protein PRUPE_ppa004660mg             150   4e-36    
ref|XP_007143373.1|  hypothetical protein PHAVU_007G067100g             149   4e-36    
ref|XP_009136658.1|  PREDICTED: protein IQ-DOMAIN 14-like               149   5e-36    
emb|CDY53133.1|  BnaC01g41430D                                          149   6e-36    
ref|XP_004234367.1|  PREDICTED: uncharacterized protein LOC101268068    147   3e-35    
emb|CDY41252.1|  BnaA01g12870D                                          147   3e-35    
ref|XP_003556089.1|  PREDICTED: protein IQ-DOMAIN 14-like               146   3e-35    
ref|XP_008377224.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X1    145   8e-35    
ref|XP_004515721.1|  PREDICTED: protein IQ-DOMAIN 14-like               145   8e-35    
ref|XP_008376538.1|  PREDICTED: protein IQ-DOMAIN 14-like               142   8e-34    
gb|AFW59279.1|  hypothetical protein ZEAMMB73_392897                    138   1e-33    
ref|XP_008377231.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X2    142   1e-33    
ref|XP_009371296.1|  PREDICTED: protein IQ-DOMAIN 32-like               140   2e-33    
gb|KHN31526.1|  hypothetical protein glysoja_029661                     138   3e-33    
gb|ACF79323.1|  unknown                                                 137   4e-33    Zea mays [maize]
ref|XP_009768674.1|  PREDICTED: protein IQ-DOMAIN 14                    140   7e-33    
ref|XP_006589561.1|  PREDICTED: protein IQ-DOMAIN 14-like               139   7e-33    
gb|ACF83806.1|  unknown                                                 136   8e-33    Zea mays [maize]
ref|XP_009592277.1|  PREDICTED: protein IQ-DOMAIN 14-like               139   1e-32    
ref|XP_009382295.1|  PREDICTED: protein IQ-DOMAIN 1-like                138   3e-32    
emb|CDX98786.1|  BnaA03g45710D                                          138   3e-32    
ref|XP_008439181.1|  PREDICTED: protein IQ-DOMAIN 14                    137   5e-32    
gb|KGN57352.1|  hypothetical protein Csa_3G180400                       135   2e-31    
ref|XP_004157228.1|  PREDICTED: uncharacterized LOC101216161            135   2e-31    
ref|XP_009137309.1|  PREDICTED: protein IQ-DOMAIN 14-like               135   3e-31    
ref|XP_004159978.1|  PREDICTED: protein IQ-DOMAIN 14-like               134   3e-31    
ref|XP_011076213.1|  PREDICTED: protein IQ-DOMAIN 31                    132   2e-30    
ref|XP_004308110.1|  PREDICTED: uncharacterized protein LOC101300399    132   3e-30    
emb|CDX94150.1|  BnaC07g37840D                                          129   2e-29    
ref|XP_006421870.1|  hypothetical protein CICLE_v10004956mg             126   1e-28    
ref|XP_004496596.1|  PREDICTED: protein IQ-DOMAIN 14-like               125   5e-28    
ref|XP_006352283.1|  PREDICTED: protein IQ-DOMAIN 14-like               120   6e-27    
emb|CDX98787.1|  BnaA03g45720D                                          117   3e-26    
ref|XP_011101185.1|  PREDICTED: protein IQ-DOMAIN 14-like               118   5e-26    
gb|KHN02804.1|  hypothetical protein glysoja_016046                     117   6e-26    
emb|CDY41368.1|  BnaC03g65130D                                          116   3e-25    
ref|XP_006353347.1|  PREDICTED: uncharacterized protein LOC102581442    112   2e-24    
gb|AFK48422.1|  unknown                                                 110   3e-24    
gb|EPS73598.1|  hypothetical protein M569_01161                         111   2e-23    
ref|XP_010061313.1|  PREDICTED: LOW QUALITY PROTEIN: protein IQ-D...    110   6e-23    
gb|EYU19528.1|  hypothetical protein MIMGU_mgv1a006074mg                108   2e-22    
emb|CAA19822.1|  putative protein                                       108   7e-22    Arabidopsis thaliana [mouse-ear cress]
gb|KHG06192.1|  Protein IQ-DOMAIN 31 -like protein                      106   2e-21    
ref|XP_006399207.1|  hypothetical protein EUTSA_v10013677mg             102   2e-20    
ref|XP_010662509.1|  PREDICTED: protein IQ-DOMAIN 14                    102   5e-20    
emb|CBI31824.3|  unnamed protein product                              99.0    2e-19    
gb|KCW90731.1|  hypothetical protein EUGRSUZ_A02807                   98.6    2e-19    
ref|XP_002312547.2|  calmodulin-binding family protein                99.0    5e-19    Populus trichocarpa [western balsam poplar]
ref|XP_009757400.1|  PREDICTED: protein IQ-DOMAIN 14                  97.8    2e-18    
ref|XP_002517079.1|  calmodulin binding protein, putative             97.4    2e-18    Ricinus communis
ref|XP_002265460.1|  PREDICTED: protein IQ-DOMAIN 14                  96.7    4e-18    Vitis vinifera
ref|XP_011091033.1|  PREDICTED: protein IQ-DOMAIN 14-like             95.5    5e-18    
ref|XP_010256160.1|  PREDICTED: protein IQ-DOMAIN 14-like             95.5    1e-17    
emb|CAN66770.1|  hypothetical protein VITISV_013810                   95.9    1e-17    Vitis vinifera
ref|XP_006838975.1|  hypothetical protein AMTR_s00002p00271290        95.1    2e-17    
ref|XP_010259130.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X1  94.0    4e-17    
ref|XP_008798489.1|  PREDICTED: protein IQ-DOMAIN 14-like             93.2    4e-17    
ref|XP_011026988.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X1  93.6    5e-17    
ref|XP_011026994.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X2  93.2    5e-17    
ref|XP_006420022.1|  hypothetical protein CICLE_v10004919mg           92.0    1e-16    
ref|XP_009629604.1|  PREDICTED: protein IQ-DOMAIN 1                   91.7    2e-16    
ref|XP_010259131.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X2  91.3    2e-16    
ref|XP_006489449.1|  PREDICTED: protein IQ-DOMAIN 14-like             90.9    3e-16    
emb|CDO99100.1|  unnamed protein product                              90.5    5e-16    
gb|KDO74471.1|  hypothetical protein CISIN_1g012293mg                 90.1    6e-16    
ref|XP_010694040.1|  PREDICTED: protein IQ-DOMAIN 32                  89.7    8e-16    
emb|CDX98994.1|  BnaC09g48410D                                        87.8    1e-15    
ref|XP_010092431.1|  Protein IQ-DOMAIN 31                             88.6    2e-15    
gb|KCW90732.1|  hypothetical protein EUGRSUZ_A02807                   86.7    2e-15    
ref|XP_003630704.1|  hypothetical protein MTR_8g102400                88.2    2e-15    
ref|XP_007160280.1|  hypothetical protein PHAVU_002G308100g           88.2    2e-15    
ref|XP_010693466.1|  PREDICTED: protein IQ-DOMAIN 14                  88.2    2e-15    
ref|XP_002314666.2|  calmodulin-binding family protein                88.2    2e-15    Populus trichocarpa [western balsam poplar]
ref|XP_007143302.1|  hypothetical protein PHAVU_007G060900g           87.8    3e-15    
ref|XP_004288896.1|  PREDICTED: uncharacterized protein LOC101305601  87.0    5e-15    
ref|XP_010033552.1|  PREDICTED: protein IQ-DOMAIN 14-like             87.0    6e-15    
ref|XP_010034632.1|  PREDICTED: protein IQ-DOMAIN 14-like             87.0    6e-15    
ref|XP_011093642.1|  PREDICTED: LOW QUALITY PROTEIN: protein IQ-D...  86.7    7e-15    
ref|XP_011030639.1|  PREDICTED: protein IQ-DOMAIN 14-like             85.9    1e-14    
ref|XP_008242480.1|  PREDICTED: protein IQ-DOMAIN 14-like             85.5    1e-14    
ref|XP_010267115.1|  PREDICTED: protein IQ-DOMAIN 14-like             85.5    2e-14    
ref|XP_006426860.1|  hypothetical protein CICLE_v10025716mg           85.1    2e-14    
ref|XP_008224258.1|  PREDICTED: protein IQ-DOMAIN 14                  85.5    2e-14    
gb|KDO51826.1|  hypothetical protein CISIN_1g014980mg                 84.7    2e-14    
ref|XP_009335283.1|  PREDICTED: protein IQ-DOMAIN 14-like             85.1    2e-14    
gb|KDP40852.1|  hypothetical protein JCGZ_24851                       84.0    4e-14    
emb|CDO97967.1|  unnamed protein product                              84.0    4e-14    
ref|XP_009364672.1|  PREDICTED: protein IQ-DOMAIN 14-like             83.6    5e-14    
ref|XP_009392357.1|  PREDICTED: protein IQ-DOMAIN 14                  84.0    5e-14    
ref|XP_009347221.1|  PREDICTED: protein IQ-DOMAIN 14-like             83.6    6e-14    
ref|XP_006465703.1|  PREDICTED: protein IQ-DOMAIN 14-like             83.6    6e-14    
emb|CDX70019.1|  BnaA10g23680D                                        82.4    8e-14    
ref|NP_196341.1|  IQ-domain 24 protein                                82.8    9e-14    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007204806.1|  hypothetical protein PRUPE_ppa025288mg           83.2    1e-13    
gb|AAM14074.1|  unknown protein                                       82.8    1e-13    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003524408.1|  PREDICTED: protein IQ-DOMAIN 14-like             82.0    1e-13    
ref|XP_008360734.1|  PREDICTED: uncharacterized protein LOC103424428  82.4    2e-13    
ref|XP_009338738.1|  PREDICTED: uncharacterized protein LOC103931052  82.0    2e-13    
ref|XP_010249482.1|  PREDICTED: protein IQ-DOMAIN 31-like             82.0    2e-13    
ref|XP_008380848.1|  PREDICTED: uncharacterized protein LOC103443739  82.0    2e-13    
ref|XP_006451315.1|  hypothetical protein CICLE_v10008287mg           81.6    3e-13    
ref|XP_006475587.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X1  81.3    4e-13    
ref|XP_011072442.1|  PREDICTED: protein IQ-DOMAIN 31-like             80.9    4e-13    
ref|XP_007034845.1|  Iq-domain 31 isoform 1                           81.3    4e-13    
ref|XP_006280595.1|  hypothetical protein CARUB_v10026553mg           80.9    4e-13    
ref|XP_007034846.1|  Iq-domain 31 isoform 2                           81.3    5e-13    
ref|XP_007224458.1|  hypothetical protein PRUPE_ppa022210mg           80.9    6e-13    
ref|XP_009122359.1|  PREDICTED: LOW QUALITY PROTEIN: protein IQ-D...  80.1    6e-13    
ref|XP_010932804.1|  PREDICTED: protein IQ-DOMAIN 14 isoform X1       80.5    7e-13    
ref|XP_008777374.1|  PREDICTED: protein IQ-DOMAIN 14                  80.5    7e-13    
ref|XP_010656256.1|  PREDICTED: protein IQ-DOMAIN 14                  80.5    7e-13    
ref|XP_010932805.1|  PREDICTED: protein IQ-DOMAIN 14 isoform X2       80.5    7e-13    
ref|XP_010483943.1|  PREDICTED: protein IQ-DOMAIN 14-like             80.1    8e-13    
ref|XP_002871260.1|  IQ-domain 24                                     80.1    8e-13    
ref|XP_010458214.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X1  79.3    1e-12    
gb|KDP40224.1|  hypothetical protein JCGZ_02222                       79.7    1e-12    
ref|XP_007013015.1|  Iq-domain 31                                     79.3    2e-12    
ref|XP_006363480.1|  PREDICTED: protein IQ-DOMAIN 14-like             79.7    2e-12    
ref|XP_011073614.1|  PREDICTED: protein IQ-DOMAIN 32-like             78.2    2e-12    
ref|XP_009108597.1|  PREDICTED: protein IQ-DOMAIN 14-like             79.0    2e-12    
emb|CAN69979.1|  hypothetical protein VITISV_011284                   78.6    2e-12    Vitis vinifera
gb|KHG17476.1|  Protein IQ-DOMAIN 14 -like protein                    79.0    2e-12    
gb|KHN26986.1|  Protein IQ-DOMAIN 31                                  79.0    2e-12    
gb|KFK27942.1|  hypothetical protein AALP_AA8G451100                  78.6    3e-12    
gb|KEH43814.1|  IQ calmodulin-binding motif protein                   78.6    3e-12    
ref|XP_004503492.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X1  78.2    4e-12    
ref|XP_004503494.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X3  78.2    4e-12    
ref|XP_004503493.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X2  78.2    4e-12    
gb|KFK25118.1|  hypothetical protein AALP_AA8G068100                  77.8    4e-12    
ref|XP_002514224.1|  conserved hypothetical protein                   78.2    4e-12    Ricinus communis
ref|XP_007145905.1|  hypothetical protein PHAVU_007G277500g           77.8    5e-12    
gb|KHG26933.1|  Protein IQ-DOMAIN 31 -like protein                    77.8    5e-12    
ref|XP_002866468.1|  hypothetical protein ARALYDRAFT_496381           77.4    5e-12    
ref|XP_004244720.1|  PREDICTED: protein IQ-DOMAIN 31-like             75.5    6e-12    
ref|XP_010098153.1|  Protein IQ-DOMAIN 31                             75.9    6e-12    
ref|XP_004247593.1|  PREDICTED: protein IQ-DOMAIN 14                  77.4    6e-12    
ref|XP_008450788.1|  PREDICTED: protein IQ-DOMAIN 14-like             77.0    7e-12    
ref|XP_004510319.1|  PREDICTED: protein IQ-DOMAIN 14-like             76.6    1e-11    
ref|XP_004241751.1|  PREDICTED: protein IQ-DOMAIN 14-like             76.6    1e-11    
ref|XP_002277925.2|  PREDICTED: protein IQ-DOMAIN 14-like             76.3    1e-11    Vitis vinifera
ref|XP_003517637.1|  PREDICTED: protein IQ-DOMAIN 14-like             76.6    1e-11    
gb|EYU25070.1|  hypothetical protein MIMGU_mgv1a007392mg              76.3    1e-11    
ref|XP_011080380.1|  PREDICTED: protein IQ-DOMAIN 14-like             75.9    2e-11    
gb|AAM65934.1|  unknown                                               75.9    2e-11    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004158419.1|  PREDICTED: uncharacterized protein LOC101226199  75.5    2e-11    
ref|XP_006356137.1|  PREDICTED: protein IQ-DOMAIN 14-like             75.5    2e-11    
ref|XP_004135807.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  74.7    3e-11    
emb|CBI26300.3|  unnamed protein product                              75.5    3e-11    
gb|KGN66184.1|  hypothetical protein Csa_1G575000                     74.7    3e-11    
ref|XP_008228411.1|  PREDICTED: protein IQ-DOMAIN 14                  75.1    3e-11    
gb|KDP33804.1|  hypothetical protein JCGZ_07375                       75.1    4e-11    
ref|XP_004244721.2|  PREDICTED: uncharacterized protein LOC101261345  71.2    5e-11    
ref|XP_009371968.1|  PREDICTED: protein IQ-DOMAIN 14-like             74.7    5e-11    
ref|XP_007216908.1|  hypothetical protein PRUPE_ppa019001mg           74.3    5e-11    
ref|XP_011000945.1|  PREDICTED: protein IQ-DOMAIN 14-like             74.3    7e-11    
ref|XP_004297967.1|  PREDICTED: uncharacterized protein LOC101300531  74.3    7e-11    
ref|XP_008391004.1|  PREDICTED: protein IQ-DOMAIN 14                  74.3    8e-11    
ref|XP_010444078.1|  PREDICTED: protein IQ-DOMAIN 14-like             72.4    8e-11    
ref|XP_004140851.1|  PREDICTED: uncharacterized protein LOC101216161  72.0    9e-11    
ref|XP_007135626.1|  hypothetical protein PHAVU_010G144700g           73.6    9e-11    
emb|CDX86928.1|  BnaC03g51980D                                        73.6    1e-10    
gb|EPS67207.1|  hypothetical protein M569_07568                       73.9    1e-10    
gb|KHG10609.1|  Protein IQ-DOMAIN 14 -like protein                    73.2    1e-10    
ref|XP_009151328.1|  PREDICTED: protein IQ-DOMAIN 14                  73.2    1e-10    
ref|XP_006394438.1|  hypothetical protein EUTSA_v10004365mg           72.8    2e-10    
emb|CDY00253.1|  BnaA06g21540D                                        72.8    2e-10    
ref|XP_002299740.2|  hypothetical protein POPTR_0001s19140g           72.4    2e-10    Populus trichocarpa [western balsam poplar]
ref|XP_004134123.1|  PREDICTED: uncharacterized protein LOC101202972  72.4    3e-10    
emb|CDP03247.1|  unnamed protein product                              72.4    3e-10    
ref|XP_006584809.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X1  72.0    3e-10    
ref|XP_009622656.1|  PREDICTED: protein IQ-DOMAIN 31-like             71.2    6e-10    
ref|XP_009130986.1|  PREDICTED: uncharacterized protein LOC103855722  70.9    6e-10    
emb|CBI36045.3|  unnamed protein product                              72.0    6e-10    
ref|XP_003638200.1|  Vacuolar protein sorting-associated protein-...  71.2    8e-10    
ref|XP_004496689.1|  PREDICTED: protein IQ-DOMAIN 1-like              70.9    9e-10    
emb|CDX78285.1|  BnaA03g01970D                                        69.7    1e-09    
ref|XP_007152967.1|  hypothetical protein PHAVU_004G175300g           69.7    2e-09    
ref|XP_009777311.1|  PREDICTED: protein IQ-DOMAIN 31-like             69.3    2e-09    
ref|XP_004497985.1|  PREDICTED: protein IQ-DOMAIN 14-like             69.7    2e-09    
emb|CDX91859.1|  BnaC03g31610D                                        69.7    2e-09    
ref|XP_010062543.1|  PREDICTED: uncharacterized protein LOC104449924  69.3    2e-09    
ref|XP_010523575.1|  PREDICTED: uncharacterized protein LOC104801888  68.6    3e-09    
ref|XP_009801538.1|  PREDICTED: uncharacterized protein LOC104247280  65.9    5e-09    
gb|KEH41068.1|  IQ calmodulin-binding motif protein                   67.8    7e-09    
ref|XP_006583044.1|  PREDICTED: protein IQ-DOMAIN 14-like             67.8    8e-09    
gb|KHN14257.1|  Protein IQ-DOMAIN 31                                  67.8    8e-09    
ref|XP_006583555.1|  PREDICTED: protein IQ-DOMAIN 14-like             67.8    8e-09    
emb|CDX81042.1|  BnaC03g02960D                                        67.4    8e-09    
ref|XP_008342322.1|  PREDICTED: protein IQ-DOMAIN 14-like             67.4    9e-09    
ref|XP_009344480.1|  PREDICTED: uncharacterized protein LOC103936369  67.4    9e-09    
emb|CDY69140.1|  BnaAnng29450D                                        67.8    1e-08    
gb|EYU41446.1|  hypothetical protein MIMGU_mgv1a006082mg              67.0    1e-08    
ref|XP_009134490.1|  PREDICTED: protein IQ-DOMAIN 1                   66.6    2e-08    
ref|XP_002304223.2|  hypothetical protein POPTR_0003s04620g           65.9    3e-08    
ref|XP_008438624.1|  PREDICTED: protein IQ-DOMAIN 14                  65.9    3e-08    
ref|XP_007024326.1|  Iq-domain 14 isoform 1                           65.9    3e-08    
ref|XP_006606073.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X2  65.5    5e-08    
gb|KHN15734.1|  Protein IQ-DOMAIN 14                                  64.7    7e-08    
ref|XP_003556065.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X1  64.7    7e-08    
ref|XP_006589585.1|  PREDICTED: protein IQ-DOMAIN 14-like             64.7    9e-08    
ref|XP_010452681.1|  PREDICTED: protein IQ-DOMAIN 14                  63.5    2e-07    
ref|XP_006287883.1|  hypothetical protein CARUB_v10001110mg           63.2    2e-07    
emb|CDY00251.1|  BnaA06g21520D                                        63.2    2e-07    
ref|XP_004305257.1|  PREDICTED: protein IQ-DOMAIN 14-like             62.8    3e-07    
ref|XP_008649419.1|  PREDICTED: protein IQ-DOMAIN 14-like             62.4    4e-07    
ref|XP_010938447.1|  PREDICTED: protein IQ-DOMAIN 14-like             62.4    4e-07    
ref|XP_010110878.1|  Protein IQ-DOMAIN 31                             62.4    5e-07    
ref|XP_010267407.1|  PREDICTED: protein IQ-DOMAIN 1                   62.4    5e-07    
ref|XP_011013968.1|  PREDICTED: protein IQ-DOMAIN 14-like             61.6    6e-07    
ref|NP_001054836.1|  Os05g0187500                                     62.0    6e-07    
ref|XP_002875013.1|  IQ-domain 17                                     61.6    8e-07    
ref|XP_010457172.1|  PREDICTED: protein IQ-DOMAIN 1-like              61.6    8e-07    
ref|XP_006606074.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X3  61.2    8e-07    
ref|XP_002515955.1|  conserved hypothetical protein                   61.2    8e-07    
ref|XP_009352560.1|  PREDICTED: protein IQ-DOMAIN 14-like             61.2    9e-07    
ref|XP_002518922.1|  conserved hypothetical protein                   60.8    1e-06    
ref|XP_004134281.1|  PREDICTED: protein IQ-DOMAIN 14-like             60.5    2e-06    
ref|XP_004155200.1|  PREDICTED: protein IQ-DOMAIN 14-like             60.5    2e-06    
ref|XP_010051558.1|  PREDICTED: protein IQ-DOMAIN 14-like             60.1    2e-06    
ref|XP_010480654.1|  PREDICTED: protein IQ-DOMAIN 1-like              59.7    3e-06    
ref|XP_011025382.1|  PREDICTED: protein IQ-DOMAIN 1                   59.7    3e-06    
gb|KFK42501.1|  hypothetical protein AALP_AA1G001700                  59.7    4e-06    
ref|XP_010474698.1|  PREDICTED: protein IQ-DOMAIN 1-like              59.3    4e-06    
ref|XP_007150597.1|  hypothetical protein PHAVU_005G165500g           58.9    4e-06    
ref|NP_201013.1|  protein IQ-domain 23                                58.9    5e-06    
ref|XP_006307205.1|  hypothetical protein CARUB_v10008796mg           59.3    5e-06    
dbj|BAF00832.1|  hypothetical protein                                 58.9    6e-06    
ref|NP_567191.2|  protein IQ-domain 17                                58.9    6e-06    
ref|XP_007150595.1|  hypothetical protein PHAVU_005G165500g           58.5    6e-06    
ref|XP_010456163.1|  PREDICTED: protein IQ-DOMAIN 1-like              58.5    8e-06    
gb|KHN10073.1|  Protein IQ-DOMAIN 31                                  58.2    8e-06    
ref|XP_003536833.1|  PREDICTED: protein IQ-DOMAIN 14-like             58.2    8e-06    
ref|XP_008658572.1|  PREDICTED: calmodulin binding protein isofor...  57.8    1e-05    
ref|XP_006585563.1|  PREDICTED: protein IQ-DOMAIN 14-like             57.8    1e-05    
ref|XP_006406831.1|  hypothetical protein EUTSA_v10020849mg           57.4    1e-05    
ref|XP_004514932.1|  PREDICTED: protein IQ-DOMAIN 1-like              57.8    2e-05    
gb|KDP23646.1|  hypothetical protein JCGZ_23479                       57.0    2e-05    
ref|XP_010423237.1|  PREDICTED: protein IQ-DOMAIN 14-like             56.6    2e-05    
ref|XP_006287463.1|  hypothetical protein CARUB_v10000672mg           57.0    2e-05    
ref|XP_008239264.1|  PREDICTED: protein IQ-DOMAIN 1-like              57.0    2e-05    
gb|EYU45838.1|  hypothetical protein MIMGU_mgv1a021295mg              56.6    2e-05    
ref|XP_007039184.1|  IQ-domain 17, putative                           57.0    3e-05    
ref|XP_010491328.1|  PREDICTED: protein IQ-DOMAIN 14-like             56.2    3e-05    
emb|CDP08623.1|  unnamed protein product                              56.6    4e-05    
ref|XP_010102309.1|  Protein IQ-DOMAIN 14                             56.2    4e-05    
ref|XP_009416469.1|  PREDICTED: uncharacterized protein LOC103997...  55.8    5e-05    
ref|XP_009416470.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X2  55.8    5e-05    
ref|XP_010428170.1|  PREDICTED: protein IQ-DOMAIN 1-like              55.8    5e-05    
ref|XP_006396335.1|  hypothetical protein EUTSA_v10028557mg           55.8    6e-05    
ref|XP_008437775.1|  PREDICTED: protein IQ-DOMAIN 1                   55.5    7e-05    
gb|KCW82319.1|  hypothetical protein EUGRSUZ_C03723                   55.5    7e-05    
gb|KHG03794.1|  Protein IQ-DOMAIN 31 -like protein                    55.1    7e-05    
gb|KHG21404.1|  Protein IQ-DOMAIN 14 -like protein                    55.1    9e-05    
ref|XP_007039369.1|  Iq-domain 1                                      55.1    1e-04    
gb|KFK30665.1|  hypothetical protein AALP_AA6G011900                  54.7    1e-04    
ref|XP_010662925.1|  PREDICTED: protein IQ-DOMAIN 14                  54.7    1e-04    
ref|XP_003597791.1|  hypothetical protein MTR_2g102380                51.2    1e-04    
gb|KHN00271.1|  Protein IQ-DOMAIN 31                                  54.3    1e-04    
emb|CBI23074.3|  unnamed protein product                              54.3    1e-04    
ref|XP_002464600.1|  hypothetical protein SORBIDRAFT_01g021660        54.7    1e-04    
ref|XP_011013401.1|  PREDICTED: protein IQ-DOMAIN 1-like              54.7    1e-04    
ref|XP_002302670.2|  hypothetical protein POPTR_0002s17930g           54.3    2e-04    
ref|XP_009385779.1|  PREDICTED: protein IQ-DOMAIN 14-like             53.5    2e-04    
ref|XP_010917795.1|  PREDICTED: protein IQ-DOMAIN 14-like             53.5    2e-04    
ref|XP_009415192.1|  PREDICTED: protein IQ-DOMAIN 14-like             53.5    3e-04    
ref|XP_002300498.2|  hypothetical protein POPTR_0001s45220g           53.5    3e-04    
ref|NP_001242711.1|  uncharacterized protein LOC100810189             53.1    4e-04    
ref|XP_006574456.1|  PREDICTED: uncharacterized protein LOC100810...  53.1    4e-04    
ref|XP_010688345.1|  PREDICTED: protein IQ-DOMAIN 14                  52.8    5e-04    
ref|XP_007210753.1|  hypothetical protein PRUPE_ppa021141mg           52.8    6e-04    
ref|XP_006574457.1|  PREDICTED: uncharacterized protein LOC100810...  52.0    6e-04    
ref|XP_004486789.1|  PREDICTED: protein IQ-DOMAIN 14-like             52.0    7e-04    
gb|KGN61670.1|  hypothetical protein Csa_2G222130                     52.4    7e-04    
ref|XP_008449323.1|  PREDICTED: uncharacterized protein LOC103491236  52.4    7e-04    
ref|XP_004166570.1|  PREDICTED: uncharacterized LOC101212161          52.0    7e-04    
ref|XP_004145422.1|  PREDICTED: uncharacterized protein LOC101212161  52.0    7e-04    
ref|XP_011041076.1|  PREDICTED: protein IQ-DOMAIN 1-like              52.4    8e-04    
ref|XP_006343775.1|  PREDICTED: protein IQ-DOMAIN 14-like             52.0    8e-04    
ref|XP_003627052.1|  IQ domain-containing protein                     52.0    9e-04    
ref|XP_003597665.1|  IQ domain-containing protein                     51.6    0.001    



>ref|XP_009630714.1| PREDICTED: protein IQ-DOMAIN 14 [Nicotiana tomentosiformis]
Length=510

 Score =   401 bits (1031),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 263/374 (70%), Positives = 293/374 (78%), Gaps = 19/374 (5%)
 Frame = +1

Query  61    NRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGL  240
             NR+    G RE+ AAV IQSHFRAYLSRRALRALK LV+LQALV+G++VR+ TAD LR +
Sbjct  151   NRSRAESGSREDWAAVVIQSHFRAYLSRRALRALKGLVKLQALVRGHIVRQQTADYLRQM  210

Query  241   QALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKR  420
             QA++RAQSRAR+G  ++S SPHSSTKSVQF H GP TPEKFE VI  RS ++D+T MLKR
Sbjct  211   QAMIRAQSRARAGRSQVSGSPHSSTKSVQFLHAGPTTPEKFEHVIRARSMKHDETFMLKR  270

Query  421   NLSKR--RVIGDQEKVRSNRMDYRMDAWSWEHQGSS-RSGPIDDGKSDKILEIDTGKPVF  591
             N SK   +VI D EK R               QGSS R+   DD KSDKILEIDTGK   
Sbjct  271   NTSKSNWKVI-DSEKAR------------IRPQGSSARTNSFDDEKSDKILEIDTGKQYA  317

Query  592   LPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESC  771
              PK RNLFHSSHLSLNSDQYSYSL TSK+STAHQ V SPS C  Q LSP  F +++ E+C
Sbjct  318   TPKQRNLFHSSHLSLNSDQYSYSLTTSKESTAHQTVPSPSSCGNQPLSPLKFNEELEEAC  377

Query  772   FCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSL  948
             FCTADNSPQFYSASSKGGSS+ GPFTP+KSD +RSCLSGYSDHPNYMSYTESAKAK+RS+
Sbjct  378   FCTADNSPQFYSASSKGGSSKRGPFTPTKSDGSRSCLSGYSDHPNYMSYTESAKAKVRSM  437

Query  949   SAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPVIR  1128
             SAPKQRP YERSSS KRYSIHGY E RTNSQ+G S  A+FT KAYPGSGRLD  GMPVIR
Sbjct  438   SAPKQRPHYERSSSIKRYSIHGYSESRTNSQKG-SFYASFTGKAYPGSGRLDRLGMPVIR  496

Query  1129  -DQVGFSGGLWHRY  1167
              D  GFSGGL HRY
Sbjct  497   ADPSGFSGGLRHRY  510



>ref|XP_009768838.1| PREDICTED: uncharacterized protein LOC104219797, partial [Nicotiana 
sylvestris]
Length=346

 Score =   387 bits (995),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 232/331 (70%), Positives = 259/331 (78%), Gaps = 19/331 (6%)
 Frame = +1

Query  190   VKGYLVRKHTADMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQ  369
             V+G++VR+ TAD LR +QA++RAQSRAR+G  ++S SPHSSTKSVQF H GP TPEKFE 
Sbjct  30    VRGHIVRQQTADYLRQMQAMIRAQSRARAGRYQVSGSPHSSTKSVQFLHGGPTTPEKFEH  89

Query  370   VIHMRSGQNDDTIMLKRNLSKR--RVIGDQEKVRSNRMDYRMDAWSWEHQGSS-RSGPID  540
             V+  RS ++D+T MLKRN SK   +VI D EK R               QGSS R+   D
Sbjct  90    VVRARSMKHDETFMLKRNTSKSNWKVI-DSEKAR------------IRPQGSSARTNSFD  136

Query  541   DGKSDKILEIDTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCE  720
             D KSDKILEIDTGKP   PK RNLFHSSHLSLNSDQYSYSL TSK+STAHQ V SPS C 
Sbjct  137   DEKSDKILEIDTGKPYATPKQRNLFHSSHLSLNSDQYSYSLTTSKESTAHQTVPSPSSCG  196

Query  721   AQSLSPQNFGQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDH  897
              Q LSP  F ++I E+CFCTADNSPQFYSASSKGGSS+ GPFTP+KSD +RSCLSGYSDH
Sbjct  197   NQPLSPLKFNEEIEEACFCTADNSPQFYSASSKGGSSKRGPFTPTKSDGSRSCLSGYSDH  256

Query  898   PNYMSYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSK  1077
             PNYMSYTESAKAK+RS+SAPKQRP YERSSS KRYSIHGY E RTNSQ+G S  A+FT K
Sbjct  257   PNYMSYTESAKAKVRSMSAPKQRPHYERSSSIKRYSIHGYSESRTNSQKG-SFYASFTGK  315

Query  1078  AYPGSGRLDSFGMPVIR-DQVGFSGGLWHRY  1167
             AYPGSGRLD  GMPVIR D  GFSGGL HRY
Sbjct  316   AYPGSGRLDRLGMPVIRADPSGFSGGLRHRY  346



>ref|XP_004245642.1| PREDICTED: protein IQ-DOMAIN 14 [Solanum lycopersicum]
Length=499

 Score =   392 bits (1007),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 263/395 (67%), Positives = 298/395 (75%), Gaps = 21/395 (5%)
 Frame = +1

Query  1     GRSTSAAAWCGSTVNSTAC-INRNAGGYGIREELAAVKIQSHFraylsrralralkalvr  177
             G + +   W G ++ S+A    R     G RE  AAV IQSHFRAYLSRRALRALK LV+
Sbjct  120   GGAAAVTTWNGVSLTSSAVGCKRKGVAAGNRENWAAVVIQSHFRAYLSRRALRALKGLVK  179

Query  178   lqalVKGYLVRKHTADMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPE  357
             LQALV+G+++R+ TAD LR +QA+ RAQSRAR+G  ++S SPHSSTKSVQF H  P TPE
Sbjct  180   LQALVRGHIIRRQTADYLRQMQAISRAQSRARAGRSQVSGSPHSSTKSVQFVH-DPTTPE  238

Query  358   KFEQVIHMRSGQNDDTIMLKRNLSKR--RVIGDQEKVRSNRMDYRMDAWSWEHQGSS-RS  528
             KFE VI  RS ++D+T +LKRN SK   +VI D EK R               QGSS R+
Sbjct  239   KFEHVIRARSLKHDETSVLKRNTSKSNWKVI-DSEKAR------------IRPQGSSART  285

Query  529   GPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSP  708
               IDD KSDKILEIDTGKP   PK RNLFHSSHL LNSDQYSYSL TSK+STAHQ V SP
Sbjct  286   SSIDDEKSDKILEIDTGKPYVTPKQRNLFHSSHLCLNSDQYSYSLTTSKESTAHQTVPSP  345

Query  709   SYCEAQSLSPQNFGQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSG  885
             S C  Q LSP  F + ++E+CFCTADNSPQFYSASSKGGSS+ GPFTP+KSD +RS +SG
Sbjct  346   SSCGNQPLSPLKFNEDLDEACFCTADNSPQFYSASSKGGSSKRGPFTPTKSDGSRSYMSG  405

Query  886   YSDHPNYMSYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQAN  1065
             YSDHPNYMSYTES+KAK+RS+SAPKQRP YERSSSTKRYSIHGY E R NSQ+G S  AN
Sbjct  406   YSDHPNYMSYTESSKAKVRSMSAPKQRPHYERSSSTKRYSIHGYSESRNNSQKG-SFYAN  464

Query  1066  FTSKAYPGSGRLDSFGMPVIR-DQVGFSGGLWHRY  1167
             FT KAYPGSGRLD  GMPVIR D  GFSGGL HRY
Sbjct  465   FTGKAYPGSGRLDRLGMPVIRADPSGFSGGLRHRY  499



>ref|XP_011073931.1| PREDICTED: protein IQ-DOMAIN 14-like [Sesamum indicum]
Length=440

 Score =   382 bits (980),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 241/390 (62%), Positives = 285/390 (73%), Gaps = 17/390 (4%)
 Frame = +1

Query  19    AAWCGSTVNSTACINRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKG  198
             A+WCG            AGGYG REE AAV IQSHFRAYLSRRALRALK LV+LQALV+G
Sbjct  61    ASWCGG----------RAGGYGWREERAAVTIQSHFRAYLSRRALRALKGLVKLQALVRG  110

Query  199   YLVRKHTADMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIH  378
             +++RKHTA++LR +QA+ R Q+RAR+G   ISE+PHSS KS  F + GP TPEKFE  I 
Sbjct  111   HILRKHTAEILRQMQAIARVQARARAGRALISEAPHSSMKSAHFNYVGPTTPEKFEPTIR  170

Query  379   MRSG-QNDDTIMLKRNLSKRR--VIGDQEK--VRSNRMDYRMDAWSWEHQGSSRSGPIDD  543
              RS  + +  +MLKRN S+     I D EK  +  +RMD R    SWE    +R  P+DD
Sbjct  171   ARSTMKQEQHMMLKRNGSRLNGNSIYDPEKSQLSRHRMDRRTGERSWEQGSFTRIIPMDD  230

Query  544   GKSDKILEIDTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTA-HQIVHSPSYCE  720
              ++DKILE+DTGK    PKHR++FHSSHLS +S+QYS S +TSKDSTA H    SP   E
Sbjct  231   ERTDKILEVDTGKLHVTPKHRSIFHSSHLSHSSEQYSQSFSTSKDSTARHTTAVSPLSGE  290

Query  721   AQSLSPQNFGQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDH  897
              QSL+   F Q  +ES FCTADNSPQ+YSASS GGSS+ G FTP+KSD +RS LSGYSDH
Sbjct  291   VQSLNRLKFTQDTDESPFCTADNSPQYYSASSMGGSSKRGAFTPTKSDGSRSYLSGYSDH  350

Query  898   PNYMSYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSK  1077
             PNYM+YTES+KAK+RSLS PKQRPQYERSSS  RYS+H  GE RTN+Q+ S+L ANFT+K
Sbjct  351   PNYMAYTESSKAKVRSLSVPKQRPQYERSSSMNRYSVHACGESRTNTQKVSALHANFTNK  410

Query  1078  AYPGSGRLDSFGMPVIRDQVGFSGGLWHRY  1167
             AYPGSGRLD  GMP   D  GFSGG WHRY
Sbjct  411   AYPGSGRLDRLGMPTRGDISGFSGGHWHRY  440



>ref|XP_006358875.1| PREDICTED: protein IQ-DOMAIN 14-like [Solanum tuberosum]
Length=500

 Score =   381 bits (979),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 258/386 (67%), Positives = 293/386 (76%), Gaps = 19/386 (5%)
 Frame = +1

Query  25    WCGSTVNSTACINRNAGGY-GIREELAAVKIQSHFraylsrralralkalvrlqalVKGY  201
             W G +++S+A + +  G   G RE  AAV IQS FRAYLSRRALRALK LV+LQALV+G+
Sbjct  129   WNGISLSSSAVVGKKKGAAAGNRENWAAVVIQSLFRAYLSRRALRALKGLVKLQALVRGH  188

Query  202   LVRKHTADMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHM  381
             ++R+ TAD LR +QA+ RAQSRAR+G  ++S SPHSSTKSVQF H  P TPEKFE VI  
Sbjct  189   IIRQQTADYLRQMQAISRAQSRARAGRSQVSGSPHSSTKSVQFLH-DPTTPEKFEHVIRA  247

Query  382   RSGQNDDTIMLKRNLSKRRVIG-DQEKVRSNRMDYRMDAWSWEHQGSS-RSGPIDDGKSD  555
             RS ++D+T MLKRN SK      D EK R               QGSS R+  IDD KSD
Sbjct  248   RSLKHDETSMLKRNTSKSNWKAIDSEKAR------------IRPQGSSARTSSIDDEKSD  295

Query  556   KILEIDTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLS  735
             KILEIDTGKP   PK RNLFHSSHLSLNSDQYSYSL TSK+STAHQ V SPS C  Q LS
Sbjct  296   KILEIDTGKPHVTPKQRNLFHSSHLSLNSDQYSYSLTTSKESTAHQTVPSPSSCGNQPLS  355

Query  736   PQNFGQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMS  912
             P  F + ++E+CFCTADNSPQFYSASSKGGSS+ GPFTP+KSD +RS +SGYSDHP+YMS
Sbjct  356   PLKFNEDLDEACFCTADNSPQFYSASSKGGSSKRGPFTPTKSDGSRSYMSGYSDHPSYMS  415

Query  913   YTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGS  1092
             YTES+KAK+RS+SAPKQRP YERSSSTKRYSIHG  E R NSQ+G S   NFT KAYPGS
Sbjct  416   YTESSKAKVRSMSAPKQRPHYERSSSTKRYSIHGCSESRNNSQKG-SFYPNFTGKAYPGS  474

Query  1093  GRLDSFGMPVIR-DQVGFSGGLWHRY  1167
             GRLD  GMPVIR D  GFSGGL HRY
Sbjct  475   GRLDRLGMPVIRADPSGFSGGLRHRY  500



>ref|XP_011081019.1| PREDICTED: uncharacterized protein LOC105164138 [Sesamum indicum]
Length=484

 Score =   371 bits (953),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 241/392 (61%), Positives = 289/392 (74%), Gaps = 7/392 (2%)
 Frame = +1

Query  1     GRSTSAAAWCGSTVNSTACINRNAGGYGIREELAAVKIQSHFraylsrralralkalvrl  180
             GR+ S A   G    + A + ++  GYG REE AAV IQSHFRAYLSRRALRALKALV+L
Sbjct  95    GRNISVAGSVGDDT-AVASVTQSGAGYGSREEWAAVTIQSHFRAYLSRRALRALKALVKL  153

Query  181   qalVKGYLVRKHTADMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEK  360
             QALV+G+LVRK TA +L+ LQAL+RAQ RAR+G   ISESPHS+TK  QF +PGP TP+K
Sbjct  154   QALVRGHLVRKQTAYVLKRLQALLRAQVRARTGRILISESPHSNTKPSQFNYPGPGTPDK  213

Query  361   FEQVIHMRSGQNDDTIMLKRNLSKRR--VIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGP  534
             FE V+  RS ++D  +ML+RN SK    V  D EK R   MD RM    WE    +R+ P
Sbjct  214   FEHVVRARSMKHDHLMMLERNGSKSTGSVNYDPEKQRI-WMDSRMGERLWEQASFTRTLP  272

Query  535   IDDGKSDKILEIDTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSY  714
              +D ++ KILE+DTG P  + + R+LF+SSHLS+ SDQ   S +TSKDST  Q V SPS 
Sbjct  273   PEDDRAYKILEVDTGNPNSMSRRRSLFYSSHLSMGSDQNCQSFSTSKDSTTRQSVLSPSS  332

Query  715   CEAQSLSPQNFGQQINESCFCTADNSPQFYSASSKGGSSRVGP-FTPSKSD-ARSCLSGY  888
              EAQSLSP  F Q ++ES FCTADNSP F SASS+GGSS+ G  FTP+KSD  RSCLSGY
Sbjct  333   GEAQSLSPLKFVQDVDESAFCTADNSPTFLSASSRGGSSKRGAIFTPAKSDGTRSCLSGY  392

Query  889   SDHPNYMSYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANF  1068
             SDHPNYM+YTES+KAK+RSLSAPKQRPQ+ERSSSTKRYS+HG G+ R  +QR S+L ANF
Sbjct  393   SDHPNYMAYTESSKAKVRSLSAPKQRPQFERSSSTKRYSVHGCGDSRP-AQRVSALHANF  451

Query  1069  TSKAYPGSGRLDSFGMPVIRDQVGFSGGLWHR  1164
             T+KAYPGSGRLD  GMP+  D  G +   WHR
Sbjct  452   TNKAYPGSGRLDRLGMPIRGDLAGPTCSHWHR  483



>ref|XP_002276651.1| PREDICTED: uncharacterized protein LOC100254717 [Vitis vinifera]
Length=494

 Score =   371 bits (952),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 247/368 (67%), Positives = 288/368 (78%), Gaps = 6/368 (2%)
 Frame = +1

Query  70    AGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQAL  249
             + G+  REE A +KIQS FR YL+RRALRALKALV+LQALV+G++VRK TADMLR +QAL
Sbjct  122   SAGFSAREEWAVIKIQSLFRGYLARRALRALKALVKLQALVRGHIVRKQTADMLRRMQAL  181

Query  250   VRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLS  429
             VRAQ+RAR+G  +ISES HSS KS QF HPGP TPEKFE  I  ++ + D + +LKRN S
Sbjct  182   VRAQARARAGRAQISESSHSSGKSSQFHHPGPATPEKFEHAIRAKNMKQDQSSILKRNSS  241

Query  430   KR--RVIGDQEKVRSNR--MDYRMDAWSWEHQGSS-RSGPIDDGKSDKILEIDTGKPVFL  594
             K   R I DQ+K   +R   D R+D  SW+ QGSS R+GP DD KSDKILEIDTGKP F 
Sbjct  242   KASGRNIIDQDKTHLSRNWSDRRLDEGSWDQQGSSIRAGPTDDEKSDKILEIDTGKPNFT  301

Query  595   PKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCF  774
             PK RNLF SSH  + SDQ S+S  TSKDST HQ V SPS CE QSLSP  F Q++ E  F
Sbjct  302   PKRRNLFQSSHHGVASDQISHSFTTSKDSTTHQTVPSPSSCEVQSLSPLKFCQEVEEGSF  361

Query  775   CTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLS  951
             CTADNSPQFYSASS+ GSSR GPFTP+KSD +RS LSGYSDHPNYM+YTES+KAK+RS S
Sbjct  362   CTADNSPQFYSASSRAGSSRRGPFTPTKSDGSRSYLSGYSDHPNYMAYTESSKAKVRSFS  421

Query  952   APKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPVIRD  1131
             APKQRPQYERSSSTKRYS+HG+G+ R+N+QR S++ ANFTSKAYPGSGRLD  GMP+  +
Sbjct  422   APKQRPQYERSSSTKRYSVHGFGDSRSNAQRVSAMHANFTSKAYPGSGRLDRLGMPIRSE  481

Query  1132  QVGFSGGL  1155
               G SGG 
Sbjct  482   AFGLSGGF  489



>emb|CAN75939.1| hypothetical protein VITISV_040960 [Vitis vinifera]
Length=530

 Score =   351 bits (900),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 219/336 (65%), Positives = 255/336 (76%), Gaps = 14/336 (4%)
 Frame = +1

Query  190   VKGYLVRKHTADMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQ  369
             V+G++VRK TADMLR +QALVRAQ+RAR+G  +ISES HSS KS QF HPGP TPEKFE 
Sbjct  190   VRGHIVRKQTADMLRRMQALVRAQARARAGRAQISESSHSSGKSSQFHHPGPATPEKFEH  249

Query  370   VIHMRSGQNDDTIMLK--------RNLSKR--RVIGDQEKVRSNR--MDYRMDAWSWEHQ  513
              I  ++ + D + +LK        RN SK   R I DQ+K   +R   D R+D  SW+ Q
Sbjct  250   AIRAKNMKQDQSSILKVCAVIFGLRNSSKASGRNIIDQDKTHLSRNWSDRRLDEGSWDQQ  309

Query  514   GSS-RSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAH  690
             GSS R+GP DD KSDKILEIDTGKP F PK RNLF SSH  + SDQ S+S  TSKDST H
Sbjct  310   GSSIRAGPTDDEKSDKILEIDTGKPNFTPKRRNLFQSSHHGVASDQISHSFTTSKDSTTH  369

Query  691   QIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-A  867
             Q V SPS CE QSLSP  F Q++ E  FCTADNSPQFYSASS+ GSSR GPFTP+KSD +
Sbjct  370   QTVPSPSSCEVQSLSPLKFCQEVEEGSFCTADNSPQFYSASSRAGSSRRGPFTPTKSDGS  429

Query  868   RSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRG  1047
             RS LSGYSDHPNYM+YTES+KAK+RS SAPKQRPQYERSSSTKRYS+HG+G+ R+N+QR 
Sbjct  430   RSYLSGYSDHPNYMAYTESSKAKVRSFSAPKQRPQYERSSSTKRYSVHGFGDSRSNAQRV  489

Query  1048  SSLQANFTSKAYPGSGRLDSFGMPVIRDQVGFSGGL  1155
             S++ ANFTSKAYPGSGRLD  GMP+  +  G SGG 
Sbjct  490   SAMHANFTSKAYPGSGRLDRLGMPIRSEAFGLSGGF  525



>ref|XP_011029204.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X1 [Populus euphratica]
Length=478

 Score =   330 bits (847),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 229/367 (62%), Positives = 282/367 (77%), Gaps = 12/367 (3%)
 Frame = +1

Query  55    CINRN----AGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTA  222
             C+N +    +G  G+RE LAAVKIQ+ FR YL+RRALRALKALVRLQALV+G++ RK TA
Sbjct  109   CVNNSVANVSGSLGLRENLAAVKIQAAFRGYLARRALRALKALVRLQALVRGHIERKRTA  168

Query  223   DMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDD  402
             + L  +QAL+RAQSRAR G  +ISES HSS+KS +F HPGPPTPEKFE  I  RSG+ + 
Sbjct  169   EWLHRMQALLRAQSRARVGRAQISESSHSSSKSSRFHHPGPPTPEKFEHAIRARSGKYEQ  228

Query  403   TIMLKRNLSK--RRVIGDQE--KVRSNRMDYRMDAWSWEHQGS-SRSGPIDDGKSDKILE  567
             + +LKR  SK   R IGD +   +  N  + RMD  +W+H+   + +G IDD KSDKILE
Sbjct  229   SSILKRTGSKCKGRAIGDLDVAHLSLNWSERRMDDQTWDHEVPLAGTGTIDDDKSDKILE  288

Query  568   IDTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNF  747
             IDTGKP   PK RNLFHSSHLSL++DQYS+S  T+KDSTAHQ V SPS CE QSLSP  F
Sbjct  289   IDTGKPHITPKRRNLFHSSHLSLSADQYSHSFTTTKDSTAHQTVPSPSSCEVQSLSPLKF  348

Query  748   GQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTES  924
                + E+  CTA+NSPQFYSASS+GGSS+  PFTPS+SD +R+ L GY  +PNYMS TES
Sbjct  349   SHVVEEA-LCTAENSPQFYSASSRGGSSKRSPFTPSRSDGSRNFLIGYYGYPNYMSNTES  407

Query  925   AKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNS-QRGSSLQANFTSKAYPGSGRL  1101
             ++AK RSLSAPKQRPQYERSSST+RYS+ G+G+ R++S Q  S+L+A+F+SKAYPGSGRL
Sbjct  408   SRAKARSLSAPKQRPQYERSSSTRRYSVFGFGDPRSSSAQPASALRASFSSKAYPGSGRL  467

Query  1102  DSFGMPV  1122
             D  GMP+
Sbjct  468   DKLGMPI  474



>ref|XP_002299555.2| hypothetical protein POPTR_0001s08910g [Populus trichocarpa]
 gb|EEE84360.2| hypothetical protein POPTR_0001s08910g [Populus trichocarpa]
Length=477

 Score =   329 bits (844),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 233/372 (63%), Positives = 284/372 (76%), Gaps = 13/372 (3%)
 Frame = +1

Query  40    VNSTACINRN----AGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLV  207
              +S  C+N +    +G  G+RE+LAAVKIQ+ FR YL+RRALRALKALVRLQALV+G++ 
Sbjct  104   TSSGRCVNNSVANVSGSLGLREDLAAVKIQAAFRGYLARRALRALKALVRLQALVRGHIE  163

Query  208   RKHTADMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRS  387
             RK TA+ L  +QAL+RAQSRARSG  +ISES HSS+KS +FQHPGPPTPEKFE  I  RS
Sbjct  164   RKRTAEWLHRMQALLRAQSRARSGRAQISESSHSSSKSSRFQHPGPPTPEKFEHAIRARS  223

Query  388   GQNDDTIMLKRNLSK--RRVIGDQE--KVRSNRMDYRMDAWSWEHQGS-SRSGPIDDGKS  552
             G+ + + +LKR  SK   R IGD +   +  N  + RMD  +W+HQ   + +G IDD KS
Sbjct  224   GKYEQSSILKRTGSKCKGRAIGDLDVAHLSLNWSERRMDDQTWDHQVPLAGTGTIDDDKS  283

Query  553   DKILEIDTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSL  732
             DKILEIDTGKP   PK RNLFHSSHLSL+ DQYS+S  T+KDSTAHQ V SPS CE QSL
Sbjct  284   DKILEIDTGKPHITPKRRNLFHSSHLSLS-DQYSHSFTTTKDSTAHQTVPSPSSCEVQSL  342

Query  733   SPQNFGQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYM  909
             SP  F   + E+  CTA+NSPQFYSASS+GGSS+  PFTPS+SD +R+ L GY  +PNYM
Sbjct  343   SPLKFSHVVEEA-LCTAENSPQFYSASSRGGSSKRSPFTPSRSDGSRNFLIGYYGYPNYM  401

Query  910   SYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNS-QRGSSLQANFTSKAYP  1086
               TES++AK RSLSAPKQRPQYERSSST+RYS+ G GE R++S Q  S+L+A+F+SKAYP
Sbjct  402   CNTESSRAKARSLSAPKQRPQYERSSSTRRYSVLGCGEPRSSSAQHASALRASFSSKAYP  461

Query  1087  GSGRLDSFGMPV  1122
             GSGRLD  GMP+
Sbjct  462   GSGRLDKLGMPI  473



>ref|XP_008238822.1| PREDICTED: protein IQ-DOMAIN 14 [Prunus mume]
Length=385

 Score =   323 bits (828),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 205/355 (58%), Positives = 255/355 (72%), Gaps = 34/355 (10%)
 Frame = +1

Query  67    NAGGYGIREE-LAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQ  243
             +A   G+REE  AA+KIQ+ FR  L+RRALRALK LVRLQALV+G++VRK+ A  L+ LQ
Sbjct  58    SAARVGVREEEWAALKIQAAFRGCLARRALRALKGLVRLQALVRGHIVRKNNAARLQRLQ  117

Query  244   ALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRN  423
             A++RAQ+RAR+G  +ISE  HS TKS QF  PGP TPEK E  I  RS + +    L+RN
Sbjct  118   AILRAQARARTGRSQISELSHSRTKSSQFHQPGPATPEKIEHPIRSRSTKLEQFSTLRRN  177

Query  424   LSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRS-GPIDDGKSDKILEIDTGKPVFLPK  600
                                            SSRS G  DD K+D++LEIDTGKP    K
Sbjct  178   -------------------------------SSRSYGTTDDEKNDRVLEIDTGKPFIATK  206

Query  601   HRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCT  780
              RNLFHS+HL+L SDQYS+S  TSKDST+HQ + SPS CE QSL+P  F +++ E  FCT
Sbjct  207   RRNLFHSTHLALASDQYSHSFTTSKDSTSHQTLPSPSSCEVQSLTPLKFSREVEEDSFCT  266

Query  781   ADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSAP  957
             A++SPQF+SASS+GG+S+  PFTP++SD ++S LSGYSD+P+YM+ TES+KAK+RSLSAP
Sbjct  267   ANSSPQFHSASSRGGNSKRSPFTPTRSDGSKSYLSGYSDYPSYMACTESSKAKLRSLSAP  326

Query  958   KQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
             KQRPQYERS S KRYSIHG GEL++++QR S+L  NF SKAYPGSGRLD  GMPV
Sbjct  327   KQRPQYERSGSAKRYSIHGSGELKSSAQRASALHTNFASKAYPGSGRLDKLGMPV  381



>ref|XP_007040139.1| IQ-domain 22, putative [Theobroma cacao]
 gb|EOY24640.1| IQ-domain 22, putative [Theobroma cacao]
Length=508

 Score =   327 bits (838),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 231/354 (65%), Positives = 274/354 (77%), Gaps = 10/354 (3%)
 Frame = +1

Query  82    GIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQ  261
             G REE AAVKIQS FR YL+RRALRALK LVRLQALV+G++ RK TA+ +R +QAL+RAQ
Sbjct  154   GAREEFAAVKIQSAFRGYLARRALRALKGLVRLQALVRGHIERKRTAEWVRRMQALLRAQ  213

Query  262   SRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRR-  438
             +RAR+G  +ISES  SS+KS  F HPGPPTPEKFE  I  +S +++ + MLKR+ SK R 
Sbjct  214   ARARAGRAQISESSQSSSKSSHFHHPGPPTPEKFEHAIRSKSTKHEQSSMLKRSGSKSRG  273

Query  439   -VIGDQEKVRS--NRMDYRMDAWSWEHQ-GSSRSGPIDDGKSDKILEIDTGKPVFLPKHR  606
               + + EK+    NR D R+D  SW+ Q  S+R GP+DD K DKILE+DTGKP F  K R
Sbjct  274   RTLDNHEKIPLGWNRSDRRIDEQSWDQQVHSTRVGPMDDEKDDKILEVDTGKPQFSSKRR  333

Query  607   nlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTAD  786
             NLFHS+HL+LNSD YS S   S+DS  HQ   SPS  E QS+SP     ++ ES FCTAD
Sbjct  334   NLFHSTHLALNSDLYSCSFTNSRDS--HQTAPSPSSGEVQSISPLKCSHEVEESAFCTAD  391

Query  787   NSPQFYSASSKGGSSR-VGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSAPK  960
             NSPQFYSASSKGGSSR   PFTP+KSD +RS LSGYSDHPNYM+YTES++AK+RSLSAPK
Sbjct  392   NSPQFYSASSKGGSSRGRSPFTPAKSDGSRSFLSGYSDHPNYMAYTESSRAKVRSLSAPK  451

Query  961   QRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
             QRPQYERSSSTKRYSIHG+ EL++N+QR  SL ANF SKAYPGSGRLD  GMP+
Sbjct  452   QRPQYERSSSTKRYSIHGFAELKSNTQR-PSLHANFASKAYPGSGRLDRLGMPL  504



>ref|XP_007210506.1| hypothetical protein PRUPE_ppa005786mg [Prunus persica]
 gb|EMJ11705.1| hypothetical protein PRUPE_ppa005786mg [Prunus persica]
Length=444

 Score =   323 bits (829),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 202/349 (58%), Positives = 253/349 (72%), Gaps = 32/349 (9%)
 Frame = +1

Query  82    GIREE-LAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRA  258
             G+REE  AA+KIQ+ FR  L+RRALRALK LVRLQALV+G++ RK+ A  L+ LQA++RA
Sbjct  122   GVREEEWAALKIQAAFRGCLARRALRALKGLVRLQALVRGHIARKNNAARLQRLQAILRA  181

Query  259   QSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRR  438
             Q+RAR+G  +ISE  HS TKS QF  PGP TPEKFE  I  RS + +    L+RN+S+  
Sbjct  182   QARARTGRSQISELSHSRTKSSQFHQPGPATPEKFEHPIRSRSTKLEQFSTLRRNISR--  239

Query  439   VIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfh  618
                           Y               G  DD K+D++LEIDTGKP    K RNLFH
Sbjct  240   -------------SY---------------GTTDDEKNDRVLEIDTGKPYIATKRRNLFH  271

Query  619   sshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQ  798
             S+HL+L SDQYS+S  TSKDST+HQ + SPS CE QSL+P  F +++ E  FCTA++SPQ
Sbjct  272   STHLALASDQYSHSFTTSKDSTSHQTLPSPSSCEVQSLTPLKFSREVEEDSFCTANSSPQ  331

Query  799   FYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQY  975
             FYS SS+GG+S+  PFTP++SD ++S LSGYSD+P+YM+ TES+KAK+RSLSAPKQRPQY
Sbjct  332   FYSTSSRGGNSKRSPFTPTRSDGSKSYLSGYSDYPSYMACTESSKAKLRSLSAPKQRPQY  391

Query  976   ERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
             ERS S KRYSIHG+GE ++++QR S+L ANF SKAYPGSGRLD  GMPV
Sbjct  392   ERSGSAKRYSIHGFGESKSSAQRASALHANFASKAYPGSGRLDKLGMPV  440



>ref|XP_010112558.1| Protein IQ-DOMAIN 31 [Morus notabilis]
 gb|EXC34105.1| Protein IQ-DOMAIN 31 [Morus notabilis]
Length=483

 Score =   322 bits (824),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 213/356 (60%), Positives = 255/356 (72%), Gaps = 13/356 (4%)
 Frame = +1

Query  76    GYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVR  255
             G GIREE AAVKIQS FR  L+RRALRALK LV+LQALV+G++ RK TA+ L  +QAL++
Sbjct  130   GAGIREEWAAVKIQSAFRGCLARRALRALKGLVKLQALVRGHIERKRTAEWLHRMQALMQ  189

Query  256   AQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDD--TIMLKRNLS  429
             AQ+RA  G  ++SE  HS++KS  F HPGP TPEKFE VI  +S ++D    +    + S
Sbjct  190   AQARAIGGRSQLSEFQHSNSKSSNFHHPGPATPEKFEHVIRSKSRKHDQPSLLRKSSSKS  249

Query  430   KRRVIGDQEKVRS--NRMDYRMDAWSWEHQGSS-RSGPIDDGKSDKILEIDTGKPVFLPK  600
               R I D +K  S  +R + ++D  S   + SS R+   DD KSD+ILEIDTGKP   PK
Sbjct  250   NSRTISDHDKTYSGGSRSESQLDERSGNLRSSSVRNTATDDEKSDRILEIDTGKPHITPK  309

Query  601   HRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNF-GQQINESCFC  777
              RNLFHSS      DQ S+S  TSKDST H  + SPS  E QSL+P       + E+ FC
Sbjct  310   RRNLFHSS------DQCSHSFTTSKDSTTHYTLPSPSSYEVQSLTPLKLSNNDVEEASFC  363

Query  778   TADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSA  954
             TA+NSPQFYSASSKG SSR  PFTPSKSD +RS LSGYSD+PNYM+ TES+KAK+RSLSA
Sbjct  364   TANNSPQFYSASSKGASSRRSPFTPSKSDGSRSFLSGYSDYPNYMACTESSKAKLRSLSA  423

Query  955   PKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
             PKQRPQYERSSS KRYSIHG GE R + QR S+L ANF +KAYPGSGRLD  GMP+
Sbjct  424   PKQRPQYERSSSMKRYSIHGVGESRQSGQRFSTLHANFMNKAYPGSGRLDKLGMPI  479



>gb|KDP25495.1| hypothetical protein JCGZ_20651 [Jatropha curcas]
Length=509

 Score =   320 bits (819),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 229/359 (64%), Positives = 276/359 (77%), Gaps = 9/359 (3%)
 Frame = +1

Query  70    AGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQAL  249
             +G +G RE+ AAVKIQ+ FR YL+RRALRALKALVRLQALV+G++ RK TA+ L  +Q+L
Sbjct  148   SGSHGWREDFAAVKIQAAFRGYLARRALRALKALVRLQALVRGHIQRKQTAEWLHRMQSL  207

Query  250   VRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLS  429
             ++AQ+RAR+G  +ISES HSS+KS  F HPG PTPEK E  I  RSG+ + + MLKR  S
Sbjct  208   LKAQARARAGRAQISESSHSSSKSSHFHHPGRPTPEKVEHAIRARSGKYEQSSMLKRTGS  267

Query  430   KR--RVIGDQEK--VRSNRMDYRMDAWSWEHQGS-SRSGPIDDGKSDKILEIDTGKPVFL  594
             +   R I D++K  +  N  +  MD  SWE +   +RS P+DD KSDKILEIDTGKP F 
Sbjct  268   RSTCRAISDEDKTHLSFNWSERCMDDRSWEQRVPWTRSSPMDDEKSDKILEIDTGKPHFT  327

Query  595   PKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCF  774
             PK RNLFHSSH +L SDQYS+S  TSKDST HQ V SPS  E QSL+P  F +Q +E  F
Sbjct  328   PKRRNLFHSSHHALGSDQYSHSFTTSKDSTTHQTVPSPSSGEVQSLTPLKFPRQ-DEEAF  386

Query  775   CTADNSPQFYSASSKGGSSRVGPFTPSKSDARSCL-SGYSD-HPNYMSYTESAKAKMRSL  948
             CTA+NSPQFYSASSKGG  R  PFTPSKSD  +   SGYS+ +PNYMSYTES+KAK+RSL
Sbjct  387   CTAENSPQFYSASSKGGGGRRSPFTPSKSDGSASFQSGYSEYYPNYMSYTESSKAKVRSL  446

Query  949   SAPKQRPQYERSSSTKRYSIHGYGELRTNS-QRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
             SAP+QRPQYERSSS KRYS+HG+GE R++S QR S+L+A+FTSKAYPGSGRLD  GMPV
Sbjct  447   SAPRQRPQYERSSSVKRYSLHGFGETRSSSAQRASALRASFTSKAYPGSGRLDRLGMPV  505



>ref|XP_011029205.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X2 [Populus euphratica]
Length=476

 Score =   307 bits (787),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 222/366 (61%), Positives = 275/366 (75%), Gaps = 12/366 (3%)
 Frame = +1

Query  55    CINRN----AGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTA  222
             C+N +    +G  G+RE LAAVKIQ+ FR YL+RRALRALKALVRLQALV+G++ RK TA
Sbjct  109   CVNNSVANVSGSLGLRENLAAVKIQAAFRGYLARRALRALKALVRLQALVRGHIERKRTA  168

Query  223   DMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDD  402
             + L  +QAL+RAQSRAR+G  +ISES HSS+KS +F HPGPPTPEKFE  I  RS + + 
Sbjct  169   EWLHRMQALLRAQSRARAGRAQISESSHSSSKSSRFHHPGPPTPEKFEHAIRARSAKYEQ  228

Query  403   TIMLKRNLSK--RRVIGDQE--KVRSNRMDYRMDAWSWEHQGS-SRSGPIDDGKSDKILE  567
             + +LKR  SK   R IGD +   +  N  + RMD  + +H+   + +G IDD KSDKILE
Sbjct  229   SSILKRTGSKCKGRAIGDLDVAHLSLNWSERRMDDQTCDHEVPLAGTGTIDDDKSDKILE  288

Query  568   IDTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNF  747
             IDTGKP   PK RNLFHSSHLSL++DQYS+S  T+KDSTAHQ V SPS CE QSLSP  F
Sbjct  289   IDTGKPHITPKRRNLFHSSHLSLSADQYSHSFTTTKDSTAHQTVPSPSSCEVQSLSPLKF  348

Query  748   GQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTES  924
                + E+  CTA+NSPQFYSASS+GGSS+  PFTPS+SD +R+ L GY  +PNYMS TES
Sbjct  349   SHVVEEA-LCTAENSPQFYSASSRGGSSKRSPFTPSRSDGSRNFLIGYYGYPNYMSNTES  407

Query  925   AKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLD  1104
             ++AK RSLSAPKQRPQYERSSST+RYS+ G+G+ R++S   +   +  +SKAYPGSGRLD
Sbjct  408   SRAKARSLSAPKQRPQYERSSSTRRYSVFGFGDPRSSSAASALRASF-SSKAYPGSGRLD  466

Query  1105  SFGMPV  1122
               GMP+
Sbjct  467   KLGMPI  472



>ref|XP_004298748.1| PREDICTED: uncharacterized protein LOC101291430 [Fragaria vesca 
subsp. vesca]
Length=468

 Score =   303 bits (777),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 205/357 (57%), Positives = 267/357 (75%), Gaps = 15/357 (4%)
 Frame = +1

Query  73    GGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALV  252
             G  GIREE AAV+IQ+ FR  L+RRALRALK LVRLQALV+G++ RK  A  L+  QA++
Sbjct  116   GSIGIREEWAAVRIQAAFRGCLARRALRALKGLVRLQALVRGHIERKKWAKRLQRFQAIL  175

Query  253   RAQSRARSGLPKISE--SPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNL  426
             RAQ+RAR+G  +ISE    ++S++S Q   PGP TPEKFE  +  RS +++ + +L+RN 
Sbjct  176   RAQARARAGRTQISELSHSYTSSQSSQIHQPGPATPEKFEHGLRSRSTKHEHSSILRRNS  235

Query  427   SKR--RVIGDQEKVRSNRMDYRMDAWSWEHQGSS-RSGPIDDGKSDKILEIDTGKPVFLP  597
             S+   R++GD +K  S R        SWE  GS+ ++G  +D K+D++LEIDTGK     
Sbjct  236   SRSNGRIVGDYDKTHSER--------SWEQPGSAMKNGTPEDEKNDRVLEIDTGKSHIAA  287

Query  598   KHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFC  777
             K RNLFHS+HL+L SDQYS+S  TSKDST HQ + SPS CE QSL+P  F +++ E  FC
Sbjct  288   KRRNLFHSTHLALASDQYSHSFTTSKDSTTHQTLPSPSSCEVQSLTPLKFSREVEEDSFC  347

Query  778   TADNSPQFYSA-SSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLS  951
             TA+NSPQFYSA SS+GG+S+  PFTP+KSD +++ LSGYSD+PNYM+ T+S+KAK+RSLS
Sbjct  348   TANNSPQFYSATSSRGGNSKRTPFTPTKSDGSKNYLSGYSDYPNYMACTQSSKAKLRSLS  407

Query  952   APKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
             APKQRPQYERS S KR S+ GY E R+N+QR S+L +NFT+KAYPGSGRLD  GMP+
Sbjct  408   APKQRPQYERSISAKRCSVPGYSESRSNAQRSSALHSNFTNKAYPGSGRLDRLGMPI  464



>ref|XP_002509726.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF51113.1| calmodulin binding protein, putative [Ricinus communis]
Length=491

 Score =   303 bits (777),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 226/384 (59%), Positives = 278/384 (72%), Gaps = 13/384 (3%)
 Frame = +1

Query  4     RSTSAAAWC---GSTVNSTACINRNAGGYGIREELAAVKIQSHFraylsrralralkalv  174
             R TS++  C    +   + A ++ N+  +  RE+LAAVKIQS FR YL+RRALRALKALV
Sbjct  106   RLTSSSGRCVANNNNNTAVAYVSENSNSHCWREDLAAVKIQSAFRGYLARRALRALKALV  165

Query  175   rlqalVKGYLVRKHTADMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTP  354
             RLQALV+G++ RK T   L  +QAL++AQ+RAR+G   ISES HSS+KS  F HPGPPTP
Sbjct  166   RLQALVRGHIERKRTTAWLHRMQALLKAQARARAGRAHISESSHSSSKSSHFHHPGPPTP  225

Query  355   EKFEQVIHMRSGQNDDTIMLKRNLSKR--RVIGDQEK--VRSNRMDYRMDAWSWEHQ-GS  519
             EKFE     RSG+ + + +LKR  SK     IGD+++  +  N  D RMD  SWE +  S
Sbjct  226   EKFEHATRARSGKYEQSSILKRIGSKSIGMEIGDEDRAHISFNWSDRRMDERSWEQRVPS  285

Query  520   SRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIV  699
             +RSG +DD KSDKILEIDTGKP F  K R     S  +   DQYS+S   SKDS  HQ V
Sbjct  286   ARSGTLDDEKSDKILEIDTGKPHFTSK-RRNLFHSLQTSTPDQYSHSFTNSKDSIVHQTV  344

Query  700   HSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSC  876
              SPS CE QSL+P  F ++ +E   CTA+NSPQFYSASS+GGS R  PFTPSKSD + S 
Sbjct  345   PSPSSCEVQSLTPLKFPRE-DEEALCTAENSPQFYSASSRGGSGRRSPFTPSKSDGSTSF  403

Query  877   LSGYSDH-PNYMSYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNS-QRGS  1050
             LSGYSD+ PNYMSYTES++AK+RSLSAPKQR QYERSSS KRYSIHG+G++R++S QR S
Sbjct  404   LSGYSDYFPNYMSYTESSRAKVRSLSAPKQRLQYERSSSMKRYSIHGFGDIRSSSAQRAS  463

Query  1051  SLQANFTSKAYPGSGRLDSFGMPV  1122
             +L+A+F SKAYPGSGRLD  GMP+
Sbjct  464   ALRASFASKAYPGSGRLDKLGMPI  487



>emb|CBI34723.3| unnamed protein product [Vitis vinifera]
Length=465

 Score =   302 bits (774),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 221/366 (60%), Positives = 260/366 (71%), Gaps = 43/366 (12%)
 Frame = +1

Query  70    AGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQAL  249
             + G+  REE A +KIQS FR YL+RRALRALKALV+LQALV+G++VRK TADMLR +QAL
Sbjct  122   SAGFSAREEWAVIKIQSLFRGYLARRALRALKALVKLQALVRGHIVRKQTADMLRRMQAL  181

Query  250   VRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLS  429
             VRAQ+RAR+G  +ISES HSS KS QF HPGP TPEKFE  I  ++ + D + +LKRN S
Sbjct  182   VRAQARARAGRAQISESSHSSGKSSQFHHPGPATPEKFEHAIRAKNMKQDQSSILKRNSS  241

Query  430   KR--RVIGDQEKVRSNR--MDYRMDAWSWEHQGSS-RSGPIDDGKSDKILEIDTGKPVFL  594
             K   R I DQ+K   +R   D R+D  SW+ QGSS R+GP DD KSDKILEIDTGKP F 
Sbjct  242   KASGRNIIDQDKTHLSRNWSDRRLDEGSWDQQGSSIRAGPTDDEKSDKILEIDTGKPNFT  301

Query  595   PKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCF  774
             PK RNLF SSH  + SDQ                                      +  F
Sbjct  302   PKRRNLFQSSHHGVASDQI-------------------------------------KGSF  324

Query  775   CTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLS  951
             CTADNSPQFYSASS+ GSSR GPFTP+KSD +RS LSGYSDHPNYM+YTES+KAK+RS S
Sbjct  325   CTADNSPQFYSASSRAGSSRRGPFTPTKSDGSRSYLSGYSDHPNYMAYTESSKAKVRSFS  384

Query  952   APKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPVIRD  1131
             APKQRPQYERSSSTKRYS+HG+G+ R+N+QR S++ ANFTSKAYPGSGRLD  GMP+  +
Sbjct  385   APKQRPQYERSSSTKRYSVHGFGDSRSNAQRVSAMHANFTSKAYPGSGRLDRLGMPIRSE  444

Query  1132  QVGFSG  1149
               G S 
Sbjct  445   AFGLSA  450



>emb|CDP09797.1| unnamed protein product [Coffea canephora]
Length=307

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 179/317 (56%), Positives = 226/317 (71%), Gaps = 17/317 (5%)
 Frame = +1

Query  238   LQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLK  417
             ++A++R Q+RA +   ++ ESPH   KS    +PGP TPEKFE +   +S +  + ++ +
Sbjct  1     MRAVLRVQARASTVRAQVFESPH---KSNHIHYPGPATPEKFECISRAKSMKLGENLLFR  57

Query  418   RNLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSS-RSGPIDDGKSDKILEIDTGKPVFL  594
             RN  K   I       S+  D RMD  SWEH+GSS ++G   D  +DK+LEIDT +P   
Sbjct  58    RNSLKNWKI-------SSYQDSRMDIKSWEHEGSSTKTGFRGDEANDKVLEIDTARPQTR  110

Query  595   PKHRnlfhsshlslnsDQYSYS-LATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESC  771
              K RNLFHSSHLS+ SDQ S+S   TSKDST HQ V SPS CE QS+SP  F   + +  
Sbjct  111   HKIRNLFHSSHLSIGSDQCSHSGFTTSKDSTVHQTVPSPSSCEVQSVSPLKFSHDVEDDP  170

Query  772   FCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSD--HPNYMSYTESAKAKMR  942
             FCTA NSP  +SASSKGG S+ GPFTP+KSD +RSCLSGYSD  +PNYMS T+S+KAK+R
Sbjct  171   FCTAANSPLLHSASSKGGGSKRGPFTPAKSDGSRSCLSGYSDYYYPNYMSCTQSSKAKIR  230

Query  943   SLSAPKQRPQYERSSSTKRYSIHGYGELR-TNSQRGSSLQANFTSKAYPGSGRLDSFGMP  1119
             SLSAPKQRPQYERSSSTKR+S++GYGE + +N QR S+L A+FTSKAYPGSGRLD  GMP
Sbjct  231   SLSAPKQRPQYERSSSTKRFSMYGYGEPKFSNPQRVSALHASFTSKAYPGSGRLDRLGMP  290

Query  1120  VIRDQV-GFSGGLWHRY  1167
             +  + + GFSGG WHR+
Sbjct  291   IGEEAIGGFSGGQWHRF  307



>gb|KDO63544.1| hypothetical protein CISIN_1g011616mg [Citrus sinensis]
Length=481

 Score =   300 bits (768),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 227/372 (61%), Positives = 282/372 (76%), Gaps = 12/372 (3%)
 Frame = +1

Query  37    TVNSTACIN---RNAGGYG-IREELAAVKIQSHFraylsrralralkalvrlqalVKGYL  204
             T NS  C N      GG+G   +E AA+KIQS FR YL+RRALRAL+ LVRLQALV+G++
Sbjct  108   TSNSGRCGNFPSAYVGGFGGTLDEPAAIKIQSAFRGYLARRALRALRGLVRLQALVRGHI  167

Query  205   VRKHTADMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMR  384
              RK TA+ L+ +QAL+RAQ+RAR+G  +ISES HSS KS  FQ PGPPTPEKFE  I  +
Sbjct  168   ERKRTAEWLQRMQALLRAQARARAGRAQISESSHSSGKSSHFQQPGPPTPEKFEHSIRSK  227

Query  385   SGQNDDTIMLKRNLSKR--RVIGDQEK--VRSNRMDYRMDAWSWEHQGS-SRSGPIDDGK  549
             + + + +  LK+N SK   RV    EK  V  N  + +MD  S   + + +++G IDD +
Sbjct  228   NSKCEVSSALKKNGSKSNGRVNVHHEKAHVSWNWPESQMDNRSKNQKAAPTKTGAIDDER  287

Query  550   SDKILEIDTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQS  729
             SDKILEIDTGK  F PK RNLFHSSHL+++SD YS+S  +SKDSTAHQ   SPS CE QS
Sbjct  288   SDKILEIDTGKMHFTPKRRNLFHSSHLTVSSDHYSHSFTSSKDSTAHQTEPSPSSCEVQS  347

Query  730   LSPQNFGQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKS-DARSCLSGYSDHPNY  906
             LSP  F  ++ +  FCTA+NSPQFYSASS+GGSS+  PFTP+KS  ++SCLSGYSDHPNY
Sbjct  348   LSPLKFSHEVED--FCTAENSPQFYSASSRGGSSKRSPFTPTKSYSSQSCLSGYSDHPNY  405

Query  907   MSYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYP  1086
             M+YTES++AK+RSLSAPKQRPQYERSSS KRYSIH + E ++++QR ++L ANFT+KAYP
Sbjct  406   MAYTESSRAKVRSLSAPKQRPQYERSSSAKRYSIHTFAESKSSAQRFTALHANFTNKAYP  465

Query  1087  GSGRLDSFGMPV  1122
             GSGRLDSFGMPV
Sbjct  466   GSGRLDSFGMPV  477



>ref|XP_010055603.1| PREDICTED: protein IQ-DOMAIN 14 [Eucalyptus grandis]
 gb|KCW72099.1| hypothetical protein EUGRSUZ_E00539 [Eucalyptus grandis]
Length=490

 Score =   300 bits (768),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 215/359 (60%), Positives = 268/359 (75%), Gaps = 6/359 (2%)
 Frame = +1

Query  88    REELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSR  267
             RE  AA+KIQS FR YL+RRALRALK LV++QALV+G++ RK TA+++R +QAL+RAQ+R
Sbjct  131   REVEAALKIQSAFRGYLARRALRALKGLVKIQALVRGHIERKRTAELVRKMQALLRAQAR  190

Query  268   ARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKR--RV  441
             AR+   ++SES  SS+KS  F  PGP TPEK E V+  +S + D + +L+RN S+   R+
Sbjct  191   ARAERAQVSESSQSSSKSSHFHQPGPATPEKSEYVVRSKSSRQDQSPVLRRNGSRSSGRI  250

Query  442   IGDQEK--VRSNRMDYRMDAWSWEHQGS-SRSGPIDDGKSDKILEIDTGKPVFLPKHRnl  612
             +G  E+  +  N  + R+D    + +G  + SG +DD +SDKILEID GKP F PK R+L
Sbjct  251   VGFPERAPLGRNWSERRVDDRLGDQRGPLANSGHVDDERSDKILEIDPGKPSFTPKRRSL  310

Query  613   fhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNS  792
               SS  SL SDQ S+S  TSKDSTAHQ V SPS CE QSL P +F   + E  FCTADNS
Sbjct  311   VQSSRYSLPSDQASHSYTTSKDSTAHQTVPSPSSCEVQSLCPLDFSHDVEEGAFCTADNS  370

Query  793   PQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRP  969
             PQFYSASS+G SSR  PFTP+KSD +RS LSGYSDHPNYM+YTES+KAK RS+SAPKQRP
Sbjct  371   PQFYSASSRGASSRRSPFTPTKSDGSRSYLSGYSDHPNYMAYTESSKAKARSMSAPKQRP  430

Query  970   QYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPVIRDQVGFS  1146
              +E+SSSTKRYSIHG+GE R+ SQ+  SL ANF+SKAYPGSGRLD  GMPV  D  G++
Sbjct  431   HFEKSSSTKRYSIHGFGESRSISQKVLSLHANFSSKAYPGSGRLDKLGMPVRGDGYGYT  489



>gb|KHG04847.1| Protein IQ-DOMAIN 31 -like protein [Gossypium arboreum]
Length=462

 Score =   299 bits (765),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 204/354 (58%), Positives = 259/354 (73%), Gaps = 10/354 (3%)
 Frame = +1

Query  79    YGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRA  258
             Y   +ELAAVKIQS FR YL+RRALRALK LV+LQALV+G++ RK TA+ LR +Q  ++ 
Sbjct  108   YWAGKELAAVKIQSTFRGYLARRALRALKGLVKLQALVRGHIERKKTAEWLRRMQVFLQT  167

Query  259   QSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKR-  435
             Q+RAR+G  +ISES   S+KS  + HPGPPTPE FE  +  +S + + + MLKRN S+  
Sbjct  168   QARARAGRAQISESSRISSKSSHYLHPGPPTPENFEHAVQPKSTKYEQSSMLKRNGSRLS  227

Query  436   -RVIGDQEKVRSNRM--DYRMDAWSWEHQG-SSRSGPIDDGKSDKILEIDTGKPVFLPKH  603
              R   + E++       D+ +D  SW+ +G S+R G  DD K+DKILE+D GKP F  K 
Sbjct  228   GRTRDNYEQMHPGWYTSDHWIDDQSWDQRGHSTRIGHTDDEKNDKILEVDIGKPRFTSKR  287

Query  604   RnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTA  783
             RNLFHS+HL+LNSD Y  S   S+DS  HQ   +P   E QSL+   F  ++ ES FCTA
Sbjct  288   RNLFHSTHLALNSDLYGCSFTNSRDS--HQTAPTP-LSEVQSLNLLKFPHEVEESPFCTA  344

Query  784   DNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSAPK  960
             DNSP F+SASSKGGSS   PFTP+KSD +RS LSGYSDHPNYM++TES++AK+RSLSAPK
Sbjct  345   DNSPDFHSASSKGGSSMRSPFTPAKSDGSRSYLSGYSDHPNYMAFTESSRAKVRSLSAPK  404

Query  961   QRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
             QRPQ++RSSS KRYSIHG+GEL++ + + S+L ANF +KAYPGSGRLD  GMPV
Sbjct  405   QRPQHDRSSSIKRYSIHGFGELKSGTLK-SALHANFANKAYPGSGRLDRLGMPV  457



>ref|XP_006477414.1| PREDICTED: protein IQ-DOMAIN 14-like [Citrus sinensis]
Length=481

 Score =   299 bits (765),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 227/372 (61%), Positives = 281/372 (76%), Gaps = 12/372 (3%)
 Frame = +1

Query  37    TVNSTACIN---RNAGGYG-IREELAAVKIQSHFraylsrralralkalvrlqalVKGYL  204
             T NS  C N      GG+G   +E AA+KIQS FR YL+RRALRAL+ LVRLQALV+G++
Sbjct  108   TSNSGRCGNFPSAYVGGFGGTLDEPAAIKIQSAFRGYLARRALRALRGLVRLQALVRGHI  167

Query  205   VRKHTADMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMR  384
              RK TA+ L+ +QAL+RAQ+RAR+G  +ISES HSS KS  FQ PGPPTPEKFE  I  +
Sbjct  168   ERKRTAEWLQRMQALLRAQARARAGRAQISESSHSSGKSSHFQQPGPPTPEKFEHSIRSK  227

Query  385   SGQNDDTIMLKRNLSKR--RVIGDQEK--VRSNRMDYRMDAWSWEHQGS-SRSGPIDDGK  549
             + + + +  LK+N SK   RV    EK  V  N  + +MD  S   +   +++G IDD +
Sbjct  228   NSKCEVSSALKKNGSKSNGRVNVHHEKAHVSWNWPESQMDNRSKNQKAPPTKTGAIDDER  287

Query  550   SDKILEIDTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQS  729
             SDKILEIDTGK  F PK RNLFHSSHL+++SD YS+S  +SKDSTAHQ   SPS CE QS
Sbjct  288   SDKILEIDTGKMHFTPKRRNLFHSSHLTVSSDHYSHSFTSSKDSTAHQTEPSPSSCEVQS  347

Query  730   LSPQNFGQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKS-DARSCLSGYSDHPNY  906
             LSP  F  ++ +  FCTA+NSPQFYSASS+GGSS+  PFTP+KS  ++SCLSGYSDHPNY
Sbjct  348   LSPLKFSHEVED--FCTAENSPQFYSASSRGGSSKRSPFTPTKSYSSQSCLSGYSDHPNY  405

Query  907   MSYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYP  1086
             M+YTES++AK+RSLSAPKQRPQYERSSS KRYSIH + E ++++QR ++L ANFT+KAYP
Sbjct  406   MAYTESSRAKVRSLSAPKQRPQYERSSSAKRYSIHTFAESKSSAQRFTALHANFTNKAYP  465

Query  1087  GSGRLDSFGMPV  1122
             GSGRLDSFGMPV
Sbjct  466   GSGRLDSFGMPV  477



>ref|XP_006440555.1| hypothetical protein CICLE_v10019930mg [Citrus clementina]
 gb|ESR53795.1| hypothetical protein CICLE_v10019930mg [Citrus clementina]
Length=481

 Score =   298 bits (763),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 222/356 (62%), Positives = 275/356 (77%), Gaps = 8/356 (2%)
 Frame = +1

Query  73    GGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALV  252
             G  G  +E AA+KIQS FR YL+RRALRAL+ LVRLQALV+G++ RK TA+ L+ +QAL+
Sbjct  124   GCGGTLDEPAAIKIQSAFRGYLARRALRALRGLVRLQALVRGHIERKRTAEWLQRMQALL  183

Query  253   RAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSK  432
             RAQ+RAR+G  +ISES HSS KS  FQ PGPPTPEKFE  I  ++ + + +  LK+N SK
Sbjct  184   RAQARARAGRAQISESSHSSGKSSHFQQPGPPTPEKFEHSIRSKNSKCEVSSALKKNGSK  243

Query  433   R--RVIGDQEK--VRSNRMDYRMDAWSWEHQGS-SRSGPIDDGKSDKILEIDTGKPVFLP  597
                RV    EK  V  N  + +MD  S   + + ++ G IDD +SDKILEIDTGK  F P
Sbjct  244   SNGRVNVHHEKAHVSWNWPESQMDNRSKNQKAAPTKIGAIDDERSDKILEIDTGKMHFTP  303

Query  598   KHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFC  777
             K RNLFHSSHL+++SD YS+S  +SKDSTAHQI  SPS CE QSLSP  F  ++ +  FC
Sbjct  304   KRRNLFHSSHLTVSSDHYSHSFTSSKDSTAHQIEPSPSSCEVQSLSPLKFSHEVED--FC  361

Query  778   TADNSPQFYSASSKGGSSRVGPFTPSKS-DARSCLSGYSDHPNYMSYTESAKAKMRSLSA  954
             TA+NSPQFYSASS+GGSS+  PFTP+KS  ++SCLSGYSDHPNYM+YTES++AK+RSLSA
Sbjct  362   TAENSPQFYSASSRGGSSKRSPFTPTKSYSSQSCLSGYSDHPNYMAYTESSRAKVRSLSA  421

Query  955   PKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
             PKQRPQYERSSS KRYSIH + E ++++QR ++L ANFT+KAYPGSGRLDSFGMPV
Sbjct  422   PKQRPQYERSSSAKRYSIHTFAESKSSAQRFTALHANFTNKAYPGSGRLDSFGMPV  477



>emb|CAK18867.1| putative calmodulin binding protein precursor [Phillyrea latifolia]
Length=227

 Score =   286 bits (733),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 172/222 (77%), Positives = 185/222 (83%), Gaps = 4/222 (2%)
 Frame = +1

Query  511   QGSS-RSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTA  687
             QGSS R+   DD KSDKILEID+GKP   PK RNLFHSSH SLNSDQYSYSL TSK+STA
Sbjct  7     QGSSARTNSFDDVKSDKILEIDSGKPYATPKQRNLFHSSHFSLNSDQYSYSLTTSKESTA  66

Query  688   HQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-  864
             HQ V SPS C  Q LSP  F Q++ E+CFCTADNSPQFYSASSKGGSS+ GPFTP+KSD 
Sbjct  67    HQTVPSPSSCGNQPLSPLKFNQELEEACFCTADNSPQFYSASSKGGSSKRGPFTPTKSDG  126

Query  865   ARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQR  1044
             +RSCLSGYSDHPNYMSYTESAKAK+RS+SAPKQRP YERSSS KRYSIHGY E RTNSQ+
Sbjct  127   SRSCLSGYSDHPNYMSYTESAKAKVRSMSAPKQRPHYERSSSIKRYSIHGYSESRTNSQK  186

Query  1045  GSSLQANFTSKAYPGSGRLDSFGMPVIR-DQVGFSGGLWHRY  1167
             G S  A+FT KAYPGSGRLD  GMPVIR D  GFSGGL HRY
Sbjct  187   G-SFYASFTGKAYPGSGRLDRLGMPVIRADPSGFSGGLRHRY  227



>ref|XP_010676531.1| PREDICTED: protein IQ-DOMAIN 14 [Beta vulgaris subsp. vulgaris]
Length=510

 Score =   295 bits (754),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 209/380 (55%), Positives = 268/380 (71%), Gaps = 18/380 (5%)
 Frame = +1

Query  61    NRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGL  240
              RN G   I    A V IQSHFR YL+RRALRALK LV+LQALV+G+++R+ TA+ +R +
Sbjct  130   TRNGGEKEI--WCATVVIQSHFRGYLARRALRALKGLVKLQALVRGHIMRRKTAETMRCM  187

Query  241   QALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKR  420
             QA++RAQ+RARS    I E+P SS+KS    HPGP TP+KFEQV+  +S + D    +KR
Sbjct  188   QAMLRAQARARSIRSYIPETPFSSSKSCPIFHPGPLTPDKFEQVVRAKSIKQDHLPKIKR  247

Query  421   NLSK---RRVIGDQEKVR--SNRMDYRMDAWSWEHQG---SSRSGPIDDGKSDKILEIDT  576
             N SK   R     QE+    S+  D R+D   W+ +G   S+R+   DD ++D+ILEIDT
Sbjct  248   NSSKSSSRMNTMSQERPNFGSSWSDSRVDDPMWDPRGATSSTRTCLTDDDRADRILEIDT  307

Query  577   GKPVFLPKHRnlfhsshl-slnsDQYSYSLATSKDSTAHQIVHSPSYCEA-QSLSPQNFG  750
             GKP +  + R+LF +S+   L SDQ S+SL TSKDST HQ VHSP+ CE  Q+L P    
Sbjct  308   GKPHYSSRRRSLFETSYSGLLTSDQVSHSLTTSKDSTTHQTVHSPASCEVVQTLKPLLLP  367

Query  751   QQI--NESCFCTADNSPQF-YSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYT  918
             Q+I  + + +CTA+NSPQ+  +AS  G SSR G FTP+KSD  RS LSGYSD P+YM+YT
Sbjct  368   QEIVDDNNSYCTAENSPQYCSAASQGGSSSRRGSFTPTKSDGCRSFLSGYSDCPSYMAYT  427

Query  919   ESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGE--LRTNSQRGSSLQANFTSKAYPGS  1092
             ESAKAKMRSLSAPKQRPQYER++STKRYS+HG+GE   R+N+ R S++QA+F+SKAYPGS
Sbjct  428   ESAKAKMRSLSAPKQRPQYERTNSTKRYSVHGFGEHNPRSNAHRVSAMQASFSSKAYPGS  487

Query  1093  GRLDSFGMPVIRDQVGFSGG  1152
             GRLD  GMPV    V +  G
Sbjct  488   GRLDRLGMPVKDSTVVYYSG  507



>ref|XP_008345351.1| PREDICTED: protein IQ-DOMAIN 14-like [Malus domestica]
Length=444

 Score =   290 bits (743),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 197/349 (56%), Positives = 244/349 (70%), Gaps = 32/349 (9%)
 Frame = +1

Query  82    GIREE-LAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRA  258
             GIREE LAAVKIQ+ FR  L+RRALRALK LVRLQALV+G++VRK  AD L+ LQA++RA
Sbjct  122   GIREEELAAVKIQAAFRGCLARRALRALKGLVRLQALVRGHIVRKFYADRLQRLQAILRA  181

Query  259   QSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRR  438
             Q+RA++   +IS+  HS TKS QF  P P TPEKFE  I  RS +++    L+ N SK  
Sbjct  182   QARAQARRAQISDLSHSRTKSSQFHQPDPATPEKFEHPIRSRSTKHEQFSTLRXNSSK--  239

Query  439   VIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfh  618
                      SN                   G  DD K+D++LEID GK    P+ RNLFH
Sbjct  240   ---------SN-------------------GTTDDEKNDRVLEIDXGKSYIAPRRRNLFH  271

Query  619   sshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQ  798
             S+HL++ SDQ S+S  TSKDST+H  + SP  CE QS SP    +++ E  FCTA+ SPQ
Sbjct  272   STHLAVXSDQCSHSFTTSKDSTSHHTLPSPXSCEFQSFSPLKLSREVEEDSFCTANCSPQ  331

Query  799   FYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQY  975
              YSASS+G +S+  PFTP++SD ++S LSGYSD+PNYM+ TES+KAK RSLSAPKQRP Y
Sbjct  332   LYSASSQGATSKRSPFTPTRSDGSKSYLSGYSDYPNYMACTESSKAKFRSLSAPKQRPHY  391

Query  976   ERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
             +RSSSTKRYSIHG+GE R+ +QR S+L ANF +KAYPGSGRLD  GMPV
Sbjct  392   DRSSSTKRYSIHGFGESRSITQRTSALHANFANKAYPGSGRLDKLGMPV  440



>ref|XP_002303569.2| hypothetical protein POPTR_0003s12300g [Populus trichocarpa]
 gb|EEE78548.2| hypothetical protein POPTR_0003s12300g [Populus trichocarpa]
Length=476

 Score =   275 bits (702),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 220/367 (60%), Positives = 273/367 (74%), Gaps = 14/367 (4%)
 Frame = +1

Query  43    NSTACINRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTA  222
             NS A +   +G  G+RE+ AAVKI++ FR YL+RRALRALKALVRLQALV+G+L RK TA
Sbjct  113   NSVAYV---SGSPGLREDFAAVKIEAAFRGYLARRALRALKALVRLQALVRGHLERKRTA  169

Query  223   DMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDD  402
             + L  +QAL+RAQ+RAR+G  +ISES HSS+KS ++  PG PT EK E  I   SG+ + 
Sbjct  170   EWLHRMQALLRAQARARAGRAQISESSHSSSKSSRYHLPGLPTHEKSEHAIRATSGKYEQ  229

Query  403   TIMLKRNLSKR--RVIGDQE--KVRSNRMDYRMDAWSWEHQGSS-RSGPIDDGKSDKILE  567
             + MLKR  SK   R I DQ+   +  N  ++ MD+ +W+HQ  S  +GPIDD   DKILE
Sbjct  230   SSMLKRTGSKTKGREIADQDVAHLSFNWSEHGMDSRTWDHQAPSPGTGPIDD---DKILE  286

Query  568   IDTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNF  747
             ID+GKP   PK RNLFH SHLSL++DQYS+S  TSK ST  Q V SPS  E QS SP  F
Sbjct  287   IDSGKPHITPKRRNLFHPSHLSLSADQYSHSFTTSKGSTVRQAVPSPSSGEVQSFSPLKF  346

Query  748   GQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTES  924
               ++ E+ FCTADNSPQF SASS+GGS +  PFTPS+S  +RS +SGYSD+PNYM  TES
Sbjct  347   SHEVEEA-FCTADNSPQFCSASSRGGSGKRSPFTPSRSGGSRSFMSGYSDYPNYMCNTES  405

Query  925   AKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGE-LRTNSQRGSSLQANFTSKAYPGSGRL  1101
             ++AK+RSLSAPKQRPQYERSSSTKRYS+ G+GE   +++Q  S+L+A+FTSKAYPGSGRL
Sbjct  406   SRAKVRSLSAPKQRPQYERSSSTKRYSVLGFGEQRSSSAQSASALRASFTSKAYPGSGRL  465

Query  1102  DSFGMPV  1122
             D  GMPV
Sbjct  466   DRLGMPV  472



>ref|XP_010278570.1| PREDICTED: protein IQ-DOMAIN 14-like [Nelumbo nucifera]
Length=476

 Score =   273 bits (698),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 206/383 (54%), Positives = 258/383 (67%), Gaps = 30/383 (8%)
 Frame = +1

Query  46    STACINRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTAD  225
             +TA ++ N+G    RE  AAVKIQ+ FR YL+RRALRALK LV+LQALV+G++VRK  A+
Sbjct  115   ATAYVSSNSG---RREVWAAVKIQATFRGYLARRALRALKGLVKLQALVRGHIVRKGMAE  171

Query  226   MLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDT  405
              LR LQALVRAQ+RAR+G    SE+ H+ +K     HPGP TPEK+E  I   S + D T
Sbjct  172   QLRCLQALVRAQARARAGRVLGSETRHTYSKHSLSHHPGPATPEKYEHSIRASSTRYDRT  231

Query  406   IMLKRNLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKP  585
               L+RN  K     +   + +N   +    WS+      R+GP DD K+DKILEIDTGKP
Sbjct  232   STLRRNSPK----PNNWDINNNEKAHGGPNWSFL-----RNGPTDDEKNDKILEIDTGKP  282

Query  586   VFLPKHRnlfhsshlslnsDQYSYSLAT-----SKDSTAHQI-VHSPSYCEAQSLSPQNF  747
                  H N    +  +L SD+ S S  T     SKDS   Q+ + SPS  E QSLSP  F
Sbjct  283   -----HLNSRRHNIHTLASDRNSQSFTTTLESLSKDSATAQLSIPSPSSGEVQSLSPLKF  337

Query  748   GQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTES  924
               ++++S    A NSPQF SASS+ GS+R GPFTPS+SD +RS LSGYSD+PNYM+ TES
Sbjct  338   SYEVDDS----ASNSPQFLSASSRPGSARRGPFTPSRSDCSRSFLSGYSDYPNYMANTES  393

Query  925   AKAKMRSLSAPKQRPQYERSSSTKRYSIH--GYGELRTNSQRGSSLQANFTSKAYPGSGR  1098
             +KAK+RSLSAPKQRP++E+SSSTKR+S+H  G G+ R++SQR S L ANFTSKAYPGSGR
Sbjct  394   SKAKVRSLSAPKQRPEFEKSSSTKRFSVHGPGLGDSRSSSQRASVLHANFTSKAYPGSGR  453

Query  1099  LDSFGMPVIRDQVGFSGGLWHRY  1167
             LD  GMP   D VG SG   +RY
Sbjct  454   LDRLGMPYRGDSVGSSGVYRNRY  476



>ref|XP_011033789.1| PREDICTED: protein IQ-DOMAIN 14-like [Populus euphratica]
Length=484

 Score =   271 bits (694),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 220/367 (60%), Positives = 273/367 (74%), Gaps = 14/367 (4%)
 Frame = +1

Query  43    NSTACINRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTA  222
             NS A +   +G  G+RE+ AAVKI++ FR YL+RRALRALKALVRLQALV+G+L RK TA
Sbjct  113   NSVAYV---SGSPGLREDFAAVKIEAAFRGYLARRALRALKALVRLQALVRGHLERKRTA  169

Query  223   DMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDD  402
             + L  +QAL+RAQ+RAR+G  +ISES HSS+KS  +  PG PT EK E  I   SG+ + 
Sbjct  170   EWLHRMQALLRAQARARAGRAQISESSHSSSKSSHYHLPGLPTCEKSEHAIRATSGKYEQ  229

Query  403   TIMLKR--NLSKRRVIGDQE--KVRSNRMDYRMDAWSWEHQGSS-RSGPIDDGKSDKILE  567
             + MLKR  + SK R I DQ+   +  N  ++ MD  +W+HQ  S  +GPIDD   DKILE
Sbjct  230   SSMLKRTGSKSKGREIADQDVAHLSFNWSEHGMDGRTWDHQAPSPGTGPIDD---DKILE  286

Query  568   IDTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNF  747
             ID+GK    PK RNLFH SHLSL++DQYS+S   SK ST HQ V SP   E QSLSP  F
Sbjct  287   IDSGKSHISPKLRNLFHPSHLSLSADQYSHSFTASKGSTVHQAVPSPLSGEVQSLSPLKF  346

Query  748   GQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTES  924
              +++ E+ FCTADNSPQFYSASS+GGS +  PFTPS+S  +RS +SGYSD+PNYM  TES
Sbjct  347   SREVEEA-FCTADNSPQFYSASSRGGSGKRSPFTPSRSGGSRSFMSGYSDYPNYMCNTES  405

Query  925   AKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGE-LRTNSQRGSSLQANFTSKAYPGSGRL  1101
             ++AK+RSLSAPKQRPQYERSSSTKRYS+ G+GE   +++Q  S+L+A+FTSKAYPGSGRL
Sbjct  406   SRAKVRSLSAPKQRPQYERSSSTKRYSVLGFGEQRSSSAQSASALRASFTSKAYPGSGRL  465

Query  1102  DSFGMPV  1122
             D  GMPV
Sbjct  466   DRLGMPV  472



>ref|XP_009628884.1| PREDICTED: protein IQ-DOMAIN 14-like [Nicotiana tomentosiformis]
Length=419

 Score =   253 bits (647),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 195/363 (54%), Positives = 225/363 (62%), Gaps = 68/363 (19%)
 Frame = +1

Query  88    REELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSR  267
             REE AAV IQSHFRAYLS+RALRALK LV+LQALV+G++VRK TADMLR +QAL+RAQSR
Sbjct  122   REEWAAVVIQSHFRAYLSKRALRALKGLVKLQALVRGHIVRKQTADMLRRMQALIRAQSR  181

Query  268   ARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIG  447
             AR+G  ++SESPH STKS+ F H GP TP+KF+ VI  RS +ND   MLKRN        
Sbjct  182   ARAGRSQVSESPHFSTKSIHFFHQGPATPDKFDHVIRARSMKNDQMFMLKRN--------  233

Query  448   DQEKVRSNRMDYRMDAWSWEHQGS-SRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhss  624
                   SN M  RMD    + QGS +R+G IDD    KIL+I++GK      HRNLF+SS
Sbjct  234   -----SSNNMGCRMD----KKQGSFARTGSIDD--IGKILDINSGKSYITSTHRNLFYSS  282

Query  625   hlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFY  804
              LSLNSDQ SYSL                                +E+CF +ADNSPQ  
Sbjct  283   DLSLNSDQLSYSL--------------------------------DETCFSSADNSPQLL  310

Query  805   SASSKGGSSRVGPFTPSKSDARSCLSGY-SDHPNYMSYTESAKAKMRSLSAPKQRPQYER  981
             S SSK   SR  PFTP+KS    C S Y S+HPNYMSYTE+AKAK RS+SAPK RPQ + 
Sbjct  311   STSSKCARSRRAPFTPTKST--DCSSEYSSNHPNYMSYTEAAKAKTRSMSAPKLRPQCD-  367

Query  982   SSSTKRYSIHGYGELRTNSQRGSSLQANFTSK-AYPGSGRLDSFGMPVIRDQVGFSGGLW  1158
                 KRYS       R+N Q GS    NFTSK  YP SGRLD  GMPV  D   FS G  
Sbjct  368   ----KRYS-------RSNLQNGSIFCTNFTSKGVYPVSGRLDRHGMPVRGDSDEFSRGFL  416

Query  1159  HRY  1167
             H Y
Sbjct  417   HIY  419



>ref|XP_010255505.1| PREDICTED: protein IQ-DOMAIN 1-like [Nelumbo nucifera]
Length=496

 Score =   249 bits (636),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 203/388 (52%), Positives = 264/388 (68%), Gaps = 22/388 (6%)
 Frame = +1

Query  46    STACINRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTAD  225
             +TA ++ N+G    R+  AA+KIQS FR YL+RRAL+ALK LVRLQALV+G++VRK  A+
Sbjct  117   ATAYVSVNSGR---RDVWAAIKIQSAFRGYLARRALQALKGLVRLQALVRGHIVRKGMAE  173

Query  226   MLRGLQALVRAQSRARSGLPKIS-ESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDD  402
              LR LQAL RAQ+RAR+    +S ES H S+K   + HPGP TPEK+E+     S ++D 
Sbjct  174   QLRCLQALARAQARARASRIHVSLESQHLSSKHSLYHHPGPATPEKYERSTRANSARHDR  233

Query  403   TIMLKRNLSKRRVI---GDQEKVRSNRMDYRMDAWSWEHQGSS--RSGPIDDGKSDKILE  567
             T  L+RN  K  +     D+  V  N ++  M+  SW+H   +  R+ P DD KSDKILE
Sbjct  234   TSSLRRNGLKPNISDINSDKAHVCPNWLENWMNERSWDHHKETPVRTDPADDEKSDKILE  293

Query  568   IDTGKPVFLPKHRnlf-hsshlslnsDQYSYSLAT----SKDSTAHQI-VHSPSYCEAQS  729
             IDTGKP    K R+    SS  +L SD+ S S AT    SKDST  Q+ + SPS  E QS
Sbjct  294   IDTGKPHLCSKRRHNIFQSSQQNLASDRNSRSFATLESPSKDSTTAQLSIPSPSSGEVQS  353

Query  730   LSPQNFGQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNY  906
              SP  F  ++++S    A NSPQF SASS+ GSSR GPFTP+KSD +RS  SGY D+PNY
Sbjct  354   SSPLKF-YEVDDS----ASNSPQFLSASSRRGSSRRGPFTPTKSDCSRSIFSGYGDYPNY  408

Query  907   MSYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELR-TNSQRGSSLQANFTSKAY  1083
             M+ TES++AK+RS SAPKQRP++E+ SSTKR+SI+G+G++R T +Q+ S L ANF SKAY
Sbjct  409   MANTESSRAKVRSQSAPKQRPEFEKCSSTKRFSIYGFGDIRSTTTQKASVLHANFASKAY  468

Query  1084  PGSGRLDSFGMPVIRDQVGFSGGLWHRY  1167
             PGSGRLD  GMP   D +G++G   +RY
Sbjct  469   PGSGRLDRLGMPYRGDTIGYTGLYGNRY  496



>ref|XP_009615885.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X1 [Nicotiana tomentosiformis]
Length=413

 Score =   245 bits (625),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 194/376 (52%), Positives = 227/376 (60%), Gaps = 67/376 (18%)
 Frame = +1

Query  46    STACINRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTAD  225
             +TA    N  G+  REE AAV IQS+FRAYLSRRALRALK LV+LQALV+G++VRK T D
Sbjct  103   TTAVTTWNGVGFN-REEWAAVVIQSYFRAYLSRRALRALKGLVKLQALVRGHIVRKQTVD  161

Query  226   MLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDT  405
             MLR +QAL+RAQSRAR G  ++SESPH S   +QF   GP TP+KFE V   +S +ND  
Sbjct  162   MLRRMQALIRAQSRARVGRSQVSESPHFSANFIQFLDHGPATPDKFEHVSRAKSMKNDQM  221

Query  406   IMLKRNLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGS-SRSGPIDDGKSDKILEIDTGK  582
              MLKRN              SN +  RMD    + QGS +RSG IDD    KILEID G+
Sbjct  222   FMLKRN-------------SSNHISCRMD----KKQGSFARSGSIDD--IGKILEIDNGR  262

Query  583   PVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQIN  762
             P      +NLF+SS LSLNSDQ SYSL                                +
Sbjct  263   PYITSTQKNLFYSSDLSLNSDQLSYSL--------------------------------D  290

Query  763   ESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSDARSCLSGYSDHPNYMSYTESAKAKMR  942
             E+CF +ADNSPQ +S SSK   SR GPFTP+KS      S  S+HPNYMSYTE+AKAK R
Sbjct  291   ETCFSSADNSPQLHSVSSKCACSRRGPFTPTKS-TDGTRSYSSNHPNYMSYTEAAKAKTR  349

Query  943   SLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSK-AYPGSGRLDSFGMP  1119
             S+SAPK RPQY+     KRYS       R+N Q GS+   NFTSK  YPGSG+LD  GMP
Sbjct  350   SMSAPKLRPQYD-----KRYS-------RSNLQNGSTYCTNFTSKGVYPGSGQLDRHGMP  397

Query  1120  VIRDQVGFSGGLWHRY  1167
             V  D   FS G  H Y
Sbjct  398   VRGDSDEFSRGFLHMY  413



>ref|XP_009762655.1| PREDICTED: protein IQ-DOMAIN 14-like [Nicotiana sylvestris]
Length=400

 Score =   240 bits (612),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 185/361 (51%), Positives = 212/361 (59%), Gaps = 81/361 (22%)
 Frame = +1

Query  88    REELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSR  267
             REE AAV IQSHFRAYLSRRALRALK LV+LQALV+G++VRK TADMLR +  L+RAQSR
Sbjct  120   REEWAAVVIQSHFRAYLSRRALRALKGLVKLQALVRGHIVRKQTADMLRRMHVLIRAQSR  179

Query  268   ARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIG  447
             AR+G  ++SESPH S KS+QF H GP TP+KFE VI  RS +ND+  MLKRN        
Sbjct  180   ARAGRSQVSESPHFSAKSIQFLHHGPATPDKFEHVIRARSMKNDEMFMLKRN--------  231

Query  448   DQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhssh  627
                   SN M  RMD                            G P     HRNLF+SS 
Sbjct  232   -----SSNHMGCRMD---------------------------IGNPYVTSTHRNLFYSSD  259

Query  628   lslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYS  807
             LSLNSDQ SYSL                                +E+CF +ADNSPQ +S
Sbjct  260   LSLNSDQLSYSL--------------------------------DETCFSSADNSPQLHS  287

Query  808   ASSKGGSSRVGPFTPSKSDARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQYERSS  987
             +SSK   SR GPFTP+KS      S  S+HPNYMSYTE+AKAK RS+SAPK RPQY+ S+
Sbjct  288   SSSKYARSRRGPFTPTKS-TDGTRSYSSNHPNYMSYTEAAKAKTRSISAPKLRPQYDMSN  346

Query  988   STKRYSIHGYGELRTNSQRGSSLQANFTSK-AYPGSGRLDSFGMPVIRDQVGFSGGLWHR  1164
             STK YS       R+N Q  S+   NFTSK  YPGSGRLD  GMPV  D   FS G  H 
Sbjct  347   STKIYS-------RSNLQNSSNFSTNFTSKGVYPGSGRLDRHGMPVRGDSDEFSRGFLHI  399

Query  1165  Y  1167
             Y
Sbjct  400   Y  400



>ref|XP_009792336.1| PREDICTED: uncharacterized protein LOC104239404 [Nicotiana sylvestris]
Length=262

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 152/319 (48%), Positives = 188/319 (59%), Gaps = 62/319 (19%)
 Frame = +1

Query  226   MLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDT  405
             MLR +QAL+RAQSRAR+G  ++SESPH S KS+QF H GP TP+KFE +I  RS + D  
Sbjct  1     MLRRMQALIRAQSRARAGRSQVSESPHFSAKSIQFFHHGPATPDKFEHIIRARSMKIDQM  60

Query  406   IMLKRNLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGS-SRSGPIDDGKSDKILEIDTGK  582
              MLKRN              SN M  R+D    + QGS +R+G IDD    KILEID+GK
Sbjct  61    FMLKRN-------------SSNHMSCRID----KKQGSFARTGSIDD--IGKILEIDSGK  101

Query  583   PVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQIN  762
             P                               ST ++ +    Y    SL+ +     ++
Sbjct  102   PYIT----------------------------STQYRNLF---YSSDLSLNSEQLSYSLD  130

Query  763   ESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD--ARSCLSGY-SDHPNYMSYTESAKA  933
             E+CF +ADNSPQ +SASSK   SR GPFTP+KS    RSC S + S+HPNYMSYTE+AKA
Sbjct  131   ETCFSSADNSPQLHSASSKCARSRRGPFTPTKSSDGTRSCSSEFSSNHPNYMSYTEAAKA  190

Query  934   KMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSK-AYPGSGRLDSF  1110
             K RS+SAPK RPQY+ S+STKRYS       R++ Q+GS+   NFTSK  +PGSGRLD  
Sbjct  191   KTRSISAPKLRPQYDMSNSTKRYS-------RSSLQKGSNHYTNFTSKGVHPGSGRLDRH  243

Query  1111  GMPVIRDQVGFSGGLWHRY  1167
             GMPV  D   FS G  H Y
Sbjct  244   GMPVRGDSDEFSRGFLHIY  262



>ref|XP_010933871.1| PREDICTED: protein IQ-DOMAIN 1-like [Elaeis guineensis]
Length=498

 Score =   240 bits (612),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 186/369 (50%), Positives = 236/369 (64%), Gaps = 24/369 (7%)
 Frame = +1

Query  70    AGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQAL  249
             A G G +E+ AAVKIQ+ FR YL+RRAL+ALK LV+LQALV+G +VRK  A+ LR +QAL
Sbjct  134   AAGAGKQEQWAAVKIQAAFRGYLARRALKALKGLVKLQALVRGNIVRKQAAETLRCMQAL  193

Query  250   VRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLS  429
             VR Q+R R+      E   S   S    H GPPTPEK+EQ +     ++D +  LKRN S
Sbjct  194   VRVQARTRACRVLRLEMCRSGRGSRT--HAGPPTPEKYEQDVRPSGSRSDRSCTLKRNSS  251

Query  430   KRRVIG--DQEKVRS---NRMDYRMDAWSWE-HQGSSRSGP-IDDGKSDKILEIDTGKPV  588
             K   I   D E+  S   N +D  M+   W+  + +++ GP +DD KS KILE+D GKP 
Sbjct  252   KPASIDAVDSERAHSSGWNWLDRWMEERYWDSREAAAKPGPAVDDDKSAKILEVDPGKPQ  311

Query  589   FLPKHRnlfhssh-lslnsDQYSYSLAT-----SKDSTAHQI-VHSPSYCEAQ-SLSPQN  744
             F PK R     S   +L SDQ S S A      SKDST  Q+ + SPS  + Q SLSP  
Sbjct  312   FNPKRRGNNLQSSCSTLASDQNSRSFAAVPDSPSKDSTTAQLSIPSPSSVDMQQSLSPLR  371

Query  745   FGQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTE  921
             F   + E        SPQFYSA+S+ GSSR G FTPSKS+ +RS  SGY D+PNYM+ TE
Sbjct  372   F--HLAEPG--DFGESPQFYSATSRPGSSRRGSFTPSKSECSRSLFSGYLDYPNYMANTE  427

Query  922   SAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELR--TNSQRGSSLQANFTSKAYPGSG  1095
             S++AK+RS SAPKQRP++E+S S KR S  G+G+    T++QR SSL A FT+KAYPGSG
Sbjct  428   SSRAKVRSHSAPKQRPEFEKSGSIKRLSGQGFGQHHSGTSAQRSSSLHAKFTNKAYPGSG  487

Query  1096  RLDSFGMPV  1122
             RLD  GMP+
Sbjct  488   RLDRLGMPI  496



>ref|XP_003550875.1| PREDICTED: protein IQ-DOMAIN 14-like [Glycine max]
Length=447

 Score =   236 bits (601),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 179/367 (49%), Positives = 243/367 (66%), Gaps = 17/367 (5%)
 Frame = +1

Query  37    TVNSTACINRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKH  216
             T NS  C +   G   IR+  AAVKIQ+ FR  L+RRALRALK LV+LQALV+G++ RK 
Sbjct  89    TSNSGRCAD--GGPTRIRQHWAAVKIQAAFRGCLARRALRALKGLVKLQALVRGHIERKR  146

Query  217   TADMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQN  396
             TA+ L+ LQAL+ AQ++  +GL  +  SP SS  S   Q  GP TPEKFE  I  +S ++
Sbjct  147   TAEWLKRLQALLHAQTQVSAGL-TLHASPSSSKLSSHLQ--GPETPEKFESPIRSKSMKH  203

Query  397   DDTIMLKRNLSKR-RVIGDQEKVRSNRMDYRMDAWSWEHQGS-SRSGPIDDGKSDKILEI  570
             + + +LKRN SK   +I   +++  +R + + +   W    S +R+   +D ++ K+LE+
Sbjct  204   EHSPILKRNGSKSCALINGYQEICGSRSESQGNEQLWNSGRSMNRAHGSNDERNGKVLEV  263

Query  571   DTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQS--LSPQN  744
             D+GKP F  K RNL +S+      D YS SL ++K+ST+ Q   SP  CE QS   S Q 
Sbjct  264   DSGKPHFTLKRRNLSYSTGS----DLYSKSLNSTKESTSLQSAQSPC-CEVQSHSYSSQK  318

Query  745   FGQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTE  921
                ++ ES FCTADNSPQ+ SASSK    +  PFTP++SD +RS + GY D+P+YM+ TE
Sbjct  319   VNNEVEESPFCTADNSPQYLSASSKDDGFKRSPFTPTRSDGSRSYIRGYPDYPSYMACTE  378

Query  922   SAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRL  1101
             S+KAK RSLSAPKQRPQ ERS S+ RYS++G+   R  +QR  ++QA+FT+KAYPGSGRL
Sbjct  379   SSKAKARSLSAPKQRPQSERSGSSDRYSLNGFDMSRLATQR--AMQASFTNKAYPGSGRL  436

Query  1102  DSFGMPV  1122
             D  GMPV
Sbjct  437   DKLGMPV  443



>ref|XP_008799524.1| PREDICTED: protein IQ-DOMAIN 1 [Phoenix dactylifera]
Length=494

 Score =   236 bits (603),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 183/369 (50%), Positives = 235/369 (64%), Gaps = 24/369 (7%)
 Frame = +1

Query  70    AGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQAL  249
             A G G RE  AAVKIQS FR YL+RRALRALK LV+LQALV+G +VRK  A+ LR +QAL
Sbjct  130   ASGAGKREVAAAVKIQSAFRGYLARRALRALKGLVKLQALVRGNIVRKQAAETLRCMQAL  189

Query  250   VRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLS  429
             VR Q+R R+     SE   S   S    H GPPTPE +EQ +     ++D +  LKRN S
Sbjct  190   VRVQARTRACRALRSEMSRSGRGSRA--HAGPPTPENYEQAVRSSGSKSDRSCTLKRNPS  247

Query  430   KRRVIG--DQEKVRS---NRMDYRMDAWSWE-HQGSSRSGP-IDDGKSDKILEIDTGKPV  588
             K   +   D ++  S   N +D  M+   W+  Q ++++G  +DD K+ KILE+D GKP 
Sbjct  248   KAASMDAVDSDRTHSSGWNWLDRWMEERYWDSRQAAAKTGAAMDDEKNAKILEVDPGKPQ  307

Query  589   FLPKHRnlfhssh-lslnsDQYSYSLAT-----SKDSTAHQI-VHSPSYCEA-QSLSPQN  744
             F PK R     S   +L SDQ + S+A      SKDST  Q+ + SPS  +  QSLSP  
Sbjct  308   FNPKRRGNNLQSSCSTLASDQNNRSIAAMPDSPSKDSTTAQLSIPSPSSVDMPQSLSPLR  367

Query  745   FGQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTE  921
             F   + E        SPQFYS +S+ GSSR GPFTPSKS+ +RS  SGYSD+PNYM+ TE
Sbjct  368   F--HLPEPG--DFGESPQFYSVASRPGSSRRGPFTPSKSECSRSLFSGYSDYPNYMANTE  423

Query  922   SAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRT--NSQRGSSLQANFTSKAYPGSG  1095
             S++AK+RS SAP+QRP++E+S S KR S  G G+  +  ++QR SSL A F +KAYPGSG
Sbjct  424   SSRAKVRSHSAPRQRPEFEKSGSIKRLSGQGLGQQHSGASAQRSSSLHAKFANKAYPGSG  483

Query  1096  RLDSFGMPV  1122
             RLD  GMP+
Sbjct  484   RLDRLGMPI  492



>gb|KEH31712.1| calmodulin-binding protein [Medicago truncatula]
Length=427

 Score =   233 bits (595),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 171/349 (49%), Positives = 229/349 (66%), Gaps = 13/349 (4%)
 Frame = +1

Query  85    IREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQS  264
             IRE+ AAVKIQ+ FR  L+R+ALRALK LV+LQALV+G++ RK TA+ L+ +Q+L+RAQ 
Sbjct  85    IREQWAAVKIQAAFRGSLARKALRALKGLVKLQALVRGHIERKRTAEWLKRMQSLLRAQ-  143

Query  265   RARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVI  444
              AR    +  ++ H + KS      GP TPEK E  +  RS +++ +  LKRN SK   +
Sbjct  144   -ARFNAARTMQTSHLNAKSSTLHLYGPATPEKSESPVRSRSMKSEHSPGLKRNGSKS-CL  201

Query  445   GDQEKVRSNRMDYRMDAWSWEHQGS-SRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhs  621
              +   +  N++D +    SW    S  R+    D KSD+I+EID+GK     K RN+FHS
Sbjct  202   SNGGNISENQLDEQ----SWNRVRSLIRTYSRSDEKSDRIVEIDSGKQHINTKRRNIFHS  257

Query  622   shlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQF  801
             +        YS +L  +K+S +HQ   S S CE QS        ++ E+ FCTA+NSPQ 
Sbjct  258   TSDPDYY--YSQNLTPTKESKSHQFGQSVS-CEVQSYYNPLKLNEVEENSFCTANNSPQL  314

Query  802   YS-ASSKGGSSRVGPFTPSKSDA-RSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQY  975
              S A+SK       PFTP++SD  RS + GYSD+P+YM+YTESAKAK+RSLSAPKQRPQY
Sbjct  315   LSSATSKDDGYNRSPFTPTRSDGPRSYIRGYSDYPSYMAYTESAKAKVRSLSAPKQRPQY  374

Query  976   ERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
             E+SSS+ RYS++G+   R  +QR S+LQA+FTSK YPGSGRLD  GMPV
Sbjct  375   EKSSSSNRYSLNGHDMARLAAQRTSALQASFTSKGYPGSGRLDKLGMPV  423



>ref|XP_003525537.1| PREDICTED: protein IQ-DOMAIN 14-like [Glycine max]
Length=445

 Score =   232 bits (592),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 171/356 (48%), Positives = 238/356 (67%), Gaps = 14/356 (4%)
 Frame = +1

Query  67    NAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQA  246
             +AG   IR+  AAV+IQ+ FR  L+RRALRALK LV+LQALV+G++ RK TA+ L+ +Q 
Sbjct  96    DAGPTRIRQHWAAVRIQAAFRGCLARRALRALKGLVKLQALVRGHIERKRTAEWLKRVQV  155

Query  247   LVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNL  426
             L+ AQ +  +GL  +  SP  S  S      GP TPEKFE  I  +S +++ + +LKRN 
Sbjct  156   LLHAQPQVSAGL-ILHASPSGSKLSSHLH--GPETPEKFESPIRSKSMKHEHSPILKRNG  212

Query  427   SKRRV-IGDQEKVRSNRMDYRMDAWSWEHQGS-SRSGPIDDGKSDKILEIDTGKPVFLPK  600
             SK  V I   +++  +R + +++  SW    S +R+   +D ++D++LE+D+GKP F  K
Sbjct  213   SKSCVQINGYQEMCGSRSESQVNEQSWNSGRSLNRTYSSNDERNDRVLEVDSGKPHFTIK  272

Query  601   HRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLS-PQNFGQQINESCFC  777
              +NL  S+      D YS SL ++K+ST+ Q   S S CE QS S       ++ ES FC
Sbjct  273   RKNLSFSTGS----DLYSKSLNSTKESTSLQSGQS-SCCEVQSHSYTSQKVNEVEESPFC  327

Query  778   TADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSA  954
             TADNSPQ+ SA+SK G  +  PFTP+KSD +RS + GY D+P+YM+ TES+KAK RSLSA
Sbjct  328   TADNSPQYLSATSKDGGFKRSPFTPTKSDGSRSYIRGYPDYPSYMACTESSKAKARSLSA  387

Query  955   PKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
             PKQRPQ E+S S+ RYS++G+   R  +QR  ++QA+FT+KAYPGSGRLD  GMPV
Sbjct  388   PKQRPQSEKSGSSNRYSLNGFDMSRLATQR--AMQASFTNKAYPGSGRLDKLGMPV  441



>ref|XP_007155556.1| hypothetical protein PHAVU_003G211800g [Phaseolus vulgaris]
 gb|ESW27550.1| hypothetical protein PHAVU_003G211800g [Phaseolus vulgaris]
Length=446

 Score =   231 bits (590),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 171/356 (48%), Positives = 236/356 (66%), Gaps = 15/356 (4%)
 Frame = +1

Query  67    NAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQA  246
             +AG   IR+  AAVKIQ+ FR  L+RRALRALK LV+LQALV+G++ RK TA  L+ +QA
Sbjct  98    DAGPTRIRQHWAAVKIQAAFRGCLARRALRALKGLVKLQALVRGHIERKRTAQWLKRVQA  157

Query  247   LVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNL  426
             L+ AQ++  +GL  +  SP S+  S      GP TPEKFE  I  +S + + + +LKRN 
Sbjct  158   LLHAQAQVSAGL-ALHASPSSAKLSSNLH--GPETPEKFESPISSKSMKYEQSPILKRNG  214

Query  427   SKRRV-IGDQEKVRSNRMDYRMDAWSWEHQGS-SRSGPIDDGKSDKILEIDTGKPVFLPK  600
             SK  V I   +++  +R + ++   SW    S  R+   +D ++D++LE+D+GKP F PK
Sbjct  215   SKSCVQINGYQEICGSRSENQVTEISWNTARSLIRTYSSNDERNDRVLEVDSGKPHF-PK  273

Query  601   HRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSP-SYCEAQSLSPQNFGQQINESCFC  777
              RNL +S+      D YS SL ++K+ST+ Q   SP    ++ S S Q    ++ ES FC
Sbjct  274   RRNLSYSTGS----DHYSKSLNSTKESTSLQSGQSPCGEVQSYSYSSQKV-NEVEESPFC  328

Query  778   TADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSA  954
             TADNSPQF SA+SK    +  PFTP++SD +RS + GY DHP+YM  TES+KAK+RSLSA
Sbjct  329   TADNSPQFLSATSKDDGFKRSPFTPTRSDGSRSYIRGYPDHPSYMGCTESSKAKVRSLSA  388

Query  955   PKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
             PKQRP  ER  S+ RYS++G+   R+ +QR  ++ A+FT+KAYPGSGRLD  GMPV
Sbjct  389   PKQRPNCERPGSSNRYSLNGFDMSRSTTQR--AMHASFTNKAYPGSGRLDKLGMPV  442



>ref|XP_004515805.1| PREDICTED: protein IQ-DOMAIN 14-like [Cicer arietinum]
Length=431

 Score =   228 bits (582),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 167/358 (47%), Positives = 228/358 (64%), Gaps = 13/358 (4%)
 Frame = +1

Query  58    INRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRG  237
              N + G   IRE+ AAVKIQ+ FR  L+R+ALRAL+ LV+LQALV+G++ RK TA+ L+ 
Sbjct  80    FNSSNGIIRIREQWAAVKIQAAFRGCLARKALRALRGLVKLQALVRGHIERKRTAEWLKK  139

Query  238   LQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLK  417
             +QAL+RAQ+R  +   +  ++  S+ KS      GP TPEK E  +  RS + + +  LK
Sbjct  140   MQALLRAQTRVSAA--RTLQTSQSNVKSSTLHLYGPATPEKSESPVRSRSVKYEHSPALK  197

Query  418   RNLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGS-SRSGPIDDGKSDKILEIDTGKPVFL  594
             RN SK  +      +  N  +  +D  SW    S  R+    + K+D+I+EID+GK  F 
Sbjct  198   RNGSKSCL-----PISGNISETHLDEQSWNRVRSLIRTYSRSEEKADRIVEIDSGKQHFT  252

Query  595   PKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCF  774
              KHRNLF+S+  + +   YS SL  +KDS +HQ   S S CE QS        ++ ES F
Sbjct  253   SKHRNLFYSTSDTDHY--YSQSLTPTKDSKSHQSGQSLS-CEVQSYYNPLKLNEVEESPF  309

Query  775   CTADNSPQFYSASSKGGSSRVGPFTPSKSDA--RSCLSGYSDHPNYMSYTESAKAKMRSL  948
             CTA NSPQF SA+S     +  PFTP+KSD    S   GY+D+P+YM+YTES+KAK+RS+
Sbjct  310   CTASNSPQFLSATSNDDGYKRSPFTPTKSDGSRNSYPKGYADYPSYMAYTESSKAKVRSM  369

Query  949   SAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
             SAPKQRP YE+SS + RYS++G+   R  SQ+  +LQ +F+SK YPGSGRLD  GMPV
Sbjct  370   SAPKQRPIYEKSSLSNRYSLNGHDMARLASQKTFTLQTSFSSKGYPGSGRLDKLGMPV  427



>gb|KHN34427.1| hypothetical protein glysoja_016755 [Glycine soja]
Length=345

 Score =   223 bits (568),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 148/317 (47%), Positives = 209/317 (66%), Gaps = 18/317 (6%)
 Frame = +1

Query  190   VKGYLVRKHTADMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQ  369
             V+G++ RK TA+ L+ +Q L+ AQ +  +GL  +  SP  S  S      GP TPEKFE 
Sbjct  37    VRGHIERKRTAEWLKRVQVLLHAQPQVSAGL-ILHASPSGSKLSSHLH--GPETPEKFES  93

Query  370   VIHMRSGQNDDTIMLKRNLSKRRV-IGDQEKVRSNRMDYRMDAWSWEHQGS-SRSGPIDD  543
              I  +S +++ + +LKRN SK  V I   +++  +R + +++  SW    S +R+   +D
Sbjct  94    PIRSKSMKHEHSPILKRNGSKSCVQINGYQEMCGSRSESQVNEQSWNSGRSLNRTYSSND  153

Query  544   GKSDKILEIDTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEA  723
              ++D++LE+D+GKP F  K RNL  S+      D YS SL ++K+ST+ Q   S S CE 
Sbjct  154   ERNDRVLEVDSGKPHFTIKRRNLSFSTGS----DLYSKSLNSTKESTSLQSGQS-SCCEV  208

Query  724   QSLSPQNFGQQINE---SCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYS  891
             QS S  +  Q++NE   S FCTADNSPQ+ SA+SK G  +  PFTP+KSD +RS + GY 
Sbjct  209   QSHSYTS--QKVNEVEESPFCTADNSPQYLSATSKDGGFKRSPFTPTKSDGSRSYIRGYP  266

Query  892   DHPNYMSYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFT  1071
             D+P+YM+ TES+KAK RSLSAPKQRPQ E+S S+ RYS++G+   R  +QR  ++QA+FT
Sbjct  267   DYPSYMACTESSKAKARSLSAPKQRPQSEKSGSSNRYSLNGFDMSRLATQR--AMQASFT  324

Query  1072  SKAYPGSGRLDSFGMPV  1122
             +KAYPGSGRLD  GMPV
Sbjct  325   NKAYPGSGRLDKLGMPV  341



>gb|KHN14115.1| hypothetical protein glysoja_033342 [Glycine soja]
Length=397

 Score =   224 bits (570),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 149/316 (47%), Positives = 208/316 (66%), Gaps = 15/316 (5%)
 Frame = +1

Query  190   VKGYLVRKHTADMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQ  369
             V+G++ RK TA+ L+ LQAL+ AQ++  +GL  +  SP SS  S   Q  GP TPEKFE 
Sbjct  88    VRGHIERKRTAEWLKRLQALLHAQTQVSAGL-TLHASPSSSKLSSHLQ--GPETPEKFES  144

Query  370   VIHMRSGQNDDTIMLKRNLSKR-RVIGDQEKVRSNRMDYRMDAWSWEHQGS-SRSGPIDD  543
              I  +S +++ + +LKRN SK   +I   +++  +R + + +   W    S +R+   +D
Sbjct  145   PIRSKSMKHEHSPILKRNGSKSCALINGYQEICGSRSESQGNEQLWNSGRSMNRAHGSND  204

Query  544   GKSDKILEIDTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEA  723
              ++ K+LE+D+GKP F  K RNL +S+      D YS SL ++K+ST+ Q   SP  CE 
Sbjct  205   ERNGKVLEVDSGKPHFTLKRRNLSYSTGS----DLYSKSLNSTKESTSLQSAQSPC-CEV  259

Query  724   QS--LSPQNFGQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSD  894
             QS   S Q    ++ ES FCTADNSPQ+ SASSK    +  PFTP++SD +RS + GY D
Sbjct  260   QSHSYSSQKVNNEVEESPFCTADNSPQYLSASSKDDGFKRSPFTPTRSDGSRSYIRGYPD  319

Query  895   HPNYMSYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTS  1074
             +P+YM+ TES+KAK RSLSAPKQRPQ ERS S+ RYS++G+   R  +QR  ++QA+FT+
Sbjct  320   YPSYMACTESSKAKARSLSAPKQRPQSERSGSSDRYSLNGFDMSRLATQR--AMQASFTN  377

Query  1075  KAYPGSGRLDSFGMPV  1122
             KAYPGSGRLD  GMPV
Sbjct  378   KAYPGSGRLDKLGMPV  393



>ref|XP_008795399.1| PREDICTED: protein IQ-DOMAIN 1-like [Phoenix dactylifera]
Length=494

 Score =   225 bits (573),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 179/370 (48%), Positives = 230/370 (62%), Gaps = 26/370 (7%)
 Frame = +1

Query  70    AGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQAL  249
             A G G +E+ AAV+IQ+ FR YL+RRALRALK LV+LQALV+G +VRK  A+ LR +QAL
Sbjct  130   AAGAGKQEQWAAVRIQAAFRGYLARRALRALKGLVKLQALVRGNIVRKQAAETLRCMQAL  189

Query  250   VRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLS  429
             VR Q R R+     SE   S  KS +  H GPPTPEK+EQ +     ++D +  LKR+ S
Sbjct  190   VRVQGRTRACRALRSEMTRSG-KSFR-THAGPPTPEKYEQDVRPSGSRSDRSCTLKRSSS  247

Query  430   KRRVIG--DQEKVRSNRMDYRMDAWSWEHQGSSRSGP------IDDGKSDKILEIDTGKP  585
             K   +   D E+  S+  ++ +D W  E    SR         +DD K+ +ILE+D GKP
Sbjct  248   KPASVDAVDSERTHSSGWNW-LDRWMEERYWDSREAAAKAGAAMDDDKNARILEVDPGKP  306

Query  586   VFLPKHRnlfhssh-lslnsDQYSYSLATSKDS------TAHQIVHSPSYCEA-QSLSPQ  741
              F PK R     S   +L SDQ S S AT  DS      TA   + SPS  +  QSLSP 
Sbjct  307   QFNPKRRGSHLQSSCSTLASDQNSRSFATVPDSPSKVSTTAQLSIPSPSSVDMRQSLSPP  366

Query  742   NFGQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYT  918
              F   + E        SPQFYSA+S+ GSSR G FTPS S+ ARS  SGY D+PNYM+ T
Sbjct  367   RF--HLPEPG--DFGESPQFYSAASRPGSSRRGSFTPSNSECARSLFSGYLDYPNYMANT  422

Query  919   ESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELR--TNSQRGSSLQANFTSKAYPGS  1092
             ES++AK+RS SAP+QRP++++S STKR S  G+ +    T++QR SSL A F +KAYPGS
Sbjct  423   ESSRAKVRSHSAPRQRPEFDKSGSTKRLSGQGFAQQHSGTSAQRPSSLHAKFANKAYPGS  482

Query  1093  GRLDSFGMPV  1122
             GRLD  GMP+
Sbjct  483   GRLDRLGMPI  492



>ref|XP_009615886.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X2 [Nicotiana tomentosiformis]
Length=396

 Score =   220 bits (560),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 186/376 (49%), Positives = 217/376 (58%), Gaps = 84/376 (22%)
 Frame = +1

Query  46    STACINRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTAD  225
             +TA    N  G+  REE AAV IQS+FRAYLSRRALRALK LV+LQALV+G++VRK T D
Sbjct  103   TTAVTTWNGVGFN-REEWAAVVIQSYFRAYLSRRALRALKGLVKLQALVRGHIVRKQTVD  161

Query  226   MLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDT  405
             MLR +QAL+RAQSRAR G  +                 GP TP+KFE V   +S +ND  
Sbjct  162   MLRRMQALIRAQSRARVGRSQ-----------------GPATPDKFEHVSRAKSMKNDQM  204

Query  406   IMLKRNLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGS-SRSGPIDDGKSDKILEIDTGK  582
              MLKRN              SN +  RMD    + QGS +RSG IDD    KILEID G+
Sbjct  205   FMLKRN-------------SSNHISCRMD----KKQGSFARSGSIDD--IGKILEIDNGR  245

Query  583   PVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQIN  762
             P      +NLF+SS LSLNSDQ SYSL                                +
Sbjct  246   PYITSTQKNLFYSSDLSLNSDQLSYSL--------------------------------D  273

Query  763   ESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSDARSCLSGYSDHPNYMSYTESAKAKMR  942
             E+CF +ADNSPQ +S SSK   SR GPFTP+KS      S  S+HPNYMSYTE+AKAK R
Sbjct  274   ETCFSSADNSPQLHSVSSKCACSRRGPFTPTKS-TDGTRSYSSNHPNYMSYTEAAKAKTR  332

Query  943   SLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSK-AYPGSGRLDSFGMP  1119
             S+SAPK RPQY+     KRYS       R+N Q GS+   NFTSK  YPGSG+LD  GMP
Sbjct  333   SMSAPKLRPQYD-----KRYS-------RSNLQNGSTYCTNFTSKGVYPGSGQLDRHGMP  380

Query  1120  VIRDQVGFSGGLWHRY  1167
             V  D   FS G  H Y
Sbjct  381   VRGDSDEFSRGFLHMY  396



>ref|XP_010919244.1| PREDICTED: protein IQ-DOMAIN 14 [Elaeis guineensis]
 ref|XP_010919245.1| PREDICTED: protein IQ-DOMAIN 14 [Elaeis guineensis]
Length=492

 Score =   221 bits (564),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 186/372 (50%), Positives = 231/372 (62%), Gaps = 29/372 (8%)
 Frame = +1

Query  70    AGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQAL  249
             A G G REE AAVKIQ+ FR YL+RRALRALK LV+LQALV+G +VRK  A+ LR +QAL
Sbjct  127   AAGAGKREEAAAVKIQAAFRGYLARRALRALKGLVKLQALVRGNIVRKQAAETLRCMQAL  186

Query  250   VRAQSRARSGLPKISESPHSSTKSVQFQ-HPGPPTPEKFEQVIHMRSGQNDDTIMLKRNL  426
             VR Q+RAR+     SE   S      F+ H GPPTPEK+EQ +     ++D +  LKRN 
Sbjct  187   VRVQARARACRALRSEMSRSGRG---FRAHAGPPTPEKYEQAVRSSGSKSDRSCTLKRNP  243

Query  427   SKRRVIG--DQEKVRSNRMDYRMDAWSWEHQGSSR------SGPIDDGKSDKILEIDTGK  582
             SK   I   D ++  S+  ++ +D W  E    SR         +DD K+ KILE+D GK
Sbjct  244   SKSASIDAVDSDRTHSSGWNW-LDRWMEERYWDSREAAAKAGAAMDDEKNAKILEVDPGK  302

Query  583   PVFLPKHRnlfhssh-lslnsDQYSYSLAT-----SKDSTAHQI-VHSPSYCEA-QSLSP  738
             P F  K R     S   +L SDQ + S A      SKDST  Q+ + SPS  +  QSLSP
Sbjct  303   PQFNLKRRGNNLHSSCSTLASDQNNRSFAAMPDSPSKDSTIAQLSIPSPSSVDMPQSLSP  362

Query  739   QNFGQQINESCFCTADNSPQFYSASSKGGSSRVG-PFTPSKSD-ARSCLSGYSDHPNYMS  912
               F   + E        SPQFYSA+S+ GSSR G  FTPSKS+ +RS  SGYSD+PNYM+
Sbjct  363   LRF--HLPEPG--EFGESPQFYSATSRPGSSRRGGAFTPSKSECSRSLFSGYSDYPNYMA  418

Query  913   YTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELR--TNSQRGSSLQANFTSKAYP  1086
              TES++AK+RS SAPKQRP++E S S KR S  G G+     ++QR SSL A F +KAYP
Sbjct  419   NTESSRAKVRSHSAPKQRPEFENSGSIKRLSGQGLGQQHPGASAQRSSSLHAKFANKAYP  478

Query  1087  GSGRLDSFGMPV  1122
             GSGRLD  GMPV
Sbjct  479   GSGRLDRLGMPV  490



>ref|XP_003516692.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X1 [Glycine max]
Length=396

 Score =   215 bits (547),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 179/374 (48%), Positives = 235/374 (63%), Gaps = 49/374 (13%)
 Frame = +1

Query  55    CINRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLR  234
             C    AGG    EE AAVKIQ+ FR  L+R+ALRALK LV+LQALV+G++ RK TA+ L+
Sbjct  50    CPATTAGG-NTPEEWAAVKIQAAFRGSLARKALRALKGLVKLQALVRGHIERKRTAEWLQ  108

Query  235   GLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDD--TI  408
              +QAL+R Q++ R+G  +I  SP SST  ++    GP TP+KFE  I   S + D   + 
Sbjct  109   RVQALLRVQAQIRAGRAQILHSP-SSTSHLR----GPATPDKFEIPIRSESMKYDQYSSP  163

Query  409   MLKRNLSKRRVI---GDQEKVRSNRMDYRMDAWSWEHQGS-SRSGPIDDGKSDKILEIDT  576
             +LKRN SK RV    G+QE+ RS   D R+D   W  + S +R   +D+ +S +ILEID+
Sbjct  164   LLKRNSSKSRVQINGGNQERCRSRSSDSRIDEQPWTQRRSWTRGCSMDEERSVRILEIDS  223

Query  577   GKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSY--CEAQSLSPQNFG  750
              KP    K RNLF           YS S A         +V S  Y  C   + SP ++ 
Sbjct  224   VKPHVTSKRRNLF-----------YSPSQA---------MVVSDHYSGCNLTTTSPSSYN  263

Query  751   -----QQINESCFCTADNSPQFYS--ASSKGGSSRVGPFTPSKSD-ARSCLSGYSD--HP  900
                   ++ ES FC ADNSPQ  S  +SSK G+S+  P TP++SD +RS LSGYS+  +P
Sbjct  264   SPLKINELEESSFCAADNSPQALSLSSSSKDGASKRSPLTPTRSDGSRSFLSGYSEPNYP  323

Query  901   NYMSYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKA  1080
             +YM+YTES+KAK+RSLSAPKQRPQYER SS+ RYS+HG       +QR ++L A+FT+KA
Sbjct  324   SYMAYTESSKAKLRSLSAPKQRPQYERCSSSNRYSLHGLA-----TQRIAALHASFTNKA  378

Query  1081  YPGSGRLDSFGMPV  1122
             YPGSGRLD  GM V
Sbjct  379   YPGSGRLDKLGMHV  392



>gb|EYU29831.1| hypothetical protein MIMGU_mgv1a006306mg [Erythranthe guttata]
Length=449

 Score =   213 bits (542),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 185/402 (46%), Positives = 233/402 (58%), Gaps = 68/402 (17%)
 Frame = +1

Query  7     STSAAAWCGSTVNS-TACINRNAGGYGI-REELAAVKIQSHFraylsrralralkalvrl  180
             STSAA   G +V+S ++   RN  GYG  REE AAV IQSHFRAYL+RRALRALKALV++
Sbjct  101   STSAAGNGGGSVDSYSSAGGRNGPGYGWSREERAAVAIQSHFRAYLARRALRALKALVKI  160

Query  181   qalVKGYLVRKHTADMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEK  360
             QA+V+G++ RK  AD LR + A+VR Q+RAR+G   I+E+ HS+  S  F H    + EK
Sbjct  161   QAMVRGHISRKKAADDLRRMHAIVRVQARARAGRVPINEARHSTANSSHFSHSALSSWEK  220

Query  361   FEQVIHMRSGQNDDTIMLKRNLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPID  540
             FEQ I     +++  +MLK+N       G +   RS R        SW+          +
Sbjct  221   FEQRIRAGITKHEQPMMLKKN-------GSRSCERSER--------SWD----------E  255

Query  541   DGKSDKILEIDTG-KPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAH--QIVHSPS  711
             D +SDKILE+D+  KP   PK                    +  S+ S +   ++  SPS
Sbjct  256   DERSDKILEVDSSFKPNPTPK--------------------IKNSRISHSRHPKLPISPS  295

Query  712   YC-EAQSLSPQNFGQ-----QINESCFC-TADNSPQFYSASSKGGSSRVGPFTPSKSDAR  870
                E +SLS   F Q      I+ S    T+DN P  YSAS    SS+   FTP+KS+  
Sbjct  296   SSNEVRSLSRLKFEQDDAADDISSSSHALTSDNCPFVYSASP---SSKTALFTPTKSEGS  352

Query  871   -SCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRP--QYERSSSTKRYSIHGYGELRTNSQ  1041
              SCLSGYS++PNYM+YTES+KAK RS SAPKQRP  QYERSSST RYS+H  G+      
Sbjct  353   VSCLSGYSENPNYMAYTESSKAKARSTSAPKQRPDQQYERSSSTSRYSVHVSGDYGGGGG  412

Query  1042  RGSSLQANFTSKAYPGSGRLDSFGMPVIRDQVGFSGGLWHRY  1167
                  +AN   KAYPGSG LD  GMPV RD   FSGGLW RY
Sbjct  413   --GEKRAN---KAYPGSGHLDKHGMPVTRDVSSFSGGLWVRY  449



>ref|XP_008369498.1| PREDICTED: protein IQ-DOMAIN 14 [Malus domestica]
Length=393

 Score =   210 bits (534),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 127/161 (79%), Gaps = 1/161 (1%)
 Frame = +1

Query  643   DQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYSASSKG  822
             DQ S+S  TSKDST+H  + SP  CE QS SP    +++ E  FCTA+ SPQ YSASS+G
Sbjct  229   DQCSHSFTTSKDSTSHHTLPSPXSCEFQSFSPLKLSREVEEDSFCTANCSPQLYSASSQG  288

Query  823   GSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQYERSSSTKR  999
              +S+  PFTP++SD ++S LSGYSD+PNYM+ TES+KAK RSLSAPKQRP Y+RSSSTKR
Sbjct  289   ATSKRSPFTPTRSDGSKSYLSGYSDYPNYMACTESSKAKFRSLSAPKQRPHYDRSSSTKR  348

Query  1000  YSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
             YSIHG+GE R+ +QR S+L ANF +KAYPGSGRLD  GMPV
Sbjct  349   YSIHGFGESRSITQRTSALHANFANKAYPGSGRLDKLGMPV  389


 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 78/102 (76%), Gaps = 1/102 (1%)
 Frame = +1

Query  82   GIREE-LAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRA  258
            GIREE LAAVKIQ+ FR  L+RRALRALK LVRLQALV+G++VRK  AD L+ LQA++RA
Sbjct  122  GIREEELAAVKIQAAFRGCLARRALRALKGLVRLQALVRGHIVRKFYADRLQRLQAILRA  181

Query  259  QSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMR  384
            Q+RA++   +IS+  HS TKS QF  P P TPEKFE  I  R
Sbjct  182  QARAQARRAQISDLSHSRTKSSQFHQPDPATPEKFEHPIRSR  223



>ref|XP_006573764.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X2 [Glycine max]
Length=387

 Score =   205 bits (522),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 174/371 (47%), Positives = 230/371 (62%), Gaps = 52/371 (14%)
 Frame = +1

Query  55    CINRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLR  234
             C    AGG    EE AAVKIQ+ FR  L+R+ALRALK LV+LQALV+G++ RK TA+ L+
Sbjct  50    CPATTAGG-NTPEEWAAVKIQAAFRGSLARKALRALKGLVKLQALVRGHIERKRTAEWLQ  108

Query  235   GLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDD--TI  408
              +QAL+R Q++ R+G  +I  SP SST  ++    GP TP+KFE  I   S + D   + 
Sbjct  109   RVQALLRVQAQIRAGRAQILHSP-SSTSHLR----GPATPDKFEIPIRSESMKYDQYSSP  163

Query  409   MLKRNLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGS-SRSGPIDDGKSDKILEIDTGKP  585
             +LK N       G+QE+ RS   D R+D   W  + S +R   +D+ +S +ILEID+ KP
Sbjct  164   LLKIN------GGNQERCRSRSSDSRIDEQPWTQRRSWTRGCSMDEERSVRILEIDSVKP  217

Query  586   VFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSY--CEAQSLSPQNFG---  750
                 K RNLF           YS S A         +V S  Y  C   + SP ++    
Sbjct  218   HVTSKRRNLF-----------YSPSQA---------MVVSDHYSGCNLTTTSPSSYNSPL  257

Query  751   --QQINESCFCTADNSPQFYS--ASSKGGSSRVGPFTPSKSD-ARSCLSGYSD--HPNYM  909
                ++ ES FC ADNSPQ  S  +SSK G+S+  P TP++SD +RS LSGYS+  +P+YM
Sbjct  258   KINELEESSFCAADNSPQALSLSSSSKDGASKRSPLTPTRSDGSRSFLSGYSEPNYPSYM  317

Query  910   SYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPG  1089
             +YTES+KAK+RSLSAPKQRPQYER SS+ RYS+HG       +QR ++L A+FT+KAYPG
Sbjct  318   AYTESSKAKLRSLSAPKQRPQYERCSSSNRYSLHGLA-----TQRIAALHASFTNKAYPG  372

Query  1090  SGRLDSFGMPV  1122
             SGRLD  GM V
Sbjct  373   SGRLDKLGMHV  383



>gb|KHN25723.1| Protein IQ-DOMAIN 14 [Glycine soja]
Length=423

 Score =   203 bits (516),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 148/329 (45%), Positives = 202/329 (61%), Gaps = 48/329 (15%)
 Frame = +1

Query  190   VKGYLVRKHTADMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQ  369
             V+G++ RK TA+ L+ +QAL+R Q++ R+G  +I  SP SST  ++    GP TP+KFE 
Sbjct  121   VRGHIERKRTAEWLQRVQALLRVQAQIRAGRAQILHSP-SSTSHLR----GPATPDKFEI  175

Query  370   VIHMRSGQNDD--TIMLKRNLSKRRVI---GDQEKVRSNRMDYRMDAWSWEHQGS-SRSG  531
              I   S + D   + +LKRN SK RV    G+QE+ RS   D R+D   W  + S +R  
Sbjct  176   PIRSESMKYDQYSSPLLKRNSSKSRVQINGGNQERCRSRSSDSRIDEQPWTQRRSWTRGC  235

Query  532   PIDDGKSDKILEIDTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPS  711
              +D+ +S +ILEID+ KP    K RNLF+                    S +  +V S  
Sbjct  236   SMDEERSVRILEIDSVKPHVTSKRRNLFY--------------------SPSQAMVVSDH  275

Query  712   Y--CEAQSLSPQNFG-----QQINESCFCTADNSPQFYS--ASSKGGSSRVGPFTPSKSD  864
             Y  C   + SP ++       ++ ES FC ADNSPQ  S  +SSK G+S+  P TP++SD
Sbjct  276   YSGCNLTTTSPSSYNSPLKINELEESSFCAADNSPQALSLSSSSKDGASKRSPLTPTRSD  335

Query  865   -ARSCLSGYSD--HPNYMSYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTN  1035
              +RS LSGYS+  +P+YM+YTES+KAK+RSLSAPKQRPQYER SS+ RYS+HG       
Sbjct  336   GSRSFLSGYSEPNYPSYMAYTESSKAKLRSLSAPKQRPQYERCSSSNRYSLHGLA-----  390

Query  1036  SQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
             +QR ++L A+FT+KAYPGSGRLD  GM V
Sbjct  391   TQRIAALHASFTNKAYPGSGRLDKLGMHV  419



>gb|EYU38984.1| hypothetical protein MIMGU_mgv1a008113mg [Erythranthe guttata]
Length=384

 Score =   192 bits (489),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 174/368 (47%), Positives = 205/368 (56%), Gaps = 102/368 (28%)
 Frame = +1

Query  88    REELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSR  267
             R+E AAV IQSHFR YLSRRALRALKALV+LQALV+G+LVRK TA  LR LQALVRAQ R
Sbjct  111   RQEWAAVTIQSHFRGYLSRRALRALKALVKLQALVRGHLVRKQTAYTLRRLQALVRAQVR  170

Query  268   ARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTI--MLKRNLSKRRV  441
             AR+G    S+SPHSS KS  F   GPPTPEKFE VI  RS +++  +  MLKRN S R  
Sbjct  171   ARAGRCLSSDSPHSSIKSSHFNCNGPPTPEKFEHVIRARSMKHEQHLITMLKRNGSNR--  228

Query  442   IGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhs  621
                                                 +DKILE+DT               
Sbjct  229   ------------------------------------TDKILEMDT---------------  237

Query  622   shlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQF  801
                    +   ++  T + S          +  AQ L+P         +  C + ++P +
Sbjct  238   -------ENIPHAATTKRRSL---------FYSAQ-LTP-------GPTQHCRSFSTPTY  273

Query  802   YSASSKGGSSRVG-PFTPSKSDA-RSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRP-Q  972
             YSASS  G S     FTP+KS+A RSCLSGYSDHPNYM+YTES+KAK RS+SAPKQRP Q
Sbjct  274   YSASSSRGGSSKRGAFTPTKSEASRSCLSGYSDHPNYMAYTESSKAKARSISAPKQRPVQ  333

Query  973   YERS-SSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPVIRDQVG--F  1143
              ERS SSTKRYS+H                ANFT+K YPGSGRLD  GMP IR +V    
Sbjct  334   IERSTSSTKRYSVH----------------ANFTTKGYPGSGRLDRLGMP-IRGEVSGGG  376

Query  1144  SGGLWHRY  1167
              GG W RY
Sbjct  377   GGGYWQRY  384



>ref|XP_002448359.1| hypothetical protein SORBIDRAFT_06g025790 [Sorghum bicolor]
 gb|EES12687.1| hypothetical protein SORBIDRAFT_06g025790 [Sorghum bicolor]
Length=467

 Score =   193 bits (490),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 172/372 (46%), Positives = 221/372 (59%), Gaps = 52/372 (14%)
 Frame = +1

Query  88    REELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSR  267
             REE AAV+IQ+ FR YL+RRAL+AL+ LV+LQALV+G +VR+  A+ LR + ALVR Q+R
Sbjct  119   REEWAAVRIQAAFRGYLARRALKALRGLVKLQALVRGNIVRRQAAETLRCMHALVRVQAR  178

Query  268   ARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKR---R  438
             AR+     S+  H +       HP PPTPEK++Q    R G++     LK N SK     
Sbjct  179   ARACRAIRSQ--HVAA------HPDPPTPEKYDQAGAPRHGRSGS---LKANASKTPGGE  227

Query  439   VIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTG--------KPVFL  594
              +G +E+  S   ++ +D W  E         +DD K+ KILE+DTG        K    
Sbjct  228   RLG-RERSESCGRNW-LDRWVEERY-------MDDEKNAKILEVDTGNKPGRYASKRRGG  278

Query  595   PKHRnlfhsshlslnsDQYSYSLAT-----SKDST-AHQIVHSPSYC-EAQSLSPQNFGQ  753
                 +   S   ++ SDQ S S AT     SKDST A Q V SPS    A++LSP     
Sbjct  279   GGGNHHHQSPCSTMTSDQNSRSYATMPESPSKDSTTAQQSVPSPSSVGMAEALSPLRMPV  338

Query  754   QINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAK  930
              I E C     +SPQF+SA+S+ GSSR GPFTP+KS+ +RS   GYSD+PNYM+ TES +
Sbjct  339   DIAELC-----DSPQFFSATSRPGSSRRGPFTPTKSECSRSLFGGYSDYPNYMANTESFR  393

Query  931   AKMRSLSAPKQRPQYERSSSTKRYSIHGYG-------ELRTNSQRGS-SLQANFTSKAYP  1086
             AK RS SAPKQRPQYE+SSS ++ S H +             +QR S SL A FT+KAYP
Sbjct  394   AKARSQSAPKQRPQYEKSSSLRKASAHAFATGPCAPPSAGAAAQRSSASLHAKFTNKAYP  453

Query  1087  GSGRLDSFGMPV  1122
             GSGRLD  GMPV
Sbjct  454   GSGRLDRLGMPV  465



>ref|XP_009401769.1| PREDICTED: protein IQ-DOMAIN 31-like [Musa acuminata subsp. malaccensis]
Length=481

 Score =   191 bits (486),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 170/361 (47%), Positives = 221/361 (61%), Gaps = 27/361 (7%)
 Frame = +1

Query  82    GIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQ  261
             G REE AAVKIQS FR YL+RRALRAL+ LV+LQALV+G +VRK  A+ LR +QALVR Q
Sbjct  132   GKREESAAVKIQSTFRGYLARRALRALRGLVKLQALVRGNIVRKQAAETLRCMQALVRVQ  191

Query  262   SRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRV  441
             +RAR+     SE     ++       GPPTPEK+EQ +   + ++D +  LKRN SK   
Sbjct  192   ARARACRALRSE--RDGSEKGNRMRAGPPTPEKYEQAVRSSATKSDGSCALKRNSSKHAG  249

Query  442   IGDQEKVRS-NRMDYRMDAWSWEHQGSSRS----GPIDDGKSDKILEIDTGKPVFLPKHR  606
               D+    + N +D  ++   W+ + ++R       IDD K+ KILE+D GKP F  K  
Sbjct  250   ADDRPDTAAWNWLDRWVEERCWDGREAARKTGSFASIDDEKNAKILEVDPGKPQFSHKRS  309

Query  607   nlfhsshlslnsDQYSYSLAT-----SKDSTA-HQIVHSPSYC--EAQSLSPQNFGQQIN  762
             N    S  +L SD  S S  T     SKDSTA  Q + SPS    + Q LS   F  Q+ 
Sbjct  310   NHHQYSCSTLTSDYNSRSFTTVQDSPSKDSTAAQQSIPSPSSVNMQQQCLSSLRFPLQV-  368

Query  763   ESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKM  939
                FC    SPQ+YS+SS+ GS+  GPFTPS  + ++S  SG++D PNYM+ T+S+ AK+
Sbjct  369   -VGFC---GSPQYYSSSSRRGSATKGPFTPSNGEGSQSLFSGFADFPNYMANTQSSTAKL  424

Query  940   RSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMP  1119
             RS SAPKQRP+YE+S S KR S          +Q+ SSL A FT+KAYPGSGRLD  GMP
Sbjct  425   RSHSAPKQRPEYEKSGSLKRSSGA------VAAQKSSSLHAKFTNKAYPGSGRLDRLGMP  478

Query  1120  V  1122
             +
Sbjct  479   L  479



>emb|CAH67037.1| OSIGBa0139P06.10 [Oryza sativa Indica Group]
 emb|CAH67274.1| OSIGBa0111L12.1 [Oryza sativa Indica Group]
 gb|EAY95212.1| hypothetical protein OsI_17031 [Oryza sativa Indica Group]
Length=464

 Score =   186 bits (472),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 167/371 (45%), Positives = 218/371 (59%), Gaps = 40/371 (11%)
 Frame = +1

Query  64    RNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQ  243
             R A     REE AAV+IQ+ FR YL+RRAL+AL+ LV+LQALV+G +VR+  A+ LR + 
Sbjct  114   RCAPAAAKREEYAAVRIQAAFRGYLARRALKALRGLVKLQALVRGNIVRRQAAETLRCMH  173

Query  244   ALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHM---RSGQNDDTIML  414
             ALVR Q RAR+     S+  H S       HPGPPTPEK++Q  H    + G++      
Sbjct  174   ALVRVQRRARACRAIRSQ--HVSA------HPGPPTPEKYDQATHEGVPKHGRSGSLKGS  225

Query  415   KRNLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKP---  585
                      +  +E+  S   ++ +D W  E         +DD K+ KILE+DTGKP   
Sbjct  226   SSKTPGSERL-TRERSESCGRNW-LDKWVEERY-------LDDEKNAKILEVDTGKPGRH  276

Query  586   -VFLPKHRnlfhsshlslnsDQYSYSLAT-----SKDSTAHQ--IVHSPSYCEAQSLSPQ  741
                     +  HSS  S+ S+Q S S AT     SKDST  Q  +   PS   A++LSP 
Sbjct  277   ASRRRSGSHHHHSSCSSMTSEQKSRSYATMPESPSKDSTTAQQSVPSPPSVGMAEALSPL  336

Query  742   NFGQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYT  918
                  I E C     +SPQF+SA+S+ GSSR   FTP+KS+ +RS   GYSD+PNYM+ T
Sbjct  337   RMAVDIAELC-----DSPQFFSATSRPGSSRSRAFTPTKSECSRSLFGGYSDYPNYMANT  391

Query  919   ESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGY--GELRTNSQRGS-SLQANFTSKAYPG  1089
             ES +AK RS SAPKQRPQYE+SSS ++ S H +  G     +QR + SL + FT+KAYPG
Sbjct  392   ESFRAKARSQSAPKQRPQYEKSSSLRKASAHAFGPGSCAPVAQRTTASLHSKFTNKAYPG  451

Query  1090  SGRLDSFGMPV  1122
             SGRLD  GMPV
Sbjct  452   SGRLDRLGMPV  462



>ref|XP_007158468.1| hypothetical protein PHAVU_002G154900g [Phaseolus vulgaris]
 gb|ESW30462.1| hypothetical protein PHAVU_002G154900g [Phaseolus vulgaris]
Length=400

 Score =   184 bits (466),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 148/351 (42%), Positives = 210/351 (60%), Gaps = 54/351 (15%)
 Frame = +1

Query  88    REELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSR  267
             REE AAVKIQ+ FR  L+R+AL ALK LV+LQALV+G + RK T++ L+ +Q L+R Q++
Sbjct  85    REEWAAVKIQAAFRGSLARKALGALKGLVKLQALVRGEIERKRTSEWLQRVQTLLRVQAQ  144

Query  268   ARSGLPKISESPH-SSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTI-MLKRNLSKRRV  441
              R+G  +I   P+ ++  S    H  P  P+KFE  I   S + D +  +LKRN SK R+
Sbjct  145   FRAGRAQILHGPYWNANSSTPLLHVSPAKPDKFESPIRSESMKYDHSPSLLKRNSSKSRM  204

Query  442   IGDQEKVRSNRMDYRMDAWSWEHQGS-SRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfh  618
               ++               SW  + S SR   +D+ +  ++LE D+ KP           
Sbjct  205   QINE---------------SWHQRRSWSRGCSLDEERCFRMLENDSVKP-----------  238

Query  619   sshlslnsDQYSYSLATSKDSTAHQIVHSPSY---CEAQSLSPQNFGQQINESCFCTADN  789
                           + TSK        +SPS+   CE +S SP    +++ E+ +C  +N
Sbjct  239   -------------QMTTSK---GRNQFYSPSHGLVCEVESYSPLKMKEEVEENSWCGGEN  282

Query  790   SPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYS--DHPNYMSYTESAKAKMRSLSAPK  960
             SP+  SASS+ G S+  PFTPSKSD ++S  SGYS  ++P+YM+YTES+ AK+RS SAPK
Sbjct  283   SPRTLSASSRNGGSKRSPFTPSKSDGSKSHGSGYSEPEYPSYMAYTESSMAKVRSASAPK  342

Query  961   QRPQYER-SSSTKRYSI--HGYGELRTNSQRGSSLQANFTSKAYPGSGRLD  1104
             QRPQYER SSS+ RYS+  HG+G+ +  +QR ++L ANFT+KAYPGS RLD
Sbjct  343   QRPQYERSSSSSNRYSVHDHGFGDSKFATQRLAALHANFTNKAYPGSARLD  393



>ref|NP_001053598.1| Os04g0569900 [Oryza sativa Japonica Group]
 emb|CAE75904.1| OSJNBa0088I22.17 [Oryza sativa Japonica Group]
 dbj|BAF15512.1| Os04g0569900 [Oryza sativa Japonica Group]
 gb|EAZ31681.1| hypothetical protein OsJ_15829 [Oryza sativa Japonica Group]
 dbj|BAG94580.1| unnamed protein product [Oryza sativa Japonica Group]
Length=464

 Score =   185 bits (469),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 167/371 (45%), Positives = 218/371 (59%), Gaps = 40/371 (11%)
 Frame = +1

Query  64    RNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQ  243
             R A     REE AAV+IQ+ FR YL+RRAL+AL+ LV+LQALV+G +VR+  A+ LR + 
Sbjct  114   RCAPAAAKREEYAAVRIQAAFRGYLARRALKALRGLVKLQALVRGNIVRRQAAETLRCMH  173

Query  244   ALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHM---RSGQNDDTIML  414
             ALVR Q RAR+     S+  H S       HPGPPTPEK++Q  H    + G++      
Sbjct  174   ALVRVQRRARACRAIRSQ--HVSA------HPGPPTPEKYDQATHEGVPKHGRSGSLKGS  225

Query  415   KRNLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKP---  585
                      +  +E+  S   ++ +D W  E         +DD K+ KILE+DTGKP   
Sbjct  226   SSKTPGSERL-TRERSESCGRNW-LDKWVEERY-------LDDEKNAKILEVDTGKPGRH  276

Query  586   -VFLPKHRnlfhsshlslnsDQYSYSLAT-----SKDSTAHQ--IVHSPSYCEAQSLSPQ  741
                     +  HSS  S+ S+Q S S AT     SKDST  Q  +   PS   A++LSP 
Sbjct  277   ASRRRSGSHHHHSSCSSMTSEQKSRSYATMPESPSKDSTTAQQSVPSPPSVGMAEALSPL  336

Query  742   NFGQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYT  918
                  I E C     +SPQF+SA+S+ GSSR   FTP+KS+ +RS   GYSD+PNYM+ T
Sbjct  337   LMAVDIAELC-----DSPQFFSATSRPGSSRSRAFTPTKSECSRSLFGGYSDYPNYMANT  391

Query  919   ESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGY--GELRTNSQRGS-SLQANFTSKAYPG  1089
             ES +AK RS SAPKQRPQYE+SSS ++ S H +  G     +QR + SL + FT+KAYPG
Sbjct  392   ESFRAKARSQSAPKQRPQYEKSSSLRKASAHAFGPGSCAPVAQRTTASLHSKFTNKAYPG  451

Query  1090  SGRLDSFGMPV  1122
             SGRLD  GMPV
Sbjct  452   SGRLDRLGMPV  462



>ref|XP_004976532.1| PREDICTED: protein IQ-DOMAIN 1-like [Setaria italica]
Length=462

 Score =   183 bits (465),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 161/373 (43%), Positives = 213/373 (57%), Gaps = 42/373 (11%)
 Frame = +1

Query  64    RNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQ  243
             R A   G REE AAV+IQ+ FR YL+RRAL+AL+ LV+LQALV+G +VR+  A+ LR + 
Sbjct  110   RCAPAAGKREEWAAVRIQAAFRGYLARRALKALRGLVKLQALVRGNIVRRQAAETLRCMH  169

Query  244   ALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRN  423
             ALVR Q+RAR+     S+   +        HP PPTPEK++     R G++         
Sbjct  170   ALVRVQARARACRAIRSQQAPA--------HPDPPTPEKYDHAGAPRHGRSGSLKGSSSK  221

Query  424   LSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKH  603
                   +G +E+  S   ++ +D W  E         +DD K+ KILE+D GKP      
Sbjct  222   TPGSERLG-RERSESCGRNW-LDRWVEERF-------MDDEKNAKILEVDNGKPGRHASK  272

Query  604   Rnlfhssh-----lslnsDQYSYSLAT-----SKDSTAHQ--IVHSPSYCEAQSLSPQNF  747
             R     +H      ++ SDQ S S AT     SKDST  Q  +   PS    ++LSP   
Sbjct  273   RRGGGGNHHHSPCSTMTSDQNSRSYATMPESPSKDSTTAQQSVPSPPSVSMGEALSPLRL  332

Query  748   GQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTES  924
                I E C     +SPQF+SA+S+ GSSR GPFTP+KS+ +RS   GYSD+PNYM+ TES
Sbjct  333   PVDIAELC-----DSPQFFSATSRPGSSRRGPFTPTKSECSRSLFGGYSDYPNYMANTES  387

Query  925   AKAKMRSLSAPKQRPQYERSSSTKR------YSIHGYGEL-RTNSQRGSSLQANFTSKAY  1083
              +AK RS SAPKQRPQYE+SSS ++      ++   Y        +  +SL A FT+KAY
Sbjct  388   FRAKARSQSAPKQRPQYEKSSSLRKASAANAFATGPYAPTAAAAQRSAASLHAKFTNKAY  447

Query  1084  PGSGRLDSFGMPV  1122
             PGSGRLD  GMPV
Sbjct  448   PGSGRLDRLGMPV  460



>dbj|BAJ88194.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=465

 Score =   179 bits (453),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 161/366 (44%), Positives = 204/366 (56%), Gaps = 42/366 (11%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             EE AAV+IQ+ FR YL+RRAL+AL+ LV+LQALV+G +VR+  A+ LR +QALV  QSRA
Sbjct  118   EEWAAVRIQAAFRGYLARRALKALRGLVKLQALVRGNIVRRQAAETLRCMQALVSVQSRA  177

Query  271   RSGLPKISESPHSSTKSVQFQ-HPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIG  447
             R+           +T+S Q   HPG  TPEK+EQ  +    ++  +  LK   SK     
Sbjct  178   RA---------SRATRSRQAAAHPGATTPEKYEQAAYDGPLRHGRSGSLKGGSSKTPGSE  228

Query  448   DQEKVRSNRMDYR-MDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPV--FLPKHRnlf-  615
                + RS       +D W  E         +DD K+ KILE+D GKP      K R    
Sbjct  229   RMSRERSESCGRNWLDRWVEERY-------MDDEKNAKILEVDPGKPGRHAASKRRGSGG  281

Query  616   ----hsshlslnsDQYSYSLATSKDS------TAHQIVHSPSYC-----EAQSLSPQNFG  750
                  SS  +  S+Q S S AT  DS      TA Q V SPS         ++LSP    
Sbjct  282   GHHHQSSCSTRTSEQNSRSYATMPDSPSRDSTTAQQSVPSPSSVGMGMGAGEALSPLRMP  341

Query  751   QQINESCFCTADNSPQFYSASSKGGSSRVGPF-TPSKSD-ARSCLSGYSDHPNYMSYTES  924
                    +     SPQF+SA+S+ GSS+ G F TP+KS+ ARS   GYSD+PNYMS TES
Sbjct  342   ADTAAELY----ESPQFFSATSRPGSSKRGAFFTPTKSECARSLFGGYSDYPNYMSNTES  397

Query  925   AKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLD  1104
              +AK RS SAPKQRP YE+S S ++ S H +       +  SSL A FT+KAYPGSGRLD
Sbjct  398   FRAKARSQSAPKQRPLYEKSGSLRKASAHAFAPGAAGQRSSSSLHAKFTNKAYPGSGRLD  457

Query  1105  SFGMPV  1122
               GMPV
Sbjct  458   RLGMPV  463



>ref|XP_006653689.1| PREDICTED: protein IQ-DOMAIN 14-like [Oryza brachyantha]
Length=418

 Score =   174 bits (442),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 140/329 (43%), Positives = 182/329 (55%), Gaps = 40/329 (12%)
 Frame = +1

Query  190   VKGYLVRKHTADMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQ  369
             V+G +VR+  A+ LR + ALVR Q RAR+     S+  H +       HPGPPTPEK++Q
Sbjct  110   VRGNIVRRQAAETLRCMHALVRVQRRARACRAIRSQ--HVAA------HPGPPTPEKYDQ  161

Query  370   VIH---MRSGQNDDTIMLKRNLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPID  540
               H    R G++               +  +E+  S   ++ +D W  E         +D
Sbjct  162   AAHDSVPRHGRSGSLKGSSSKTPGSERL-SRERSESCGRNW-LDKWVEERY-------LD  212

Query  541   DGKSDKILEIDTGKPVFLPKHRnlfhsshlslns----DQYSYSLAT-----SKDSTAHQ  693
             D K+ KILE+DTGKP      R      H S  S    +Q S S AT     SKDST  Q
Sbjct  213   DEKNAKILEVDTGKPGRHASRRRSGSQHHHSSCSSMTSEQKSRSYATMPESPSKDSTTAQ  272

Query  694   --IVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-  864
               +   PS   A++LSP      I E C     +SPQF+SA+S+ GSSR   FTP+KS+ 
Sbjct  273   QSVPSPPSVGMAEALSPLRMPIDIAELC-----DSPQFFSATSRPGSSRSRAFTPTKSEC  327

Query  865   ARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGY--GELRTNS  1038
             +RS   GYSD+PNYM+ TES +AK RS SAPKQRPQYE+SSS ++ S H +  G     +
Sbjct  328   SRSLFGGYSDYPNYMANTESFRAKARSQSAPKQRPQYEKSSSLRKASAHAFGPGSCAPAA  387

Query  1039  QRGS-SLQANFTSKAYPGSGRLDSFGMPV  1122
             QR + SL   FT+KAYPGSGRLD  GMPV
Sbjct  388   QRTTASLHTKFTNKAYPGSGRLDRLGMPV  416



>ref|XP_002318230.2| hypothetical protein POPTR_0012s13350g [Populus trichocarpa]
 gb|EEE96450.2| hypothetical protein POPTR_0012s13350g [Populus trichocarpa]
Length=455

 Score =   174 bits (442),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 147/359 (41%), Positives = 214/359 (60%), Gaps = 15/359 (4%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             EE++AVKIQS FR YL+RRALRALKALV+LQALV+G++VRK TADMLR +Q LVR Q+RA
Sbjct  99    EEVSAVKIQSAFRGYLARRALRALKALVKLQALVRGHIVRKQTADMLRRMQTLVRLQARA  158

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKR---NLSKRRV  441
             R+    +S+S H++ KS   ++  P +P K + +  + S + D   +LKR   N + R  
Sbjct  159   RASRSYVSDSSHTTGKSSHSRYAVPASPSK-DHLFRVSSTKFDGPSILKRCGSNANFRES  217

Query  442   IG-DQEKVRSNRMDYRMDAWSWEHQGSS--RSGPIDDGKSDKILEIDTGKPVFLPKHRnl  612
             I  D+ K  SN +D  M+       GS+  RS   DD KSDKILE+DT KP    +  N 
Sbjct  218   IDFDKVKWGSNWLDRWMEESFLNDHGSNPPRSRNADDEKSDKILEVDTWKPHVKSQQSNR  277

Query  613   fhsshlslnsDQYSYSLATSKDSTAHQIVHS----PSYCEAQSLSPQNFGQQINESCFCT  780
                +     +  ++     + DS +          PS    + L         +E+ + T
Sbjct  278   TFQTSQHALASDHNNQSFMTFDSMSKLSKKEPNPMPSISSGEILQSLKLPLGNDEAVYRT  337

Query  781   ADNSPQFYSASSKGGSS--RVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLS  951
             A+NSP+ +SA+S+ GSS  R GPFTP++S+ +    +GYS +PNYM+ TES++AK+RS S
Sbjct  338   AENSPRMFSATSRPGSSGRRGGPFTPTRSECSWGFFNGYSGYPNYMANTESSRAKVRSQS  397

Query  952   APKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPVIR  1128
             AP+QR ++E+  S++R S+ GY +  T S+RG +      +KAY  SG L+  G   +R
Sbjct  398   APRQRLEFEKYGSSRR-SVQGYSDSETRSERGFAQNTELQNKAYVASGYLNRLGTSDLR  455



>ref|XP_006857873.1| hypothetical protein AMTR_s00069p00100460 [Amborella trichopoda]
 gb|ERN19340.1| hypothetical protein AMTR_s00069p00100460 [Amborella trichopoda]
Length=463

 Score =   169 bits (429),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 158/368 (43%), Positives = 204/368 (55%), Gaps = 59/368 (16%)
 Frame = +1

Query  88    REELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSR  267
             RE+ AAVKIQS FRAYL+RRALRALK LV+LQALV+G++VRK   + LR +QALVR Q+R
Sbjct  130   REDWAAVKIQSAFRAYLARRALRALKGLVKLQALVRGHIVRKQAFETLRCMQALVRVQAR  189

Query  268   ARSGLPKISES---PHSSTKSV-QFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKR  435
             AR+G    SE+   PHSS  S   F   GP TP+K E  +     + +  + LKRN SK 
Sbjct  190   ARAGRLHASEATHPPHSSQPSKPTF---GPATPDKQESRMQRNLSKRERMVPLKRNASKP  246

Query  436   RVIGD--QEKVRSNRM--DYRMD-------AWSWEHQGSSRSGPI--DDGKSDKILEIDT  576
                GD  Q+ +    M  D  MD       A S E   S+R+     DD  SDKILEID 
Sbjct  247   -SSGDIGQDGMHPGWMWLDRWMDGGRSIDHAPSTETARSARTAKTTHDDDHSDKILEIDP  305

Query  577   GKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQI-VHSPSYCEAQSLSPQNFGQ  753
             GKP   P             + D  +  L+ S  S + ++ +HSP       LSP     
Sbjct  306   GKPGLSP-------------SKDSTTAQLSISSASPSVRMPLHSP-------LSPLRVRY  345

Query  754   QINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSDARSCLSGYSD-----HPNYMSYT  918
             +  +  + TA+NSPQ YSASS     + GPF P+KS+      GY D      PNYM+ T
Sbjct  346   EEEDCIYGTAENSPQLYSASSSMHGLKRGPFAPAKSEGSGVGQGYFDGYYWNFPNYMANT  405

Query  919   ESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGR  1098
             ES++AK RS SAP+QRP+ E+  S ++            S+ G   +A FTSKAYPGSGR
Sbjct  406   ESSRAKARSQSAPRQRPECEKVGSLQK------------SEHGDGCKARFTSKAYPGSGR  453

Query  1099  LDSFGMPV  1122
             L+  GMP+
Sbjct  454   LNRLGMPI  461



>ref|XP_010555545.1| PREDICTED: protein IQ-DOMAIN 14, partial [Tarenaya hassleriana]
Length=343

 Score =   166 bits (421),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 149/351 (42%), Positives = 189/351 (54%), Gaps = 65/351 (19%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             E+LAA+KIQS FR YL+RRALRALK LV+LQA+V+G++ RK  A  LR +QALVR+QSR 
Sbjct  47    EDLAAIKIQSAFRGYLARRALRALKGLVKLQAMVRGHIERKRAAVHLRRMQALVRSQSRL  106

Query  271   RSG--LPKISESPHSSTKSVQF-QHPGPPTPEKFEQVIHMRSGQNDDT--IMLKRNLSKR  435
             RS   L   S S  S+ KS  F   PGPPTPEK E  I  RS   D +  + L+RN SK 
Sbjct  107   RSARALGSESSSSLSNPKSSHFPSQPGPPTPEKLEHSIRSRSANYDQSHVLRLQRNGSK-  165

Query  436   RVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlf  615
                                                   SDKILE+D        KH    
Sbjct  166   -------------------------------------TSDKILEVDNSA-----KHHTHT  183

Query  616   hsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSP  795
                     S    ++ +    ++   I+  P        SP +  ++   S FCTA+NSP
Sbjct  184   KRRPNIFYSTHLVFNSSDRCPASTEPILARP-------FSPTSSHEEEVNSHFCTAENSP  236

Query  796   QFYSASSKGGSSRVGPFTPSKSDARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQ-  972
             Q YSA+S  G     PF  S + + S  S ++DHPN+MSYTES++AK+RS SAPKQR Q 
Sbjct  237   QLYSATSSRGIR--SPFASSTAQSVSMRSCFADHPNFMSYTESSRAKVRSASAPKQRLQS  294

Query  973   -YERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
              YERS+S KR       + +   QRGS+L  +F +KAYPGSGRLD FGMPV
Sbjct  295   HYERSASAKR------CDTKLGPQRGSALHTSFMNKAYPGSGRLDRFGMPV  339



>ref|XP_007038616.1| IQ-domain 24, putative [Theobroma cacao]
 gb|EOY23117.1| IQ-domain 24, putative [Theobroma cacao]
Length=458

 Score =   169 bits (428),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 147/356 (41%), Positives = 209/356 (59%), Gaps = 14/356 (4%)
 Frame = +1

Query  85    IREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQS  264
             + +E+AAVK+QS FR YL+RRALRALKALV+LQALV+G++VRK TADMLR +Q LVR Q+
Sbjct  98    LAQEMAAVKMQSAFRGYLARRALRALKALVKLQALVRGHIVRKQTADMLRRMQTLVRLQA  157

Query  265   RARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRV-  441
             RAR+    +++S  S+ K  Q ++  P +  K E  +   S + D   +LKR  S   + 
Sbjct  158   RARASRAYVTKSFDSAGKMSQSRNAVPASSVKDECQLRAYSTKFDGPSILKRCGSNSNLG  217

Query  442   -IGDQEKVR--SNRMDYRMDAWSWEHQGSS--RSGPIDDGKSDKILEIDTGKPVFLPKHR  606
              I D EK R  SN +D  M+   W +      R G +DD KSDKILE+DT KP    +  
Sbjct  218   DIIDLEKARMGSNWLDRWMEESLWNNNRDVPLRHGHVDDEKSDKILEVDTWKPHLNTQQS  277

Query  607   nlfhsshlslnsDQYSYSLAT-----SKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESC  771
             N    +    ++  Y++S  T          A   + + +  E  +LS   +    +E+ 
Sbjct  278   NRNFRASQHGSAWDYNHSFMTYDSPRKLSGKASNPLPNLTSAEVLALSSLKYPGGKDEAV  337

Query  772   FCTADNSPQFYSASSKGGSS-RVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRS  945
               TADNSPQ  SASS+ GSS R  PFTP++S+ +   LSG S HPNYM+ TES++AK RS
Sbjct  338   LRTADNSPQVLSASSRPGSSARRSPFTPARSECSWGYLSGCSGHPNYMANTESSRAKYRS  397

Query  946   LSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFG  1113
              SAP+QR ++++  ST+R +  G  +  TNS+R      +F  + +P SG L+  G
Sbjct  398   QSAPRQRLEFDKYGSTRR-TFQGLWDSGTNSERDFPQHVDFRYRVHPASGGLNRLG  452



>ref|XP_008663478.1| PREDICTED: protein IQ-DOMAIN 1-like [Zea mays]
 gb|AFW59152.1| hypothetical protein ZEAMMB73_954204 [Zea mays]
Length=465

 Score =   167 bits (424),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 166/371 (45%), Positives = 217/371 (58%), Gaps = 54/371 (15%)
 Frame = +1

Query  88    REELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSR  267
             RE+ AAV+IQ+ FR YL+RRAL+AL+ LV+LQALV+G +VR+  A+ LR + ALVR Q+R
Sbjct  121   REQWAAVRIQAAFRGYLARRALKALRGLVKLQALVRGNIVRRQAAETLRCMHALVRVQAR  180

Query  268   ARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIG  447
             AR+     S+  H +       HP PPTPEK+EQ    R G++     LK N S  R  G
Sbjct  181   ARACRAIRSQ--HVTA------HPDPPTPEKYEQAGAPRHGRSGS---LKANSS--RTPG  227

Query  448   DQ----EKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPV--FLPKHRn  609
              +    E+  S   ++ +D W  E         +DD K+ KILE+D GKP   +  K R 
Sbjct  228   GERLGRERSESCGRNW-LDRWVEERY-------MDDEKNAKILEVDNGKPRRRYASKRRG  279

Query  610   lfhss---------hlslnsDQYSYSLAT-----SKDST-AHQIVHSPSYC--EAQSLSP  738
                 +           ++ S+Q S S AT     SKDST A Q V SP+      ++LSP
Sbjct  280   GGGGNHHHHHQSPCSTTMGSEQNSRSYATMAESPSKDSTTAQQSVPSPASVGMAEEALSP  339

Query  739   QNFGQQINESCFCTADNSPQFYSA-SSKGGSSRVGPFTPS-KSD-ARSCLSGYSDHPNYM  909
                    + +  C   +SPQF+SA SS+ GSSR GPFTP+ KS+ +RS   GYSD+PNYM
Sbjct  340   LRVPVPADVAELC---DSPQFFSATSSRPGSSRRGPFTPTAKSECSRSLFGGYSDYPNYM  396

Query  910   SYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPG  1089
             + TES +AK RS SAPKQRPQYERSSS +R S        + +   SSL A FT+KAYPG
Sbjct  397   ANTESFRAKARSQSAPKQRPQYERSSSLRRASAAQR----SAAAAASSLHAKFTNKAYPG  452

Query  1090  SGRLDSFGMPV  1122
             SGRLD  G+P 
Sbjct  453   SGRLDRLGLPA  463



>ref|XP_011030086.1| PREDICTED: protein IQ-DOMAIN 14 isoform X2 [Populus euphratica]
Length=449

 Score =   166 bits (421),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 143/356 (40%), Positives = 214/356 (60%), Gaps = 20/356 (6%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             EE++AVKIQS FR YL+RRALRALKALV+LQALV+G++VRK TADMLR +Q LVR Q+RA
Sbjct  104   EEVSAVKIQSAFRGYLARRALRALKALVKLQALVRGHIVRKQTADMLRRMQTLVRLQARA  163

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLS----KRR  438
             R+    +S+S +++ KS   ++  P +P K + +  + S + D   +LKR  S    +  
Sbjct  164   RASRSYVSDSSYTTGKSSHSRYAVPASPSK-DHLSRVSSTKFDGPSILKRCGSYSNFRES  222

Query  439   VIGDQEKVRSNRMDYRMDAWSWEHQGSS--RSGPIDDGKSDKILEIDTGKPVFLPKHRnl  612
             +  D+ K+ SN +D  M+       GS+  RS   DD KSDKILE+DT KP         
Sbjct  223   IDFDKVKLGSNWLDRWMEESFLNDHGSNPPRSRNADDEKSDKILEVDTWKP--------H  274

Query  613   fhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQ-NFGQQINESCFCTADN  789
               S   +       ++LA+  ++ +     S S    +  +P  +     +E+ + TA+N
Sbjct  275   VKSQQSNRTFQTSQHALASDHNNQSFMTFDSMSKLSKKEPNPMPSIPSGNDEAVYKTAEN  334

Query  790   SPQFYSASSKGGSS--RVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSAPK  960
             SP+ +SA+S+ GSS  R GPFTP++S+ +    +GYS +PNYM+ TES++AK+RS SAP+
Sbjct  335   SPRMFSATSRPGSSGRRGGPFTPTRSECSWGFFNGYSGYPNYMANTESSRAKVRSQSAPR  394

Query  961   QRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPVIR  1128
             QR ++E+  S++R S+  Y +  T S+RG +      +KAY  SG L+  G    R
Sbjct  395   QRLEFEKYGSSRR-SVQEYSDSETPSERGFAQITELQNKAYVASGYLNRLGTSDFR  449



>ref|XP_010107408.1| Protein IQ-DOMAIN 14 [Morus notabilis]
 gb|EXC15946.1| Protein IQ-DOMAIN 14 [Morus notabilis]
Length=467

 Score =   166 bits (420),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 149/361 (41%), Positives = 210/361 (58%), Gaps = 18/361 (5%)
 Frame = +1

Query  97    LAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRARS  276
             +AA+KIQS FR YL+RRALRALKALV+LQALV+G++VRK T+DMLR +Q LVR Q+RAR+
Sbjct  108   VAAIKIQSAFRGYLARRALRALKALVKLQALVRGHIVRKQTSDMLRRMQTLVRVQARARA  167

Query  277   GLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKR---NLSKRRVIG  447
                 +SE  HS +KS   +HP P  P+K        S + D   +LKR   N + R V+ 
Sbjct  168   NRTHVSEPLHSFSKSSLPKHPFPENPDKNRHQQRAYSSKYDGPSILKRCGSNSNFRDVVN  227

Query  448   -DQEKVRSNRMDYRMDAWSWEH-QGSS-RSGP--IDDGKSDKILEIDTGKPVFLPKHRnl  612
              D+ +  SN +D  M+   W + QGSS R GP   DD K+DKILE+DT KP    +    
Sbjct  228   LDKTRTGSNWLDRWMEESVWNNCQGSSMRYGPSHADDEKNDKILEVDTWKPHLDSQRSTR  287

Query  613   fhsshlslnsDQYSYSLATSKDSTAHQIVHS----PSYCEAQSLSPQNFGQQI--NESCF  774
                    + + +Y      + DS + + + +    P+    ++ S  +F   I  +E   
Sbjct  288   TFQMPRHVLASEYQNRSFAAFDSPSKRSIKAPNPEPNMSSIKAFSLNHFKHPIEKDEGDG  347

Query  775   CTADNSPQFY--SASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRS  945
              TA NSPQ +  S+     S+R GPFTP+K++ +    SGYS HPNYM+ TES++AK+RS
Sbjct  348   RTAGNSPQTFSASSRPGSSSARRGPFTPAKTERSWGYFSGYSGHPNYMANTESSRAKVRS  407

Query  946   LSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPVI  1125
              SAP+QR ++E+  +TKR S   Y +  T+S   + L AN    AYP    +D FG   +
Sbjct  408   QSAPRQRLEFEKYGTTKR-SAQEYWDGWTHSDTNTILDANSRRSAYPSFNHMDKFGSASL  466

Query  1126  R  1128
             R
Sbjct  467   R  467



>gb|KDP22315.1| hypothetical protein JCGZ_26146 [Jatropha curcas]
Length=462

 Score =   166 bits (419),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 150/352 (43%), Positives = 207/352 (59%), Gaps = 27/352 (8%)
 Frame = +1

Query  94    ELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRAR  273
             E+AA+KIQS FR YL+RRALRALKALV+LQALV+G++VRK TADMLR +Q LVR Q+RAR
Sbjct  113   EVAAIKIQSAFRGYLARRALRALKALVKLQALVRGHIVRKQTADMLRRMQTLVRLQARAR  172

Query  274   SGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGDQ  453
             +    I E  HS++KS Q  H    +  K + ++H  S + D   +LKR  S      D+
Sbjct  173   ANRTHIPELRHSTSKSSQSHHTVTTSHVK-DHLLHDYSTKFDGPSILKRCGSNSN-FRDE  230

Query  454   EKVRSNRMDYRMDAWSWEHQGS--SRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhssh  627
              K+ SN +D+ MD   W   GS   RS   DD KSDKILE+DT KP           S  
Sbjct  231   SKLGSNWLDHWMDESFWNKHGSIPMRSHLADDEKSDKILEVDTWKP--------HMKSQQ  282

Query  628   lslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQI-----------NESCF  774
                      + LA+  +S +     SPS    Q +   + G+ +           +E+ F
Sbjct  283   SIRAFQTLQHGLASENNSQSFTTFESPSKATNQ-MPNVSSGEVLLVNTLKVPLGKDEAAF  341

Query  775   CTADNSPQ-FYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSL  948
              T +NS   F  +S  G S R GPFTP++S+ A    +GYS +PNYM+ TES +AK+RS 
Sbjct  342   RTVENSSNAFSPSSRPGSSGRRGPFTPTRSECAWGFFNGYSGYPNYMANTESFRAKVRSQ  401

Query  949   SAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLD  1104
             SAP+QR ++E+ +S+KR S  G+ +  T S+RG + Q NF ++AYP SGR++
Sbjct  402   SAPRQRLEFEKYNSSKR-SGQGFFDADTISERGFAQQPNFRNRAYPASGRMN  452



>ref|XP_002510825.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51427.1| conserved hypothetical protein [Ricinus communis]
Length=473

 Score =   165 bits (418),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 156/354 (44%), Positives = 217/354 (61%), Gaps = 19/354 (5%)
 Frame = +1

Query  94    ELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRAR  273
             E+AAVKIQS FR YL+RRALRALKALV+LQALV+G++VRK TADMLR +Q LVR Q+RAR
Sbjct  115   EVAAVKIQSAFRGYLARRALRALKALVKLQALVRGHIVRKQTADMLRRMQTLVRVQARAR  174

Query  274   SGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKR-----NLSKRR  438
             +    +SES H++ KS    +  P +P K +  +   + + D   +LKR     N     
Sbjct  175   ASRSHVSESFHTTRKSSLPHNTVPASPHK-DYHLQGYNTKFDGPSILKRCGSNSNFRDIN  233

Query  439   VIG-DQEKVRSNRMDYRMDAWSWEHQGS--SRSGPIDDGKSDKILEIDTGKPVFLPKHRn  609
             V+  D+ K+ +N +++ M+   + + GS   R    DD +SDKILE+DT KP    +   
Sbjct  234   VMHLDEAKLGANWLEHWMEESFYNNHGSIPMRKQHADDERSDKILEVDTWKPHMKSQSVG  293

Query  610   lfhsshlslnsDQYSYSLAT----SKDST--AHQIVHSPSYCEAQSLSPQNFGQQINESC  771
              F  S   L S+  + SL T    SK ST   +Q+   PS  E  SL+   F    +E+ 
Sbjct  294   TFQMSQDVLASEYKNQSLTTFDSPSKSSTKAINQMPTVPS-GEVLSLNSLKFPLGKDEAV  352

Query  772   FCTADNSPQ-FYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRS  945
               T +NSP  F  +S  G S R G FTP++S+ +    +GYS +PNYM+ TES +AK+RS
Sbjct  353   LRTVENSPHVFSPSSRPGSSGRRGTFTPTRSECSWGFFNGYSGYPNYMANTESFRAKVRS  412

Query  946   LSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDS  1107
              SAP+QR ++E+ SS+KR S+ G+ E  T S+RG + Q NF +KAYP SGRL+S
Sbjct  413   QSAPRQRLEFEKYSSSKR-SVQGFYEADTISERGFAQQTNFRNKAYPVSGRLNS  465



>ref|XP_003580351.1| PREDICTED: protein IQ-DOMAIN 1 isoform X2 [Brachypodium distachyon]
Length=451

 Score =   164 bits (416),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 159/369 (43%), Positives = 205/369 (56%), Gaps = 58/369 (16%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             EE AAV+IQ+ FR YL+RRAL+AL+ LV+LQALV+G +VR+  A+ LR +QALV  Q+RA
Sbjct  114   EEWAAVRIQAAFRGYLARRALKALRGLVKLQALVRGNIVRRQAAETLRCMQALVNVQARA  173

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVI-------HMRSGQNDDTIMLKRNLS  429
                      S H++       HP P TPEK+EQ         H R G +    +  R   
Sbjct  174   -------VRSRHAAA------HPVPTTPEKYEQAAYDGAAPRHGRPGSSKGGSI--RTPG  218

Query  430   KRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTG-KPVFLPKHR  606
               R+   +E+  S   ++ +D W  E         +DD K+ KILE+D G KP      R
Sbjct  219   GERL--SRERSESCGRNW-LDRWVEERY-------MDDEKNAKILEVDPGGKPGRHASKR  268

Query  607   nlfhssh-------lslnsDQYSYSLAT-----SKDSTAHQ--IVHSPSYCEAQSLSPQN  744
                  S         +  SDQ S S AT     SKDST  Q  +   PS    ++LSP  
Sbjct  269   RGGSGSGNHLQSSCSTRTSDQNSRSYATMPDSPSKDSTTAQQSVPSPPSVGMREALSPLR  328

Query  745   FGQQINESCFCTADNSPQFYSASSKGGSS-RVGPFTPSKSD-ARSCLSGYSDHPNYMSYT  918
                 + E       +SPQF+SA+S+ GSS R G FTP+KS+ ARS   GYSD+PNYM+ T
Sbjct  329   MPVDMAELY-----DSPQFFSATSRPGSSKRGGAFTPTKSECARSLFGGYSDYPNYMANT  383

Query  919   ESAKAKMRSLSAPKQRP-QYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSG  1095
             ES +AK RS SAPKQRP QYE+S S ++      G  +   QR +SL A FT+KAYPGSG
Sbjct  384   ESFRAKARSQSAPKQRPQQYEKSGSLRKGFAFAPGPAQ---QRAASLHAKFTNKAYPGSG  440

Query  1096  RLDSFGMPV  1122
             RLD  GMPV
Sbjct  441   RLDRLGMPV  449



>ref|XP_002869792.1| IQ-domain 22 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46051.1| IQ-domain 22 [Arabidopsis lyrata subsp. lyrata]
Length=482

 Score =   165 bits (417),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 197/356 (55%), Gaps = 51/356 (14%)
 Frame = +1

Query  88    REELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSR  267
             REELA +KIQS FR YL++RALRALK LVRLQA+V+G++ RK  +  LR + ALVRAQ+R
Sbjct  163   REELAVIKIQSTFRGYLAKRALRALKGLVRLQAIVRGHIERKRMSVHLRRMHALVRAQAR  222

Query  268   ARSG----LPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKR  435
              R+      P+ S S  ++TKS QFQ+PGPPTPEK E  I  RS +   + + KRN SK 
Sbjct  223   VRATRVIVTPESSSSQSNNTKSSQFQNPGPPTPEKLEHSISSRSSKLGHSHLFKRNGSK-  281

Query  436   RVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlf  615
                 D  ++ +                + R       + +KIL+ID          R   
Sbjct  282   --ASDNNRLYT----------------AHRETFSATDEEEKILQID----------RKHI  313

Query  616   hsshlslnsDQ-YSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNS  792
              S       D  YS  L       +  +  +P        SP +  ++I  S FCTA+NS
Sbjct  314   SSYTRRSRPDMFYSSHLILDNGGLSEPVFATP-------FSPSSSHEEIT-SQFCTAENS  365

Query  793   PQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRP  969
             PQ YS +S+   S     + + SD  +SC  G  DHP+YM+ TES++AK RS SAPK RP
Sbjct  366   PQLYSGTSRSKRSAFTASSIAPSDCTKSCCDG--DHPSYMACTESSRAKARSASAPKSRP  423

Query  970   Q--YERSSSTKRYSIHGY---GELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
             Q  YER+SS KR+        G+ ++  Q+GS+L  +F +KAYPGSGRLD  GMP+
Sbjct  424   QLYYERASS-KRFGFVDVPYCGDTKSGPQKGSALHTSFMNKAYPGSGRLDRLGMPI  478



>emb|CDP05236.1| unnamed protein product [Coffea canephora]
Length=512

 Score =   165 bits (418),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 166/403 (41%), Positives = 220/403 (55%), Gaps = 33/403 (8%)
 Frame = +1

Query  4     RSTSAAAWCGSTVNSTACINRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlq  183
             R TSA+   G T  + +   + + G   R+E+AAVKIQS FRAYL+RRALRALK LV+LQ
Sbjct  116   RLTSASTSAGGT-RTVSFTPQGSSGRDWRQEVAAVKIQSAFRAYLARRALRALKGLVKLQ  174

Query  184   alVKGYLVRKHTADMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKF  363
             ALV+G++VRK +ADMLR +QA+ R Q+RA +     S+S H+  K+ Q  H   P P+K 
Sbjct  175   ALVRGHIVRKQSADMLRRMQAMARIQARASATRANTSDSSHAHMKASQHCHADTPAPKKH  234

Query  364   EQVIHMRS-GQNDDTIMLKRNLSKRRVIGDQEKVR-----SNRMDYRMDAWSWEHQGSSR  525
             +  I  RS     +   LKR +SK   I +  KV      S+ +D  M+  +W +Q  S 
Sbjct  235   D--IPQRSYSTKHEGPELKRWVSKPN-ISNSIKVEGLHLGSSWLDRWMEECTWNNQNGSC  291

Query  526   SGPI--DDGKSDKILEIDTGKPVFLPKH-----------RnlfhsshlslnsDQYSYSLA  666
                +  DD KS KILEIDT KP   P+            R    +       D  S  LA
Sbjct  292   LNNVSRDDEKSIKILEIDTWKPHHNPRQSEKIFQASQGFRAWNDNGQSVTTFDPIS-GLA  350

Query  667   TSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYSASSK-GGSSRVGP  843
             T  +     +    S  E  +L    F  Q       TADNSP  +SASS+ G SSR GP
Sbjct  351   TKLEKPNPSV----SSGEVPNLRSLKFHPQEEHVLAWTADNSPCLHSASSRPGTSSRRGP  406

Query  844   FTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYG  1020
             FTPS+S+ +RS    Y  HP+YM+ TES+ AK+RS SAP+QR QYER  +  ++ +    
Sbjct  407   FTPSRSECSRSVYGDYLSHPSYMANTESSLAKVRSQSAPRQRTQYERLGANWKF-VPSLW  465

Query  1021  ELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPVIRDQVGFSG  1149
             +  T S+RG+   +N  SKAY  SG LD  GM V  D V FS 
Sbjct  466   DAETVSERGTP-HSNLRSKAYHSSG-LDRVGMRVHGDNVDFSA  506



>ref|XP_009393924.1| PREDICTED: protein IQ-DOMAIN 1-like [Musa acuminata subsp. malaccensis]
Length=445

 Score =   164 bits (414),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 161/376 (43%), Positives = 204/376 (54%), Gaps = 69/376 (18%)
 Frame = +1

Query  64    RNAGGY-----GIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADM  228
             R+A G+     G REE AA+KIQ+ FR YL+RRAL+ALK LV+LQALV+G +VRK  A+ 
Sbjct  114   RSAVGFSLAAAGKREEGAAIKIQAVFRGYLARRALKALKGLVKLQALVRGNIVRKQAAET  173

Query  229   LRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVI--HMRSGQ---  393
             LR +QALVR Q+RAR+     SE                    KFE+    H R      
Sbjct  174   LRCMQALVRVQARARACRVLRSER------------------SKFEKAPSGHSRGSSRPA  215

Query  394   NDDTIMLKRNLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRS----GPIDDGKSDKI  561
             + D    +R  S             N +D  M+   W+ + S +       +DD K+ KI
Sbjct  216   SSDAAHRERATS----------AGWNWLDRWMEERYWDSRESVKKAGHGASMDDDKNAKI  265

Query  562   LEIDTGKPVFLPKHRnlfhssh-lslnsDQYSYSLATSKDS------TAHQIVHSPSYCE  720
             LE+D GKP F  K RN  + S   +L SDQ S+S  T  DS       A   V S S  E
Sbjct  266   LEVDPGKPQFHHKRRNTHNHSSCSTLTSDQNSHSFVTVPDSPSVESTAAQHFVPSSSSVE  325

Query  721   A-QSLSPQNFGQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSD  894
               QS+    F  +  E        SPQFYSASS+ GSSR GPFTPSKSD +RS  SGYSD
Sbjct  326   MQQSVGHLRFPFEAGE-----YGESPQFYSASSRPGSSRKGPFTPSKSDCSRSLFSGYSD  380

Query  895   HPNYMSYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTS  1074
             +PNYM+ TES++AK+RS SAPKQRP            ++  G     +QR SSL A  ++
Sbjct  381   YPNYMANTESSRAKVRSHSAPKQRPD----------RLNPLGPF---AQRSSSLHAKSSN  427

Query  1075  KAYPGSGRLDSFGMPV  1122
             KAYPGSGRLD  G+P+
Sbjct  428   KAYPGSGRLDRLGLPI  443



>ref|XP_011030085.1| PREDICTED: protein IQ-DOMAIN 14 isoform X1 [Populus euphratica]
Length=460

 Score =   164 bits (414),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 143/359 (40%), Positives = 212/359 (59%), Gaps = 15/359 (4%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             EE++AVKIQS FR YL+RRALRALKALV+LQALV+G++VRK TADMLR +Q LVR Q+RA
Sbjct  104   EEVSAVKIQSAFRGYLARRALRALKALVKLQALVRGHIVRKQTADMLRRMQTLVRLQARA  163

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLS----KRR  438
             R+    +S+S +++ KS   ++  P +P K + +  + S + D   +LKR  S    +  
Sbjct  164   RASRSYVSDSSYTTGKSSHSRYAVPASPSK-DHLSRVSSTKFDGPSILKRCGSYSNFRES  222

Query  439   VIGDQEKVRSNRMDYRMDAWSWEHQGSS--RSGPIDDGKSDKILEIDTGKPVFLPKHRnl  612
             +  D+ K+ SN +D  M+       GS+  RS   DD KSDKILE+DT KP    +  N 
Sbjct  223   IDFDKVKLGSNWLDRWMEESFLNDHGSNPPRSRNADDEKSDKILEVDTWKPHVKSQQSNR  282

Query  613   fhsshlslnsDQYSYSLATSKDSTAHQIVHSP----SYCEAQSLSPQNFGQQINESCFCT  780
                +     +  ++     + DS +      P    S    + L         +E+ + T
Sbjct  283   TFQTSQHALASDHNNQSFMTFDSMSKLSKKEPNPMPSIPSGEILQSLKLPLGNDEAVYKT  342

Query  781   ADNSPQFYSASSKGGSS--RVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLS  951
             A+NSP+ +SA+S+ GSS  R GPFTP++S+ +    +GYS +PNYM+ TES++AK+RS S
Sbjct  343   AENSPRMFSATSRPGSSGRRGGPFTPTRSECSWGFFNGYSGYPNYMANTESSRAKVRSQS  402

Query  952   APKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPVIR  1128
             AP+QR ++E+  S++R S+  Y +  T S+RG +      +KAY  SG L+  G    R
Sbjct  403   APRQRLEFEKYGSSRR-SVQEYSDSETPSERGFAQITELQNKAYVASGYLNRLGTSDFR  460



>ref|NP_001147670.1| LOC100281279 [Zea mays]
 gb|ACG28327.1| calmodulin binding protein [Zea mays]
 gb|AFW59281.1| calmodulin binding protein [Zea mays]
Length=457

 Score =   163 bits (413),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 168/367 (46%), Positives = 212/367 (58%), Gaps = 52/367 (14%)
 Frame = +1

Query  88    REELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSR  267
             REE AAV+IQ+ FR YL+RRAL+AL+ LV+LQALV+G +VR+  A+ LR + ALVR Q+R
Sbjct  119   REEWAAVRIQAAFRGYLARRALKALRGLVKLQALVRGNIVRRQAAETLRCMHALVRVQAR  178

Query  268   ARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQV---IHMRSGQNDDTIMLKRNLSKR-  435
             AR+     S+  H +       HP PPTPEK++Q     H RSG       LK N SK  
Sbjct  179   ARACRAIRSQ--HVAA------HPDPPTPEKYDQAGAPRHARSGS------LKANSSKTP  224

Query  436   --RVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRn  609
                 +G +E+  S   ++ +D W  E          DD K+ KILE+D GKP      R 
Sbjct  225   GGERLG-RERSESCGRNW-LDRWVEERY-------TDDEKNAKILEVDNGKPGRHGSKRR  275

Query  610   lf---hsshlslnsDQYSYSLAT-----SKDST-AHQIVHSPSYC--EAQSLSPQNFGQQ  756
                   S   ++ S+Q S S AT     SKDST A Q V SPS     A++LSP      
Sbjct  276   GGNHHQSPCSTMTSEQNSRSYATMPESPSKDSTTAQQSVPSPSSVGMAAEALSPLRVPAD  335

Query  757   INESCFCTADNSPQFYSASSKGGSSRVG-PFTPS-KSD-ARSCLSGYSDHPNYMSYTESA  927
             I E C     +SPQF+SA+S+ GSSR G  FTP+ KS+ +RS   GYSD PNYM+ TES 
Sbjct  336   IAELC-----DSPQFFSATSRPGSSRRGGAFTPAAKSECSRSLFGGYSDCPNYMANTESF  390

Query  928   KAKMRSLSAPKQRP--QYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRL  1101
             +AK RS SAPKQRP  QYE+S S +R S H        +QR  S+ +    KAYPGSGRL
Sbjct  391   RAKARSQSAPKQRPQQQYEKSGSLRRASAHALAAGPAAAQR--SVASLHAMKAYPGSGRL  448

Query  1102  DSFGMPV  1122
             D  GMPV
Sbjct  449   DRLGMPV  455



>ref|XP_010240279.1| PREDICTED: protein IQ-DOMAIN 1 isoform X1 [Brachypodium distachyon]
Length=454

 Score =   163 bits (412),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 158/370 (43%), Positives = 207/370 (56%), Gaps = 57/370 (15%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             EE AAV+IQ+ FR YL+RRAL+AL+ LV+LQALV+G +VR+  A+ LR +QALV  Q+RA
Sbjct  114   EEWAAVRIQAAFRGYLARRALKALRGLVKLQALVRGNIVRRQAAETLRCMQALVNVQARA  173

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIH----MRSGQNDDTIMLK----RNL  426
                      S H++       HP P TPEK+EQ  +     R G+   +  ++    R  
Sbjct  174   -------VRSRHAAA------HPVPTTPEKYEQAAYDGAAPRHGRPGSSKRMQGGSIRTP  220

Query  427   SKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTG-KPVFLPKH  603
                R+   +E+  S   ++ +D W  E         +DD K+ KILE+D G KP      
Sbjct  221   GGERL--SRERSESCGRNW-LDRWVEERY-------MDDEKNAKILEVDPGGKPGRHASK  270

Query  604   Rnlfhssh-------lslnsDQYSYSLAT-----SKDSTAHQ--IVHSPSYCEAQSLSPQ  741
             R     S         +  SDQ S S AT     SKDST  Q  +   PS    ++LSP 
Sbjct  271   RRGGSGSGNHLQSSCSTRTSDQNSRSYATMPDSPSKDSTTAQQSVPSPPSVGMREALSPL  330

Query  742   NFGQQINESCFCTADNSPQFYSASSKGGSS-RVGPFTPSKSD-ARSCLSGYSDHPNYMSY  915
                  + E       +SPQF+SA+S+ GSS R G FTP+KS+ ARS   GYSD+PNYM+ 
Sbjct  331   RMPVDMAELY-----DSPQFFSATSRPGSSKRGGAFTPTKSECARSLFGGYSDYPNYMAN  385

Query  916   TESAKAKMRSLSAPKQRP-QYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGS  1092
             TES +AK RS SAPKQRP QYE+S S ++      G  +   QR +SL A FT+KAYPGS
Sbjct  386   TESFRAKARSQSAPKQRPQQYEKSGSLRKGFAFAPGPAQ---QRAASLHAKFTNKAYPGS  442

Query  1093  GRLDSFGMPV  1122
             GRLD  GMPV
Sbjct  443   GRLDRLGMPV  452



>gb|KEH17374.1| calmodulin-binding protein [Medicago truncatula]
Length=456

 Score =   163 bits (412),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 143/344 (42%), Positives = 210/344 (61%), Gaps = 18/344 (5%)
 Frame = +1

Query  100   AAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRARSG  279
             AAVKIQS FR YL+RRALRALKALV+LQALV+G++VRK TADMLR +Q LVR QSRAR+ 
Sbjct  119   AAVKIQSAFRGYLARRALRALKALVKLQALVRGHIVRKQTADMLRRMQTLVRLQSRARAS  178

Query  280   LPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKR---NLSKRRVIGD  450
                IS++ HS   S+       P P+ +E  + + S + D + +LKR   N + R +  +
Sbjct  179   RVHISDNMHSFKSSLSHY----PVPDDYEHPLRVYSTKFDGSSILKRCSSNANFRDMNLE  234

Query  451   QEKVRSNRMDYRMDAWSWEHQGSSRSGPI-DDGKSDKILEIDTGKPVFLPKHRnlfhssh  627
             + +  SN +D  M+  +W   G + S  + DD KSDKILE+DT KP    +H       H
Sbjct  235   RARFGSNWLDSWMEENTWSQTGDTSSKNVNDDEKSDKILEVDTWKPHLKSQHSTSTSFQH  294

Query  628   lslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYS  807
                +SD  + +L   +DS + +   S +Y  + S      G++   +   TA++SPQ +S
Sbjct  295   HYSSSDYNNENLMV-QDSPSKR--SSKAYNPSLSSMKHQKGKEEEVASLRTAESSPQAFS  351

Query  808   ASSKGGS-SRVGPFTPSKSDAR-SCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQYER  981
             ASS+  S SR GPFTP+KS++     + +S +P+YM+ T+S++AK+RS SAP+QR ++ER
Sbjct  352   ASSRLESGSRRGPFTPTKSESSWGFFNAHSGYPSYMANTQSSRAKVRSQSAPRQRLEFER  411

Query  982   SSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFG  1113
               S+ R SI G  E  +NS+    + ++F SK YP +  L+  G
Sbjct  412   YGSSNR-SIQGLWESGSNSE----IDSDFRSKVYPTTSSLNRIG  450



>ref|XP_007152324.1| hypothetical protein PHAVU_004G120200g [Phaseolus vulgaris]
 gb|ESW24318.1| hypothetical protein PHAVU_004G120200g [Phaseolus vulgaris]
Length=512

 Score =   162 bits (411),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 150/345 (43%), Positives = 203/345 (59%), Gaps = 32/345 (9%)
 Frame = +1

Query  100   AAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRARSG  279
             AAV+IQS FR YL+RRALRALKALV+LQALV+G++VRK T DMLR +Q LVR QSRAR+ 
Sbjct  167   AAVRIQSAFRGYLARRALRALKALVKLQALVRGHIVRKQTTDMLRRMQTLVRLQSRARAT  226

Query  280   LPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKR---NLSKRRVIGD  450
                +S++ HS   S+       P PE ++  ++  S + D +I LKR   N + R V  +
Sbjct  227   RGNLSDNMHSFKSSLSHY----PVPEDYQHSLYGYSTKFDGSI-LKRCSSNANFRDVDLE  281

Query  451   QEKVRSNRMDYRMD--AWSWEHQGSSRSGPIDDGKSDKILEIDTGKP----------VFL  594
             + +  S+ +D  M+  +WS    GS ++G +DD KSDKILE+DT KP           F 
Sbjct  282   KARFGSHWLDNWMEENSWSQTRDGSLKNGHLDDEKSDKILEVDTWKPHLNSHHSSGSSFQ  341

Query  595   PKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCF  774
             P H  L    +        S S  +SK      +  S S  EA         +   E+  
Sbjct  342   PAHHYLSSDYNNENFVAYESPSKRSSK-----TLYPSLSSREALPFGSLKLHKGKEEASL  396

Query  775   CTADNSPQFYSASSKGGS-SRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSL  948
                ++SPQ +SASS  GS +R GPFTP+KS+ A S  SGYS HPNYMS TES++AK+RS 
Sbjct  397   RNVEDSPQAFSASSGLGSGARRGPFTPTKSECAWSVFSGYSGHPNYMSNTESSRAKVRSH  456

Query  949   SAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAY  1083
             SAP+QR ++ER  S++R S+ GY +   +S R S    +F SKAY
Sbjct  457   SAPRQRIEFERYGSSRR-SLQGYYDAGPSSDRDS----DFRSKAY  496



>ref|XP_003549118.1| PREDICTED: protein IQ-DOMAIN 14-like [Glycine max]
Length=477

 Score =   161 bits (408),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 151/371 (41%), Positives = 216/371 (58%), Gaps = 37/371 (10%)
 Frame = +1

Query  28    CGSTVNSTACINRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLV  207
             C S++ + A  +R           AAVKIQS FR YL+RRALRALKALV+LQALV+G++V
Sbjct  108   CASSLPAAAPQSRRVAN---ETTAAAVKIQSAFRGYLARRALRALKALVKLQALVRGHIV  164

Query  208   RKHTADMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRS  387
             RK T+DMLR +Q LVR QSRAR+    +S++ HS   S+       P PE ++  +   S
Sbjct  165   RKQTSDMLRRMQTLVRLQSRARATRGNLSDNMHSFKSSLSHY----PVPEDYQHSLRAYS  220

Query  388   GQNDDTIMLKR---NLSKRRVIGDQEKVRSNRMDYRMDAWSWEH--QGSSRSGPIDDGKS  552
              + D +I LKR   N + R +  ++ +  S+ +D  M+  SW      S ++G +DD KS
Sbjct  221   TKFDGSI-LKRCSSNANFRDIDVEKARFGSHWLDSWMEENSWRQTRDASLKNGHLDDEKS  279

Query  553   DKILEIDTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSL  732
             DKILE+DT KP     H N  HSS  S  +  + Y L++  ++       SPS   +++L
Sbjct  280   DKILEVDTWKP-----HLNSHHSSGSSFQTSSHHY-LSSDYNNENFVAYESPSKRSSKAL  333

Query  733   SPQNFGQQI------------NESCFCTADNSPQFYSASSKGGS-SRVGPFTPSKSD-AR  870
             +P    +++             E+     ++SPQ +SASS+ GS +R GPFTP+KS+ A 
Sbjct  334   NPSLSSREVLPFGSLKSHKGKEEAALQNVEDSPQAFSASSRLGSDARRGPFTPTKSECAW  393

Query  871   SCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGS  1050
             S  SGY  HPNYM+ TES++AK+RS SAP+QR ++ER   + R S+ G  E   +S R S
Sbjct  394   SFFSGYPGHPNYMANTESSRAKVRSHSAPRQRMEFERYGHSTRRSLQGLWEAGPSSDRDS  453

Query  1051  SLQANFTSKAY  1083
                 +F SKAY
Sbjct  454   ----DFRSKAY  460



>gb|KFK28871.1| hypothetical protein AALP_AA7G059200 [Arabis alpina]
Length=481

 Score =   158 bits (400),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 154/393 (39%), Positives = 211/393 (54%), Gaps = 66/393 (17%)
 Frame = +1

Query  4     RSTSAAAWCGSTVNSTACINRNAGGYGI--REELAAVKIQSHFraylsrralralkalvr  177
             RS   A +     +  A ++R  G Y    REELAA++IQS FR YL+RRALRALK LVR
Sbjct  131   RSPVTAHFSNGFDDVAALVSRFDGHYHHHGREELAAIQIQSTFRGYLARRALRALKGLVR  190

Query  178   lqalVKGYLVRKHTADMLRGLQALVRAQSRARS----GLPKISESPHSSTKSVQFQHPGP  345
             LQA+V+G++ RK  +  LR + ALVRAQ+R R+      P+ S S  ++TKS  FQ+PGP
Sbjct  191   LQAIVRGHIERKRMSVHLRRMHALVRAQARVRANRVIATPESSSSQSNNTKSSHFQNPGP  250

Query  346   PTPEKFEQVIHMRSGQNDDTIMLKRNLSK----RRVIGDQEKVRSNRMDYRMDAWSWEHQ  513
             PTPEK E  I  RS +   + + KRN SK     R+   Q ++ S               
Sbjct  251   PTPEKLEHSISSRSSKLAYSHLFKRNGSKASDNNRLYTAQREIFSA--------------  296

Query  514   GSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKD--STA  687
                        + +KIL+I      F  KH +              SY+  +  D   ++
Sbjct  297   ---------TDEEEKILQI------FYRKHNS--------------SYTRCSRPDIFYSS  327

Query  688   HQIVHSPSYCEAQSLSPQNFGQQINE--SCFCTADNSPQFYSASSKGGSSRVGPFTPSKS  861
             H +V +    E     P +      E  S FCTA+NSPQ YSA+S+   S     + + S
Sbjct  328   HLVVDNRGLSEPVYTMPFSSSSSHEETGSQFCTAENSPQLYSATSRSKRSAFTASSIAPS  387

Query  862   DA-RSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQY--ERSSSTKRY---SIHGYGE  1023
             D  +SC   Y+DHP+YM+ TES++AK RS SAPK RPQ   ERSSS KR+    +    +
Sbjct  388   DCTQSCC--YADHPSYMACTESSRAKARSASAPKSRPQLFIERSSS-KRFGFVDVPYCSD  444

Query  1024  LRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
              ++  Q+GS+L  +F +KAYPGSGRLD  GMP+
Sbjct  445   TKSGPQKGSALHTSFMNKAYPGSGRLDRLGMPI  477



>ref|NP_194037.2| protein IQ-domain 22 [Arabidopsis thaliana]
 gb|AAW22634.1| calmodulin binding protein IQD22 [Arabidopsis thaliana]
 gb|AEE84701.1| protein IQ-domain 22 [Arabidopsis thaliana]
Length=484

 Score =   158 bits (400),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 147/356 (41%), Positives = 197/356 (55%), Gaps = 55/356 (15%)
 Frame = +1

Query  94    ELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRAR  273
             ELA +KIQS FR YL++RALRALK LVRLQA+V+G++ RK  +  LR + ALVRAQ+R R
Sbjct  167   ELAVIKIQSIFRGYLAKRALRALKGLVRLQAIVRGHIERKRMSVHLRRMHALVRAQARVR  226

Query  274   SG----LPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRV  441
             +      P+ S S  ++TKS  FQ+PGPPTPEK E  I  RS +   + + KRN SK   
Sbjct  227   ATRVIVTPESSSSQSNNTKSSHFQNPGPPTPEKLEHSISSRSSKLAHSHLFKRNGSK---  283

Query  442   IGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhs  621
                     +NR+             + R       + +KIL+ID          R    S
Sbjct  284   -----ASDNNRL-----------YPAHRETFSATDEEEKILQID----------RKHISS  317

Query  622   shlslnsDQYSYSLATSKDSTAHQIVHSPSYCE---AQSLSPQNFGQQINESCFCTADNS  792
                    D + YS        +H I+ +    E   A   SP +  ++I  S FCTA+NS
Sbjct  318   YTRRNRPDMF-YS--------SHLILDNAGLSEPVFATPFSPSSSHEEIT-SQFCTAENS  367

Query  793   PQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRP  969
             PQ YSA+S+   S     + + SD  +SC  G  DHP+YM+ TES++AK RS SAPK RP
Sbjct  368   PQLYSATSRSKRSAFTASSIAPSDCTKSCCDG--DHPSYMACTESSRAKARSASAPKSRP  425

Query  970   Q--YERSSSTKRYSIHGY---GELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
             Q  YER SS KR+        G+ ++  Q+GS+L  +F +KAYPGSGRLD  GMP+
Sbjct  426   QLFYERPSS-KRFGFVDLPYCGDTKSGPQKGSALHTSFMNKAYPGSGRLDRLGMPI  480



>ref|XP_008437216.1| PREDICTED: protein IQ-DOMAIN 14 isoform X1 [Cucumis melo]
Length=364

 Score =   155 bits (393),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 148/343 (43%), Positives = 197/343 (57%), Gaps = 56/343 (16%)
 Frame = +1

Query  100   AAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRARSG  279
             AA+KIQ+ FR +L+R+ALRAL+ LVRLQALV+G++ RK TA+ ++ +QAL+RAQ+RAR+G
Sbjct  72    AAIKIQAAFRGFLARKALRALRGLVRLQALVRGHIERKRTAEWIKRMQALLRAQARARAG  131

Query  280   LPKIS-ESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGDQE  456
               + S +  HS  K   F    P TPEKFE   H +S                       
Sbjct  132   RSQSSLDFLHSDIKFSSFSSIDPVTPEKFEHSPHTKS-----------------------  168

Query  457   KVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshlsl  636
               R  +M           +  SR   ID    D+ILEI+  K  F  K ++LF S     
Sbjct  169   -TRFKQM----------QRSGSRFTTIDAENIDRILEIENEKAHFKLKPKSLFSSIR---  214

Query  637   nsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYSASS  816
                    +  +S D  + Q   S S CE Q  SP  F  ++ E+ F         +S SS
Sbjct  215   -------NALSSSDVPSKQPPSSFS-CETQCFSPFKFSHEVEENSF---------FSVSS  257

Query  817   KGGSSRVGPFTPSKSDA-RSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQYERSSST  993
             +GGS++  PFTP+KSD+ RS  SG S++P+YM+ TES++AKMRS SAP+QRPQYERSSS 
Sbjct  258   RGGSTKKSPFTPAKSDSTRSYFSGDSEYPSYMACTESSRAKMRSHSAPRQRPQYERSSSA  317

Query  994   KRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
             KR S    GE R  +Q+ S+L++NF  KAYPGSGRLD  GMPV
Sbjct  318   KRGSAFIVGESRLTAQQVSTLRSNFVGKAYPGSGRLDKLGMPV  360



>ref|XP_003533215.1| PREDICTED: protein IQ-DOMAIN 14-like [Glycine max]
Length=482

 Score =   157 bits (398),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 145/351 (41%), Positives = 205/351 (58%), Gaps = 40/351 (11%)
 Frame = +1

Query  100   AAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRARSG  279
             AAVKIQS FR YL+RRALRALKALV+LQALV+G++VRK T+DMLR +Q LVR QSRAR+ 
Sbjct  132   AAVKIQSAFRGYLARRALRALKALVKLQALVRGHIVRKQTSDMLRRMQTLVRLQSRARAT  191

Query  280   LPKISESPHSSTKSVQFQHPGP--PTPEKFEQVIHMRSGQNDDTIMLKR---NLSKRRVI  444
                +S++ HS      F+ P    P PE ++  +   S + D +I LKR   N + R + 
Sbjct  192   RGNLSDNMHS------FKSPLSHYPVPEDYKHSLRAYSTKFDGSI-LKRCSSNANFRDID  244

Query  445   GDQEKVRSNRMDYRMDAWSWEH--QGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfh  618
              ++ +  S+ +D  M+  SW      S + G +DD KSDKILE+DT KP     H     
Sbjct  245   VEKARFGSHWLDSWMEENSWRQTRDASLKIGRLDDEKSDKILEVDTWKPHLNSHH---SS  301

Query  619   sshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQI-------------  759
              S    +S  Y YS   +++  A++   SPS   ++ L+P    +++             
Sbjct  302   GSSYQTSSHHYLYSDYNNENFVAYE---SPSKGSSKGLNPSLSSREVLPFGSLTFHKGKE  358

Query  760   NESCFCTADNSPQFYSASSKGGS--SRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAK  930
               +     ++SPQ +SASS+ GS  +R GPFTP+KS+ A S  SGY  HPNYM+ TES++
Sbjct  359   EVAALPNVEDSPQAFSASSRLGSGGARRGPFTPTKSECAWSFFSGYPGHPNYMANTESSR  418

Query  931   AKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAY  1083
             AK+RS SAP+QR ++ER   + R S+ G  E   +S R S    +F S+AY
Sbjct  419   AKVRSHSAPRQRMEFERYGHSTRRSLQGLWEAEPSSDRDS----DFRSQAY  465



>ref|XP_006283627.1| hypothetical protein CARUB_v10004684mg [Capsella rubella]
 gb|EOA16525.1| hypothetical protein CARUB_v10004684mg [Capsella rubella]
Length=487

 Score =   157 bits (397),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 153/364 (42%), Positives = 204/364 (56%), Gaps = 57/364 (16%)
 Frame = +1

Query  76    GYGI--REELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQAL  249
             GYG   RE+LAA+KIQS FR YL+RRALRALK LVRLQA+V+G++ RK  +  LR + AL
Sbjct  162   GYGRDGREDLAAIKIQSTFRGYLARRALRALKGLVRLQAIVRGHIERKRMSVHLRRMHAL  221

Query  250   VRAQSRARSG----LPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLK  417
             VRAQSR R+      P+ S S  ++TKS  FQ+PGPPTPEK E  I  RS +   + +LK
Sbjct  222   VRAQSRVRASRLIVTPESSSSQSNNTKSSHFQNPGPPTPEKLEHSISSRSSKLSHSHLLK  281

Query  418   RNLSKRRVIGDQEKVRSNRM--DYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVF  591
             R       IG +    +NR+   YR    + + +             +KIL+ID      
Sbjct  282   R-------IGSKAS-DNNRLYPAYRETFSATDEE-------------EKILQID------  314

Query  592   LPKHRnlfhsshlslnsDQ-YSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINES  768
                 R    S    +  D  YS  L       +  +  +P        SP +  +++  S
Sbjct  315   ----RKHISSYTRRIRPDMFYSSHLVLDNAGRSEPVYVTP-------FSPSSSHEEVT-S  362

Query  769   CFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRS  945
              FCTA+NSPQ YSA S+   S     + + SD  +SC   Y DHP+YM+ TES++AK RS
Sbjct  363   QFCTAENSPQLYSAMSRSKRSAFTASSIAPSDCTKSCC--YGDHPSYMACTESSRAKARS  420

Query  946   LSAPKQRPQ--YERSSSTKRYSIHGY---GELRTNSQRGSSLQANFTSKAYPGSGRLDSF  1110
              SAPK RPQ  YERSSS KR+        G+ ++  Q+GS+L  +F +KAYPGSGRLD  
Sbjct  421   ASAPKSRPQLYYERSSS-KRFGFVDLPYCGDTKSGPQKGSALHTSFMNKAYPGSGRLDRL  479

Query  1111  GMPV  1122
             GMP+
Sbjct  480   GMPI  483



>ref|XP_006413583.1| hypothetical protein EUTSA_v10025012mg [Eutrema salsugineum]
 gb|ESQ55036.1| hypothetical protein EUTSA_v10025012mg [Eutrema salsugineum]
Length=493

 Score =   157 bits (396),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 148/358 (41%), Positives = 192/358 (54%), Gaps = 55/358 (15%)
 Frame = +1

Query  88    REELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSR  267
             R ELAA+KIQS FR YLSRRALRALK LV+LQA+V+G++ RK  +  LR + ALVRAQ+R
Sbjct  174   RRELAAIKIQSAFRGYLSRRALRALKGLVKLQAIVRGHIERKRMSVHLRRMHALVRAQAR  233

Query  268   ARSG----LPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKR  435
              R+      P+ S S  ++TKS  FQ+PGPPTPEK E  I  RS +   + + KRN SK 
Sbjct  234   IRANRVIVTPESSSSQSNNTKSSYFQNPGPPTPEKLEHSISSRSSKLGHSHLFKRNGSK-  292

Query  436   RVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlf  615
                       +N   Y      +              + +KILEID          R   
Sbjct  293   --------ASNNNRPYTAHREIFSAMN----------EEEKILEID----------RKHN  324

Query  616   hsshlslnsDQ-YSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNS  792
              S       D  YS  L       +  I   P        SP +   +   S FCTADNS
Sbjct  325   SSYTRRSRPDMFYSSHLVLDNAGRSEPIYTMP-------FSPSS-SHEETVSQFCTADNS  376

Query  793   PQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRP  969
             PQ +SA+S+   S     + + SD  +SC   Y+DHP+YM+ TES++AK RS SAPK RP
Sbjct  377   PQLHSATSRSKRSAFTASSIAPSDCTQSCC--YADHPSYMACTESSRAKARSASAPKSRP  434

Query  970   Q-YERSSSTKRYSIHGY------GELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
             Q Y   SS+KR+   GY      G+ R+  Q+ S+L  +F +KAYPGSGRLD  GMP+
Sbjct  435   QLYYEQSSSKRF---GYVDLPYCGDSRSGPQKVSALHTSFMNKAYPGSGRLDRLGMPI  489



>ref|XP_004143989.1| PREDICTED: protein IQ-DOMAIN 14-like [Cucumis sativus]
 gb|KGN50140.1| hypothetical protein Csa_5G155510 [Cucumis sativus]
Length=365

 Score =   154 bits (389),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 146/343 (43%), Positives = 193/343 (56%), Gaps = 56/343 (16%)
 Frame = +1

Query  100   AAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRARSG  279
             AA+KIQ+ FR +L+R+ALRAL+ LVRLQALV+G++ RK TA+ ++ +QAL+RAQ+RAR+G
Sbjct  73    AAIKIQAAFRGFLARKALRALRGLVRLQALVRGHIERKRTAEWIKRMQALLRAQARARAG  132

Query  280   LPKIS-ESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGDQE  456
               + S +  HS  K   F    P TPEKFE   H +S                       
Sbjct  133   RSQSSFDFLHSDIKFSSFSSIDPVTPEKFEHSPHTKS-----------------------  169

Query  457   KVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshlsl  636
               R  +M           +  SR   ID    D+ILEI+  K  F  K ++LF       
Sbjct  170   -TRFKQM----------QRSGSRFTTIDAENIDRILEIENEKAHFKLKPKSLFS------  212

Query  637   nsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYSASS  816
                  S   A S      +   S   CE Q  SP  F  ++ E+ F         +S SS
Sbjct  213   -----SIKNALSSSDVPSKEPPSSFSCETQCFSPFKFSHEVEENSF---------FSVSS  258

Query  817   KGGSSRVGPFTPSKSDA-RSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQYERSSST  993
             +GGS++  PFTP+KSD+ RS  SG S++P+YM+ TES++AKMRS SAP+QRPQYERSSS 
Sbjct  259   RGGSTKKSPFTPAKSDSTRSYFSGDSEYPSYMACTESSRAKMRSHSAPRQRPQYERSSSA  318

Query  994   KRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
             KR S    GE R  +Q+ S+L++NF  KAYPGSGRLD  GMPV
Sbjct  319   KRGSAFIVGESRLTAQQVSTLRSNFIGKAYPGSGRLDKLGMPV  361



>ref|XP_008437217.1| PREDICTED: protein IQ-DOMAIN 14 isoform X2 [Cucumis melo]
Length=318

 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 127/313 (41%), Positives = 170/313 (54%), Gaps = 56/313 (18%)
 Frame = +1

Query  190   VKGYLVRKHTADMLRGLQALVRAQSRARSGLPKIS-ESPHSSTKSVQFQHPGPPTPEKFE  366
             V+G++ RK TA+ ++ +QAL+RAQ+RAR+G  + S +  HS  K   F    P TPEKFE
Sbjct  56    VRGHIERKRTAEWIKRMQALLRAQARARAGRSQSSLDFLHSDIKFSSFSSIDPVTPEKFE  115

Query  367   QVIHMRSGQNDDTIMLKRNLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDG  546
                H +S                         R  +M           +  SR   ID  
Sbjct  116   HSPHTKS------------------------TRFKQM----------QRSGSRFTTIDAE  141

Query  547   KSDKILEIDTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQ  726
               D+ILEI+  K  F  K ++LF S   +           +S D  + Q   S S CE Q
Sbjct  142   NIDRILEIENEKAHFKLKPKSLFSSIRNA----------LSSSDVPSKQPPSSFS-CETQ  190

Query  727   SLSPQNFGQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSDA-RSCLSGYSDHPN  903
               SP  F  ++ E+ F         +S SS+GGS++  PFTP+KSD+ RS  SG S++P+
Sbjct  191   CFSPFKFSHEVEENSF---------FSVSSRGGSTKKSPFTPAKSDSTRSYFSGDSEYPS  241

Query  904   YMSYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAY  1083
             YM+ TES++AKMRS SAP+QRPQYERSSS KR S    GE R  +Q+ S+L++NF  KAY
Sbjct  242   YMACTESSRAKMRSHSAPRQRPQYERSSSAKRGSAFIVGESRLTAQQVSTLRSNFVGKAY  301

Query  1084  PGSGRLDSFGMPV  1122
             PGSGRLD  GMPV
Sbjct  302   PGSGRLDKLGMPV  314



>gb|KHG15436.1| Protein IQ-DOMAIN 14 -like protein [Gossypium arboreum]
Length=461

 Score =   154 bits (390),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 146/358 (41%), Positives = 208/358 (58%), Gaps = 23/358 (6%)
 Frame = +1

Query  85    IREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQS  264
             + +E+AAV+IQS FR YL+RRALRALKALV+LQALV+G+ VRK TADMLR +Q LV+ Q 
Sbjct  100   LVQEVAAVRIQSAFRGYLARRALRALKALVKLQALVRGHFVRKQTADMLRRMQTLVKLQD  159

Query  265   RARSGLPKISESPHSSTKSVQF-QHPGPPTPEKFEQVIHMRSGQNDDTIMLKR--NLSKR  435
             RARS    +++S  S  K  +  ++    T  K E  +     ++D   +LKR  + S  
Sbjct  160   RARSSRAHVTKSLDSVVKMSRLPRNAVHATSGKDECQLRAYCTKSDGLSILKRCGSNSNF  219

Query  436   RVIGDQEKVR--SNRMDYRMDAWSWEHQGSSRSGPI-----DDGKSDKILEIDTGKPVFL  594
             R I D EK R  SN +D+  +   W ++   R  P+     DD KSDKILE+DT KP   
Sbjct  220   RNIIDLEKARMGSNWLDHWREESLWNNR---REAPLSRRLADDEKSDKILEVDTWKPHLS  276

Query  595   PKHRnlfhsshlslnsDQYSYSLATSKDS------TAHQIVHSPSYCEAQSLSPQNFGQQ  756
              +  +         ++  Y+ S  T+ DS       A   + + S  E  +LS   +   
Sbjct  277   SQQSHRNVRPSQHFSALDYTQSF-TAYDSPRKASGKASNAIPNISSAEVLTLSSMKYPGG  335

Query  757   INESCFCTADNSPQFYSASSKGGSS-RVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAK  930
              +E+   TADNSPQ +SASS+ GSS R  PFTP++S+ +   LSGYS +PNYM+ TES++
Sbjct  336   KDEAVLRTADNSPQVHSASSRPGSSARRSPFTPTRSECSWGYLSGYSGYPNYMANTESSR  395

Query  931   AKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLD  1104
             AK RS SAP+QR + ++  ST+R +  G  +  TNS+R      +F  +A+P S  L+
Sbjct  396   AKYRSQSAPRQRLELDKYGSTRR-TYQGLWDSGTNSERDFPHHVDFRYRAHPTSDCLN  452



>ref|XP_003592300.1| hypothetical protein MTR_1g101330 [Medicago truncatula]
 gb|AES62551.1| calmodulin-binding protein [Medicago truncatula]
Length=441

 Score =   154 bits (389),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 145/365 (40%), Positives = 212/365 (58%), Gaps = 36/365 (10%)
 Frame = +1

Query  61    NRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGL  240
             N+  G   + EE AAVKIQS FR YL+RRALRALKALV+LQALV+G++VRK TADMLR +
Sbjct  104   NKTRGQLRLPEETAAVKIQSAFRGYLARRALRALKALVKLQALVRGHIVRKKTADMLRRM  163

Query  241   QALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKR  420
             Q LVR Q++AR+    +S     S KS    +P    PE++EQ  H+ S +   + +LKR
Sbjct  164   QTLVRLQTKARASRAHLSSDNLHSFKSSLSHYP---VPEEYEQPHHVYSTKFGGSSILKR  220

Query  421   ---NLSKRRVIGDQEKVRSNRMDYRM--DAWSWEHQGSSRSGPIDDGKSDKILEIDTGKP  585
                N + R++  ++ +  SN +D+ M  ++ S     SS++   D+ KSDKILE+DT KP
Sbjct  221   CSSNSNFRKIESEKPRFGSNWLDHWMQENSISQTKNASSKNRHPDEHKSDKILEVDTWKP  280

Query  586   VFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINE  765
                              N ++ + +  +++  + H      +  + QSLS +    +   
Sbjct  281   QL---------------NKNENNVNSMSNESPSKHS-----TKAQNQSLSVKFHKAKEEV  320

Query  766   SCFCTADNSPQFYSASSKGGSS--RVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAK  936
             +   TADNSPQ +SASS+ GS   R  PFTP++S+ + S L GYS +PNYM+ TES++AK
Sbjct  321   AASRTADNSPQTFSASSRNGSGVRRNTPFTPTRSECSWSFLGGYSGYPNYMANTESSRAK  380

Query  937   MRSLSAPKQRPQYERSSSTKRYSIHGYGEL-RTNSQRGSSLQANFTSKAYPGSGRLDSFG  1113
             +RS SAP+QR ++E  SST+R    G  ++  TNS   S  ++N   K  P   R +  G
Sbjct  381   VRSQSAPRQRHEFEEYSSTRR-PFQGLWDVGSTNSDNDSDSRSN---KVSPALSRFNRIG  436

Query  1114  MPVIR  1128
                +R
Sbjct  437   SSNLR  441



>ref|XP_011048685.1| PREDICTED: protein IQ-DOMAIN 14-like [Populus euphratica]
Length=444

 Score =   154 bits (388),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 138/338 (41%), Positives = 203/338 (60%), Gaps = 29/338 (9%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             EE++AVKIQS FR YL+RRALRALKALV+LQALV+G++VRK TADMLR +Q LVR Q+RA
Sbjct  96    EEVSAVKIQSAFRGYLARRALRALKALVKLQALVRGHIVRKQTADMLRRMQTLVRLQARA  155

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKR---NLSKRRV  441
             R+    +S+S H+++KS   ++  P +P K + +    S ++D   +LKR   N + R  
Sbjct  156   RASRSHVSDSWHTTSKSSHSRYAVPASPSK-DHLFCASSTKSDGPSILKRCGSNANFRES  214

Query  442   IG-DQEKVRSNRMDYRMDAWSWEHQGSS--RSGPIDDGKSDKILEIDTGKPVFLPKHRnl  612
             I  D+ K+ SN ++  M+   W   GS+  R+   DD KSDKILE+DT KP         
Sbjct  215   IDFDKVKLGSNWLERWMEESLWNDHGSNPLRNRHADDEKSDKILEVDTWKP--------H  266

Query  613   fhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQI---------NE  765
               S   +       Y+LA+  ++ +     SPS      +     G+           +E
Sbjct  267   VRSQQSNRTFQTSQYALASDHNNQSFMTFDSPSKKTPNPMLSVPSGEIFHSLKLPLGNDE  326

Query  766   SCFCTADNSPQFYSASSKGGSS-RVG--PFTPSKSD-ARSCLSGYSDHPNYMSYTESAKA  933
             +   TA+NSP+ +SA+S+ GSS R G   FTP++S+ +    +GY  +PNYMS TES++A
Sbjct  327   AISRTAENSPRLFSATSRPGSSGRKGGAHFTPTRSECSWGFFNGYPGYPNYMSNTESSRA  386

Query  934   KMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRG  1047
             K+RS SAP+QR ++E+  S++R S+ GY +    S+RG
Sbjct  387   KVRSQSAPRQRLEFEKYGSSRR-SVQGYYDADIRSERG  423



>ref|XP_010439237.1| PREDICTED: uncharacterized protein LOC104722723 [Camelina sativa]
Length=498

 Score =   154 bits (388),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 151/371 (41%), Positives = 201/371 (54%), Gaps = 62/371 (17%)
 Frame = +1

Query  76    GYGI--REELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQAL  249
             GYG   RE+LA +KIQ+ FR YL+RRALRALK LVRLQA+V+G++ RK  +  LR + AL
Sbjct  164   GYGRDGREDLAVIKIQATFRGYLARRALRALKGLVRLQAIVRGHIERKRMSVHLRRMHAL  223

Query  250   VRAQSRARSG----LPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLK  417
             VRAQSR R+      P+ S S  ++TKS  FQ+PGPPTPEK E  I  RS +   + + K
Sbjct  224   VRAQSRVRASRIIVTPESSSSQSNNTKSSHFQNPGPPTPEKLEHSISSRSSKLSHSHLFK  283

Query  418   RNLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLP  597
             R       IG   K   N   Y     ++          +D+   +KIL+ID        
Sbjct  284   R-------IG--SKASDNNRLYAAHRETF--------SAMDE--EEKILQID--------  316

Query  598   KHRnlfhsshlslnsDQ-YSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCF  774
               R    S       D  YS  L       +  +  +P        SP +  ++I  S F
Sbjct  317   --RKHISSYTRRSRPDMFYSSHLVLDNAGRSEPVFVTP-------FSPSSSHEEIT-SQF  366

Query  775   CTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLS  951
             CTA+NSPQ YSA+S+   S     + + SD  +SC   Y DHP+YM+ TES++AK RS+S
Sbjct  367   CTAENSPQIYSATSRSKRSTFTASSIAPSDCTKSCC--YGDHPSYMACTESSRAKARSVS  424

Query  952   APKQRPQ--YERSSSTKRYSIHGY------------GELRTNSQRGSSLQANFTSKAYPG  1089
             APK RPQ  YERSSS KR+                 G++++  Q+GS L  +F +KAYPG
Sbjct  425   APKSRPQLYYERSSS-KRFGFVDVPYCGDTKSGPFCGDMKSGPQKGSVLHTSFMNKAYPG  483

Query  1090  SGRLDSFGMPV  1122
             SGRLD  GMP+
Sbjct  484   SGRLDRLGMPI  494



>gb|AFW59282.1| hypothetical protein ZEAMMB73_392897 [Zea mays]
Length=340

 Score =   150 bits (380),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 142/333 (43%), Positives = 181/333 (54%), Gaps = 52/333 (16%)
 Frame = +1

Query  190   VKGYLVRKHTADMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQ  369
              +G +VR+  A+ LR + ALVR Q+RAR+     S+  H +       HP PPTPEK++Q
Sbjct  36    FRGNIVRRQAAETLRCMHALVRVQARARACRAIRSQ--HVAA------HPDPPTPEKYDQ  87

Query  370   V---IHMRSGQNDDTIMLKRNLSKR---RVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSG  531
                  H RSG       LK N SK      +G +E+  S   ++ +D W  E        
Sbjct  88    AGAPRHARSGS------LKANSSKTPGGERLG-RERSESCGRNW-LDRWVEERY------  133

Query  532   PIDDGKSDKILEIDTGKPVFLPKHRnlfhsshl---slnsDQYSYSLAT-----SKDST-  684
               DD K+ KILE+D GKP      R   +       ++ S+Q S S AT     SKDST 
Sbjct  134   -TDDEKNAKILEVDNGKPGRHGSKRRGGNHHQSPCSTMTSEQNSRSYATMPESPSKDSTT  192

Query  685   AHQIVHSPSYC--EAQSLSPQNFGQQINESCFCTADNSPQFYSASSKGGSSRVG-PFTPS  855
             A Q V SPS     A++LSP      I E C     +SPQF+SA+S+ GSSR G  FTP+
Sbjct  193   AQQSVPSPSSVGMAAEALSPLRVPADIAELC-----DSPQFFSATSRPGSSRRGGAFTPA  247

Query  856   -KSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRP--QYERSSSTKRYSIHGYGE  1023
              KS+ +RS   GYSD PNYM+ TES +AK RS SAPKQRP  QYE+S S +R S H    
Sbjct  248   AKSECSRSLFGGYSDCPNYMANTESFRAKARSQSAPKQRPQQQYEKSGSLRRASAHALAA  307

Query  1024  LRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
                 +QR  S+ +    KAYPGSGRLD  GMPV
Sbjct  308   GPAAAQR--SVASLHAMKAYPGSGRLDRLGMPV  338



>ref|XP_002322461.1| calmodulin-binding family protein [Populus trichocarpa]
 gb|EEF06588.1| calmodulin-binding family protein [Populus trichocarpa]
Length=451

 Score =   152 bits (385),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 136/341 (40%), Positives = 204/341 (60%), Gaps = 32/341 (9%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             EE++AVKIQS FR YL+RRALRALKALV+LQALV+G++VRK TADMLR +Q LVR Q+RA
Sbjct  100   EEVSAVKIQSAFRGYLARRALRALKALVKLQALVRGHIVRKQTADMLRRMQTLVRLQARA  159

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKR---NLSKRRV  441
             R+    +S+S H+++KS   ++  P +P K + +    S + D   +LKR   N + R  
Sbjct  160   RASRSHVSDSWHTTSKSSHSRYAVPASPSK-DHLFRASSTKFDGPSILKRCGSNANFRES  218

Query  442   IG-DQEKVRSNRMDYRMDAWSWEHQGSS--RSGPIDDGKSDKILEIDTGKPVFLPKHRnl  612
             I  D+ K+ SN ++  M+   W   GS+  R+   DD +SDKILE+DT KP         
Sbjct  219   IDFDKVKLGSNWLERWMEESLWNDHGSNPLRNRHADDERSDKILEVDTWKP--------H  270

Query  613   fhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQ---NFGQQI--------  759
               S   +       ++LA+  ++       SPS    ++ +P      G+ +        
Sbjct  271   VKSQQSNRTFQTSQHALASDHNNQIFMTFDSPSKISKKAPNPMPSIPSGEILYSLKLPLG  330

Query  760   -NESCFCTADNSPQFYSASSKGGSSRV---GPFTPSKSD-ARSCLSGYSDHPNYMSYTES  924
              +E+   TA+NSP+ +SA+S+ GSS     G FTP++S+ +    +GY  +PNYMS TES
Sbjct  331   NDEAVSRTAENSPRLFSATSRPGSSGRKGGGHFTPTRSECSWGFFNGYPGYPNYMSNTES  390

Query  925   AKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRG  1047
             ++AK+RS SAP+QR ++E+  S++R S+ GY +    S+RG
Sbjct  391   SRAKVRSQSAPRQRLEFEKYGSSRR-SVQGYYDADIRSERG  430



>ref|XP_010448780.1| PREDICTED: protein IQ-DOMAIN 14-like [Camelina sativa]
Length=498

 Score =   152 bits (384),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 149/372 (40%), Positives = 203/372 (55%), Gaps = 64/372 (17%)
 Frame = +1

Query  76    GYGI--REELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQAL  249
             GYG   RE+LA +KIQ+ FR YL+RRALRALK LVRLQA+V+G++ RK  +  LR + AL
Sbjct  164   GYGRDGREDLAVIKIQATFRGYLARRALRALKGLVRLQAIVRGHIERKRMSVHLRRMHAL  223

Query  250   VRAQSRARSG----LPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLK  417
             VRAQSR R+      P+ S S  ++TKS  FQ+PGPPTPEK E  I  RS +   + + K
Sbjct  224   VRAQSRVRASRVIVTPESSSSQSNNTKSSHFQNPGPPTPEKLEHSISSRSSKLSHSHLFK  283

Query  418   RNLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLP  597
             R  SK     D  ++ +   +    A + E               +KIL+ID        
Sbjct  284   RFGSK---ASDNNRLYATHRET-FSAMNEE---------------EKILQID--------  316

Query  598   KHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINE--SC  771
               R    S       D + YS        +H ++ +    E   ++P +      E  S 
Sbjct  317   --RKHISSYTRRSRPDMF-YS--------SHLVLDNAGRSEPVFVTPFSSSSSHEEITSQ  365

Query  772   FCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSL  948
             FCTA+NSPQ YSA+S+   S     + + SD  +SC   Y DHP+YM+ TES++AK RS+
Sbjct  366   FCTAENSPQIYSATSRSKRSTFTASSIAPSDCTKSCC--YGDHPSYMACTESSRAKSRSV  423

Query  949   SAPKQRPQ--YERSSSTKRYSIHGY------------GELRTNSQRGSSLQANFTSKAYP  1086
             SAPK RPQ  YERSSS KR+                 G++++  Q+GS+L  +F +KAYP
Sbjct  424   SAPKSRPQLYYERSSS-KRFGFVDVPYIGDTKSGPYCGDMKSGPQKGSALHTSFMNKAYP  482

Query  1087  GSGRLDSFGMPV  1122
             GSGRLD  GMP+
Sbjct  483   GSGRLDHLGMPI  494



>ref|XP_006421869.1| hypothetical protein CICLE_v10004956mg [Citrus clementina]
 ref|XP_006490343.1| PREDICTED: protein IQ-DOMAIN 14-like [Citrus sinensis]
 gb|ESR35109.1| hypothetical protein CICLE_v10004956mg [Citrus clementina]
 gb|KDO60064.1| hypothetical protein CISIN_1g013059mg [Citrus sinensis]
Length=450

 Score =   150 bits (380),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 200/356 (56%), Gaps = 34/356 (10%)
 Frame = +1

Query  94    ELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRAR  273
             ELAAV+IQ  FR YL+RRAL+ALKALV+LQALV+G++VRK TADML+ +Q LV+ Q+R R
Sbjct  118   ELAAVRIQCAFRGYLARRALKALKALVKLQALVRGHIVRKQTADMLKRMQTLVKVQARVR  177

Query  274   SGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGDQ  453
             +     SES  SS+KS   +     +   F  +  +                      D+
Sbjct  178   ASRTPTSESLLSSSKSSLSRSTRCGSSSNFGDITDL----------------------DK  215

Query  454   EKVRSNRMDYRMD--AWSWEHQGSSRSG-PIDDGKSDKILEIDTGKPVFLPK-HRnlfhs  621
              ++ SN +D  M+   W+       +SG P DD KSDKILE+DT KP   P+ H  +  S
Sbjct  216   GRLGSNWLDRWMEESVWNGHRVSQLKSGPPADDEKSDKILEVDTWKPHLNPRQHNRVIRS  275

Query  622   shlslnsDQYSYSLATSKDSTAHQI-----VHSPSYCEAQSLSPQNFGQQINESCFCTAD  786
             S      D  ++S  T    +   +     + S S  E  SLS        +++   TAD
Sbjct  276   SPHGSALDYNNHSYMTIDSPSKLSVKNMNPIPSVSPGEVLSLSSLKVPVGKSDAALRTAD  335

Query  787   NSPQFYSASSKGGSS-RVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSAPK  960
             NSPQ  SAS + GSS R GPFTP++S+ +    SG   HPNYM+ TES++AK+RSLSAP+
Sbjct  336   NSPQVSSASYRPGSSARRGPFTPTRSEYSWGYFSGCIGHPNYMANTESSRAKVRSLSAPR  395

Query  961   QRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPVIR  1128
             QR + ER  STKR S HG+ +   NS+R  +  A+F ++A P S RL  FG   +R
Sbjct  396   QRLELERYGSTKR-SAHGFWDGSINSERDFAQHADFRNRASPTSDRLSKFGSINLR  450



>ref|XP_010433947.1| PREDICTED: uncharacterized protein LOC104717998 [Camelina sativa]
Length=497

 Score =   150 bits (379),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 149/371 (40%), Positives = 201/371 (54%), Gaps = 62/371 (17%)
 Frame = +1

Query  76    GYGI--REELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQAL  249
             GYG   RE+LA +KIQ+ FR YL+RRALRALK LVRLQA+V+G++ RK  +  LR + AL
Sbjct  163   GYGRDGREDLAVIKIQATFRGYLARRALRALKGLVRLQAIVRGHIERKRMSVHLRRMHAL  222

Query  250   VRAQSRARSG----LPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLK  417
             VRAQSR R+      P+ S S  ++TKS  F +PGPPTPEK E  I  RS +   + + K
Sbjct  223   VRAQSRIRASRVIVTPESSSSQSNNTKSSHFLNPGPPTPEKLEHSISSRSSKLSHSHLFK  282

Query  418   RNLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLP  597
             R       IG   K   N   Y   + ++          +D+   +KIL+ID        
Sbjct  283   R-------IG--SKASDNNRLYATHSETF--------SAMDE--EEKILQID--------  315

Query  598   KHRnlfhsshlslnsDQ-YSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCF  774
               R    S       D  YS  L       +  +  +P        SP +  ++I  S F
Sbjct  316   --RKHISSYTRRSRPDMFYSSHLVLDNAGRSEPVFVTP-------FSPSSSHEEIT-SQF  365

Query  775   CTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLS  951
             CTA+NSPQ YSA+S+   S     + + SD  +SC   Y DHP+YM+ TES++AK RS+S
Sbjct  366   CTAENSPQIYSATSRSKRSTFTASSIAPSDCTKSCC--YGDHPSYMACTESSRAKARSVS  423

Query  952   APKQRP--QYERSSSTKRYSIHGY------------GELRTNSQRGSSLQANFTSKAYPG  1089
             APK RP   YERSSS KR+                 G++++  Q+GS+L  +F +KAYPG
Sbjct  424   APKSRPPLYYERSSS-KRFGFVDVPYCGDTKSGPYCGDMKSGPQKGSALHTSFMNKAYPG  482

Query  1090  SGRLDSFGMPV  1122
             SGRLD  GMP+
Sbjct  483   SGRLDRLGMPI  493



>ref|XP_007219045.1| hypothetical protein PRUPE_ppa004660mg [Prunus persica]
 gb|EMJ20244.1| hypothetical protein PRUPE_ppa004660mg [Prunus persica]
Length=497

 Score =   150 bits (378),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 117/323 (36%), Positives = 185/323 (57%), Gaps = 16/323 (5%)
 Frame = +1

Query  190   VKGYLVRKHTADMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQ  369
             V+G++VRK +ADMLR +Q LVR Q+RAR+    +S+SPHSS KS    HP P +P+K   
Sbjct  171   VRGHIVRKQSADMLRRMQTLVRVQARARASRTLMSDSPHSSRKSSLSHHPLPESPDKIGY  230

Query  370   VIHMRSGQNDDTIMLKR---NLSKRRVIG-DQEKVRSNRMDYRMD--AWSWEHQGSSRSG  531
                  S + D   +LKR   N + R V+  D+ ++ S  +D  M+  A +     S R  
Sbjct  231   QPRACSSKFDGPSILKRCGSNSNVRDVVNLDRRRLASGWLDRWMEESARNNRRDASLRYE  290

Query  532   PIDDGKSDKILEIDTGKPVFLPKHR-nlfhsshlslnsDQYSYSLATSKDSTAHQI----  696
               DD + DKILE+DT KP    + R   F ++H  L S++Y+ +  T    + H +    
Sbjct  291   QADDVRGDKILEVDTWKPHLGSQRRPQTFQTAHHVLTSNRYNPTFMTFDSPSKHSMKEPN  350

Query  697   -VHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYSASSKGGSS--RVGPFTPSKSD-  864
              + + +  +  SLS   +    +E+ F TA+NSPQ +SASS+ GSS  R   FTP++S+ 
Sbjct  351   PIPNQASMDVLSLSSLKYAIATDEAAFRTAENSPQAFSASSRPGSSGRRGHHFTPARSEC  410

Query  865   ARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQR  1044
             +   ++GY+ +PNYM+ TES++AK+RS SAP+QR ++E+   TK+ S+  + +  T S  
Sbjct  411   SWGFINGYAGYPNYMANTESSRAKVRSQSAPRQRLEFEKYGLTKK-SVQEFWDAGTCSDT  469

Query  1045  GSSLQANFTSKAYPGSGRLDSFG  1113
               +  ++  +K+   S RL+  G
Sbjct  470   SFAQDSDCRNKSVFSSSRLNRLG  492



>ref|XP_007143373.1| hypothetical protein PHAVU_007G067100g [Phaseolus vulgaris]
 gb|ESW15367.1| hypothetical protein PHAVU_007G067100g [Phaseolus vulgaris]
Length=465

 Score =   149 bits (376),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 152/396 (38%), Positives = 220/396 (56%), Gaps = 43/396 (11%)
 Frame = +1

Query  7     STSAAAWCGSTVNSTACINRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqa  186
             S +AAA   ST    A          + E  AAV IQS FR YL+RRALRALKALV+LQA
Sbjct  89    SGAAAATSNSTSTRPAAAAARVSQLRLPELTAAVTIQSAFRGYLARRALRALKALVKLQA  148

Query  187   lVKGYLVRKHTADMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFE  366
             LV+G++VRK +ADMLR +Q LV+ Q++AR+    +S    S   S+       P PE++E
Sbjct  149   LVRGHIVRKQSADMLRRMQTLVKLQAQARASRAHLSYYTPSFKSSLSHY----PVPEEYE  204

Query  367   QVIHMRSGQNDDTIMLKR---NLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQ---GSSRS  528
                   + + D + +LKR   N + R V  ++ +  SN ++  M+  +   Q    S ++
Sbjct  205   HPPRALNTKFDGSSILKRCSSNANCRNVDSERARFDSNWLNRWMELDNKCRQTGDASLKT  264

Query  529   GPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSP  708
             G  DD KSDKILE+DT +P F P H +    +     S  Y+     + +  AH+   SP
Sbjct  265   GRPDDDKSDKILEVDTWRPHFKPHHSSSSLQTAHCYLSSDYN-----NDNFMAHE---SP  316

Query  709   SYCEAQSLSPQNFGQ-----QIN---------ESCFCTADNSPQFYSASSKGGS-SRVGP  843
             S   A++L+ Q+F       Q+N         E+   TADNSPQ +SA+S+ GS ++ GP
Sbjct  317   SKRSAKALN-QSFSSSREVLQLNSLKFHRGKEEATSRTADNSPQSFSANSRNGSGAKRGP  375

Query  844   FTPSKSDAR-SCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYG  1020
             FTP++S+      SGYS HPNYM+ TES +AK+RS SAP+QR +++R  ST+R  +H  G
Sbjct  376   FTPTRSECSWGFFSGYSGHPNYMANTESFQAKVRSQSAPRQRLEFDRYGSTRR-PVHVVG  434

Query  1021  ELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPVIR  1128
                 NS + S L+    +K  P S  ++  G   +R
Sbjct  435   P---NSDQDSDLR----NKVLPASNSVNRIGSSNLR  463



>ref|XP_009136658.1| PREDICTED: protein IQ-DOMAIN 14-like [Brassica rapa]
Length=496

 Score =   149 bits (377),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 140/356 (39%), Positives = 194/356 (54%), Gaps = 44/356 (12%)
 Frame = +1

Query  76    GYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVR  255
             G G+RE+LAA+KIQS FR YL+RRALRALK LVRLQA+V+G++ RK  +  LR + ALVR
Sbjct  174   GRGVREDLAAIKIQSAFRGYLARRALRALKGLVRLQAIVRGHIERKRMSVHLRRMHALVR  233

Query  256   AQSRARSGLPKISESPHSSTKSV----QFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRN  423
             AQ+R R+    ++    SS  +      FQ+PGPPTPEK E  I  RS +   + + KRN
Sbjct  234   AQARVRASRVIVTSESSSSQSNNTKSSHFQNPGPPTPEKLEHSISSRSSKLGHSHLFKRN  293

Query  424   LSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKH  603
              SK     ++    ++R  +                     + +KILEID          
Sbjct  294   GSKANNNSNKPYTSAHREVF-----------------TAMNEEEKILEID----------  326

Query  604   RnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQ-INESCFCT  780
             R            D + YS     D++       P Y  A   SP +  ++ +N+  F T
Sbjct  327   RKHNSFHTRRSRPDLF-YSSHLVLDNSGRS---GPVY--AMPFSPSSSHEETVNQ--FFT  378

Query  781   ADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSAP  957
             A+NSPQ YSA+S    S     + + SD  +SC   Y+DHP+YM+ TES++AK RS SAP
Sbjct  379   AENSPQLYSATSVSKRSAFTASSIAPSDCTKSCC--YADHPSYMACTESSRAKARSASAP  436

Query  958   KQRPQ-YERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
             K RPQ +   SS+KR+          +++ GS+L A+F +KAYPGSGRLD  GMP+
Sbjct  437   KSRPQLFYDQSSSKRFGFVDVPYCGGDTKSGSALHASFMNKAYPGSGRLDRLGMPI  492



>emb|CDY53133.1| BnaC01g41430D [Brassica napus]
Length=486

 Score =   149 bits (376),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 143/360 (40%), Positives = 198/360 (55%), Gaps = 50/360 (14%)
 Frame = +1

Query  76    GYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVR  255
             G G+ E+LAA+KIQS FR YL+RRALRALK LVRLQA+V+G++ RK  +  LR + ALVR
Sbjct  162   GRGVCEDLAAIKIQSAFRGYLARRALRALKGLVRLQAIVRGHIERKRMSVHLRRMHALVR  221

Query  256   AQSRARSGLPKISESPHSSTKSV----QFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRN  423
             AQ+  R+    ++    SS  +      FQ+PGPPTPEK E  I  RS +   + + K+N
Sbjct  222   AQACVRASRVTVTSESSSSQSNNTKSSHFQNPGPPTPEKLEHSISSRSSKLGHSHIFKKN  281

Query  424   LSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKH  603
              SK           +NR           + G+ R       + +KILEID          
Sbjct  282   GSK---------ANNNR----------PYAGAHREVFSAMNEEEKILEID----------  312

Query  604   RnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTA  783
             R    S       D +  S     +S     V+S  +  + S       + +N+  F TA
Sbjct  313   RKHNSSYTRRSRPDMFYSSHLVLDNSGRSGPVYSMPFSPSSSHE-----ETVNQ--FFTA  365

Query  784   DNSPQFYSASSKGGSSRVGPFTPSKSDA-RSCLSGYSDHPNYMSYTESAKAKMRSLSAPK  960
             +NSPQ YSA+S    S     + + SD  +SC   Y+DHP+YM+ TES++AK RS+SAPK
Sbjct  366   ENSPQLYSATSVSKRSAFTASSIAPSDCTKSCC--YADHPSYMACTESSRAKARSVSAPK  423

Query  961   QRPQ--YERSSSTKRYSI----HGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
              RPQ  YE+SSS KR+      +  G+ ++  Q+GS+L A+F +KAYPGSGRLD  GMP+
Sbjct  424   SRPQLFYEQSSS-KRFGFVDVPYCGGDTKSGPQKGSALHASFMNKAYPGSGRLDRLGMPI  482



>ref|XP_004234367.1| PREDICTED: uncharacterized protein LOC101268068 [Solanum lycopersicum]
Length=486

 Score =   147 bits (370),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 144/368 (39%), Positives = 203/368 (55%), Gaps = 26/368 (7%)
 Frame = +1

Query  88    REELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSR  267
             R E AAVKIQS FRAYL+RRALRALK LV+LQALV+G +VRK +ADMLR +QA+ R Q+R
Sbjct  117   RREWAAVKIQSEFRAYLARRALRALKGLVKLQALVRGRIVRKQSADMLRRMQAMARIQAR  176

Query  268   ARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRS----GQNDDTIMLKRNLSKR  435
             A +     S+  HSS ++ +F+HPG  TP K++   +  +    G N     LK++ SK 
Sbjct  177   ASANRNVTSDPSHSSIRASRFEHPGIATPRKYDPQQYSFNCKYHGPN-----LKKSGSKL  231

Query  436   RV---IG-DQEKVRSNRMDYRMDAWSWEHQGSS---RSGPIDDGKSDKILEIDTGKPVFL  594
             ++    G D+  + S  + + M+  +    G +   ++G   D  +DKILEIDT KP   
Sbjct  232   KLHESFGQDRSHLASQYIHHWMEECAKNGYGDTSLKKNGGDHDESTDKILEIDTWKPSLH  291

Query  595   PKHRnlfhsshlslnsDQYSYSLATSKDST---AHQIVHSPSYC--EAQSLSPQNFGQQI  759
             PK       +    + +  ++   T    +    + +  +PS    E  SL    F Q  
Sbjct  292   PKPSEKKSHNSRYSSWNDNAHGTRTVNSMSKLLGNHMKPNPSISSGEVSSLRSLTFCQDT  351

Query  760   NESCFCTADNSPQFYSASSK-GGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKA  933
             ++    T + SP  +S  S+ G SSR GP + S+SD +RS    Y  HPNYMS TES  A
Sbjct  352   DQPAAWTVERSPGVHSTLSRPGSSSRRGP-SLSRSDCSRSLFGDYLGHPNYMSNTESYLA  410

Query  934   KMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFG  1113
             K+RS SAP+QR Q+E+  STK   + G  +  TNS++      NF +K  PGSG+ D  G
Sbjct  411   KLRSHSAPRQRVQFEKIGSTK--YVDGLVDADTNSEKSWRSLGNFMNKPKPGSGQSDRVG  468

Query  1114  MPVIRDQV  1137
              P  R  V
Sbjct  469   TPDHRSAV  476



>emb|CDY41252.1| BnaA01g12870D [Brassica napus]
Length=488

 Score =   147 bits (370),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 142/360 (39%), Positives = 200/360 (56%), Gaps = 48/360 (13%)
 Frame = +1

Query  76    GYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVR  255
             G G+ E+LAA+KIQS FR YL+RRALRALK LVRLQA+V+G++ RK  +  LR + ALVR
Sbjct  162   GRGVCEDLAAIKIQSAFRGYLARRALRALKGLVRLQAIVRGHIERKRMSVHLRRMHALVR  221

Query  256   AQSRARSGLPKISESPHSSTKSV----QFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRN  423
             AQ+R R+    ++    SS  +      FQ+PGPPTPEK E  I  RS +   + + KRN
Sbjct  222   AQARVRASRVVVTSESSSSQSNNTKSSHFQNPGPPTPEKLEHSISSRSSKLGHSHLFKRN  281

Query  424   LSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKH  603
              SK     ++    ++R     + +S  ++             +KILEID          
Sbjct  282   GSKANNNSNKPYTSAHR-----EVFSAMNE------------EEKILEID----------  314

Query  604   RnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQ-INESCFCT  780
             R    S       D + YS     D++       P Y      SP +  ++ +N+  F T
Sbjct  315   RKHNSSYTRRSRPDMF-YSSHLVLDNSGRS---GPVY--PMPFSPSSSHEETVNQ--FFT  366

Query  781   ADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSAP  957
             A+NSPQ YSA+S    S     + + SD  +SC   Y+DHP+YM+ TES++AK RS SAP
Sbjct  367   AENSPQLYSATSVSKRSAFTASSIAPSDCTKSCC--YADHPSYMACTESSRAKARSASAP  424

Query  958   KQRPQ-YERSSSTKRYSI----HGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
             K RPQ +   SS+KR+      +  G+ ++  Q+GS+L A+F +KAYPGSGRLD  GMP+
Sbjct  425   KSRPQLFYDQSSSKRFGFVDVPYCGGDTKSGPQKGSALHASFMNKAYPGSGRLDRLGMPI  484



>ref|XP_003556089.1| PREDICTED: protein IQ-DOMAIN 14-like [Glycine max]
Length=456

 Score =   146 bits (369),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 141/360 (39%), Positives = 206/360 (57%), Gaps = 27/360 (8%)
 Frame = +1

Query  94    ELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRAR  273
             E AAV+IQS FR YL+RRALRALKALV+LQALV+G++VRK +ADMLR +Q LVR Q++AR
Sbjct  109   ETAAVRIQSAFRGYLARRALRALKALVKLQALVRGHIVRKQSADMLRRMQTLVRLQAQAR  168

Query  274   SGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKR---NLSKRRVI  444
             +    +S+   +   S+       P PE++E      S + D + +LKR   N + R V 
Sbjct  169   ASRAHLSDPSFNFNSSLSHY----PVPEEYEHPPRGFSTKFDGSSILKRCSSNANSRNVD  224

Query  445   GDQEKVRSNRMDYRMDAWSWEHQ---GSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlf  615
              ++ +  SN ++  M+  +   Q    S ++G  DD KSDKILE+DT +P F   H +  
Sbjct  225   SERARFDSNWLNRWMELDNKSSQTGDASLKNGRPDDDKSDKILEVDTWRPHFKSHHSSSS  284

Query  616   hsshlslnsDQYS-YSLATSKDS----TAHQIVHSPSYCEAQSLSPQNFGQQINESCFCT  780
               +     S  Y+  +   + +S    +A  +  S S  E   LS   F +   E+   T
Sbjct  285   FQAAHYYLSSDYNNENFGAAHESPSKRSAKALNQSFSSREVLQLSSLKFHKGKEEASSRT  344

Query  781   ADNSPQFYSASSKGGSSRV---GPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSL  948
             ADNSPQ +SA+S+ GS      GPFTP++S+ +   LSGY  HPNYM+ TES +AK+RS 
Sbjct  345   ADNSPQTFSANSRNGSGARRGGGPFTPTRSECSWGFLSGYPGHPNYMANTESFRAKVRSQ  404

Query  949   SAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPVIR  1128
             SAP+QR +++R  ST+R  +H  G   +NS   S L+    +K  P   +++  G   +R
Sbjct  405   SAPRQRLEFDRYGSTRR-PVHLVG---SNSDHDSDLR----NKVLPAFNQMNRIGSSNLR  456



>ref|XP_008377224.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X1 [Malus domestica]
Length=469

 Score =   145 bits (367),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 147/363 (40%), Positives = 212/363 (58%), Gaps = 20/363 (6%)
 Frame = +1

Query  85    IREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQS  264
             +R  LAAVKIQS FR YL+RRALRALK+LV+LQALV+G +VRK +ADMLR +Q LVR Q+
Sbjct  112   VRRHLAAVKIQSAFRRYLARRALRALKSLVKLQALVRGRIVRKQSADMLRRMQTLVRVQA  171

Query  265   RARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVI  444
             RAR+         HSS+KS    HP P +P+K      + SG+ D   +L+R  S   V 
Sbjct  172   RARAS----QSLMHSSSKSSLSDHPQPESPDKTGYQHRVYSGKFDGPSILQRCRSNSNVR  227

Query  445   G----DQEKVRSNRMDYRMDAWSWEHQ--GSSRSGPIDDGKSDKILEIDTGKPVFLPKHR  606
                  D+ ++ S  +D  M+  +W+++  GS R    DD K DKILE+DT KP    + R
Sbjct  228   DATNLDRRRLASGWLDQWMEEGTWDNRRDGSLRYEHSDDVKVDKILEVDTWKPHLGSQRR  287

Query  607   n-lfhsshlslnsDQYSYSLAT----SKDST-AHQIVHSPSYCEAQSLSPQNFGQQINES  768
                F ++H  ++SD Y+ +  T    SK ST    +  S +   A S+    +    +E+
Sbjct  288   PPAFQTAHRVVSSDHYNPNFMTYDSPSKRSTKGSNLNPSQASINAVSMRYLKYPLATDEA  347

Query  769   CFCTADNSPQFYSASSKGGSS--RVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKM  939
              F TA NSPQ +SAS + GSS  R   FTP++S+ +    +GY+ HPNYM+ TES++AK+
Sbjct  348   AFRTAPNSPQAFSASCRPGSSGRRGHHFTPARSECSWGFFNGYASHPNYMANTESSRAKV  407

Query  940   RSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMP  1119
             RS SAP+QR ++E+   TK+ S+       T+S    +   +  +KA+  S RL+  G  
Sbjct  408   RSQSAPRQRLEFEKYGLTKK-SVPESWNAGTHSDTSFAEDGDLRNKAFSSSSRLNRVGSS  466

Query  1120  VIR  1128
              +R
Sbjct  467   NLR  469



>ref|XP_004515721.1| PREDICTED: protein IQ-DOMAIN 14-like [Cicer arietinum]
Length=451

 Score =   145 bits (366),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 140/334 (42%), Positives = 198/334 (59%), Gaps = 23/334 (7%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             E +AAVKIQS FR YL+RRALRALKALV+LQALV+G++VRK T+DMLR +Q LVR QSRA
Sbjct  122   EIVAAVKIQSAFRGYLARRALRALKALVKLQALVRGHIVRKQTSDMLRRMQTLVRLQSRA  181

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKR---NLSKRRV  441
             R+    +S++    T S +  H   P P+ +E  + + S + D + +LKR   N   R +
Sbjct  182   RASRLHVSDN----TDSFKSSHSRYPVPDDYEHPLRVYSTKFDGSSILKRCSSNAYYRDM  237

Query  442   IGDQEKVRSNRMDYRMDAWSWEHQGSSRSGP--IDDGKSDKILEIDTGKPVFLPKHRnlf  615
               ++ +  S+ +D  M+  +    G S S    +DD KSDKILE+DT KP     H    
Sbjct  238   NLERARFGSSWLDSWMEENTRSQTGDSSSSTKHLDDEKSDKILEVDTWKPHLNSHH----  293

Query  616   hsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQS----LSPQNFGQQINESCFCTA  783
              +S+    ++ YS S   + +  A +   SPS   +++    LS     +   E    TA
Sbjct  294   STSNSFHATNHYSSSNYNNDNFIAFE---SPSKRSSKTHNSILSSMKHHKGKEELASRTA  350

Query  784   DNSPQFYSASSKGGSS-RVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSAP  957
             +NSPQ +SASS+ GS  R   FTP+KS+ +    +GYS +P+YM+ TES++AK RS SAP
Sbjct  351   ENSPQAFSASSRHGSGGRRDSFTPTKSECSWGFFNGYSGYPSYMANTESSRAKARSQSAP  410

Query  958   KQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQ  1059
             +QR ++ER  +T R SI    E  +NS R SSL 
Sbjct  411   RQRLEFERYGATTR-SIQCLWESGSNSDRNSSLN  443



>ref|XP_008376538.1| PREDICTED: protein IQ-DOMAIN 14-like [Malus domestica]
Length=464

 Score =   142 bits (359),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 144/352 (41%), Positives = 210/352 (60%), Gaps = 13/352 (4%)
 Frame = +1

Query  85    IREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQS  264
             +R  LAAVKIQS FR YL+RRALRALK+LV+LQALV+G++VRK +ADMLR +Q LVR Q+
Sbjct  112   VRRHLAAVKIQSTFRRYLARRALRALKSLVKLQALVRGHIVRKQSADMLRRMQTLVRVQA  171

Query  265   RARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVI  444
             RAR+    +SES HSS+KS    HP P +P+K      + S + D   +L+R  S  +V 
Sbjct  172   RARATRSLMSESLHSSSKSFLSYHPLPESPDKIGHQHRVYSSKFDGPSILQRCGSNSKV-  230

Query  445   GDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHR-nlfhs  621
              D+ ++ S  +D  M+  S    GS R    DD K DK+LE+DT KP    + R   F +
Sbjct  231   -DRRRLASGWLDQWMEE-SARRDGSLRYEHSDDMKVDKVLEVDTWKPHLGSQRRPQTFXT  288

Query  622   shlslnsDQYSYSLAT----SKDST-AHQIVHSPSYCEAQSLSPQNFGQQINESCFCTAD  786
             +H  L+SD Y+ S  T    SK ST       + +  +  SL    +    +E+ F T +
Sbjct  289   AHRVLSSDHYNPSFMTYDSPSKRSTKGSNFNRNQAPIDVVSLPSLKYPLATDEAAFRTTE  348

Query  787   NSPQFYSASSKGGSS--RVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSAP  957
             NSPQ +SASS+ G+S  R  PFTP++S+ +    +GY+  PNYM+ TES +AK+RS SAP
Sbjct  349   NSPQAFSASSRPGTSGRRCHPFTPARSECSWGFFNGYAGCPNYMANTESFRAKVRSQSAP  408

Query  958   KQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFG  1113
             +QR ++++   TK+ S+  + +  T S    +   +  ++A+    RL+  G
Sbjct  409   RQRLEFDKYGLTKK-SVPEFWDAGTYSDTSFAEDGDLRNRAFFSPSRLNRVG  459



>gb|AFW59279.1| hypothetical protein ZEAMMB73_392897 [Zea mays]
 gb|AFW59280.1| hypothetical protein ZEAMMB73_392897 [Zea mays]
 gb|AIB05677.1| orphans transcription factor, partial [Zea mays]
Length=289

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 128/285 (45%), Positives = 157/285 (55%), Gaps = 44/285 (15%)
 Frame = +1

Query  334   HPGPPTPEKFEQV---IHMRSGQNDDTIMLKRNLSKR---RVIGDQEKVRSNRMDYRMDA  495
             HP PPTPEK++Q     H RSG       LK N SK      +G +E+  S   ++ +D 
Sbjct  25    HPDPPTPEKYDQAGAPRHARSGS------LKANSSKTPGGERLG-RERSESCGRNW-LDR  76

Query  496   WSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHR---nlfhsshlslnsDQYSYSLA  666
             W  E          DD K+ KILE+D GKP      R   N   S   ++ S+Q S S A
Sbjct  77    WVEERY-------TDDEKNAKILEVDNGKPGRHGSKRRGGNHHQSPCSTMTSEQNSRSYA  129

Query  667   T-----SKDST-AHQIVHSPSYC--EAQSLSPQNFGQQINESCFCTADNSPQFYSASSKG  822
             T     SKDST A Q V SPS     A++LSP      I E C     +SPQF+SA+S+ 
Sbjct  130   TMPESPSKDSTTAQQSVPSPSSVGMAAEALSPLRVPADIAELC-----DSPQFFSATSRP  184

Query  823   GSSRVG-PFTPS-KSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRP--QYERSS  987
             GSSR G  FTP+ KS+ +RS   GYSD PNYM+ TES +AK RS SAPKQRP  QYE+S 
Sbjct  185   GSSRRGGAFTPAAKSECSRSLFGGYSDCPNYMANTESFRAKARSQSAPKQRPQQQYEKSG  244

Query  988   STKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
             S +R S H        +QR  S+ +    KAYPGSGRLD  GMPV
Sbjct  245   SLRRASAHALAAGPAAAQR--SVASLHAMKAYPGSGRLDRLGMPV  287



>ref|XP_008377231.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X2 [Malus domestica]
Length=468

 Score =   142 bits (357),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 147/363 (40%), Positives = 212/363 (58%), Gaps = 21/363 (6%)
 Frame = +1

Query  85    IREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQS  264
             +R  LAAVKIQS FR YL+RRALRALK+LV+LQALV+G +VRK +ADMLR +Q LVR Q+
Sbjct  112   VRRHLAAVKIQSAFRRYLARRALRALKSLVKLQALVRGRIVRKQSADMLRRMQTLVRVQA  171

Query  265   RARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVI  444
             RAR+         HSS+KS    HP P +P+K      + SG+ D   +L+R  S   V 
Sbjct  172   RARAS----QSLMHSSSKSSLSDHP-PESPDKTGYQHRVYSGKFDGPSILQRCRSNSNVR  226

Query  445   G----DQEKVRSNRMDYRMDAWSWEHQ--GSSRSGPIDDGKSDKILEIDTGKPVFLPKHR  606
                  D+ ++ S  +D  M+  +W+++  GS R    DD K DKILE+DT KP    + R
Sbjct  227   DATNLDRRRLASGWLDQWMEEGTWDNRRDGSLRYEHSDDVKVDKILEVDTWKPHLGSQRR  286

Query  607   n-lfhsshlslnsDQYSYSLAT----SKDST-AHQIVHSPSYCEAQSLSPQNFGQQINES  768
                F ++H  ++SD Y+ +  T    SK ST    +  S +   A S+    +    +E+
Sbjct  287   PPAFQTAHRVVSSDHYNPNFMTYDSPSKRSTKGSNLNPSQASINAVSMRYLKYPLATDEA  346

Query  769   CFCTADNSPQFYSASSKGGSS--RVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKM  939
              F TA NSPQ +SAS + GSS  R   FTP++S+ +    +GY+ HPNYM+ TES++AK+
Sbjct  347   AFRTAPNSPQAFSASCRPGSSGRRGHHFTPARSECSWGFFNGYASHPNYMANTESSRAKV  406

Query  940   RSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMP  1119
             RS SAP+QR ++E+   TK+ S+       T+S    +   +  +KA+  S RL+  G  
Sbjct  407   RSQSAPRQRLEFEKYGLTKK-SVPESWNAGTHSDTSFAEDGDLRNKAFSSSSRLNRVGSS  465

Query  1120  VIR  1128
              +R
Sbjct  466   NLR  468



>ref|XP_009371296.1| PREDICTED: protein IQ-DOMAIN 32-like [Pyrus x bretschneideri]
Length=417

 Score =   140 bits (354),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 144/355 (41%), Positives = 213/355 (60%), Gaps = 16/355 (5%)
 Frame = +1

Query  85    IREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQS  264
              R  LAAVKIQS FR YL+RRALRALK+LV+LQALV+G++VRK +ADMLR +Q LVR Q+
Sbjct  56    FRRHLAAVKIQSTFRRYLARRALRALKSLVKLQALVRGHIVRKQSADMLRRMQTLVRVQA  115

Query  265   RARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKR---NLSKR  435
             RAR+    +SES HSS+KS    HP P +P+K      + S + D   ML+R   N + R
Sbjct  116   RARATRSLMSESLHSSSKSSLSYHPLPESPDKIGYQHRVCSSKVDGPSMLQRCGSNSTVR  175

Query  436   RVIG-DQEKVRSNRMDYRMDAWSWEHQ--GSSRSGPIDDGKSDKILEIDTGKPVFLPKHR  606
               I  D+ ++ S  +D  M+  +W+++  GS R    DD K DKILE+DT K     + R
Sbjct  176   DAINLDRRRLASGWLDQWMEESAWDNRGDGSLRYEHSDDVKVDKILEVDTWKSHLGSQRR  235

Query  607   -nlfhsshlslnsDQYSYSLAT----SKDSTAHQIVHSP-SYCEAQSLSPQNFGQQINES  768
                F ++H  ++SD Y+    T    SK ST     ++P +  +  SL    +    +E+
Sbjct  236   PQTFQTAHRVVSSDHYNPGFMTYDSPSKRSTKGSNFNTPQAPIDVVSLRSLKYPLATDEA  295

Query  769   CFCTADNSPQFYSASSKGGSS--RVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKM  939
              F T  NSPQ +SASS+ GSS  R  PFT ++S+ +    +GY+ +PNYM+ TES +AK+
Sbjct  296   AFRTTKNSPQAFSASSRPGSSGRRGHPFTQARSECSWGFFNGYAGYPNYMANTESFRAKV  355

Query  940   RSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLD  1104
             RS SAP+QR ++++   +K+ S+  + +  T S    +  A+  ++A+    RL+
Sbjct  356   RSQSAPRQRLEFDKYGLSKK-SVPEFWDAGTYSDTSFAEDADLRNRAFFSPSRLN  409



>gb|KHN31526.1| hypothetical protein glysoja_029661 [Glycine soja]
Length=307

 Score =   138 bits (347),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 109/305 (36%), Positives = 164/305 (54%), Gaps = 34/305 (11%)
 Frame = +1

Query  226   MLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDT  405
             MLR +Q LVR QSRAR+    +S++ HS   S+       P PE ++  +   S + D +
Sbjct  1     MLRRMQTLVRLQSRARATRGNLSDNMHSFKSSLSHY----PVPEDYQHSLRAYSTKFDGS  56

Query  406   IMLKR---NLSKRRVIGDQEKVRSNRMDYRMDAWSWEH--QGSSRSGPIDDGKSDKILEI  570
             I LKR   N + R +  ++ +  S+ +D  M+  SW      S ++G +DD KSDKILE+
Sbjct  57    I-LKRCSSNANFRDIDVEKARFGSHWLDSWMEENSWRQTRDASLKNGHLDDEKSDKILEV  115

Query  571   DTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFG  750
             DT KP     H +       S       + L++  ++       SPS   +++L+P    
Sbjct  116   DTWKPHLNSHHSSGSSFQTSSH------HYLSSDYNNENFVAYESPSKRSSKALNPSLSS  169

Query  751   QQI------------NESCFCTADNSPQFYSASSKGGS-SRVGPFTPSKSD-ARSCLSGY  888
             +++             E+     ++SPQ +SASS+ GS +R GPFTP+KS+ A S  SGY
Sbjct  170   REVLPFGSLKSHKGKEEAALQNVEDSPQAFSASSRLGSDARRGPFTPTKSECAWSFFSGY  229

Query  889   SDHPNYMSYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANF  1068
               HPNYM+ TES++AK+RS SAP+QR ++ER   + R S+ G  E   +S R S    +F
Sbjct  230   PGHPNYMANTESSRAKVRSHSAPRQRMEFERYGHSTRRSLQGLWEAGPSSDRDS----DF  285

Query  1069  TSKAY  1083
              SKAY
Sbjct  286   RSKAY  290



>gb|ACF79323.1| unknown [Zea mays]
Length=289

 Score =   137 bits (345),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 128/285 (45%), Positives = 156/285 (55%), Gaps = 44/285 (15%)
 Frame = +1

Query  334   HPGPPTPEKFEQV---IHMRSGQNDDTIMLKRNLSKR---RVIGDQEKVRSNRMDYRMDA  495
             HP PPTPEK++Q     H RSG       LK N SK      +G +E+  S   ++ +D 
Sbjct  25    HPDPPTPEKYDQAGAPRHARSGS------LKANSSKTPGGERLG-RERSESCGRNW-LDR  76

Query  496   WSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHR---nlfhsshlslnsDQYSYSLA  666
             W  E          DD K+ KILE+D GKP      R   N   S   ++ S+Q S S A
Sbjct  77    WVEERY-------TDDEKNAKILEVDNGKPGRHGSKRRGGNHHQSPCSTMTSEQNSRSYA  129

Query  667   T-----SKDST-AHQIVHSPSYC--EAQSLSPQNFGQQINESCFCTADNSPQFYSASSKG  822
             T     SKDST A Q V SPS     A++LSP      I E C     +SPQF+SA+S+ 
Sbjct  130   TMPESPSKDSTTAQQSVPSPSSVGMAAEALSPLRVPADIAELC-----DSPQFFSATSRP  184

Query  823   GSSRVG-PFTPS-KSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRP--QYERSS  987
             GSSR G  FTP+ KS+ +RS   GYSD PNYM+ TES +AK RS SAPKQRP  QYE S 
Sbjct  185   GSSRRGGAFTPAAKSECSRSLFGGYSDCPNYMANTESFRAKARSQSAPKQRPQQQYEMSG  244

Query  988   STKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
             S +R S H        +QR  S+ +    KAYPGSGRLD  GMPV
Sbjct  245   SLRRASAHALAAGPAAAQR--SVASLHAMKAYPGSGRLDRLGMPV  287



>ref|XP_009768674.1| PREDICTED: protein IQ-DOMAIN 14 [Nicotiana sylvestris]
Length=495

 Score =   140 bits (352),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 150/370 (41%), Positives = 200/370 (54%), Gaps = 22/370 (6%)
 Frame = +1

Query  88    REELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSR  267
             R E AAVKIQS FRAYL+RRALRALK LV+LQALV+G +VRK +ADMLR +QA+ R Q+R
Sbjct  124   RREWAAVKIQSEFRAYLARRALRALKGLVKLQALVRGRIVRKQSADMLRRMQAMARIQAR  183

Query  268   ARSGLPKISESPHSSTKSVQFQHPGPPTPEKFE-QVIHMRSGQNDDTIMLKRNLSKRRVI  444
             A +      + P+SS K+ +F+HPG  TP K++ Q        +  T  LK++ SK    
Sbjct  184   ASANRTITLDPPYSSIKASRFEHPGIATPRKYDPQQYSFNCKYHGPT--LKKSGSKLNAH  241

Query  445   GDQEKVRSNRMDYRMDAWSWEHQGSSRSGPI--------DDGKSDKILEIDTGKPVFLPK  600
                 + RS+     +  W  E   ++  G I         D  +DKILEIDT KP   PK
Sbjct  242   ESYGQDRSHLASQWIHHWM-EECATNGYGDISLQKGVGDQDESTDKILEIDTWKPRLNPK  300

Query  601   --HRnlfhsshlslnsDQYSYSLATSKDSTAHQIVH-----SPSYCEAQSLSPQNFGQQI  759
                ++  +S   S  +D  +    T    + H   H     S S  E  SL    F Q+ 
Sbjct  301   PSEKSSHNSHFFSSWNDNNAQGTRTVNSISRHLANHMKPNPSISSGEVSSLRSLAFCQET  360

Query  760   NESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAK  936
              +S   T + SP  +S  S+ GSS     +PS+S+ +RS    Y  HPNYMS TES  AK
Sbjct  361   EQSAAWTVERSPGVHSTLSRPGSSSRRGPSPSRSECSRSLFGEYPGHPNYMSNTESYLAK  420

Query  937   MRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGM  1116
             +RS SAP+QR Q+E+  S K+  + G  +  TNS++      NF SKA PGSGR D  G 
Sbjct  421   LRSHSAPRQRLQFEKVGSRKQ--VDGLVDADTNSEKSWRSLGNFRSKAKPGSGRSDRVGT  478

Query  1117  PVIRDQVGFS  1146
             P  +  V FS
Sbjct  479   PDHQRAVRFS  488



>ref|XP_006589561.1| PREDICTED: protein IQ-DOMAIN 14-like [Glycine max]
Length=464

 Score =   139 bits (351),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 142/350 (41%), Positives = 198/350 (57%), Gaps = 24/350 (7%)
 Frame = +1

Query  4    RSTSAAAWCGSTVNSTACINRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlq  183
            R TS      ST + TA      G      E AAV+IQS FR YL+RRALRALKALV+LQ
Sbjct  86   RLTSGGVAATSTSSRTAVTAARVGNL----ETAAVRIQSAFRGYLARRALRALKALVKLQ  141

Query  184  alVKGYLVRKHTADMLRGLQALVRAQSRARSGLPKISE-SPHSSTKSVQFQHPGPPTPEK  360
            ALV+G++VRK +ADMLR +Q LVR Q++AR+    +S+ +P  +  S    H   P PE+
Sbjct  142  ALVRGHIVRKQSADMLRRMQTLVRLQAQARASRAHLSDNTPSFNFNSSLLSHY--PVPEE  199

Query  361  FEQVIHMRSGQNDDTIMLKR---NLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRS-  528
            +E      S + D + +LKR   N + R V  ++    SN ++  M+  +   Q    S 
Sbjct  200  YEHPPRGFSTKFDGSSILKRCSSNANSRNVDSERVGFDSNWLNRWMELDNKCSQTGDASL  259

Query  529  ---GPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshls--lnsDQYSYSLATSKDS----  681
               G  DD KSDKILE+DT +P F   H +   S      LN+D  + + A + +S    
Sbjct  260  KNNGRPDDDKSDKILEVDTWRPHFKSHHNSSSSSQAAHYYLNADYNNENFAAAHESPSKR  319

Query  682  TAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYSASSKGGSSRV---GPFTP  852
            +A  +  S S  E   L    F +   E+   TADNSPQ +SA+S+ GS      GPFTP
Sbjct  320  SAKALNQSFSSREVLQLRSLKFHKGKEEASSRTADNSPQAFSANSRNGSGARRGGGPFTP  379

Query  853  SKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQYERSSSTKR  999
            ++S+ +    SGY+ HPNYM+ TES +AK+RS SAP+QR +++R  ST+R
Sbjct  380  TRSECSLGFFSGYTGHPNYMANTESFRAKVRSQSAPRQRLEFDRYGSTRR  429



>gb|ACF83806.1| unknown [Zea mays]
Length=289

 Score =   136 bits (342),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 127/285 (45%), Positives = 156/285 (55%), Gaps = 44/285 (15%)
 Frame = +1

Query  334   HPGPPTPEKFEQV---IHMRSGQNDDTIMLKRNLSKR---RVIGDQEKVRSNRMDYRMDA  495
             HP PPTPEK++Q     H RSG       LK N SK      +G +E+  S   ++ +D 
Sbjct  25    HPDPPTPEKYDQAGAPRHARSGS------LKANSSKTPGGERLG-RERSESCGRNW-LDR  76

Query  496   WSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHR---nlfhsshlslnsDQYSYSLA  666
             W  E          DD K+ KILE+D GKP      R   N   S   ++ S+Q S S A
Sbjct  77    WVEERY-------TDDEKNAKILEVDNGKPGRHGSKRRGGNHHQSPCSTMTSEQNSRSYA  129

Query  667   T-----SKDST-AHQIVHSPSYC--EAQSLSPQNFGQQINESCFCTADNSPQFYSASSKG  822
             T     SKDST A Q V SPS     A++LSP      I E C     +SPQF+SA+S+ 
Sbjct  130   TMPESPSKDSTTAQQSVPSPSSVGMAAEALSPLRVPADIAELC-----DSPQFFSATSRP  184

Query  823   GSSRVG-PFTPS-KSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRP--QYERSS  987
             GSSR G  FTP+ KS+ +R    GYSD PNYM+ TES +AK RS SAPKQRP  QYE+S 
Sbjct  185   GSSRRGGAFTPAAKSECSRILFGGYSDCPNYMANTESFRAKARSQSAPKQRPQQQYEKSG  244

Query  988   STKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
             S +R S H        +QR  S+ +    KAYPGSGRLD  GMPV
Sbjct  245   SLRRASAHALAAGPAAAQR--SVASLHAMKAYPGSGRLDRLGMPV  287



>ref|XP_009592277.1| PREDICTED: protein IQ-DOMAIN 14-like [Nicotiana tomentosiformis]
Length=493

 Score =   139 bits (350),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 151/372 (41%), Positives = 208/372 (56%), Gaps = 27/372 (7%)
 Frame = +1

Query  88    REELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSR  267
             R E AAVKIQS FRAYL+RRALRALK LV+LQALV+G +VRK +ADMLR +QA+ R Q+R
Sbjct  123   RREWAAVKIQSEFRAYLARRALRALKGLVKLQALVRGRIVRKQSADMLRRMQAMARIQAR  182

Query  268   ARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRS----GQNDDTIMLKRNLSKR  435
             A +     S+ P+SS K+ +F+HPG  TP K++   +  +    G N     LK++ SK 
Sbjct  183   ASANRTITSDPPYSSIKASRFEHPGIATPRKYDPQQYSFNCKYHGPN-----LKKSGSKL  237

Query  436   RVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPI--------DDGKSDKILEIDTGKPVF  591
                    + RS+     +  W  E   ++  G I         D  +DKILEIDT KP  
Sbjct  238   NAHESFGQDRSHLASQWIHNWM-EECATNGYGDISLQKGVGDQDESTDKILEIDTWKPRL  296

Query  592   LPK--HRnlfhsshlslnsD--QYSYSLATSKDSTAHQIVHSPSYC--EAQSLSPQNFGQ  753
              PK   +N  +S + S  +D  Q + ++ +     A+ +  +PS    E  SL    F Q
Sbjct  297   NPKPSEKNSHNSHYFSSWNDNAQGTRTVNSISRHLANHMKPNPSISSGEVSSLRSLAFCQ  356

Query  754   QINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAK  930
             + ++S   T + SP  +S  S+ GSS     +PS+S+ +RS    Y  HPNYMS TES  
Sbjct  357   ETDQSAAWTVERSPGVHSTLSRPGSSSRRGPSPSRSECSRSLFGEYPGHPNYMSNTESYL  416

Query  931   AKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSF  1110
             AK+RS SAP+QR Q+E+  S K+  + G  +  TNS++      NF SKA PGSGR D  
Sbjct  417   AKLRSHSAPRQRLQFEKVGSRKQ--VDGLVDADTNSEKSWRSLGNFRSKAKPGSGRSDRV  474

Query  1111  GMPVIRDQVGFS  1146
             G P  +  V FS
Sbjct  475   GTPDHQRAVRFS  486



>ref|XP_009382295.1| PREDICTED: protein IQ-DOMAIN 1-like [Musa acuminata subsp. malaccensis]
Length=465

 Score =   138 bits (347),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 152/366 (42%), Positives = 198/366 (54%), Gaps = 50/366 (14%)
 Frame = +1

Query  82    GIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQ  261
             G REE AAVKIQS  R YL+RRALRAL+ LV+LQALV+G +VRK  A  LR ++ALVR Q
Sbjct  127   GKREEWAAVKIQSALRGYLARRALRALRGLVKLQALVRGNIVRKQAAQTLRCMEALVRVQ  186

Query  262   SRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRV  441
             +RAR+     SE   SS+        GPPTPEK+E+ +   +  +D +  LKR  S    
Sbjct  187   ARARACRALRSE--RSSSDKCPPPRAGPPTPEKYERTVRANASNSDRSCALKRIPS----  240

Query  442   IGDQEKVRSNRMDYRMDAWSWEHQGSSRSGP---------IDDGKSDKILEIDTGKPVFL  594
               +   + +  M +R   W  E   +SR            +DD +S KILE++      L
Sbjct  241   -NNAGNIAAWNMFHR---WMEERYWNSREAAAKKAGSSASMDDERSSKILEVEDPVKTQL  296

Query  595   PKHRnlfhsshlslns-DQYSYSLATSKDS------TAHQIVHSP-SYCEAQSLSPQNFG  750
                RN  H    S  + D+ S+S    +DS      T  Q V SP S    + LS   F 
Sbjct  297   THERNNHHQCACSTLTPDRKSHSFTAVQDSPLKDFSTLQQSVRSPPSVAMQRCLSSMRFP  356

Query  751   QQINESCFCTAD--NSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTE  921
                    F + D   SPQF   SS+ G +R G FTPSK++ ARS   G +DHPNYM+ TE
Sbjct  357   -------FESVDFVASPQFLYTSSRRGDARKGCFTPSKNECARSLFDGSADHPNYMANTE  409

Query  922   SAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRL  1101
             S++AK RS SAPKQRP+ ++S         G G L    QR S+L A   ++AY G+GRL
Sbjct  410   SSRAKARSQSAPKQRPENDKS---------GSGSL----QRSSALHAKLANRAYTGAGRL  456

Query  1102  DSFGMP  1119
             DS GMP
Sbjct  457   DSLGMP  462



>emb|CDX98786.1| BnaA03g45710D [Brassica napus]
Length=475

 Score =   138 bits (347),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 138/356 (39%), Positives = 191/356 (54%), Gaps = 60/356 (17%)
 Frame = +1

Query  88    REELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSR  267
             RE+LA +KIQS FR YL+RRALRALK LV+LQA+++G++ RK  +  LR + ALVRAQ+R
Sbjct  165   REDLAVIKIQSIFRGYLARRALRALKGLVKLQAILRGHIERKRMSIHLRRMHALVRAQAR  224

Query  268   ARSG----LPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKR  435
              R+      P+ S S  ++TKS  FQ+  PPTPEK E  I   S + D + + KRN S  
Sbjct  225   VRATRVIVTPESSSSQSNNTKSSHFQNTDPPTPEKQEHSI-SSSSKLDHSYIFKRNSSL-  282

Query  436   RVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlf  615
                       +NR    M+                  + +K+LEID          R+  
Sbjct  283   --------ANNNRPLSAMN------------------EEEKVLEID----------RSHN  306

Query  616   hsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQ-INESCFCTADNS  792
             +S       D + YS     D++       P Y  A   SP +  ++ +N+  FCTA+NS
Sbjct  307   NSYTRRNRPDMF-YSSHLVLDNSGRS---GPVY--AFPFSPSSSHEETVNQ--FCTAENS  358

Query  793   PQFYSASS--KGGSSRVGPFTPSKSDARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQR  966
             PQ +SA+S  KG +       PS      C   Y+DHP +M+ TES++AK RS SAPK R
Sbjct  359   PQLHSATSISKGSAFTASSIAPSDCTKSCC---YADHPRFMACTESSRAKARSASAPKLR  415

Query  967   PQYE-RSSSTKRY---SIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
             PQ     SS+KR+    +   G+ R+  Q+ S+L  +F +KAYPGSGRLD  GMP 
Sbjct  416   PQLSCEQSSSKRFGFVDVPYCGDTRSGPQKVSALHTSFMNKAYPGSGRLDQLGMPT  471



>ref|XP_008439181.1| PREDICTED: protein IQ-DOMAIN 14 [Cucumis melo]
Length=470

 Score =   137 bits (345),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 142/359 (40%), Positives = 201/359 (56%), Gaps = 25/359 (7%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             E+ AAVKIQS FR YL+RRALRALKALV+LQALV+G++VRK  ADMLR +Q LVR QSRA
Sbjct  114   EDAAAVKIQSAFRGYLARRALRALKALVKLQALVRGHIVRKQMADMLRRMQTLVRLQSRA  173

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKF-EQVIHMRSGQNDDTIMLKR-----NLSK  432
              +G   +S+S HS++KS         TP    +Q+    S + D++ +LKR     NL  
Sbjct  174   CAGRSNLSDSLHSTSKSSLSHIRVQATPSGIGDQLCAHHSNKFDNSALLKRCGSNSNLKD  233

Query  433   RRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPID-----DGKSDKILEIDTGKPVFLP  597
               V+ D   V S+ +D  M+    E+  ++R  P+      D K+DKILE+DT KP    
Sbjct  234   VTVV-DGAPVGSSWLDRWME----ENLWNNRQLPLKNIHAVDEKTDKILEVDTWKPHLKS  288

Query  598   KHRnlfhsshlslnsDQYSYSLATSKDSTAH-----QIVHSPSYCEAQSLSPQNFGQQIN  762
             +       +    +  +   S  T    + H       V S S  EA SLS   F     
Sbjct  289   QGNINSFKNSQMASDFRNHQSFMTIDSPSKHSSKAANPVSSLSSGEA-SLSSLKFPVGKY  347

Query  763   ESCFCTADNSPQFYSASSK-GGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAK  936
             E    TA+NSPQ +SASS+ G +++    +P++S+ A    SGY+ +PNYM+ TES+KAK
Sbjct  348   EQAPGTAENSPQVHSASSRRGNAAKRATLSPTRSEYAWGYFSGYAGYPNYMANTESSKAK  407

Query  937   MRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFG  1113
             +RS SAPKQR + E+  S KRY+   + +  + S  G S + N ++ A   + R+  F 
Sbjct  408   VRSQSAPKQRLELEKFGSNKRYAQVSW-DAWSFSNNGISHEPNSSNNANSVADRMTKFA  465



>gb|KGN57352.1| hypothetical protein Csa_3G180400 [Cucumis sativus]
Length=470

 Score =   135 bits (340),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 141/359 (39%), Positives = 200/359 (56%), Gaps = 25/359 (7%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             E+ AAVKIQS FR YL+RRALRALKALV+LQALV+G++VRK  ADMLR +Q LVR QSRA
Sbjct  114   EDAAAVKIQSAFRGYLARRALRALKALVKLQALVRGHIVRKQMADMLRRMQTLVRLQSRA  173

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKF-EQVIHMRSGQNDDTIMLKR-----NLSK  432
              +G   +S+S HS++KS         TP    +Q+    S + D++ +LKR     NL  
Sbjct  174   CAGRSNLSDSLHSTSKSSLSHIRVQATPNGTGDQLCAHHSNKFDNSALLKRCGSNSNLKD  233

Query  433   RRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPID-----DGKSDKILEIDTGKPVFLP  597
               V+ D+  V S+ +D  M+    E+  ++R  P+      D K+DKILE+DT KP    
Sbjct  234   VTVV-DRAPVGSSWLDRWME----ENLWNNRQLPLKNIHAVDEKTDKILEVDTWKPHLKS  288

Query  598   KHRnlfhsshlslnsDQYSYSLATSKDSTAH-----QIVHSPSYCEAQSLSPQNFGQQIN  762
             +       +       +   S  T    + H       V S S  E  SLS   F     
Sbjct  289   QGNINSFKNSQMAPDFRNHQSFMTIDSPSKHSSKAANPVSSLSSGEV-SLSSLKFPVGKY  347

Query  763   ESCFCTADNSPQFYSASSK-GGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAK  936
             E    TA+NSPQ +SASS+ G +++    +P++S+ A    SGY+ +PNYM+ TES+KAK
Sbjct  348   EQAPRTAENSPQVHSASSRRGNTAKRATLSPTRSEYAWGYFSGYAGYPNYMANTESSKAK  407

Query  937   MRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFG  1113
             +RS SAPKQR + E+  S KRY+   + +  + S  G S + N ++ A   + R+  F 
Sbjct  408   VRSQSAPKQRLELEKFGSNKRYAQVSW-DAWSFSNNGISHEPNSSNNANSVADRMTKFA  465



>ref|XP_004157228.1| PREDICTED: uncharacterized LOC101216161 [Cucumis sativus]
Length=470

 Score =   135 bits (340),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 141/359 (39%), Positives = 200/359 (56%), Gaps = 25/359 (7%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             E+ AAVKIQS FR YL+RRALRALKALV+LQALV+G++VRK  ADMLR +Q LVR QSRA
Sbjct  114   EDAAAVKIQSAFRGYLARRALRALKALVKLQALVRGHIVRKQMADMLRRMQTLVRLQSRA  173

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKF-EQVIHMRSGQNDDTIMLKR-----NLSK  432
              +G   +S+S HS++KS         TP    +Q+    S + D++ +LKR     NL  
Sbjct  174   CAGRSNLSDSLHSTSKSSLSHIRVQATPNGTGDQLCAHHSNKFDNSALLKRCGSNSNLKD  233

Query  433   RRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPID-----DGKSDKILEIDTGKPVFLP  597
               V+ D+  V S+ +D  M+    E+  ++R  P+      D K+DKILE+DT KP    
Sbjct  234   VTVV-DRAPVGSSWLDRWME----ENLWNNRQLPLKNIHAVDEKTDKILEVDTWKPHLKS  288

Query  598   KHRnlfhsshlslnsDQYSYSLATSKDSTAH-----QIVHSPSYCEAQSLSPQNFGQQIN  762
             +       +       +   S  T    + H       V S S  E  SLS   F     
Sbjct  289   QGNINSFKNSQMAPDFRNHQSFMTIDSPSKHSSKAANPVSSLSSGEV-SLSSLKFPVGKY  347

Query  763   ESCFCTADNSPQFYSASSK-GGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAK  936
             E    TA+NSPQ +SASS+ G +++    +P++S+ A    SGY+ +PNYM+ TES+KAK
Sbjct  348   EQAPRTAENSPQVHSASSRRGNTAKRATLSPTRSEYAWGYFSGYAGYPNYMANTESSKAK  407

Query  937   MRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFG  1113
             +RS SAPKQR + E+  S KRY+   + +  + S  G S + N ++ A   + R+  F 
Sbjct  408   VRSQSAPKQRLELEKFGSNKRYAQVSW-DAWSFSNNGISHEPNSSNNANSVADRMTKFA  465



>ref|XP_009137309.1| PREDICTED: protein IQ-DOMAIN 14-like [Brassica rapa]
Length=471

 Score =   135 bits (339),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 137/357 (38%), Positives = 190/357 (53%), Gaps = 60/357 (17%)
 Frame = +1

Query  88    REELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSR  267
             RE+LA +KIQS FR YL+RRALRAL+ LV+LQA+V+G++ RK  +  LR + ALVRAQ+R
Sbjct  159   REDLAVIKIQSIFRGYLARRALRALRGLVKLQAIVRGHIERKRMSVHLRRMHALVRAQAR  218

Query  268   ARSG----LPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKR  435
              R+      P+ S S  ++TKS  FQ+  PPTPEK E  I   S + D + + KRN S  
Sbjct  219   VRATRAIVTPESSSSQSNNTKSSHFQNTDPPTPEKQEHSISSCSSKLDHSHIFKRNGS--  276

Query  436   RVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlf  615
               + +      + M+                      K +K+LEID          R   
Sbjct  277   --LANNNNKPFSAMN----------------------KEEKVLEID----------RRHN  302

Query  616   hsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQ-INESCFCTADNS  792
             +S       D + YS     D++       P Y  A   SP +  ++ +N+  FCT +NS
Sbjct  303   NSYTRDNRPDMF-YSSHLVLDNSGRS---GPVY--AFPFSPSSSHEETVNQ--FCTVENS  354

Query  793   PQFYSASS-KGGSSRVGPFTPSKSDARSCLSG--YSDHPNYMSYTESAKAKMRSLSAPKQ  963
             PQ +SA+S + GS+    FT S      C     Y DHP +M+ TES++AK RS SAPK 
Sbjct  355   PQPHSATSIRKGSA----FTASSIALSDCTKSCCYVDHPRFMACTESSRAKARSASAPKS  410

Query  964   RPQ-YERSSSTKRY---SIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
             RPQ Y   SS+KR+    +   G+ R+  Q+  +L  +F +KAYPGSGRLD  GMP 
Sbjct  411   RPQLYHEQSSSKRFGFVDVSYCGDTRSGPQKVYALHTSFMNKAYPGSGRLDRLGMPT  467



>ref|XP_004159978.1| PREDICTED: protein IQ-DOMAIN 14-like [Cucumis sativus]
Length=378

 Score =   134 bits (336),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 141/356 (40%), Positives = 190/356 (53%), Gaps = 56/356 (16%)
 Frame = +1

Query  100   AAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRARSG  279
             AA+KIQ+ FR +L+R+ALRAL+ LVRLQALV+G++ RK TA+ ++ +QAL+RAQ+RAR+G
Sbjct  73    AAIKIQAAFRGFLARKALRALRGLVRLQALVRGHIERKRTAEWIKRMQALLRAQARARAG  132

Query  280   LPKIS-ESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGDQE  456
               + S +  HS  K   F    P TPEKFE   H +S                       
Sbjct  133   RSQSSFDFLHSDIKFSSFSSIDPVTPEKFEHSPHTKS-----------------------  169

Query  457   KVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshlsl  636
               R  +M           +  SR   ID    D+ILEI+  K      H  L   S  S 
Sbjct  170   -TRFKQM----------QRSGSRFTTIDAENIDRILEIENEK-----AHFKLKPKSLFSS  213

Query  637   nsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYSASS  816
               +  S S   SK+        S   CE Q  SP  F  ++ E+          F+S SS
Sbjct  214   IKNALSSSDVPSKEPP------SSFSCETQCFSPFKFSHEVEEN---------SFFSVSS  258

Query  817   KGGSSRVGPFTPSKSDA-RSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQYERSSST  993
             +GGS++  PFTP+KSD+ RS  SG S++P+YM+ TES++AKMRS SAP+QRPQYERSSS 
Sbjct  259   RGGSTKKSPFTPAKSDSTRSYFSGDSEYPSYMACTESSRAKMRSHSAPRQRPQYERSSSA  318

Query  994   KRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPVIRDQVGFSGGLWH  1161
             KR S    GE R  +Q+ S+L++NF  KAYP      + G   + D    +  L H
Sbjct  319   KRGSAFIVGESRLTAQQVSTLRSNFIGKAYPVLVDWTNLGCLWVTDTDASNISLLH  374



>ref|XP_011076213.1| PREDICTED: protein IQ-DOMAIN 31 [Sesamum indicum]
Length=460

 Score =   132 bits (332),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 149/399 (37%), Positives = 218/399 (55%), Gaps = 41/399 (10%)
 Frame = +1

Query  4     RSTSAAAWCGSTVNSTACINRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlq  183
             R TS+    G  V +   ++R       R   AA+KIQS FRAYL+RRALRALK LV+LQ
Sbjct  84    RLTSSGRGSGRNVAAYTSVDR-------RRAAAAIKIQSAFRAYLARRALRALKGLVKLQ  136

Query  184   alVKGYLVRKHTADMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKF  363
             ALV+G++VRK +ADMLR +QA+ R Q+RA +     SES +S+TK  +  HPG  +   +
Sbjct  137   ALVRGHMVRKQSADMLRRMQAMARIQARASA---HRSESSNSNTKISKPGHPGVVSLRDY  193

Query  364   EQ----VIHMRSGQNDDTIMLKR---NLSKRRVIGDQEKVRSNRMDYRMDAWSWE--HQG  516
                     H  SG         R   N + +R   +   + SN +D+ M+ ++W   HQ 
Sbjct  194   NHRSGNAKHGGSGLKQLQQYNSRPSMNYNGKR---ESSTLASNWLDHWMEQYAWNNHHQ-  249

Query  517   SSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshlslnsDQYS---YSLATSKDSTA  687
                    DD +SDKILEIDT KP    +  +   S+   L++  YS   +S  +S    +
Sbjct  250   -------DDERSDKILEIDTWKPRQTTRQTDKTFSTSQHLSAGNYSGQEHSNTSSFSRLS  302

Query  688   HQIVH---SPSYCEAQSLSPQNFGQQINESCFC-TADNSPQFYS-ASSKGGSSRVGPFTP  852
              ++     S S  E  S+   +F  + ++     TA+NSP+ +S ASS+  S+  GPFTP
Sbjct  303   AKLQKPNPSTSSEEVLSVISPSFPPERDQVVVVRTAENSPRVHSSASSRPASNPRGPFTP  362

Query  853   SKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELR  1029
             ++S+ +RS    Y  +PNYM+ TES++AK+RS SAPKQR Q+     T   S HG+    
Sbjct  363   ARSECSRSLFGDYLSYPNYMANTESSRAKVRSQSAPKQRLQFH-ELGTSASSGHGFWGSD  421

Query  1030  TNSQRGSSLQANFT-SKAYPGSGRLDSFGMPVIRDQVGF  1143
              NS++G +L  N+T S  Y  +G+L   G P+  D+  F
Sbjct  422   ANSEKGFALPGNYTRSSTYMQAGQLRKQGTPIPGDRYRF  460



>ref|XP_004308110.1| PREDICTED: uncharacterized protein LOC101300399 [Fragaria vesca 
subsp. vesca]
Length=444

 Score =   132 bits (331),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 138/350 (39%), Positives = 198/350 (57%), Gaps = 19/350 (5%)
 Frame = +1

Query  97    LAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRARS  276
             LAAVKIQS FR YL+RRALRALKALV+LQALV+G++VRK TADML+ +Q LVR Q RAR+
Sbjct  89    LAAVKIQSAFRRYLARRALRALKALVKLQALVRGHIVRKQTADMLKRMQTLVRLQDRARA  148

Query  277   GLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRV-----  441
                 +SES HSS+KS    +P P +P+K      + S + D   +LKR  S  +V     
Sbjct  149   TRSLMSESVHSSSKSSLSYNPLPESPDKIGYQQRVYSSKFDGPSLLKRCGSNSKVRNTTS  208

Query  442   IGDQEKVRSNRMDYRMDAWSWEHQ---GSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnl  612
             +  +    S  +D  M+   W +     S R    D  K DKILE+DT KP    +    
Sbjct  209   LDRRRLASSGWLDRWMEESVWNNSRDASSLRYVQADSEKVDKILEVDTWKPHLGSQRNAR  268

Query  613   fhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQS----LSPQNFGQQINESCFC-  777
                +   +     +  L  + DS + +    PS   +QS     S  +    I +     
Sbjct  269   AFQTAQHVMVSDNNSPLFMTFDSPSKRTTKEPSLIPSQSSMDYYSSNSLKYPIGKDEVVA  328

Query  778   --TADNSPQFYSASSKGG--SSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMR  942
               TA+NSPQ +SASS+ G  S+R   F+P++S+ +    S Y+ +P+YM+ TES++AK+R
Sbjct  329   SRTAENSPQAFSASSRPGSRSARRAHFSPTRSEYSWGFFSSYAGYPSYMANTESSRAKVR  388

Query  943   SLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGS  1092
             S SAP+QR ++E+ S TK+ SI  + E  T S+ G +  A+F +KA+  S
Sbjct  389   SQSAPRQRLEFEKYSLTKK-SIQEFCEAGTCSETGLAQDADFRTKAFLSS  437



>emb|CDX94150.1| BnaC07g37840D [Brassica napus]
Length=464

 Score =   129 bits (325),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 135/353 (38%), Positives = 185/353 (52%), Gaps = 68/353 (19%)
 Frame = +1

Query  88    REELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSR  267
             R++LA +KIQS FR YL+RRALRALK LV+LQA+V+G++ RK  +  LR + ALVRAQ+R
Sbjct  168   RDDLAVIKIQSIFRGYLARRALRALKGLVKLQAIVRGHIERKRMSIHLRRMHALVRAQAR  227

Query  268   ARSG----LPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKR  435
              R+      P+ S S  ++TKS  FQ+  PPTPEK E  I + S +   + + KRN S  
Sbjct  228   VRATRVIVTPESSSSQSNNTKSSHFQNTDPPTPEKQEHSISLCSSKLGHSHIFKRNGSM-  286

Query  436   RVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlf  615
                       +N  +  + A + E               +KILE+D          R   
Sbjct  287   ----------ANNNNRPLSAMNEE---------------EKILEMD----------RRHN  311

Query  616   hsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSP-QNFGQQINESCFCTADNS  792
              S       D + YS     D++       P Y     LSP  +  + +N+  FCTA+NS
Sbjct  312   KSYTRRNRPDMF-YSSHLILDNSGRS---GPVY--TFQLSPFSSHEETVNQ--FCTAENS  363

Query  793   PQFYSASS--KGGSSRVGPFTPSKSDARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQR  966
             PQ +SA+S  KG +       PS      C   Y+DHP +M+ TES++AK RS SAPK R
Sbjct  364   PQVHSATSISKGSAFTASSVAPSDCTKSCC---YADHPRFMACTESSRAKARSASAPKSR  420

Query  967   PQ-YERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
             PQ Y   SS+KR+   G+ ++ T          +F +KAYPGSGRLD  GMP 
Sbjct  421   PQLYYEQSSSKRF---GFVDVHT----------SFMNKAYPGSGRLDRLGMPT  460



>ref|XP_006421870.1| hypothetical protein CICLE_v10004956mg [Citrus clementina]
 gb|ESR35110.1| hypothetical protein CICLE_v10004956mg [Citrus clementina]
Length=383

 Score =   126 bits (317),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 97/238 (41%), Positives = 134/238 (56%), Gaps = 12/238 (5%)
 Frame = +1

Query  448   DQEKVRSNRMDYRMD--AWSWEHQGSSRSGP-IDDGKSDKILEIDTGKPVFLPK-HRnlf  615
             D+ ++ SN +D  M+   W+       +SGP  DD KSDKILE+DT KP   P+ H  + 
Sbjct  147   DKGRLGSNWLDRWMEESVWNGHRVSQLKSGPPADDEKSDKILEVDTWKPHLNPRQHNRVI  206

Query  616   hsshlslnsDQYSYSLATSKDSTAHQI-----VHSPSYCEAQSLSPQNFGQQINESCFCT  780
              SS      D  ++S  T    +   +     + S S  E  SLS        +++   T
Sbjct  207   RSSPHGSALDYNNHSYMTIDSPSKLSVKNMNPIPSVSPGEVLSLSSLKVPVGKSDAALRT  266

Query  781   ADNSPQFYSASSKGGSS-RVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSA  954
             ADNSPQ  SAS + GSS R GPFTP++S+ +    SG   HPNYM+ TES++AK+RSLSA
Sbjct  267   ADNSPQVSSASYRPGSSARRGPFTPTRSEYSWGYFSGCIGHPNYMANTESSRAKVRSLSA  326

Query  955   PKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPVIR  1128
             P+QR + ER  STKR S HG+ +   NS+R  +  A+F ++A P S RL  FG   +R
Sbjct  327   PRQRLELERYGSTKR-SAHGFWDGSINSERDFAQHADFRNRASPTSDRLSKFGSINLR  383



>ref|XP_004496596.1| PREDICTED: protein IQ-DOMAIN 14-like [Cicer arietinum]
Length=448

 Score =   125 bits (314),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 124/319 (39%), Positives = 180/319 (56%), Gaps = 41/319 (13%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             EE AAV+IQS FR YL+RRALRALKALV+LQALV+G++VRK T+DMLR +Q LVR Q++A
Sbjct  118   EETAAVRIQSAFRGYLARRALRALKALVKLQALVRGHIVRKQTSDMLRRMQTLVRLQTQA  177

Query  271   RSGLPKIS-ESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKR---NLSKRR  438
             R+    +S ++   S KS   ++P  P  E++E   H+ S +   + +LKR   N + R+
Sbjct  178   RATRAHLSSDNVLPSFKSSLSEYP--PVHEEYEHPHHVYSTKLGGSSILKRSSSNANFRK  235

Query  439   VIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPI--------DDGKSDKILEIDTGKPVFL  594
             +  ++ +  S+ +D       W     S+ G +        D  K DKILE+DT KP F 
Sbjct  236   IDSERTRFGSSWLDQ-----YWMECSESKDGSLKKNEQQHPDHEKIDKILEVDTWKPHFK  290

Query  595   PKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCF  774
               H               +S +   ++   AH           +S+S  +   Q      
Sbjct  291   TNHHTTSSLQTPHY---HFSSNYNNNEKCMAHH----------ESISKHSTKAQNQSLAS  337

Query  775   CTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLS  951
              T DNSPQ +SA       R  PFTP+KS+ +    +GYS +PNYM+ TES++AK+RS S
Sbjct  338   RTTDNSPQTFSA-------RKSPFTPTKSECSWGFFNGYSGYPNYMANTESSRAKVRSQS  390

Query  952   APKQRPQYER-SSSTKRYS  1005
             AP+QR +++R SSST+R+S
Sbjct  391   APRQRIEFDRYSSSTRRHS  409



>ref|XP_006352283.1| PREDICTED: protein IQ-DOMAIN 14-like [Solanum tuberosum]
Length=360

 Score =   120 bits (302),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 99/162 (61%), Gaps = 20/162 (12%)
 Frame = +1

Query  694   IVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYS-ASSKGGSSRVGPFTPSKSDAR  870
             + HS  +    SL+ + F    +E+C+ + DNSPQ +S ASSK   SR GPFTP+KS  R
Sbjct  215   LFHSSEF----SLNSEQFCFSYDETCYSSIDNSPQLHSTASSKCTRSRTGPFTPTKSSTR  270

Query  871   SCLSG-YSD-HPNYMSYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQR  1044
             S  S  YS+ HPNYMSYTE+AKAK RS+SAP+ R QY+     KRYS       R+N Q+
Sbjct  271   SYTSDEYSNNHPNYMSYTEAAKAKTRSMSAPRLRSQYD-----KRYS-------RSNMQK  318

Query  1045  GSSLQANFTSKAY-PGSGRLDSFGMPVIRDQVGFSGGLWHRY  1167
             GS+  ANFTSK    GS RLD  G+P+  D   F  G  H Y
Sbjct  319   GSNCYANFTSKGVCSGSDRLDKIGVPISGDLDEFGRGFCHIY  360


 Score =   109 bits (273),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +1

Query  91   EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
            EE AAV IQSHFRAYLSRRALRALK LV+LQALV+G++VRK TADMLR +QAL+RAQSRA
Sbjct  90   EEWAAVVIQSHFRAYLSRRALRALKGLVKLQALVRGHIVRKQTADMLRRMQALIRAQSRA  149

Query  271  RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLS  429
            R G   + ESP  S KS QF   GP TP+KFEQ+I  RS +ND   MLKRN S
Sbjct  150  RLGRSMVFESPPFSAKSTQFIPHGPTTPDKFEQIIRARSMKNDQMFMLKRNSS  202



>emb|CDX98787.1| BnaA03g45720D [Brassica napus]
Length=296

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 109/322 (34%), Positives = 160/322 (50%), Gaps = 62/322 (19%)
 Frame = +1

Query  190   VKGYLVRKHTADMLRGLQALVRAQSRARSG----LPKISESPHSSTKSVQFQHPGPPTPE  357
             ++G++ RK  +  LR + ALVRAQ+R R+      P+ S S  ++TKS  FQ+  PP P+
Sbjct  22    LRGHIERKRMSIHLRRMHALVRAQARVRATRVIVTPESSSSQSNNTKSSHFQNTDPPMPK  81

Query  358   KFEQVIHMRSGQNDDTIMLKRNLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPI  537
             K E  I   S + D + + KRN S            +NR    + A + E          
Sbjct  82    KQEHSIS-SSSKLDHSYIFKRNSSL---------ANNNRP---LSAMNEE----------  118

Query  538   DDGKSDKILEIDTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYC  717
                  +K+LEID          R+  +S       D + YS     D++       P Y 
Sbjct  119   -----EKVLEID----------RSHNNSYTRRNRPDMF-YSSHMVPDNSGRS---GPVY-  158

Query  718   EAQSLSPQNFGQQ-INESCFCTADNSPQFYSASS--KGGSSRVGPFTPSKSDARSCLSGY  888
              A   SP +  ++ +N+  FCTA+NSPQ +S++S  +G +       PS      C   Y
Sbjct  159   -AFPFSPSSSHEETVNQ--FCTAENSPQLHSSTSISQGSAFTASSVAPSDCTKSCC---Y  212

Query  889   SDHPNYMSYTESAKAKMRSLSAPKQRPQ-YERSSSTKRYSIHGY---GELRTNSQRGSSL  1056
             +DHP +M+ TES++A  RS SAPK RPQ Y   SS KR+ +      G+ R+  Q+ S++
Sbjct  213   TDHPRFMACTESSRA--RSASAPKSRPQLYHEQSSLKRFGLVDVPYCGDTRSGPQKVSAV  270

Query  1057  QANFTSKAYPGSGRLDSFGMPV  1122
               +F +KAYPGSGRLD  GMP 
Sbjct  271   HTSFMNKAYPGSGRLDRLGMPT  292



>ref|XP_011101185.1| PREDICTED: protein IQ-DOMAIN 14-like [Sesamum indicum]
Length=355

 Score =   118 bits (295),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 95/276 (34%), Positives = 150/276 (54%), Gaps = 20/276 (7%)
 Frame = +1

Query  190  VKGYLVRKHTADMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQ  369
            V+G++VRK +A+MLR +QA+ R Q+RA +     S+S +S        HPG     K+E+
Sbjct  27   VRGHIVRKQSANMLRRMQAMARIQARASAHRSYTSDSSNSKINFSNSSHPGVTNFRKYEE  86

Query  370  VIHMRSGQNDDT-IMLKRNLSKRRVIGDQE-KVRSNRMDYRMDAWSWEHQGSS-RSGPID  540
                RS        +LK+N  +  ++  +  ++ +  +++ M+  +W +  +S   G  D
Sbjct  87   ----RSNSAKHVGSLLKQNHPRSSIVNKESTQIATRWLNHWMEQCAWSNLDTSLERGHGD  142

Query  541  DGKSDKILEIDTGKP--------VFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQI  696
            D ++DKILEIDT KP          +P   +  + S  +    +YS     S+ S+  Q 
Sbjct  143  DERTDKILEIDTWKPNQNTSRNDRMVP---SSQYFSAWNGMGQEYSKISPVSRLSSKLQK  199

Query  697  VH-SPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSDA-R  870
             + S S  E  S+    F  + +     TA+NSP+ +SASS+  S+  GPFTP++S+  R
Sbjct  200  PNPSISSEEVLSVISPKFPPEGDHVAAGTAENSPRVHSASSRPTSNVRGPFTPARSECCR  259

Query  871  SCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQYE  978
            S    Y  HPNYM+ TES++AK+RS SAPKQR Q+E
Sbjct  260  SLFGDYLGHPNYMANTESSRAKVRSHSAPKQRMQFE  295



>gb|KHN02804.1| hypothetical protein glysoja_016046 [Glycine soja]
Length=309

 Score =   117 bits (292),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 101/276 (37%), Positives = 149/276 (54%), Gaps = 20/276 (7%)
 Frame = +1

Query  226  MLRGLQALVRAQSRARSGLPKISE-SPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDD  402
            MLR +Q LVR Q++AR+    +S+ +P  +  S    H   P PE++E      S + D 
Sbjct  1    MLRRMQTLVRLQAQARASRAHLSDNTPSFNFNSSLLSHY--PVPEEYEHPPRGFSTKFDG  58

Query  403  TIMLKR---NLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRS----GPIDDGKSDKI  561
            + +LKR   N + R V  ++    SN ++  M+  +   Q    S    G  DD KSDKI
Sbjct  59   SSILKRCSSNANSRNVDSERVGFDSNWLNRWMELDNKCSQTGDASLKNNGRPDDDKSDKI  118

Query  562  LEIDTGKPVFLPKHRnlfhsshls--lnsDQYSYSLATSKDS----TAHQIVHSPSYCEA  723
            LE+DT +P F   H +   S      LN+D  + + A + +S    +A  +  S S  E 
Sbjct  119  LEVDTWRPHFKSHHNSGSSSQAAHYYLNADYNNENFAAAHESPSKRSAKALNQSFSSREV  178

Query  724  QSLSPQNFGQQINESCFCTADNSPQFYSASSKGGSSRV---GPFTPSKSD-ARSCLSGYS  891
              L    F +   E+   TADNSPQ +SA+S+ GS      GPFTP++S+ +    SGY+
Sbjct  179  LQLRSLKFHKGKEEASSRTADNSPQAFSANSRNGSGARRGGGPFTPTRSECSLGFFSGYT  238

Query  892  DHPNYMSYTESAKAKMRSLSAPKQRPQYERSSSTKR  999
             HPNYM+ TES +AK+RS SAP+QR +++R  ST+R
Sbjct  239  GHPNYMANTESFRAKVRSQSAPRQRLEFDRYGSTRR  274



>emb|CDY41368.1| BnaC03g65130D [Brassica napus]
Length=420

 Score =   116 bits (291),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 132/377 (35%), Positives = 178/377 (47%), Gaps = 89/377 (24%)
 Frame = +1

Query  4     RSTSAAAWCGSTVNSTACINRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlq  183
             R TS A +     +  A ++R       R+ LAA+KIQS FR YL+RRALRALK LVRLQ
Sbjct  125   RLTSTANFNSGFNDVVAHVSRFDRYRSGRDSLAAIKIQSTFRGYLARRALRALKGLVRLQ  184

Query  184   alVKGYLVRKHTADMLRGLQALVRAQSRARSGLPKISESPHSS----TKSVQFQHPGPPT  351
             A+V+G++ RK  +  LR + ALVRAQ+R R+    ++    SS    TKS  FQ+PGPPT
Sbjct  185   AIVRGHIERKKMSVHLRRMHALVRAQARVRAHRVILTSESSSSQSNHTKSSHFQNPGPPT  244

Query  352   PEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSG  531
             PEK E  I  RS +   + + KRN S         K R NR D    +       S RSG
Sbjct  245   PEKLEYSISSRSSKLGHSHLSKRNGS---------KARRNRPDIFYSS-HLVLDNSGRSG  294

Query  532   PIDDGKSDKILEIDTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPS  711
             P+                                       Y +  S  S+  + V    
Sbjct  295   PV---------------------------------------YVMPFSPSSSHEETVS--K  313

Query  712   YCEAQSLSPQNFGQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSDARSCLSGYS  891
             +C A++ S Q +          T+ + P  ++ SS           PS+S    C   Y+
Sbjct  314   FCTAEN-STQLYS--------ATSISKPSVFTTSS---------IAPSESTKSCC---YT  352

Query  892   DHPNYMSYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFT  1071
             DHP+YM+ TES++AK RS SAPK RPQ              Y E   + Q G +L  +F 
Sbjct  353   DHPSYMACTESSRAKARSASAPKSRPQL-------------YHEQSLSKQFGDALHTSFM  399

Query  1072  SKAYPGSGRLDSFGMPV  1122
             +K YPGSGRL+  GMP+
Sbjct  400   NKTYPGSGRLNRLGMPI  416



>ref|XP_006353347.1| PREDICTED: uncharacterized protein LOC102581442 [Solanum tuberosum]
Length=324

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 105/316 (33%), Positives = 156/316 (49%), Gaps = 14/316 (4%)
 Frame = +1

Query  226   MLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDT  405
             MLR +QA+ R Q+RA +     S+  HSS ++ +F+HPG  TP K++   +  + +    
Sbjct  1     MLRRMQAMARIQARASANRNVTSDPSHSSIRASRFEHPGIATPRKYDPQQYSFNCKYHGP  60

Query  406   IMLKR--NLSKRRVIG-DQEKVRSNRMDYRMDAWSWEHQGSS---RSGPIDDGKSDKILE  567
              + K    L     +G D+  + S  + + M+  +    G +   ++G   D  +DKILE
Sbjct  61    NLKKSGSKLKPHESLGQDRSHLASQYIHHWMEECAKNGYGDTSLKKNGGDHDESTDKILE  120

Query  568   IDTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVH-----SPSYCEAQSL  732
             IDT KP   PK       +    + +  ++   T    + H   H     S S  E  SL
Sbjct  121   IDTWKPRLHPKPSEKKSHNSHYSSWNDNAHGTRTVNSMSKHLANHMKPNPSISSGEVSSL  180

Query  733   SPQNFGQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYM  909
                 F Q  ++    T ++SP  +S  S+ GSS     +PS+S+ +RS    Y  HPNYM
Sbjct  181   RSLAFCQDTDQPVAWTVEHSPGVHSTLSRPGSSSRRGPSPSRSECSRSLFGDYLGHPNYM  240

Query  910   SYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPG  1089
             S TES  AK+RS SAP+QR Q+E+  STK   + G  +  TNS++      NF +KA PG
Sbjct  241   SNTESYLAKLRSHSAPRQRVQFEKIGSTKY--VDGLVDADTNSEKSWRSLGNFRNKAKPG  298

Query  1090  SGRLDSFGMPVIRDQV  1137
             SG  D  G P  R  V
Sbjct  299   SGLSDRVGTPDHRSAV  314



>gb|AFK48422.1| unknown [Lotus japonicus]
Length=213

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 81/194 (42%), Positives = 113/194 (58%), Gaps = 9/194 (5%)
 Frame = +1

Query  490   DAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshlslnsDQYSYSLAT  669
             +AWS     S + G  DD KSDKILE+DT KP     H N  H      +++ ++   + 
Sbjct  4     NAWSQTGDASLKKGHPDDEKSDKILEVDTWKP-----HLNSHHYLPPDYSNENFTAHESP  58

Query  670   SKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYSASSK-GGSSRVGPF  846
             SK S++     S SY E  S +     +    +   TA+NSPQ +SASS+ G S+R GPF
Sbjct  59    SKRSSSKAPNPSHSYREISSFNSLKLQKGKEAASSRTAENSPQAFSASSRLGSSARRGPF  118

Query  847   TPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQYER--SSSTKRYSIHGY  1017
             TP+KS+ + S  SGY  HPNYM+ TES+KAK+RS SAP+QR ++ER   ++T+R  + G 
Sbjct  119   TPTKSECSFSFFSGYPGHPNYMANTESSKAKVRSQSAPRQRLEFERYGGATTRRSLVQGL  178

Query  1018  GELRTNSQRGSSLQ  1059
              E   NS R S  +
Sbjct  179   WEAGPNSDRDSDFR  192



>gb|EPS73598.1| hypothetical protein M569_01161 [Genlisea aurea]
Length=431

 Score =   111 bits (278),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 115/330 (35%), Positives = 163/330 (49%), Gaps = 73/330 (22%)
 Frame = +1

Query  193   KGYLVRKHTADMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQV  372
             +GY+VR+ TA +LR LQALVRAQSR RS +        SS  S    H GP TPEK E++
Sbjct  138   RGYIVRRQTAYILRRLQALVRAQSRVRSRVGSSE----SSMISSHAHHQGPATPEKCERI  193

Query  373   IHMRS---GQNDDTIMLKRNLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDD  543
                RS   G +  T+               +K  S+  ++R   W    +  SRS  +D+
Sbjct  194   PTSRSFKYGGHQSTL---------------KKSGSDFDNHRTRPW----RSVSRSNNLDE  234

Query  544   GKSDKILEIDTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEA  723
               + KIL++D    + + K+                    ++   S++ ++++ PSY ++
Sbjct  235   DTTIKILQVDNSNVMMMMKN-------------------PSSHSRSSSRRVLYPPSYHDS  275

Query  724   QSLSPQNFG-------QQINESCFCTADNSPQFYSAS---SKGGSSRVGPFTPSKSDA-R  870
                +            Q +    F   DN+ Q  S S   +   SSR    TP+KSD  R
Sbjct  276   LGSAAAAVSSPSSGEVQSLRRFEFSHYDNAYQGDSISPPTTLYSSSRGLLGTPAKSDGTR  335

Query  871   SC----LSGYSDHP-NYMSYTESAKAKMRSLSAPKQRPQYERSSS---TKRYSIHGYGEL  1026
             SC    ++G  DHP NYM+YT+S+KAK+RS SAPKQRP  ERS S    KRYS++G G+ 
Sbjct  336   SCGNNTIAG--DHPKNYMAYTQSSKAKVRSASAPKQRPPLERSCSASMAKRYSVYGNGDA  393

Query  1027  -RTNSQRGSSLQANFTSKAYPGSGRLDSFG  1113
              +   QRGS       S+ YPGSG LD  G
Sbjct  394   SKVMMQRGS------VSRCYPGSGLLDRVG  417



>ref|XP_010061313.1| PREDICTED: LOW QUALITY PROTEIN: protein IQ-DOMAIN 14 [Eucalyptus 
grandis]
Length=441

 Score =   110 bits (275),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 141/375 (38%), Positives = 189/375 (50%), Gaps = 32/375 (9%)
 Frame = +1

Query  31    GSTVNSTACINRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVR  210
             G+  +  A + R  G     E+LAAV+IQS FR YL+RRALRALKALV+LQALV+G++VR
Sbjct  90    GAAGSXNAPLRRFGGSRPRVEDLAAVRIQSAFRGYLARRALRALKALVKLQALVRGHIVR  149

Query  211   KHTADMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSG  390
             K   DMLR +Q LVR Q RAR+G    S S HSS+KS    HP   +   F   I M  G
Sbjct  150   KQMTDMLRRMQTLVRVQVRARAGRSYTSVSSHSSSKSSVSHHPRCGSNSNFRGNIDM-EG  208

Query  391   QNDDTIMLKRNLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEI  570
                 +  L R +        +E VR             +H  +      DD +S KILE+
Sbjct  209   AKFGSNWLDRWM--------EEGVRD------------DHGDAPPRHRHDDERSSKILEV  248

Query  571   DTGKPVFLPKHRnlfhsshlslnsDQY------SYSLATSKDSTAHQIVHSPSYCEAQSL  732
             DT KP    +     + S        Y       +   +   S A   V S S  E  SL
Sbjct  249   DTWKPHLNSQRNRETYQSLHQAIESNYINQNAMVFESPSKYSSRAPNPVPSLSSEEILSL  308

Query  733   SPQNFGQQINESCFCTADNSPQF--YSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPN  903
                 +     E    +ADNSPQ    S+  +  S+R GPFTP++S+ +    +GYS HPN
Sbjct  309   RSLQYPGGKGEMP-KSADNSPQVNSLSSRPRSSSARRGPFTPTRSECSWGFFNGYSGHPN  367

Query  904   YMSYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAY  1083
             YM+ TES++AK+RS SAP+QR +++R    KR S+    +    S+R   L A+  SK  
Sbjct  368   YMANTESSRAKVRSQSAPRQRLEFDRYGMAKR-SLQASWDAGATSERNYPLYADLRSKGK  426

Query  1084  PGSGRLDSFGMPVIR  1128
               S RLD  G   +R
Sbjct  427   TVSNRLDRLGTANLR  441



>gb|EYU19528.1| hypothetical protein MIMGU_mgv1a006074mg [Erythranthe guttata]
Length=458

 Score =   108 bits (271),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 128/343 (37%), Positives = 187/343 (55%), Gaps = 33/343 (10%)
 Frame = +1

Query  73    GGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALV  252
             GG   R   AAV+IQS FRAYL+RRALRALK LV+LQALV+G++VRK +ADMLR +QA+ 
Sbjct  109   GGDRRRPVAAAVRIQSAFRAYLARRALRALKGLVKLQALVRGHIVRKQSADMLRRMQAMA  168

Query  253   RAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPE-KFEQVIHMRSGQNDDTIMLKRNLS  429
             R Q+RA +     S+  + + K     H        K+EQ     S       +L++N S
Sbjct  169   RIQARASTHRSYTSDYSNPTIKFSNSHHTDVANSLGKYEQRT---SSSKHCGSLLQQNNS  225

Query  430   KRRV------IGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVF  591
             + R+        +   + S  +++ M+  +W +   +     DD +SDKILE+DT KP  
Sbjct  226   RLRMGNNNSSSNENSHLASRWLNHWMEQSTWNNLHDA-----DDERSDKILEVDTWKP-H  279

Query  592   LPKHRnlfhsshlslnsDQY-----SYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQ  756
              P       +   +  + QY      +S A    S   +   S S  +  SL  QN   Q
Sbjct  280   HPTATTATRNDQNAPPTSQYFSAWQDHSRAVPLSSKHQKPNPSASSEDFSSLKSQN--HQ  337

Query  757   INESCFCTADNSPQFYSASSKG--GSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESA  927
             I+ S + TA+NSP+ +S+SS G  GS +  PFTP++S+ +RS    +  HPNYM+ TES+
Sbjct  338   ISAS-YWTAENSPRLHSSSSVGPTGSDQRRPFTPARSECSRSLFGDFLGHPNYMANTESS  396

Query  928   KAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSL  1056
             +AK+RS SAPKQR  +E  +   R     + E  T S++GS +
Sbjct  397   RAKVRSYSAPKQR--FEELAKFSR----DFWETDTISEKGSVI  433



>emb|CAA19822.1| putative protein [Arabidopsis thaliana]
 emb|CAB79261.1| putative protein [Arabidopsis thaliana]
Length=543

 Score =   108 bits (270),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 90/140 (64%), Gaps = 10/140 (7%)
 Frame = +1

Query  721   AQSLSPQNFGQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDH  897
             A   SP +  ++I  S FCTA+NSPQ YSA+S+   S     + + SD  +SC  G  DH
Sbjct  404   ATPFSPSSSHEEIT-SQFCTAENSPQLYSATSRSKRSAFTASSIAPSDCTKSCCDG--DH  460

Query  898   PNYMSYTESAKAKMRSLSAPKQRPQ--YERSSSTKRYSIHGY---GELRTNSQRGSSLQA  1062
             P+YM+ TES++AK RS SAPK RPQ  YER SS KR+        G+ ++  Q+GS+L  
Sbjct  461   PSYMACTESSRAKARSASAPKSRPQLFYERPSS-KRFGFVDLPYCGDTKSGPQKGSALHT  519

Query  1063  NFTSKAYPGSGRLDSFGMPV  1122
             +F +KAYPGSGRLD  GMP+
Sbjct  520   SFMNKAYPGSGRLDRLGMPI  539


 Score = 58.5 bits (140),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 77/128 (60%), Gaps = 20/128 (16%)
 Frame = +1

Query  94   ELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRAR  273
            ELA +KIQS FR YL++RALRALK LVRLQA+V+G++ RK  +  LR + ALVRAQ+R R
Sbjct  167  ELAVIKIQSIFRGYLAKRALRALKGLVRLQAIVRGHIERKRMSVHLRRMHALVRAQARVR  226

Query  274  SG----LPKISESPHSSTKSVQFQHP----------------GPPTPEKFEQVIHMRSGQ  393
            +      P+ S S  ++TKS  FQ+P                GPPTPEK E  I  RS +
Sbjct  227  ATRVIVTPESSSSQSNNTKSSHFQNPVSLVKFPMIVPFNLKHGPPTPEKLEHSISSRSSK  286

Query  394  NDDTIMLK  417
               + + K
Sbjct  287  LAHSHLFK  294



>gb|KHG06192.1| Protein IQ-DOMAIN 31 -like protein [Gossypium arboreum]
Length=430

 Score =   106 bits (264),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 129/329 (39%), Positives = 175/329 (53%), Gaps = 64/329 (19%)
 Frame = +1

Query  91   EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
            +ELAAVKIQS FR YL+RRALRALKALV+LQALV+G++VRK TADMLR +Q LVR Q+RA
Sbjct  101  QELAAVKIQSAFRGYLARRALRALKALVKLQALVRGHIVRKQTADMLRRMQTLVRLQARA  160

Query  271  RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGD  450
            R+    +++S +S+               K     H R G N + +M   NL K R+  +
Sbjct  161  RASRSYMTKSFYSTC--------------KISHSRHARCGSNSN-LMDTINLEKARMGLN  205

Query  451  QEKVRSNRMDYRMDAWSWEH-QGSSRSGPI-----DDGKSDKILEIDTGKPVFL--PKHR  606
                        +D W  E  + + R  P+     DD KSDKILE+DT KP     P +R
Sbjct  206  W-----------LDNWMEESLRNNHRDSPLIHRHADDEKSDKILEVDTWKPNLNCPPCNR  254

Query  607  nlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLS--PQNFGQQI-------  759
            N   S        Q+  +   ++   A+    SP     + L+  P NF  ++       
Sbjct  255  NFRTS--------QHGSAFDYNQTYMAYD---SPRKQSGKGLNRIPDNFSAEVLPLSSLK  303

Query  760  -----NESCFCTA--DNSPQFY--SASSKGGSSRVGPFTPSKSDARSCLSGYSDHPNYMS  912
                 +E    TA  DNSPQ    S+S  G S+R  PF  S+  +   LSG+S HPNYM+
Sbjct  304  HPGRKDEVILRTADIDNSPQVLSASSSRPGSSARRSPFASSEC-SWGYLSGFSVHPNYMA  362

Query  913  YTESAKAKMRSLSAPKQRPQYERSSSTKR  999
             TES +AK RS SAP+QR ++E+  S +R
Sbjct  363  NTESFRAKYRSQSAPRQRLEFEKYGSNRR  391



>ref|XP_006399207.1| hypothetical protein EUTSA_v10013677mg [Eutrema salsugineum]
 gb|ESQ40660.1| hypothetical protein EUTSA_v10013677mg [Eutrema salsugineum]
Length=412

 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 123/333 (37%), Positives = 166/333 (50%), Gaps = 78/333 (23%)
 Frame = +1

Query  34    STVNSTACINRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRK  213
             S+V  T+ INR       +E +AA+KIQS FR YL+RRALRALKALV+LQALVKG++VRK
Sbjct  99    SSVTETSWINRRWA----QEYVAAMKIQSAFRGYLARRALRALKALVKLQALVKGHIVRK  154

Query  214   HTADMLRGLQALVRAQSRARSGL-PKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMR--  384
              TADMLR +Q LVR Q+RAR+     +S+S HS+   V      P +P+ F    H R  
Sbjct  155   QTADMLRRMQTLVRLQARARASRSSHVSDSFHSTMLMV------PSSPQSF----HARCV  204

Query  385   -SGQNDDTIMLKRNLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKI  561
                +    I + ++ + R  +G      S+R+   +D W  E   +  + P  +   DKI
Sbjct  205   SEAEYSKVIAMDQHHNHRSQMG------SSRL---LDQWKTEE--TLWNAPRYNEDDDKI  253

Query  562   LEIDTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQ  741
             LE+DT KP                                      H PSY +    SP+
Sbjct  254   LEVDTWKP--------------------------------------HFPSYHKE---SPR  272

Query  742   NFGQQINESCFCTADNSPQFYSASSKGGSSRVG--PFTPSKSDARSCLSGYSDHPNYMSY  915
               G  +      + DNSPQ  S             PFTP++S+     SGY  HPNYM+ 
Sbjct  273   KRGSLM---VPTSVDNSPQVRSRPGSSSGGSRRRTPFTPTRSEY-EYYSGY--HPNYMAN  326

Query  916   TESAKAKMRSLSAPKQRPQYERSSSTKRYSIHG  1014
             TES +AK+RS SAP+QR Q   S S  + S+ G
Sbjct  327   TESYRAKVRSQSAPRQRLQELSSESGYKRSVQG  359



>ref|XP_010662509.1| PREDICTED: protein IQ-DOMAIN 14 [Vitis vinifera]
Length=441

 Score =   102 bits (253),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 119/334 (36%), Positives = 176/334 (53%), Gaps = 59/334 (18%)
 Frame = +1

Query  70    AGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQAL  249
             +G  G R ++AAV IQS FR YL+RRAL+ALKALV+LQALV+G++VRK +ADMLR +QAL
Sbjct  113   SGSGGRRMDVAAVIIQSAFRGYLARRALKALKALVKLQALVRGHIVRKRSADMLRRMQAL  172

Query  250   VRAQSRARSGLPK-ISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNL  426
              R Q+RAR    + I ES HS+               +F    HMR G N        N+
Sbjct  173   ARVQARARVSRARAILESSHST--------------RRFSLSHHMRWGSNP-------NI  211

Query  427   SKRRVIGDQEKVR--SNRMDYRMDAWSWEHQGSSRSGPI------DDGKSDKILEIDTGK  582
             S    I ++EK +  S+ ++  M+  SW  +    S         DD   DKILE+DT K
Sbjct  212   SD---IFNREKAQQDSSWLEQWMEECSWNDRRRDSSLKTRDPDHHDDESRDKILEVDTWK  268

Query  583   PVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQ---  753
             P               +    +  +  +T + S+ +     P  C++   +P +      
Sbjct  269   P-------------DPNSMGSKRMHQKSTPQFSSYYTKPQKPISCQSMGRAPSSLSSLQC  315

Query  754   --QINESCFCTADNSPQFYSASSKGGSSR-----VGPFTPSKSDARSCLSGYSDHPNYMS  912
               +++E+   TADNSPQ   + ++ GSS          TP ++D  S  + +SDHP YM+
Sbjct  316   PFEVDEAAVYTADNSPQALPSLTRLGSSSARRRSTTALTPPRTD--SSTNFFSDHPKYMA  373

Query  913   YTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHG  1014
              T+S++AK+RS SAP+ R  +++  S+KR S HG
Sbjct  374   NTQSSQAKVRSQSAPRLRLNFDKLGSSKR-SFHG  406



>emb|CBI31824.3| unnamed protein product [Vitis vinifera]
Length=333

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 126/359 (35%), Positives = 185/359 (52%), Gaps = 63/359 (18%)
 Frame = +1

Query  94    ELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRAR  273
             ++AAV IQS FR YL+RRAL+ALKALV+LQALV+G++VRK +ADMLR +QAL R Q+RAR
Sbjct  2     DVAAVIIQSAFRGYLARRALKALKALVKLQALVRGHIVRKRSADMLRRMQALARVQARAR  61

Query  274   SGLPK-ISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGD  450
                 + I ES HS+               +F    HMR G N        N+S    I +
Sbjct  62    VSRARAILESSHST--------------RRFSLSHHMRWGSNP-------NISD---IFN  97

Query  451   QEKVR--SNRMDYRMDAWSWEHQGSSRSGPI------DDGKSDKILEIDTGKPVFLPKHR  606
             +EK +  S+ ++  M+  SW  +    S         DD   DKILE+DT KP       
Sbjct  98    REKAQQDSSWLEQWMEECSWNDRRRDSSLKTRDPDHHDDESRDKILEVDTWKP-------  150

Query  607   nlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQ-----QINESC  771
                     +    +  +  +T + S+ +     P  C++   +P +        +++E+ 
Sbjct  151   ------DPNSMGSKRMHQKSTPQFSSYYTKPQKPISCQSMGRAPSSLSSLQCPFEVDEAA  204

Query  772   FCTADNSPQFYSASSKGGSSR-----VGPFTPSKSDARSCLSGYSDHPNYMSYTESAKAK  936
               TADNSPQ   + ++ GSS          TP ++D  S  + +SDHP YM+ T+S++AK
Sbjct  205   VYTADNSPQALPSLTRLGSSSARRRSTTALTPPRTD--SSTNFFSDHPKYMANTQSSQAK  262

Query  937   MRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFG  1113
             +RS SAP+ R  +++  S+KR S HG  +   NS    S+     S +  GSG LD  G
Sbjct  263   VRSQSAPRLRLNFDKLGSSKR-SFHGCWD--PNSSPNKSIINKGRSGS--GSGCLDRVG  316



>gb|KCW90731.1| hypothetical protein EUGRSUZ_A02807 [Eucalyptus grandis]
Length=346

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 110/322 (34%), Positives = 151/322 (47%), Gaps = 32/322 (10%)
 Frame = +1

Query  190   VKGYLVRKHTADMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQ  369
             V+G++VRK   DMLR +Q LVR Q RAR+G    S S HSS+KS    HP   +   F  
Sbjct  48    VRGHIVRKQMTDMLRRMQTLVRVQVRARAGRSYTSVSSHSSSKSSVSHHPRCGSNSNFRG  107

Query  370   VIHMRSGQNDDTIMLKRNLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGK  549
              I M  G    +  L R +        +E VR             +H  +      DD +
Sbjct  108   NIDM-EGAKFGSNWLDRWM--------EEGVRD------------DHGDAPPRHRHDDER  146

Query  550   SDKILEIDTGKPVFLPKHRnlfhsshlslnsDQY------SYSLATSKDSTAHQIVHSPS  711
             S KILE+DT KP    +     + S        Y       +   +   S A   V S S
Sbjct  147   SSKILEVDTWKPHLNSQRNRETYQSLHQAIESNYINQNAMVFESPSKYSSRAPNPVPSLS  206

Query  712   YCEAQSLSPQNFGQQINESCFCTADNSPQF--YSASSKGGSSRVGPFTPSKSD-ARSCLS  882
               E  SL    +     E    +ADNSPQ    S+  +  S+R GPFTP++S+ +    +
Sbjct  207   SEEILSLRSLQYPGGKGE-MPKSADNSPQVNSLSSRPRSSSARRGPFTPTRSECSWGFFN  265

Query  883   GYSDHPNYMSYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQA  1062
             GYS HPNYM+ TES++AK+RS SAP+QR +++R    KR S+    +    S+R   L A
Sbjct  266   GYSGHPNYMANTESSRAKVRSQSAPRQRLEFDRYGMAKR-SLQASWDAGATSERNYPLYA  324

Query  1063  NFTSKAYPGSGRLDSFGMPVIR  1128
             +  SK    S RLD  G   +R
Sbjct  325   DLRSKGKTVSNRLDRLGTANLR  346



>ref|XP_002312547.2| calmodulin-binding family protein [Populus trichocarpa]
 gb|EEE89914.2| calmodulin-binding family protein [Populus trichocarpa]
Length=435

 Score = 99.0 bits (245),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 126/343 (37%), Positives = 170/343 (50%), Gaps = 55/343 (16%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             EE AAVKIQS FR+YL+R+AL ALK LV+LQALV+G+LVRK     LR +QALV  Q+RA
Sbjct  106   EEDAAVKIQSVFRSYLARKALCALKGLVKLQALVRGHLVRKQATATLRCMQALVNVQTRA  165

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGD  450
             R+    ++E    S ++                 IH +S Q ++ I    + + R +  D
Sbjct  166   RAQRIWMAEDVKPSQRNS----------------IHRKSTQ-ENRIRHTNDENNRGM--D  206

Query  451   QEKVRSNRMDYRMDAWSWEHQGS--SRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhss  624
             QE ++   +D        E +GS  SR+G     ++D            L +HR      
Sbjct  207   QENIKIVEVDV------GESKGSIKSRNGFSHRPQTD------------LTEHRFST---  245

Query  625   hlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFY  804
                     Y+ + A  K    HQI  SP+      +SP+       E+ F TA +SPQ+Y
Sbjct  246   -------HYASNHAYLKKEN-HQI--SPAPSALTDMSPRACSGHFEENSFSTAHSSPQYY  295

Query  805   SASSKGGSSRVGPFTPSKSDARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQ-YER  981
             SA SK   SR+    P    A S    Y   PNYM+ TES +AK+RS SAPKQRP  +ER
Sbjct  296   SAVSKPDPSRIPFALPRPEYAESLSYDYPLFPNYMANTESFRAKVRSHSAPKQRPDSFER  355

Query  982   SSSTKRYSIHGYGELRTNSQRGSSLQANFTSKA--YPGSGRLD  1104
               S KR SI G    R    + SS     T++   YP S +LD
Sbjct  356   QPSRKRASIEGRNVPRPMRMQRSSSNVGATAQGYIYPWSIKLD  398



>ref|XP_009757400.1| PREDICTED: protein IQ-DOMAIN 14 [Nicotiana sylvestris]
Length=465

 Score = 97.8 bits (242),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 120/357 (34%), Positives = 177/357 (50%), Gaps = 65/357 (18%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             EE AAVKIQS FR YL+R+AL ALK LV+LQALV+G+LVRK  A  LR +QALV  Q+RA
Sbjct  141   EEPAAVKIQSVFRGYLARKALNALKGLVKLQALVRGHLVRKQAAATLRCMQALVTVQARA  200

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGD  450
             R+   +++E           ++P  P      Q +H +S Q++                 
Sbjct  201   RAQRLRMAED----------ENPSNP-----RQSVHRKSTQDN-----------------  228

Query  451   QEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshl  630
               K R +  DY  D                     KI+E+D G+     K RN + +   
Sbjct  229   --KFRHSYQDYDEDI--------------------KIVEMDIGESKGSTKSRNSYSNQGQ  266

Query  631   slnsDQYSYSLATSKDSTAHQIVH-SPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYS  807
             +   ++  +  +T K  +  +  H SP+       SP+       E  + TA +SPQ+YS
Sbjct  267   T---ERTEHRFSTHKAYSNQEYQHISPAPSAITDNSPRACSGHFEEYSYGTAQSSPQYYS  323

Query  808   ASSKGGSSRVGPFTPSKSD---ARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQ-Y  975
             A SK   S++ PF+ ++S+     S  +GY  +P+YM+ T+S+ AK RS SAPKQRP+ +
Sbjct  324   AMSKPDPSKI-PFSYARSEYVEPESLYNGYPFYPSYMANTKSSMAKARSHSAPKQRPESF  382

Query  976   ERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSK--AYPGSGRLDSFGMPVIRDQVG  1140
             ER  S +R SI G    R    + SS     T++   YP S +LD   + +   + G
Sbjct  383   ERQPSRRRPSIEGRNVPRAVRMQRSSSHVGSTAQNYQYPWSIKLDRSNISIKDSECG  439



>ref|XP_002517079.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF45242.1| calmodulin binding protein, putative [Ricinus communis]
Length=455

 Score = 97.4 bits (241),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 117/344 (34%), Positives = 169/344 (49%), Gaps = 63/344 (18%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             EE+AA+KIQ+ FR+YL+R+AL ALK LV+LQALV+G+LVRK     LR +QALV AQ+RA
Sbjct  132   EEVAAIKIQAFFRSYLARKALCALKGLVKLQALVRGHLVRKQATTTLRCMQALVTAQARA  191

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGD  450
             R+   +++E              G P  +K  Q IH RS Q++                 
Sbjct  192   RAQRIRMAED-------------GNPATQK--QSIHRRSTQDN-----------------  219

Query  451   QEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSD--KILEIDTGKPVFLPKHRnlfhss  624
               + R +  D                  ID G  +  KI+E+D G+   + K RN + ++
Sbjct  220   --RFRHSNYD------------------IDGGMEENIKIVEMDLGQSKGITKSRNSYSNN  259

Query  625   hlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFY  804
               + +     Y+ +            SP+      +SP+       +  F TA +SPQ+Y
Sbjct  260   PQTEHRISTHYASSNRGYYMPDDSQVSPAPSALTEMSPRACSGHFEDYSFNTAQSSPQYY  319

Query  805   SASSKGGSSRVGPFT-PSKSDARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQ-YE  978
             SA +K       PF+ P    A S    Y   PNYM+ TES++AK+RS SAPKQRP+ +E
Sbjct  320   SAVTKPD-----PFSFPRPEYAESLSYDYPLFPNYMANTESSRAKVRSQSAPKQRPEAFE  374

Query  979   RSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAY--PGSGRLD  1104
             R  S +R S+ G    R    + SS     T++ Y  P S +LD
Sbjct  375   RQPSRRRPSVEGRNVPRAMRMQRSSSHVGATAQNYQHPWSIKLD  418



>ref|XP_002265460.1| PREDICTED: protein IQ-DOMAIN 14 [Vitis vinifera]
Length=464

 Score = 96.7 bits (239),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 121/342 (35%), Positives = 166/342 (49%), Gaps = 53/342 (15%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             EE AAVKIQ+ FRA+L+R+AL ALK LV+LQALV+G LVRK     LR +QALV  Q+RA
Sbjct  135   EEAAAVKIQAAFRAHLARKALCALKGLVKLQALVRGNLVRKQATATLRCMQALVTVQARA  194

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGD  450
             R    +++E     TK           P    Q+   +S Q++      RN +  +  G 
Sbjct  195   RVQRIRMTE----ETK-----------PVNQRQLTQRKSTQDNRF----RNTNHDKDRGM  235

Query  451   QEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshl  630
             +E ++   MD          QG S+             + +  +P F             
Sbjct  236   EENIKIVEMD----------QGESKGSSKGRNSYSNHAQTERAEPRF-------------  272

Query  631   slnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYSA  810
                S  Y+ + A SK     QI  +PS      +SP+       E CF T  +SPQ YSA
Sbjct  273   ---STNYATNHAYSKQDN-QQISPAPS--ALTDMSPRACSGHFEEYCFTTTQSSPQCYSA  326

Query  811   SSKGGSSRVGPFTPSKSDARSCLS-GYSDHPNYMSYTESAKAKMRSLSAPKQRPQ-YERS  984
              SK   + + PF   ++D    LS  Y   PNYM+ TES+KAK+RS SAPKQRP+ +ER 
Sbjct  327   VSKPDCTGL-PFAFPQTDCAESLSYDYPFFPNYMANTESSKAKVRSHSAPKQRPESFERQ  385

Query  985   SSTKRYSIHGYGELRTNSQRGSSLQANFTSKA--YPGSGRLD  1104
              S +R S+ G    R    + SS     T++   YP S +LD
Sbjct  386   PSRRRASMEGRNIPRAMRMQRSSSHVGSTAQGYQYPWSIKLD  427



>ref|XP_011091033.1| PREDICTED: protein IQ-DOMAIN 14-like [Sesamum indicum]
Length=405

 Score = 95.5 bits (236),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 128/358 (36%), Positives = 170/358 (47%), Gaps = 87/358 (24%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             EE AAVKIQS FR YL+R+AL ALK LV+LQALV+G+LVRK     LR +QALV AQ+RA
Sbjct  79    EEAAAVKIQSVFRGYLARKALNALKGLVKLQALVRGHLVRKQATATLRCMQALVTAQARA  138

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGD  450
             R    +++E      K+V  +           Q  H +S Q                   
Sbjct  139   REQRIRMAEE----IKAVDQR-----------QYNHRKSMQ-------------------  164

Query  451   QEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSD--KILEIDTGKPVFLPKHRnlfhss  624
                               EH+  S +   D G  +  KI+E+D G    + K RN     
Sbjct  165   ------------------EHRFRSPNQDFDRGLEENIKIVEMDLGDYKPMTKARN-----  201

Query  625   hlslnsDQYSYSLATSKDSTAHQI-VH-----------SPSYCEAQSLSPQNFGQQINE-  765
                      SYS  T  D T H+I  H           SP+      +SP+       E 
Sbjct  202   ---------SYSNLTQLDRTEHRISTHRTSIKQEHNQISPAPSAITDISPRTCSNHFEEY  252

Query  766   SCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMR  942
             S F TA +SPQ YSA SK   +R+ PF+  +S+ A S  + Y  +PNYM+ TES++AK+R
Sbjct  253   SSFGTAQSSPQCYSAMSKPDPARL-PFSYPRSEYAESLYNEYPFYPNYMANTESSRAKVR  311

Query  943   SLSAPKQRP--QYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSK--AYPGSGRLD  1104
             S SAPKQRP   +ER  S +R S+ G    R    + SS     T++   YP S +LD
Sbjct  312   SHSAPKQRPVETFERQPSRRRPSLEGRNVPRAVRMQRSSSHVGSTAQNYQYPWSVKLD  369



>ref|XP_010256160.1| PREDICTED: protein IQ-DOMAIN 14-like [Nelumbo nucifera]
Length=471

 Score = 95.5 bits (236),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 121/347 (35%), Positives = 169/347 (49%), Gaps = 62/347 (18%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             EE AA+KIQ+ FR+YL+R+ALRALK LV+LQALV+ +LVRK     LR +QALV  Q+RA
Sbjct  141   EEAAAIKIQAVFRSYLARKALRALKGLVKLQALVRAHLVRKQATATLRCMQALVTVQARA  200

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGD  450
             R+   +++E   S T   QF      TP K  Q    R   N+    ++ N+        
Sbjct  201   RAQRIRMAEEAQS-TPQRQF------TPRKSLQDNRFRQAYNEMDRGIEENI--------  245

Query  451   QEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshl  630
                                                KI+E+D G+     K RN + +   
Sbjct  246   -----------------------------------KIVEMDIGESRASSKSRNGYSNHPQ  270

Query  631   slnsDQ-----YSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSP  795
                +DQ     Y+ + A +K    HQ+  SP+      +SP+       E  F T  +SP
Sbjct  271   IERADQRFSIYYAGNRANAKQE--HQLQMSPAPSALTDMSPRVCSGHFEEYSFLTTQSSP  328

Query  796   QFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQ  972
             Q YSA +K   + + PF   +S+ A S  + Y   P+YM+ TES+KAK+RS SAPKQRP 
Sbjct  329   QCYSAVAKPDPT-MAPFAFPRSEYADSVSNDYPFFPHYMANTESSKAKVRSQSAPKQRPD  387

Query  973   -YERSSSTKRYSIHGYGELRT-NSQRGSS-LQANFTSKAYPGSGRLD  1104
              YER  S +R S+ G    R+   QR SS + +      YP S +LD
Sbjct  388   SYERQPSRRRASMEGRNIPRSIRMQRSSSHVGSTIHGYQYPWSIKLD  434



>emb|CAN66770.1| hypothetical protein VITISV_013810 [Vitis vinifera]
Length=570

 Score = 95.9 bits (237),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 122/342 (36%), Positives = 165/342 (48%), Gaps = 53/342 (15%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             EE AAVKIQ+ FRA+L+R+AL ALK LV+LQALV+G LVRK     LR +QALV  Q+RA
Sbjct  135   EEAAAVKIQAAFRAHLARKALCALKGLVKLQALVRGNLVRKQATATLRCMQALVTVQARA  194

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGD  450
             R    +++E     TK           P    Q+   +S Q++      RN +  +  G 
Sbjct  195   RVQRIRMTE----ETK-----------PVNQRQLTQRKSTQDNRF----RNTNHDKDRGM  235

Query  451   QEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshl  630
             +E ++   MD          QG S+             + +  +P F             
Sbjct  236   EENIKIVEMD----------QGESKGSSKGRNSYSNHAQTERAEPRF-------------  272

Query  631   slnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYSA  810
                S  Y+ + A SK     QI  +PS      +SP+       E CF T  +SPQ YSA
Sbjct  273   ---STNYATNHAYSKQDN-QQISPAPSAL--TDMSPRACSGHFEEYCFTTTQSSPQCYSA  326

Query  811   SSKGGSSRVGPFTPSKSDARSCLS-GYSDHPNYMSYTESAKAKMRSLSAPKQRPQ-YERS  984
              SK   + V PF   ++D    LS  Y   PNYM+ TES+KAK+RS SAPKQRP+  ER 
Sbjct  327   VSKPDCTGV-PFAFPQTDCAESLSYDYPFFPNYMANTESSKAKVRSHSAPKQRPESXERQ  385

Query  985   SSTKRYSIHGYGELRTNSQRGSSLQANFTSKA--YPGSGRLD  1104
              S +R S+ G    R    + SS     T++   YP S +LD
Sbjct  386   PSRRRASMEGRNIPRAMRMQRSSSHVGSTAQGYQYPWSIKLD  427



>ref|XP_006838975.1| hypothetical protein AMTR_s00002p00271290 [Amborella trichopoda]
 gb|ERN01544.1| hypothetical protein AMTR_s00002p00271290 [Amborella trichopoda]
Length=472

 Score = 95.1 bits (235),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 122/361 (34%), Positives = 178/361 (49%), Gaps = 62/361 (17%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             EE AA++IQ+ FRAYL+R+AL ALK LV++QALV+G+LVRK     LR +QAL+  Q+RA
Sbjct  137   EERAAIRIQAMFRAYLARKALCALKGLVKIQALVRGHLVRKQATATLRCMQALLTVQARA  196

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGD  450
             R+      +   SS + +   HP                      ++ K+    RR   D
Sbjct  197   RA------QRIQSSCEEI---HP----------------------VIQKQTSIHRRSFQD  225

Query  451   QEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshl  630
              +  +S  M+  MD                  ++ KI+E+D G+     K R  + +  +
Sbjct  226   NQFRQSTDMEKTMD------------------ENVKIVEMDLGESRGSSKSRISYSNPPV  267

Query  631   slnsDQYSYSLATSKDSTAH---QIVHSPSYCEA-QSLSPQNFGQQINESCFCTADNSPQ  798
                  ++S   AT K+ +     ++  SP+   A   LSP+       +  F TA +SP 
Sbjct  268   ERTEHRFSMHYATHKEHSLPPHPKLDLSPAPSPAFPDLSPRTSSGHFEDYSFTTAQSSPH  327

Query  799   FYSASSKGGSSRVGPFTPSKSDARSCLS-GYSDHPNYMSYTESAKAKMRSLSAPKQRPQ-  972
             + SA S+  S+  GPFTPS+ +    LS  YS  PNYM+ TES+KAK RS SAPKQRP  
Sbjct  328   YCSAISRADST--GPFTPSRPEYAESLSHEYSFFPNYMANTESSKAKARSQSAPKQRPDS  385

Query  973   YER---SSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSG--RLDSFGMPVIRDQV  1137
             YE+   ++S +R S  G G  R    + SS     T K Y  +G  +LD   M +   + 
Sbjct  386   YEKPASNNSKRRSSTEGRGIPRGVRMQRSSSHVGATCKGYQYTGPIKLDRSTMSLKDSEC  445

Query  1138  G  1140
             G
Sbjct  446   G  446



>ref|XP_010259130.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X1 [Nelumbo nucifera]
Length=476

 Score = 94.0 bits (232),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 120/361 (33%), Positives = 177/361 (49%), Gaps = 67/361 (19%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             EE AA+KIQ+ FR+YL+R+AL ALK LV+LQALV+G+LVRK     LR ++ALV AQ+RA
Sbjct  139   EEAAAIKIQAVFRSYLARKALSALKGLVKLQALVRGHLVRKQATATLRCMEALVTAQARA  198

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGD  450
             R+   +++E   ++ +                Q IH +S Q+                  
Sbjct  199   RAQRIRLAEEAQTTIQ---------------RQSIHRKSLQD------------------  225

Query  451   QEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSD--KILEIDTGKPVFLPKHRnlfhss  624
                                H+    +  ID G  D  KI+E+D G+     K RN++ + 
Sbjct  226   -------------------HRFRQVNNEIDRGVEDTIKIVEMDLGESRS-SKSRNIYSTP  265

Query  625   hlslnsDQ-----YSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADN  789
               +   +Q     Y+     SK    +Q   SP+      +SP+      ++  F T  +
Sbjct  266   PQTERFEQRLSMYYAGHRVNSKQE--YQFQMSPAPSALTDMSPRACSGHFDDYSFLTTQS  323

Query  790   SPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQR  966
             SPQ Y+A +K  S ++G F  S+S+ A S  + Y   P+YM+ T+S++AK+RS SAPKQR
Sbjct  324   SPQCYTAVTKPDS-KMGSFAFSRSEYADSVSNDYPFFPHYMANTKSSRAKVRSQSAPKQR  382

Query  967   PQ-YERSSSTKRYSIHGYGELR-TNSQRGSS-LQANFTSKAYPGSGRLDSFGMPVIRDQV  1137
             P  +ER  S +R SI G    R T  QR SS L +N     YP   +LD   M +   + 
Sbjct  383   PDSFERQPSRRRASIEGRNIPRSTRMQRSSSHLGSNINGHQYPWPIKLDRSTMSLKDSEC  442

Query  1138  G  1140
             G
Sbjct  443   G  443



>ref|XP_008798489.1| PREDICTED: protein IQ-DOMAIN 14-like [Phoenix dactylifera]
Length=419

 Score = 93.2 bits (230),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 116/360 (32%), Positives = 175/360 (49%), Gaps = 70/360 (19%)
 Frame = +1

Query  46    STACINRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTAD  225
             +TA   R++ G    EE AA++IQ+ FR+YL+R+AL ALK+LV+LQA+V+G+LVRK  A+
Sbjct  101   TTAAPTRSSSG---EEEAAAIRIQAAFRSYLARKALCALKSLVKLQAMVRGHLVRKRAAN  157

Query  226   MLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDT  405
              LR +QAL+ AQ+RAR+   ++ E  HSS+                        GQ++  
Sbjct  158   TLRRMQALLTAQARARAQRIRMLEKAHSSSH-----------------------GQSNS-  193

Query  406   IMLKRNLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKP  585
                      RR   +++   SN         SW +    R    +  ++ KI+E+D G  
Sbjct  194   ---------RRSPRNRQSHVSNP--------SWNNAEVDR----NVEENIKIVEMDHGVS  232

Query  586   VFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINE  765
                 + RN +          +Y +    SK     Q+  SPS      + P+ +     +
Sbjct  233   WSSSRSRNSYTVKQTERTESEYGHKRRPSKVDPLQQVSPSPSALT--DMGPRAYSGDFED  290

Query  766   SCFCTADNSPQFYSASSKGGSSRVGPFTPSKSDARSCLSGYSDHPNYMSYTESAKAKMRS  945
               F TA +SPQ+ SAS          FTP ++         + +PNYM+YTES++AK RS
Sbjct  291   FSFPTAQSSPQYLSAS----------FTPYET---------TFYPNYMAYTESSRAKARS  331

Query  946   LSAPKQRPQY-ERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPV  1122
              SAPKQRP   ER  S +R  + G    ++   + SS  A  T+  YP S  LD   +P+
Sbjct  332   QSAPKQRPNSCERQPSRRRTWVEGRNTPQSVRVQRSSSHAGSTAYQYPWSIELDKSSVPL  391



>ref|XP_011026988.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X1 [Populus euphratica]
Length=460

 Score = 93.6 bits (231),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 126/344 (37%), Positives = 169/344 (49%), Gaps = 58/344 (17%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             EE AAVKIQS FR+YL+R+AL ALK LV+LQALV+G LVRK     LR +QALV AQ+RA
Sbjct  132   EEDAAVKIQSVFRSYLARKALCALKGLVKLQALVRGQLVRKQATATLRCMQALVNAQTRA  191

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIG-  447
             R+    ++E    S ++                 IH +S Q +      RN +     G 
Sbjct  192   RAQRIWMAEDVKPSQRNS----------------IHRKSTQENRI----RNTNDENDRGM  231

Query  448   DQEKVRSNRMDYRMDAWSWEHQGS--SRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhs  621
             DQE ++   +D        E +GS  SR+G     ++D            L +HR     
Sbjct  232   DQENIKIVEVDV------GESKGSIKSRNGYSHRPQTD------------LTEHRFST--  271

Query  622   shlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQF  801
                      Y+ + A SK    HQI  SP+      +SP+       E+ F T  +SPQ+
Sbjct  272   --------HYASNHAYSKIEN-HQI--SPAPSALTDMSPRACSGYFEENSFSTTISSPQY  320

Query  802   YSASSKGGSSRVGPFTPSKSDARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQ-YE  978
              SA SK   SR+ PF   + +    LS     PNYM+ TES +AK+RS SAPKQRP  +E
Sbjct  321   SSAVSKPDPSRI-PFALPRPEYAESLSYDYPFPNYMANTESFRAKVRSHSAPKQRPDSFE  379

Query  979   RSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKA--YPGSGRLD  1104
             R  S +R SI G    R    + SS     T++   YP S +LD
Sbjct  380   RQPSRRRASIEGRNVPRPMRMQRSSSNVGATAQGYIYPWSIKLD  423



>ref|XP_011026994.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X2 [Populus euphratica]
Length=460

 Score = 93.2 bits (230),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 126/344 (37%), Positives = 169/344 (49%), Gaps = 58/344 (17%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             EE AAVKIQS FR+YL+R+AL ALK LV+LQALV+G LVRK     LR +QALV AQ+RA
Sbjct  132   EEDAAVKIQSVFRSYLARKALCALKGLVKLQALVRGQLVRKQATATLRCMQALVNAQTRA  191

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIG-  447
             R+    ++E    S ++                 IH +S Q +      RN +     G 
Sbjct  192   RAQRIWMAEDVKPSQRNS----------------IHRKSTQENRI----RNTNDENDRGM  231

Query  448   DQEKVRSNRMDYRMDAWSWEHQGS--SRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhs  621
             DQE ++   +D        E +GS  SR+G     ++D            L +HR     
Sbjct  232   DQENIKIVEVDV------GESKGSIKSRNGYSHRPQTD------------LTEHRFST--  271

Query  622   shlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQF  801
                      Y+ + A SK    HQI  SP+      +SP+       E+ F T  +SPQ+
Sbjct  272   --------HYASNHAYSKIEN-HQI--SPAPSALTDMSPRACSGYFEENSFSTTISSPQY  320

Query  802   YSASSKGGSSRVGPFTPSKSDARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQ-YE  978
              SA SK   SR+ PF   + +    LS     PNYM+ TES +AK+RS SAPKQRP  +E
Sbjct  321   SSAVSKPDPSRI-PFALPRPEYAESLSYDYPFPNYMANTESFRAKVRSHSAPKQRPDSFE  379

Query  979   RSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKA--YPGSGRLD  1104
             R  S +R SI G    R    + SS     T++   YP S +LD
Sbjct  380   RQPSRRRASIEGRNVPRPMRMQRSSSNVGATAQGYIYPWSIKLD  423



>ref|XP_006420022.1| hypothetical protein CICLE_v10004919mg [Citrus clementina]
 gb|ESR33262.1| hypothetical protein CICLE_v10004919mg [Citrus clementina]
Length=466

 Score = 92.0 bits (227),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 120/350 (34%), Positives = 174/350 (50%), Gaps = 53/350 (15%)
 Frame = +1

Query  70    AGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQAL  249
             +G   + E+ +A+KIQS FRAYL+R+AL ALK LV+LQALV+G+LVRK     LR +QAL
Sbjct  128   SGRASVIEDASAIKIQSIFRAYLARKALCALKGLVKLQALVRGHLVRKQATATLRCMQAL  187

Query  250   VRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLS  429
             V AQ+RAR+   ++++     TK        PP   +  Q IH +S Q +      R+  
Sbjct  188   VTAQARARAQRLRVTDE----TK--------PPVNPR--QSIHRKSTQENRF----RHGH  229

Query  430   KRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRn  609
                  G +E ++   MD+     S + + S  S P+ +    +     +   V+      
Sbjct  230   SEIYRGMEESIKIVEMDHGESKGSTKSRNSYASHPLSERAEHRFSAYYSSNHVY------  283

Query  610   lfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADN  789
                                +++D+  H++  SP+      +SP+       +  + TA +
Sbjct  284   -------------------SNQDN--HEV--SPAPSALTDMSPRACSGHFEDYSYSTAQS  320

Query  790   SPQFYSASSKGGSSRVGPFTPSKSDARSCLS-GYSDHPNYMSYTESAKAKMRSLSAPKQR  966
             SPQ+YSA SK   SRV PF   + D    LS  Y   PNYM+ TES++AK+RS SAPK R
Sbjct  321   SPQYYSAVSKPDPSRV-PFAFPRPDYAESLSYDYPLFPNYMANTESSRAKVRSQSAPKSR  379

Query  967   P--QYERSSSTKRYSIHGYGELR-TNSQRGSS-LQANFTSKAYPGSGRLD  1104
             P   +ER  S  R S+ G    R    QR SS L A   +  YP S +LD
Sbjct  380   PADTFERQPSRSRASMEGRNIPRAVRMQRSSSHLGAAAQNIQYPWSLKLD  429



>ref|XP_009629604.1| PREDICTED: protein IQ-DOMAIN 1 [Nicotiana tomentosiformis]
Length=465

 Score = 91.7 bits (226),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 123/368 (33%), Positives = 175/368 (48%), Gaps = 87/368 (24%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             EE AAVKIQS FR YL+R+AL ALK LV+LQALV+G+LVRK  A  LR +QALV  Q+RA
Sbjct  141   EEPAAVKIQSVFRGYLARKALNALKGLVKLQALVRGHLVRKQAAATLRCMQALVTVQARA  200

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGD  450
             R+   +++E           ++P  P      Q +H +S Q++                 
Sbjct  201   RAQRLRMAED----------ENPNNP-----RQSVHRKSTQDN-----------------  228

Query  451   QEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshl  630
               K R +  DY  D                     KI+E+D G+     K RN       
Sbjct  229   --KFRHSYQDYEEDI--------------------KIVEMDIGESKGSTKSRN-------  259

Query  631   slnsDQYSYSLATSKDSTAHQIVHSPSYC--EAQSLS----------PQNFGQQINESCF  774
                    SYS     + T H+I    +Y   E Q +S          P+       E  +
Sbjct  260   -------SYSNQGQTERTEHRISTHKAYSNQEYQHISSAPSAITDNSPRACSGHFEEYSY  312

Query  775   CTADNSPQFYSASSKGGSSRVGPFTPSKSD--ARSCL-SGYSDHPNYMSYTESAKAKMRS  945
              TA +SPQ++SA SK   S++ PF+ ++S+     CL + Y  +P+YM+ T+S+ AK RS
Sbjct  313   GTAQSSPQYHSAMSKPDPSKI-PFSYARSEYAEPECLYNEYPFYPSYMANTKSSMAKARS  371

Query  946   LSAPKQRPQ-YERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSK--AYPGSGRLDSFGM  1116
              SAPKQRP+ +ER  S +R SI G    R    + SS     T++   YP S +LD   +
Sbjct  372   HSAPKQRPESFERQPSRRRPSIEGRNVPRAVRMQRSSSHVGSTAQNYQYPWSIKLDRSNI  431

Query  1117  PVIRDQVG  1140
              +   + G
Sbjct  432   SIKDSECG  439



>ref|XP_010259131.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X2 [Nelumbo nucifera]
Length=473

 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 121/361 (34%), Positives = 176/361 (49%), Gaps = 70/361 (19%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             EE AA+KIQ+ FR+YL+R+AL ALK LV+LQALV+G+LVRK     LR ++ALV AQ+RA
Sbjct  139   EEAAAIKIQAVFRSYLARKALSALKGLVKLQALVRGHLVRKQATATLRCMEALVTAQARA  198

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGD  450
             R+   +++E   ++ +                Q IH +S Q                   
Sbjct  199   RAQRIRLAEEAQTTIQ---------------RQSIHRKSLQ-------------------  224

Query  451   QEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSD--KILEIDTGKPVFLPKHRnlfhss  624
                      D+R                ID G  D  KI+E+D G+     K RN++ + 
Sbjct  225   ---------DHRF------------RQEIDRGVEDTIKIVEMDLGESRS-SKSRNIYSTP  262

Query  625   hlslnsDQ-----YSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADN  789
               +   +Q     Y+     SK    +Q   SP+      +SP+      ++  F T  +
Sbjct  263   PQTERFEQRLSMYYAGHRVNSKQE--YQFQMSPAPSALTDMSPRACSGHFDDYSFLTTQS  320

Query  790   SPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQR  966
             SPQ Y+A +K  S ++G F  S+S+ A S  + Y   P+YM+ T+S++AK+RS SAPKQR
Sbjct  321   SPQCYTAVTKPDS-KMGSFAFSRSEYADSVSNDYPFFPHYMANTKSSRAKVRSQSAPKQR  379

Query  967   PQ-YERSSSTKRYSIHGYGELR-TNSQRGSS-LQANFTSKAYPGSGRLDSFGMPVIRDQV  1137
             P  +ER  S +R SI G    R T  QR SS L +N     YP   +LD   M +   + 
Sbjct  380   PDSFERQPSRRRASIEGRNIPRSTRMQRSSSHLGSNINGHQYPWPIKLDRSTMSLKDSEC  439

Query  1138  G  1140
             G
Sbjct  440   G  440



>ref|XP_006489449.1| PREDICTED: protein IQ-DOMAIN 14-like [Citrus sinensis]
Length=466

 Score = 90.9 bits (224),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 119/350 (34%), Positives = 174/350 (50%), Gaps = 53/350 (15%)
 Frame = +1

Query  70    AGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQAL  249
             +G   + E+ +A+KIQS FRAYL+R+AL ALK LV+LQALV+G+LVRK     LR +QAL
Sbjct  128   SGRASVIEDASAIKIQSIFRAYLARKALCALKGLVKLQALVRGHLVRKQATATLRCMQAL  187

Query  250   VRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLS  429
             V AQ+RAR+   ++++     TK        PP   +  Q IH +S Q +      R+  
Sbjct  188   VTAQARARAQRLRVTDE----TK--------PPVNPR--QSIHRKSTQENRF----RHGH  229

Query  430   KRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRn  609
                  G +E ++   MD+     S + + S  S P+ +    +     +   V+      
Sbjct  230   SEIYRGMEENIKIVEMDHGESKGSTKSRNSYASHPLSERAEHRFSAYYSSNHVY------  283

Query  610   lfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADN  789
                                +++D+  H++  SP+      +SP+       +  + TA +
Sbjct  284   -------------------SNQDN--HEV--SPAPSALTDMSPRACSGHFEDYSYSTAQS  320

Query  790   SPQFYSASSKGGSSRVGPFTPSKSDARSCLS-GYSDHPNYMSYTESAKAKMRSLSAPKQR  966
             SPQ+YSA SK   S+V PF   + D    LS  Y   PNYM+ TES++AK+RS SAPK R
Sbjct  321   SPQYYSAVSKPDPSKV-PFAFPRPDYAESLSYDYPLFPNYMANTESSRAKVRSQSAPKSR  379

Query  967   P--QYERSSSTKRYSIHGYGELR-TNSQRGSS-LQANFTSKAYPGSGRLD  1104
             P   +ER  S  R S+ G    R    QR SS L A   +  YP S +LD
Sbjct  380   PADTFERQPSRSRASMEGRNIPRAVRMQRSSSHLGAAAQNIQYPWSLKLD  429



>emb|CDO99100.1| unnamed protein product [Coffea canephora]
Length=465

 Score = 90.5 bits (223),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 122/359 (34%), Positives = 176/359 (49%), Gaps = 69/359 (19%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             EE AA+KIQS FRAYL+R+AL ALK LV+LQALV+G+LVRK     LR +QALV  Q+RA
Sbjct  142   EEAAAIKIQSVFRAYLARKALNALKGLVKLQALVRGHLVRKQATATLRCMQALVTVQARA  201

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGD  450
             R+                + Q      P   +Q  H +S Q +      ++  K    G 
Sbjct  202   RAQ---------------RIQMAQESKPNNLKQFHHRKSTQENRFSQSYQDFDK----GM  242

Query  451   QEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshl  630
             +E V                               KI+E+D G P    K RN + ++  
Sbjct  243   EENV-------------------------------KIVEMDIGDPKGSTKSRNSYSNNGQ  271

Query  631   slnsDQYSYSLATSKD-STAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYS  807
             +  +D   + ++T +  S   QI   PS      LSP+       E  F T+ +SPQ+ S
Sbjct  272   TERTD---HRISTHRAYSNQEQISPLPSAIT--DLSPRACSGHFEEYSFGTSQSSPQYCS  326

Query  808   ASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQ-YER  981
             A SK   S+ G F+ ++S+   S  + Y  +P+YM+ TES++AK+RS SAPKQRP+ +ER
Sbjct  327   AISKPDPSK-GAFSYARSEYGDSLYNEYPFYPSYMANTESSRAKVRSHSAPKQRPESFER  385

Query  982   SSSTKRYSIHGYG------ELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPVIRDQVG  1140
               S +R SI G          R++S  GS+ Q N+    YP S +LD   + +   + G
Sbjct  386   QPSRRRPSIEGRNVPRAVRMQRSSSHVGSAAQ-NYQ---YPWSIKLDKSSISLKESECG  440



>gb|KDO74471.1| hypothetical protein CISIN_1g012293mg [Citrus sinensis]
Length=466

 Score = 90.1 bits (222),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 122/357 (34%), Positives = 175/357 (49%), Gaps = 56/357 (16%)
 Frame = +1

Query  58    INRNAGGYG---IREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADM  228
             I   A G G   + E+ +A+KIQS FRAYL+R+AL ALK LV+LQALV+G+LVRK     
Sbjct  121   IRLTASGSGRASVIEDASAIKIQSIFRAYLARKALCALKGLVKLQALVRGHLVRKQATAT  180

Query  229   LRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTI  408
             LR +QALV AQ+RAR+   ++++     TK        PP   +  Q IH +S Q +   
Sbjct  181   LRCMQALVTAQARARAQRLRVTDE----TK--------PPVNPR--QSIHRKSTQENRF-  225

Query  409   MLKRNLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPV  588
                R+       G +E ++   MD+     S + + S  S P+ +    +     +   V
Sbjct  226   ---RHGHSEIYRGMEENIKIVEMDHGESKGSTKSRNSYASHPLSERAEHRFSAYYSSNHV  282

Query  589   FLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINES  768
             +                         +++D+  H++  SP+      +SP+       + 
Sbjct  283   Y-------------------------SNQDN--HEV--SPAPSALTDMSPRACSGHFEDY  313

Query  769   CFCTADNSPQFYSASSKGGSSRVGPFTPSKSDARSCLS-GYSDHPNYMSYTESAKAKMRS  945
              + TA +SPQ+YSA SK   SRV PF   + D    LS  Y   PNYM+ TES++AK+RS
Sbjct  314   SYSTAQSSPQYYSAVSKPDPSRV-PFAFPRPDYAESLSYDYPLFPNYMANTESSRAKVRS  372

Query  946   LSAPKQRP--QYERSSSTKRYSIHGYGELR-TNSQRGSS-LQANFTSKAYPGSGRLD  1104
              SAPK RP   +ER  S  R  + G    R    QR SS L A   +  YP S +LD
Sbjct  373   QSAPKSRPADTFERQPSRSRAYMEGRNIPRAVRMQRSSSHLGAAAQNIQYPWSLKLD  429



>ref|XP_010694040.1| PREDICTED: protein IQ-DOMAIN 32 [Beta vulgaris subsp. vulgaris]
Length=474

 Score = 89.7 bits (221),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 119/346 (34%), Positives = 172/346 (50%), Gaps = 63/346 (18%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             EE AAVKIQS FR+YL+R+AL+AL+ LV+LQALV+G+LVRK     LR +QALV AQ+RA
Sbjct  150   EEAAAVKIQSMFRSYLARKALKALRGLVKLQALVRGHLVRKQATATLRCMQALVTAQARA  209

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGD  450
             R+                                  +RS  +D++I+  R  + RR    
Sbjct  210   RAQ--------------------------------RIRSA-DDESIINHRQSTHRR--NS  234

Query  451   QEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshl  630
             QEK++    D   +    E         +D+G+    +   +   +  P+H N    + +
Sbjct  235   QEKIKHAYHDMEENVKIVE---------MDEGEFGSNVNSRSSYSIPSPRHMNDRMDNRI  285

Query  631   slnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYSA  810
             S+    YS     SK        +SP+      LSP+       E  F TA +SPQ Y+A
Sbjct  286   SVY---YSSQRENSKQDYQQ---YSPAPSAITDLSPRTCSGHFEEYSFATAQSSPQCYTA  339

Query  811   SSKGGSSRVGPFT-PSKSDARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQYERSS  987
              S+   SR  PF+ P+   A +    +  +PNYM+ T+S++AK RS SAPKQRP+ ER  
Sbjct  340   MSRPDPSR-APFSFPNPDYAETMSYEFPFYPNYMANTQSSRAKARSQSAPKQRPELERQP  398

Query  988   ST-KRYSIHGYG------ELRTNSQRGSSLQANFTSKAYPGSGRLD  1104
             S  +R S+ G          R++SQ GS+ Q N+    YP S +LD
Sbjct  399   SRGRRPSVEGRNIPKGAKMQRSSSQVGSTGQ-NY---HYPWSVKLD  440



>emb|CDX98994.1| BnaC09g48410D [Brassica napus]
Length=354

 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 117/331 (35%), Positives = 154/331 (47%), Gaps = 103/331 (31%)
 Frame = +1

Query  34    STVNSTACINRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRK  213
             S+VN T   NRN   +G +E  AA+KIQS FR YL+RRALRALKALV+LQALVKG++VRK
Sbjct  99    SSVNQT---NRNNRRWG-QEYAAAIKIQSAFRGYLARRALRALKALVKLQALVKGHIVRK  154

Query  214   HTADMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQ  393
              TADMLR +Q LVR Q+RAR+     S S H S                           
Sbjct  155   QTADMLRRMQTLVRLQARARA-----SRSSHVSES-------------------------  184

Query  394   NDDTIMLKRNLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSR-SGPIDDGKSDKILEI  570
                             + + E ++   MD+  +  S    GSSR + P+ +  +DKILE+
Sbjct  185   ----------------LSEAEYIKLIAMDHHHNHRS--QMGSSRWNAPLYNEDNDKILEV  226

Query  571   DTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFG  750
             DT KP                                      H PSY +    SP+  G
Sbjct  227   DTWKP--------------------------------------HFPSYHKE---SPRKRG  245

Query  751   QQINESCFCTADNSPQFYSASSKGGSSRVG---PFTPSKSDARSCLSGYSDHPNYMSYTE  921
               +      + +NSPQ  S              PFTP++S+     SGY  HPNYM+ TE
Sbjct  246   SLV---VPTSVENSPQVRSRPGSSSGGGSRRRTPFTPTRSEY-EYYSGY--HPNYMANTE  299

Query  922   SAKAKMRSLSAPKQRPQYERSSSTKRYSIHG  1014
             S +AK+RS SAP+QR +   S S  + S+ G
Sbjct  300   SYRAKVRSQSAPRQRLREFSSESGYKRSVQG  330



>ref|XP_010092431.1| Protein IQ-DOMAIN 31 [Morus notabilis]
 gb|EXB51149.1| Protein IQ-DOMAIN 31 [Morus notabilis]
Length=461

 Score = 88.6 bits (218),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 116/348 (33%), Positives = 168/348 (48%), Gaps = 64/348 (18%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             EE AA+KIQS FR+YL+R+AL ALK LV+LQALV+G+LVRK     LR +QALV AQ+RA
Sbjct  133   EEAAAIKIQSVFRSYLARKALCALKGLVKLQALVRGHLVRKQATATLRCMQALVTAQARA  192

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGD  450
             R+   ++ +     TK V  +   P T  K  Q   +R   +D  I ++ N+        
Sbjct  193   RAQRIRVVDD----TKPVSHR---PSTHRKSVQDNWLRHPYHDIDIGMEENV--------  237

Query  451   QEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshl  630
                                                KI+E+D G      K RN +     
Sbjct  238   -----------------------------------KIVEMDLGGTKGSSKSRNSYSIHPQ  262

Query  631   slnsDQYSYSLATSKDSTAHQIVHSPSYCEAQ-------SLSPQNFGQQINESCFCTADN  789
             +  +D     L+T + ++  + +++ S C+          +SP+       +  F TA +
Sbjct  263   TERTD---CRLSTHRPTSRQENINNNSSCKVSPAPSALTDMSPRACSGHFEDYSFGTAQS  319

Query  790   SPQFYSASSKGGSSRVGPFTPSKSDARSCLS-GYSDHPNYMSYTESAKAKMRSLSAPKQR  966
             SPQ+ SA+SK   SR+ PF   + D    LS     +P+YM+ TES++AK+RS SAPKQR
Sbjct  320   SPQYCSAASKPDPSRL-PFAFPRPDYAESLSYDCPLYPSYMANTESSRAKVRSQSAPKQR  378

Query  967   P--QYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSGRLD  1104
             P   +ER  S +R SI G    R    + SS     T+K Y    +LD
Sbjct  379   PADSFERQPSRRRASIEGRNVPRAVRMQRSSSHVGATAKNYQYPIKLD  426



>gb|KCW90732.1| hypothetical protein EUGRSUZ_A02807 [Eucalyptus grandis]
Length=290

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 105/311 (34%), Positives = 143/311 (46%), Gaps = 32/311 (10%)
 Frame = +1

Query  223   DMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDD  402
             DMLR +Q LVR Q RAR+G    S S HSS+KS    HP   +   F   I M  G    
Sbjct  3     DMLRRMQTLVRVQVRARAGRSYTSVSSHSSSKSSVSHHPRCGSNSNFRGNIDM-EGAKFG  61

Query  403   TIMLKRNLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGK  582
             +  L R +        +E VR             +H  +      DD +S KILE+DT K
Sbjct  62    SNWLDRWM--------EEGVRD------------DHGDAPPRHRHDDERSSKILEVDTWK  101

Query  583   PVFLPKHRnlfhsshlslnsDQY------SYSLATSKDSTAHQIVHSPSYCEAQSLSPQN  744
             P    +     + S        Y       +   +   S A   V S S  E  SL    
Sbjct  102   PHLNSQRNRETYQSLHQAIESNYINQNAMVFESPSKYSSRAPNPVPSLSSEEILSLRSLQ  161

Query  745   FGQQINESCFCTADNSPQF--YSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSY  915
             +     E    +ADNSPQ    S+  +  S+R GPFTP++S+ +    +GYS HPNYM+ 
Sbjct  162   YPGGKGE-MPKSADNSPQVNSLSSRPRSSSARRGPFTPTRSECSWGFFNGYSGHPNYMAN  220

Query  916   TESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAYPGSG  1095
             TES++AK+RS SAP+QR +++R    KR S+    +    S+R   L A+  SK    S 
Sbjct  221   TESSRAKVRSQSAPRQRLEFDRYGMAKR-SLQASWDAGATSERNYPLYADLRSKGKTVSN  279

Query  1096  RLDSFGMPVIR  1128
             RLD  G   +R
Sbjct  280   RLDRLGTANLR  290



>ref|XP_003630704.1| hypothetical protein MTR_8g102400 [Medicago truncatula]
 gb|AET05180.1| IQ calmodulin-binding motif protein [Medicago truncatula]
Length=429

 Score = 88.2 bits (217),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 115/328 (35%), Positives = 168/328 (51%), Gaps = 44/328 (13%)
 Frame = +1

Query  82    GIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQ  261
             G  ++ AAVKIQ+ FR YL+R+ALRALK LV+LQALV+GYLVRK     L  +QAL+RAQ
Sbjct  108   GGHQKFAAVKIQTTFRGYLARKALRALKGLVKLQALVRGYLVRKQATATLHSMQALIRAQ  167

Query  262   SRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRV  441
             +  RS   +       +  + +FQ     + E++    H  S +N+ T  +   +  RR+
Sbjct  168   ATVRSHKSRGLIISTKNETNNRFQTQARRSTERYN---HNESNRNEYTASIP--IHSRRL  222

Query  442   IGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhs  621
                     S+  D  M+++              D  S KI+E+DTG+P    K R+   +
Sbjct  223   --------SSSFDATMNSY--------------DIGSPKIVEVDTGRP----KSRSRRSN  256

Query  622   shlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQ-SLSPQNFGQQINESCFCTADNSPQ  798
             + +S   D  S+   +S      Q+  S  Y   Q + +  ++G    E  F TA ++P+
Sbjct  257   TSISDFGDDPSFQTLSS----PLQVTPSQLYIPNQRNYNESDWGITGEECRFSTAQSTPR  312

Query  799   FYSASSKGGSSRVGPFTPSKSDARSCLSG-YSDHPNYMSYTESAKAKMRSLSAPKQRPQY  975
             F S+ S G    V P TP      S   G Y ++PNYM+ T+S KAK+RS SAPKQRP+ 
Sbjct  313   FTSSCSCGF---VAPSTPKTICGDSFYIGDYGNYPNYMANTQSFKAKLRSHSAPKQRPE-  368

Query  976   ERSSSTKRYSIHGYGELRTNSQRGSSLQ  1059
                   KR S++   E R NS  G  +Q
Sbjct  369   --PGPKKRLSLNELMESR-NSLSGVRMQ  393



>ref|XP_007160280.1| hypothetical protein PHAVU_002G308100g [Phaseolus vulgaris]
 gb|ESW32274.1| hypothetical protein PHAVU_002G308100g [Phaseolus vulgaris]
Length=437

 Score = 88.2 bits (217),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 107/297 (36%), Positives = 151/297 (51%), Gaps = 42/297 (14%)
 Frame = +1

Query  82   GIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQ  261
            G RE LA VKIQ+ FR YL+R+ALRALK LV+LQALV+GYLVRK  A  L  +QAL+RAQ
Sbjct  114  GGRERLAVVKIQTVFRGYLARKALRALKGLVKLQALVRGYLVRKQAAATLHSMQALIRAQ  173

Query  262  SRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRV  441
            +  RS   +   S  + T   +FQ     + E+F+ +                   K   
Sbjct  174  ATVRSKKSRGIMSTKNETH--RFQTQARRSMERFDDI-------------------KSEY  212

Query  442  IGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhs  621
            I     + S R+    DA +  +  +S  G      S KI+E+DTG+P    K R+   +
Sbjct  213  IAP---IHSRRLSSSFDA-TMNNANNSIDG------SPKIVEVDTGRP----KSRSRRSN  258

Query  622  shlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQF  801
            + +S   D  S+    S     H  +  P++   ++     +G    E  F TA ++P+F
Sbjct  259  TSMSDFGDDPSFQTLPSPLPFTHLSI--PNH---RTFHDSEWGLTGEECRFSTAQSTPRF  313

Query  802  YSASSKGGSSRVGPFTPSKSDARSCLSG-YSDHPNYMSYTESAKAKMRSLSAPKQRP  969
             ++ S  GS  V P TP      +   G Y + PNYM+ T+S KAK+RS SAPKQRP
Sbjct  314  TNSCS-CGSLVVAPMTPRSVCTENFFYGQYHNFPNYMANTQSFKAKLRSHSAPKQRP  369



>ref|XP_010693466.1| PREDICTED: protein IQ-DOMAIN 14 [Beta vulgaris subsp. vulgaris]
Length=442

 Score = 88.2 bits (217),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 123/345 (36%), Positives = 183/345 (53%), Gaps = 41/345 (12%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             E  AAVKIQS FR YL+R+AL+ALK LV+LQALV+G+ VRK +  MLR LQALVR Q RA
Sbjct  103   EHFAAVKIQSVFRGYLARKALKALKGLVKLQALVRGHFVRKQSTAMLRRLQALVRVQDRA  162

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKR---NLSKRRV  441
             R    +  +SP+  T++ +           +E  ++ +S + +D+ ++KR     S R  
Sbjct  163   RVNRVQNLDSPNYDTENSR----------SYE--VYQKSEKLEDSPVIKRCGSITSSREA  210

Query  442   IGDQEKVR-SNRMDYRMDAWSWEHQGSSRSGPI-DDGKSDKILEIDTGKPVFLPK---HR  606
                + KV  +N +D  ++A S  +  SS   P  DD +SDKILE+D+ KP  +PK   ++
Sbjct  211   RSKESKVSGTNWVDNWVEAGSSINSHSSIKIPCADDERSDKILEVDSWKPHSVPKKTRNK  270

Query  607   nlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFG-----QQINESC  771
             +        L  D ++   A S D  A   +       A  ++  +       Q   E+C
Sbjct  271   SFQEPRQHILVQDYHNRRFAAS-DYLARSYLTDVCKPHASPIADDDVASLKSLQYPPEAC  329

Query  772   FCTADNSPQFYSASSKG-GSSRVGPFTPSK---SDARSCLSG-YSDH--PNYMSYTESAK  930
                +    Q  S + +G GSSR  P TP +   S  RS  +G Y     P+YM+ TES++
Sbjct  330   MDKSSPPDQSLSFAPRGFGSSRRSPKTPLRHEYSSRRSLWNGTYGSFGSPSYMANTESSR  389

Query  931   AKM---RSLSAPKQRPQY----ERSSSTKRYSIHGYGELRTNSQR  1044
             AK    RS S PKQR  +    E+ SS KR S+H + + +T+S++
Sbjct  390   AKKVRSRSQSVPKQREDFVDIPEKRSSIKR-SLHAFWQSKTSSKK  433



>ref|XP_002314666.2| calmodulin-binding family protein [Populus trichocarpa]
 gb|EEF00837.2| calmodulin-binding family protein [Populus trichocarpa]
Length=430

 Score = 88.2 bits (217),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 116/338 (34%), Positives = 163/338 (48%), Gaps = 54/338 (16%)
 Frame = +1

Query  103   AVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRARSGL  282
             A+KIQS FR+YL+R+ALRALK LV+LQALV+G+LVRK     LR +QALV  Q+RAR+  
Sbjct  106   AIKIQSVFRSYLARKALRALKGLVKLQALVRGHLVRKQATATLRCMQALVNVQTRARAQR  165

Query  283   PKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGDQEKV  462
               ++E  + S +                Q IH +S Q +   +   N    RV+ +  K+
Sbjct  166   IWMNEDVNPSQR----------------QSIHRKSTQENR--IRHTNYENERVMDENIKI  207

Query  463   RSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshlslns  642
                     MD    +    SR+      ++D+             +HR   HS+      
Sbjct  208   ------VEMDVGESKGSIKSRNSYSHHPQTDRA------------EHRFSTHSAPNHAYP  249

Query  643   DQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYSASSKG  822
              Q +Y +             SP+      +SP+       +  F TA +SPQ+YS  SK 
Sbjct  250   KQENYQI-------------SPAPSALTDMSPRASSGHFEDYSFSTAQSSPQYYSTVSKP  296

Query  823   GSSRVGPFT-PSKSDARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQ-YERSSSTK  996
               S + PF  P    A S    YS  PNYM+ TES++AK+RS SAPKQRP  +ER  + +
Sbjct  297   DPSTI-PFAFPRPEYAESLTYDYSLFPNYMANTESSRAKVRSHSAPKQRPDSFERQPNRR  355

Query  997   RYSIHGYGELR-TNSQRGSS-LQANFTSKAYPGSGRLD  1104
             + SI G    R    QR SS + A   +  YP S +LD
Sbjct  356   KVSIEGRNVPRAVRMQRSSSHVGATAQNYQYPWSIKLD  393



>ref|XP_007143302.1| hypothetical protein PHAVU_007G060900g [Phaseolus vulgaris]
 gb|ESW15296.1| hypothetical protein PHAVU_007G060900g [Phaseolus vulgaris]
Length=462

 Score = 87.8 bits (216),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 121/371 (33%), Positives = 177/371 (48%), Gaps = 74/371 (20%)
 Frame = +1

Query  103   AVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRARSGL  282
             A+KIQS FR++L+R+AL AL+ LV+LQALV+G+LVRK     LR +QALV AQ+RAR   
Sbjct  143   AIKIQSVFRSHLARKALCALRGLVKLQALVRGHLVRKQAKATLRCMQALVTAQARAR---  199

Query  283   PKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGDQEKV  462
                        + ++    G P  ++       R   +DD  M   N  +R   G ++ +
Sbjct  200   ----------IQRIRMGSEGIPNQQQ-------RKATHDDLFMHIYNEMER---GLEDNI  239

Query  463   RSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshlslns  642
             +   MD        E++ +SRS  +                     + +     H    S
Sbjct  240   KIVEMDV------GENKNNSRSSSV---------------------YHHEHQEQHDHRFS  272

Query  643   DQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYSASSKG  822
               YS + + SK+   +++  +PS      LSP+       E CF TA +SPQF+SA S+ 
Sbjct  273   THYSTNGSYSKEEN-YKVSPAPS--ALTELSPRECSGHF-EDCFSTAQSSPQFHSAVSRT  328

Query  823   GSSRVGPFT-PSKSDARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQ-YERSSSTK  996
              +S+  PF+ P  + A S    Y   PNYM+ TES++AK+RS SAPKQRP  +E+  S +
Sbjct  329   ENSK-HPFSFPRPAYAESICYDYPLFPNYMANTESSRAKVRSHSAPKQRPDSFEKQPSRR  387

Query  997   RYSIHGYGELRTNSQRGSSLQANFTSK--AYPGSGRLDSFGMPVIRDQVGFSGGLWHRY*  1170
             R S+ G    R    + SS     T++   YP S +LD       R  V   G       
Sbjct  388   RASVEGRNVPRPMRMQRSSSHVGVTAQNYQYPWSIKLD-------RSAVSLKG-------  433

Query  1171  TAECIMTSVFL  1203
              +EC  TS  L
Sbjct  434   -SECGSTSTVL  443



>ref|XP_004288896.1| PREDICTED: uncharacterized protein LOC101305601 [Fragaria vesca 
subsp. vesca]
Length=439

 Score = 87.0 bits (214),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 110/338 (33%), Positives = 166/338 (49%), Gaps = 86/338 (25%)
 Frame = +1

Query  82    GIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQ  261
             G RE  AAVK+Q+ +R YL+R+ALRALK LV+LQALV+GYLVRK     L+G+QAL+RAQ
Sbjct  126   GGRERWAAVKVQTCYRGYLARKALRALKGLVKLQALVRGYLVRKQATATLQGMQALIRAQ  185

Query  262   SRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRV  441
             +  RS                                 H   G N     L  N+++   
Sbjct  186   ATVRS---------------------------------HKSRGLN-----LNINITE---  204

Query  442   IGDQEKVRSNRMDYRMDAWSWEHQGSSRS----GPIDDGKS-------DKILEIDTGKPV  588
               ++ ++R+ +   R D    EH   S S    G +++  S        KI+E+DTG+P 
Sbjct  205   -ANRFEIRARKSTERFDESRSEHTAPSHSRRLSGCLENNSSFSTIDEVPKIVEVDTGRP-  262

Query  589   FLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYC---------EAQSLSPQ  741
                K R+            + + S++   D   +Q V SP  C         + ++    
Sbjct  263   ---KSRSR-----------RTNTSISELSDDQFYQAVSSPLPCCCPGRLIIPDPRNFQDS  308

Query  742   NFGQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYT  918
             ++G    E  F TA ++P+F ++    GS+   P TP+K+  A +   G+ ++PNYMS T
Sbjct  309   DWGLTGEECRFSTAQSTPRFVNSF---GSN--APATPAKTICAENFYRGFGNYPNYMSST  363

Query  919   ESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRT  1032
             +S KAK+RS SAPKQRP+     + KR S++   E R+
Sbjct  364   QSFKAKLRSHSAPKQRPE---PGTKKRLSLNELLESRS  398



>ref|XP_010033552.1| PREDICTED: protein IQ-DOMAIN 14-like [Eucalyptus grandis]
 gb|KCW84050.1| hypothetical protein EUGRSUZ_B009321 [Eucalyptus grandis]
Length=470

 Score = 87.0 bits (214),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 125/368 (34%), Positives = 174/368 (47%), Gaps = 69/368 (19%)
 Frame = +1

Query  67    NAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQA  246
             N  G  I EE AA+KIQS FR+YL+R+ALRALK LV+LQALV+G+LVRK     LR +QA
Sbjct  137   NGRGSAI-EEAAAIKIQSVFRSYLARKALRALKGLVKLQALVRGHLVRKQATATLRCIQA  195

Query  247   LVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNL  426
             LV  Q+RAR+   + +E P              PT  +     H +S Q++         
Sbjct  196   LVTVQARARANRLRSAEVPK-------------PTDPRLS--THRKSTQDNRF-------  233

Query  427   SKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHR  606
               R +  + EK+    +                          KI+E+D G+     K R
Sbjct  234   --RNIYHESEKMMEENI--------------------------KIVEMDIGESKASTKSR  265

Query  607   nlfhsshlslnsD-QYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTA  783
             N + +       D ++S   A  K    +QI  +PS      LSP+       +      
Sbjct  266   NSYSTHPEPEWIDPKFSAHRAYFKPEN-NQISPAPSAL--TELSPRTCSGHFEDYSLGMV  322

Query  784   DNSPQFYSASSKGGSSRVGPFTPSKSDARSCLS-GYSDHPNYMSYTESAKAKMRSLSAPK  960
              +SPQF SA SK   + + PF   +S+    LS  Y  +PNYM+ TES++AK RS SAPK
Sbjct  323   QSSPQFSSAVSKPDPAPI-PFAFPRSEYAESLSYDYPLYPNYMANTESSRAKARSQSAPK  381

Query  961   QRPQ--YERSSSTKRYSIHGYG------ELRTNSQRGSSLQANFTSKAYPGSGRLDSFGM  1116
             QRP   YER  S +R S+ G          R++S  GS+ Q N+    YP S +LD   M
Sbjct  382   QRPDIYYERQPSRRRPSLEGRNVPRAMRMQRSSSHVGSAAQ-NYQ---YPWSIKLDKSTM  437

Query  1117  PVIRDQVG  1140
              +   + G
Sbjct  438   SLKESECG  445



>ref|XP_010034632.1| PREDICTED: protein IQ-DOMAIN 14-like [Eucalyptus grandis]
 gb|KCW84166.1| hypothetical protein EUGRSUZ_B01029 [Eucalyptus grandis]
Length=470

 Score = 87.0 bits (214),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 125/368 (34%), Positives = 174/368 (47%), Gaps = 69/368 (19%)
 Frame = +1

Query  67    NAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQA  246
             N  G  I EE AA+KIQS FR+YL+R+ALRALK LV+LQALV+G+LVRK     LR +QA
Sbjct  137   NGRGSAI-EEAAAIKIQSVFRSYLARKALRALKGLVKLQALVRGHLVRKQATATLRCIQA  195

Query  247   LVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNL  426
             LV  Q+RAR+   + +E P              PT  +     H +S Q++         
Sbjct  196   LVTVQARARANRLRSAEVPK-------------PTDPRLS--THRKSTQDNRF-------  233

Query  427   SKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHR  606
               R +  + EK+    +                          KI+E+D G+     K R
Sbjct  234   --RNIYHESEKMMEENI--------------------------KIVEMDIGESKASTKSR  265

Query  607   nlfhsshlslnsD-QYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTA  783
             N + +       D ++S   A  K    +QI  +PS      LSP+       +      
Sbjct  266   NSYSTHPEPEWIDPKFSAHRAYFKPEN-NQISPAPSAL--TELSPRTCSGHFEDYSLGMV  322

Query  784   DNSPQFYSASSKGGSSRVGPFTPSKSDARSCLS-GYSDHPNYMSYTESAKAKMRSLSAPK  960
              +SPQF SA SK   + + PF   +S+    LS  Y  +PNYM+ TES++AK RS SAPK
Sbjct  323   QSSPQFSSAVSKPDPAPI-PFAFPRSEYAESLSYDYPLYPNYMANTESSRAKARSQSAPK  381

Query  961   QRPQ--YERSSSTKRYSIHGYG------ELRTNSQRGSSLQANFTSKAYPGSGRLDSFGM  1116
             QRP   YER  S +R S+ G          R++S  GS+ Q N+    YP S +LD   M
Sbjct  382   QRPDIYYERQPSRRRPSLEGRNVPRAMRMQRSSSHVGSAAQ-NYQ---YPWSIKLDKSTM  437

Query  1117  PVIRDQVG  1140
              +   + G
Sbjct  438   SLKESECG  445



>ref|XP_011093642.1| PREDICTED: LOW QUALITY PROTEIN: protein IQ-DOMAIN 14 [Sesamum 
indicum]
Length=427

 Score = 86.7 bits (213),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 114/330 (35%), Positives = 161/330 (49%), Gaps = 56/330 (17%)
 Frame = +1

Query  82    GIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQ  261
             G RE+ AAVKIQ+ FR YL+R+ALRALK LV++QALV+G+LVRK  A  L  +QAL+RAQ
Sbjct  115   GSREKWAAVKIQTVFRGYLARKALRALKGLVKIQALVRGFLVRKQAAATLHSMQALIRAQ  174

Query  262   SRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRV  441
             +  R+                          +K  ++I+   G           L  R  
Sbjct  175   ASVRA--------------------------QKIRRLINNEEG-------FPPQLQAR--  199

Query  442   IGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhs  621
             I   +K    R ++     S     SS +      +S KI+E+DTG             +
Sbjct  200   ISPLQKHDDARSEHPTSLHSRRLSASSEAAMNSFDESPKIVEVDTGSR----TRSRSRRA  255

Query  622   shlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQF  801
             +   L+S +YS+  ATS           P+  E+++   Q +G    E  F TA ++P+F
Sbjct  256   NSWMLDSGEYSFGKATSSPFPCRIPARLPTP-ESRNFPDQEWGLTGEECHFSTAQSTPRF  314

Query  802   YSASSKGGSSRVGPFTPSKSDARSCLSGYS----DHPNYMSYTESAKAKMRSLSAPKQRP  969
                +S G ++   P TP+KS    C   YS    DHPNYM+ T+S KAK+RS SAPKQRP
Sbjct  315   --TTSCGCNT---PLTPAKS---VCPESYSRSSGDHPNYMAKTQSFKAKLRSQSAPKQRP  366

Query  970   QYERSSSTKRYSIHGYGELRTNSQRGSSLQ  1059
             +       +R S+H   E R NS  G  +Q
Sbjct  367   E---PGPRRRLSLHEVMESR-NSLSGVRMQ  392



>ref|XP_011030639.1| PREDICTED: protein IQ-DOMAIN 14-like [Populus euphratica]
Length=430

 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 118/338 (35%), Positives = 162/338 (48%), Gaps = 54/338 (16%)
 Frame = +1

Query  103   AVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRARSGL  282
             A+KIQS FR+YL+R+ALRALK LV+LQALV+G+LVRK     LR +QALV  Q+RAR+  
Sbjct  106   AIKIQSVFRSYLARKALRALKGLVKLQALVRGHLVRKQATATLRCMQALVNVQTRARAQR  165

Query  283   PKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGDQEKV  462
               ++E  + S +                Q IH +S Q +   +   N    RV+  +E +
Sbjct  166   IWMNEDVNPSQR----------------QSIHRKSTQENR--IRHTNYENERVM--EENI  205

Query  463   RSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshlslns  642
             +   MD      S + + S    P  D                  +HR   HS+     S
Sbjct  206   KIVEMDVGESKGSIKSRNSYSHHPQADRA----------------EHRFSTHSAPNHAYS  249

Query  643   DQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYSASSKG  822
              Q +Y +             SP+      +SP+       +  F TA +SPQ+YS  SK 
Sbjct  250   RQENYQV-------------SPAPSALTDMSPRACSGHFEDYSFSTAQSSPQYYSTVSKL  296

Query  823   GSSRVGPFT-PSKSDARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQ-YERSSSTK  996
               S + PF  P    A S    Y   PNYM+ TES++AK+RS SAPKQRP  +ER  S +
Sbjct  297   DPS-IIPFAFPRPEYAESLSYDYPFFPNYMANTESSRAKVRSHSAPKQRPDSFERQPSRR  355

Query  997   RYSIHGYGELR-TNSQRGSS-LQANFTSKAYPGSGRLD  1104
             + SI G    R    QR SS + A   +  YP S +LD
Sbjct  356   KVSIEGRNVPRAVRMQRSSSHVGATAQNYQYPWSIKLD  393



>ref|XP_008242480.1| PREDICTED: protein IQ-DOMAIN 14-like [Prunus mume]
 ref|XP_008242481.1| PREDICTED: protein IQ-DOMAIN 14-like [Prunus mume]
Length=424

 Score = 85.5 bits (210),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 115/332 (35%), Positives = 172/332 (52%), Gaps = 75/332 (23%)
 Frame = +1

Query  82    GIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQ  261
             G RE  AAVK+Q+ FR YL+RRALRALK LV+LQALV+GYLVRK     L  +QAL+RAQ
Sbjct  118   GGRERWAAVKVQTVFRGYLARRALRALKGLVKLQALVRGYLVRKQATATLHSMQALIRAQ  177

Query  262   SRARS----GLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLS  429
             +  RS    GL  I+ +P++   + +F+     + E+F           DDT       S
Sbjct  178   ATVRSHKTRGL--INTTPNNIEANSRFEIRARKSRERF-----------DDTG------S  218

Query  430   KRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRn  609
             +        ++ ++ +D  +D                  +S KI+E+DTG+P    K R+
Sbjct  219   EHTAPSHSRRLSASNLDANID------------------ESPKIVEVDTGRP----KSRS  256

Query  610   lfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYC---------EAQSLSPQNFGQQIN  762
                ++ +S  SD          D T  Q + SP  C         ++++    ++G   +
Sbjct  257   RRTNTCVSEFSD----------DPTYQQALSSPIPCRGPARLSIPDSRNFPESDWGLAGD  306

Query  763   ESCFC-TADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAK  936
             E  F  TA ++P+F ++    G+S + P TPSKS  A +   GY+  PNYM+ T+S KAK
Sbjct  307   ECRFISTAQSTPRFVNSC---GASNL-PGTPSKSVCADNFFRGYA--PNYMASTQSFKAK  360

Query  937   MRSLSAPKQRPQYERSSSTKRYSIHGYGELRT  1032
             +RS SAPKQRP+   +   +R S+H   E R+
Sbjct  361   LRSHSAPKQRPE---TGPKRRLSLHEMLESRS  389



>ref|XP_010267115.1| PREDICTED: protein IQ-DOMAIN 14-like [Nelumbo nucifera]
 ref|XP_010267116.1| PREDICTED: protein IQ-DOMAIN 14-like [Nelumbo nucifera]
Length=430

 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 110/319 (34%), Positives = 167/319 (52%), Gaps = 59/319 (18%)
 Frame = +1

Query  82    GIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQ  261
             G RE+ AA+KIQ+ FR YL+++ALRALK LV+LQALV+GYLVRK     L  +QAL+RAQ
Sbjct  119   GGREKWAAIKIQTVFRGYLAKKALRALKGLVKLQALVRGYLVRKQATATLHSMQALIRAQ  178

Query  262   SRARSGLPKISESPHSSTKSVQFQHPGPP--TPEKFEQVIHMRSGQNDDTIMLKRNLSKR  435
             +  R+           S   V  +H  PP  + E+F++       +++ T     ++  R
Sbjct  179   ATVRA---------QKSRAVVNKEHRYPPRKSIERFDET------RSEHTA----SIHSR  219

Query  436   RVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlf  615
             R+        S  ++  ++ +                +S KI+EIDTG+P    K R+  
Sbjct  220   RL--------SASIETAINTFE---------------ESPKIVEIDTGRP----KSRSRR  252

Query  616   hsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSP  795
              ++ +S   +   Y   +S      QI    S  + ++    ++G   +E  F TA ++P
Sbjct  253   TNTSMSECGEDPPYLTISS--PLPCQIPARLSIPDCRNFQDLDWGFTGDECRFSTAQSTP  310

Query  796   QFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQ  972
             +F ++   GGS+   P TP+KS  A S    YS+ PNYM+ T+S KAK+RS SAPKQRP+
Sbjct  311   RFVNS---GGSN--APVTPAKSVCADSFFRRYSNFPNYMANTQSFKAKVRSHSAPKQRPE  365

Query  973   YERSSSTKRYSIHGYGELR  1029
                 S  KR S++   E R
Sbjct  366   ---PSPRKRLSLNEMVESR  381



>ref|XP_006426860.1| hypothetical protein CICLE_v10025716mg [Citrus clementina]
 gb|ESR40100.1| hypothetical protein CICLE_v10025716mg [Citrus clementina]
Length=415

 Score = 85.1 bits (209),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 107/306 (35%), Positives = 154/306 (50%), Gaps = 53/306 (17%)
 Frame = +1

Query  61   NRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGL  240
            NR   G G+RE+ AAVKIQ+ FR +L+R+ALRALK LV+LQALV+GYLVRK  A  L  +
Sbjct  118  NRAVLG-GVREKWAAVKIQNVFRGFLARKALRALKGLVKLQALVRGYLVRKRAAATLHSM  176

Query  241  QALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKR  420
            QAL+RAQ+  R+       +  S  K  +FQ      PE      H +S +  D      
Sbjct  177  QALIRAQTAVRT-----QRARRSFNKENRFQ------PE----FRHRKSLERFDET----  217

Query  421  NLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDD-GKSDKILEIDTGKPVFLP  597
                      + ++ S R+   +++            PI    +S KI+EIDT    F P
Sbjct  218  ----------RSEIHSKRISTSLES------------PISGFDESPKIVEIDT----FKP  251

Query  598  KHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFC  777
            + R+    + LS   D +SY   +S       +    S   +Q+L    +    +E  F 
Sbjct  252  RSRSRRFHAALSECGDDFSYQAMSSPLPIPCPVPPRISVTNSQNLHDFVWCFTGDEYKFS  311

Query  778  TADNSPQFYSASSKGGSSRVGPFTPSKSDA-RSCLSGYSDHPNYMSYTESAKAKMRSLSA  954
            +A ++P+F ++          P TP+KS    S    YS+HP+YMS T+S  AK+RS SA
Sbjct  312  SAKSTPRFANSILSNA-----PPTPAKSVCCDSYFRPYSNHPSYMSNTQSFNAKLRSYSA  366

Query  955  PKQRPQ  972
            PKQRP+
Sbjct  367  PKQRPE  372



>ref|XP_008224258.1| PREDICTED: protein IQ-DOMAIN 14 [Prunus mume]
Length=486

 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 118/363 (33%), Positives = 172/363 (47%), Gaps = 66/363 (18%)
 Frame = +1

Query  106   VKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRARSGLP  285
             VKIQS FR+YL+R+AL ALK LV+LQALV+G+LVRK     LR +QALV AQ+RAR+   
Sbjct  157   VKIQSVFRSYLARKALCALKGLVKLQALVRGHLVRKQAKATLRCMQALVTAQARARAQ--  214

Query  286   KISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGDQEKVR  465
                                            +R  ++++T++  R+ + RR + +     
Sbjct  215   ------------------------------RIRMAEDENTVIPPRHSTPRRSLQENRFWH  244

Query  466   S-NRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshlslns  642
             + N MD  M+                  ++ KI+E+D G+   + K R   +S+      
Sbjct  245   TYNEMDRGME------------------ENIKIVEMDLGESKGILKSRTSSNSNLSQTER  286

Query  643   DQYSYSL------ATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFY  804
              ++ +S       A S   + +Q+  +PS      LSP      I +  F TA +SPQ Y
Sbjct  287   TEHRFSTQHAPNQAYSNQDSYNQLSPAPS--ALTDLSPGACSAHIEDYSFGTAQSSPQCY  344

Query  805   SASSKGGSSRVGPFTPSKSDARSCLS-GYSDHPNYMSYTESAKAKMRSLSAPKQRP--QY  975
             SA SK   SR  PF   + D    LS  Y   PNYM+ T+S+KAK RS SAPKQRP    
Sbjct  345   SAMSKLDPSR-APFAFPRPDNGEPLSYDYPLFPNYMANTQSSKAKARSQSAPKQRPADSI  403

Query  976   ERS-SSTKRYSIHGYGELRTNSQRGSSLQANFTSK--AYPGSGRLDSFGMPVIRDQVGFS  1146
             ER  S  +R S+ G    R    + SS   + T++   YP   +LD   + +   + G S
Sbjct  404   ERQPSRPRRASMEGRNIPRAVKMQRSSSHVSSTAQNYQYPWYIKLDRSTVSLKESECGSS  463

Query  1147  GGL  1155
               +
Sbjct  464   STV  466



>gb|KDO51826.1| hypothetical protein CISIN_1g014980mg [Citrus sinensis]
Length=415

 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 108/306 (35%), Positives = 153/306 (50%), Gaps = 53/306 (17%)
 Frame = +1

Query  61   NRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGL  240
            NR   G G+RE+ AAVKIQ+ FR +L+R+ALRALK LV+LQALV+GYLVRK  A  L  +
Sbjct  118  NRAVLG-GVREKWAAVKIQNVFRGFLARKALRALKGLVKLQALVRGYLVRKRAAATLHSM  176

Query  241  QALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKR  420
            QAL+RAQ+  R+       +  S  K  +FQ      PE      H +S +  D      
Sbjct  177  QALIRAQTAVRT-----QRARRSFNKENRFQ------PE----FRHRKSLERFDET----  217

Query  421  NLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDD-GKSDKILEIDTGKPVFLP  597
                      + ++ S R+             +S   PI    +S KI+EIDT    F P
Sbjct  218  ----------RSEIHSKRI------------STSLESPISGFDESPKIVEIDT----FKP  251

Query  598  KHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFC  777
            + R+    + LS   D +SY   +S       +    S   +Q+L    +    +E  F 
Sbjct  252  RSRSRRFHAALSECGDDFSYQAMSSPLPIPCPVPPRISVTNSQNLHDFVWCFTGDEYKFS  311

Query  778  TADNSPQFYSASSKGGSSRVGPFTPSKSDA-RSCLSGYSDHPNYMSYTESAKAKMRSLSA  954
            +A ++P+F ++          P TP+KS    S    YS+HP+YMS T+S  AK+RS SA
Sbjct  312  SAKSTPRFANSILSNA-----PPTPAKSVCCDSYFRPYSNHPSYMSNTQSFNAKLRSYSA  366

Query  955  PKQRPQ  972
            PKQRP+
Sbjct  367  PKQRPE  372



>ref|XP_009335283.1| PREDICTED: protein IQ-DOMAIN 14-like [Pyrus x bretschneideri]
Length=482

 Score = 85.1 bits (209),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 125/382 (33%), Positives = 181/382 (47%), Gaps = 70/382 (18%)
 Frame = +1

Query  49    TACINRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADM  228
             TA  N  AG     EE AA+KIQS FR+YL+R+AL AL+ LV+LQALV+G+LVRK     
Sbjct  139   TAAANEKAGA---SEEAAAIKIQSVFRSYLARKALCALRGLVKLQALVRGHLVRKQAKAT  195

Query  229   LRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTI  408
             LR +QALV AQ+RAR+                                  +R  ++++T+
Sbjct  196   LRCMQALVTAQARARAQ--------------------------------RIRMVEDENTV  223

Query  409   MLKRNLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPV  588
               + +  +R +  ++ +   N +D  M+                  ++ KI+E+D G+  
Sbjct  224   NPRHSTPRRSLQENRSRHTYNEIDRGME------------------ENIKIVEMDIGESK  265

Query  589   FLPKHRnlfhsshlsln-------sDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNF  747
              + K RN  +S+H           S QY+ + A S   T  Q+  +PS    +S  P   
Sbjct  266   GILKSRNSSYSNHSLTERTEQHRFSTQYAPNQAYSNQETNQQVSPAPSVLTDRS--PGAC  323

Query  748   GQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSDARSCLS-GYSDHPNYMSYTES  924
                  E+ F T  +SPQ YSA SK   SR  PF   + D    LS  Y   PNYM+ T+S
Sbjct  324   SAHF-ENSFGTVQSSPQCYSAMSKIDPSR-APFAFPRPDYGEPLSYDYPFFPNYMANTQS  381

Query  925   AKAKMRSLSAPKQRP--QYERSSS-TKRYSIHGYGELRTNSQRGSSLQANFTSK--AYPG  1089
             +KAK RS SAPKQRP    ER  S  +R S+ G    R    + SS   + T++   YP 
Sbjct  382   SKAKARSQSAPKQRPIDTVERPPSRPRRTSMEGRNIPRAMRMQRSSSHVSSTAQNYQYPW  441

Query  1090  SGRLDSFGMPVIRDQVGFSGGL  1155
               +LD   + +   + G S  +
Sbjct  442   YMKLDRSTVSLKESECGSSSTV  463



>gb|KDP40852.1| hypothetical protein JCGZ_24851 [Jatropha curcas]
Length=403

 Score = 84.0 bits (206),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 106/304 (35%), Positives = 153/304 (50%), Gaps = 66/304 (22%)
 Frame = +1

Query  82   GIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQ  261
            G RE+ AA+K+Q+ FR YL+R+ALRALK LV++QALV+GYLVRK  A  L  +QAL+RAQ
Sbjct  122  GGREKWAAIKVQTVFRGYLARKALRALKGLVKIQALVRGYLVRKRAAATLHSMQALIRAQ  181

Query  262  SRARSGLPKISESPHSSTKSVQFQHPGPP--TPEKFEQVIHMRSGQNDDTIMLKRNLSKR  435
            +  R+       +  S+ K  +FQH   P  + E+F           DDT          
Sbjct  182  TAVRT-----QRACRSANKENRFQHENRPRKSIERF-----------DDT----------  215

Query  436  RVIGDQEKVRSNRMD--YRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRn  609
                 + +  S R+   Y M+A+                +S KI+EIDT KP    + R+
Sbjct  216  -----RSEYHSKRLSASYEMNAFD---------------RSPKIVEIDTYKP----RSRS  251

Query  610  lfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQIN-ESC-FCTA  783
               ++ LS   +++ Y   +S          S   C+      Q+F   +  E C F TA
Sbjct  252  RRMTAALSECDEEFPYHAMSSPLPCPIPARISIPDCKYH----QDFDWYLTGEECRFSTA  307

Query  784  DNSPQFYSASSKGGSSRVGPFTPSKSDA-RSCLSGYSDHPNYMSYTESAKAKMRSLSAPK  960
             ++P+F ++          P TP+KS    S    YS+ PNYM+ T+S KAK+RS SAPK
Sbjct  308  QSTPRFSNSVRSNA-----PATPAKSVCGDSYFRPYSNFPNYMANTQSFKAKLRSYSAPK  362

Query  961  QRPQ  972
            QRP+
Sbjct  363  QRPE  366



>emb|CDO97967.1| unnamed protein product [Coffea canephora]
Length=402

 Score = 84.0 bits (206),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 113/310 (36%), Positives = 157/310 (51%), Gaps = 71/310 (23%)
 Frame = +1

Query  73   GGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALV  252
            GG G  E+ AA+KIQ+ FR YL+R+ALRALK LV+LQALV+GYLVRK  A  L  +QAL+
Sbjct  117  GGSG--EKWAAIKIQNVFRGYLARKALRALKGLVKLQALVRGYLVRKRAAATLHSMQALI  174

Query  253  RAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSK  432
            RAQ+  RS           + +S    +  PP          MR+               
Sbjct  175  RAQAAVRS---------QRARRSTNNDYRYPP---------EMRA---------------  201

Query  433  RRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnl  612
            RR I   ++ RS     R+ A S++   +S SG  DD  S KI+EIDT KP    + R+ 
Sbjct  202  RRSIERFDECRSEFHSKRLSA-SYD---ASLSG-FDD--SPKIVEIDTIKP----RSRSR  250

Query  613  fhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYC---------EAQSLSPQNFGQQINE  765
              +          +  ++ S D   +Q + SP  C         +       ++    +E
Sbjct  251  RIT----------TTCMSDSGDDQPYQAMSSPLPCPVPARLSIPDCHHFQDYDWSFLGDE  300

Query  766  SCFCTADNSPQFYSASSKGGSSRVGPFTPSKSDA-RSCLSGYSDHPNYMSYTESAKAKMR  942
              F TA ++P+F ++    G S V P TPSKS    S    YS+HPNYM+ T+S +AK+R
Sbjct  301  CGFATAQSTPRFVNS----GRSNV-PVTPSKSVCGDSFFRPYSNHPNYMANTQSFRAKLR  355

Query  943  SLSAPKQRPQ  972
            S SAPKQRP+
Sbjct  356  SHSAPKQRPE  365



>ref|XP_009364672.1| PREDICTED: protein IQ-DOMAIN 14-like [Pyrus x bretschneideri]
Length=395

 Score = 83.6 bits (205),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 109/308 (35%), Positives = 145/308 (47%), Gaps = 70/308 (23%)
 Frame = +1

Query  79   YGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRA  258
            +G RE  AA+KIQ+ FR YL+R+A RALK LV+LQALV+G+LVRK  A  L  +QAL RA
Sbjct  110  FGKRERWAAMKIQTVFRGYLARKAHRALKGLVKLQALVRGFLVRKRAAATLYSMQALFRA  169

Query  259  QSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRR  438
            Q+  R        +  S  K  +FQ      PE                      ++ R+
Sbjct  170  QTNVR-----YQRARRSFNKENRFQ------PE----------------------INARK  196

Query  439  VIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfh  618
             +   E  RS     R+ A ++E   +S     D+  S KI+EIDT KP           
Sbjct  197  SVERFEDARSEFYSRRLSA-TYETSVNS----FDE--SPKIVEIDTFKP-----------  238

Query  619  sshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEA-------QSLSPQNFGQQIN--ESC  771
                   S +++  L+   +   +Q + SP  C          S  PQ+F    N  E  
Sbjct  239  ----RSRSRRFNTILSDCGEDLPYQTISSPLPCPMPARISIPDSKKPQDFEWYFNGNECK  294

Query  772  FCTADNSPQFYSASSKGGSSRVGPFTPSKSDA-RSCLSGYSDHPNYMSYTESAKAKMRSL  948
            F TA N+P+F ++          P TPSKS    S    YSD PNYMS T+S  AK RS 
Sbjct  295  FPTAHNTPRFATSFRSNA-----PGTPSKSVCGDSFFRPYSDSPNYMSSTQSFNAKSRSH  349

Query  949  SAPKQRPQ  972
            SAPKQRP+
Sbjct  350  SAPKQRPE  357



>ref|XP_009392357.1| PREDICTED: protein IQ-DOMAIN 14 [Musa acuminata subsp. malaccensis]
Length=440

 Score = 84.0 bits (206),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 124/371 (33%), Positives = 169/371 (46%), Gaps = 102/371 (27%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             EE AAVKIQS FRAYL+R+AL AL+ LV+LQALV+G+LVRK  A  L  +QALV AQ RA
Sbjct  126   EEDAAVKIQSAFRAYLARKALCALRGLVKLQALVRGHLVRKQAAATLLRIQALVTAQERA  185

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGD  450
             R+   +++E  H               P++  Q IH RS Q+  +               
Sbjct  186   RAQRIRMAEESHV-------------VPQR--QSIHRRSPQHPRS---------------  215

Query  451   QEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshl  630
                    R  + MD  S E+               KI+E+D G P    K R        
Sbjct  216   -------RQSHDMDRNSEEN--------------IKIVEMDLGGPRGNTKSR--------  246

Query  631   slnsDQYSYSLATSKDSTAHQI------VHSPS-------YCEAQS----LSPQNFGQQI  759
                   YSYS+ T  ++  H+       VH+PS       +  A S    +SP+ +    
Sbjct  247   ------YSYSI-TETEAKDHRFSGYYGHVHTPSKIVQYQQFSPAPSVLTEMSPRTYSGHF  299

Query  760   NESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSDARSCLSGYSDHPNYMSYTESAKAKM  939
              +  F TA +SPQ+ SA S           P  S   SC   +   PNYM+ TES++AK 
Sbjct  300   EDFSFATAQSSPQYLSAIS----------VPDPSH--SCDYPF---PNYMANTESSRAKA  344

Query  940   RSLSAPKQRPQ-YERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKAY---PGSGRLDS  1107
             RS SAP+QR    ER +S +R S+ G    R+   + SS     T+  Y   P S +LD 
Sbjct  345   RSQSAPRQRTDTIERQTSRRRPSVDGRNIPRSIKMQRSSSHLGMTANGYQYHPWSIKLDK  404

Query  1108  FGMPVIRDQVG  1140
               M +   + G
Sbjct  405   SNMSLKDSECG  415



>ref|XP_009347221.1| PREDICTED: protein IQ-DOMAIN 14-like [Pyrus x bretschneideri]
 ref|XP_009347223.1| PREDICTED: protein IQ-DOMAIN 14-like [Pyrus x bretschneideri]
Length=405

 Score = 83.6 bits (205),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 109/308 (35%), Positives = 145/308 (47%), Gaps = 70/308 (23%)
 Frame = +1

Query  79   YGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRA  258
            +G RE  AA+KIQ+ FR YL+R+A RALK LV+LQALV+G+LVRK  A  L  +QAL RA
Sbjct  120  FGKRERWAAMKIQTVFRGYLARKAHRALKGLVKLQALVRGFLVRKRAAATLYSMQALFRA  179

Query  259  QSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRR  438
            Q+  R        +  S  K  +FQ      PE                      ++ R+
Sbjct  180  QTNVR-----YQRARRSFNKENRFQ------PE----------------------INARK  206

Query  439  VIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfh  618
             +   E  RS     R+ A ++E   +S     D+  S KI+EIDT KP           
Sbjct  207  SVERFEDARSEFYSRRLSA-TYETSVNS----FDE--SPKIVEIDTFKP-----------  248

Query  619  sshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEA-------QSLSPQNFGQQIN--ESC  771
                   S +++  L+   +   +Q + SP  C          S  PQ+F    N  E  
Sbjct  249  ----RSRSRRFNTILSDCGEDLPYQTISSPLPCPMPARISIPDSKKPQDFEWYFNGNECK  304

Query  772  FCTADNSPQFYSASSKGGSSRVGPFTPSKSDA-RSCLSGYSDHPNYMSYTESAKAKMRSL  948
            F TA N+P+F ++          P TPSKS    S    YSD PNYMS T+S  AK RS 
Sbjct  305  FPTAHNTPRFATSFRSNA-----PGTPSKSVCGDSFFRPYSDSPNYMSSTQSFNAKSRSH  359

Query  949  SAPKQRPQ  972
            SAPKQRP+
Sbjct  360  SAPKQRPE  367



>ref|XP_006465703.1| PREDICTED: protein IQ-DOMAIN 14-like [Citrus sinensis]
Length=415

 Score = 83.6 bits (205),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 104/306 (34%), Positives = 148/306 (48%), Gaps = 53/306 (17%)
 Frame = +1

Query  61   NRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGL  240
            NR   G G+RE+ AAVKIQ+ FR +L+R+ALRALK LV+LQALV+GYLVRK  A  L  +
Sbjct  118  NRAVFG-GVREKWAAVKIQNVFRGFLARKALRALKGLVKLQALVRGYLVRKRAAATLHSM  176

Query  241  QALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKR  420
            QAL+RAQ+  R+   + S           F       PE                   ++
Sbjct  177  QALIRAQTAVRTQRARRS-----------FNKENRFLPE------------------FRQ  207

Query  421  NLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDD-GKSDKILEIDTGKPVFLP  597
              S  R    + ++ S R+             +S   PI    +S KI+EIDT    F P
Sbjct  208  RKSLERFDETRSEIHSKRI------------STSLESPISGFDESPKIVEIDT----FKP  251

Query  598  KHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFC  777
            + R     + LS   D +SY   +S       +    S   +Q+L    +    +E  F 
Sbjct  252  RARTRRFHAALSECGDDFSYQAMSSPLPIPCPVPPRISVTNSQNLHDFEWCFTGDEYKFS  311

Query  778  TADNSPQFYSASSKGGSSRVGPFTPSKSDA-RSCLSGYSDHPNYMSYTESAKAKMRSLSA  954
            +A ++P+F ++          P TP+KS    +    YS+HP+YMS T+S  AK+RS SA
Sbjct  312  SAKSTPRFANSIRSNA-----PPTPAKSVCCDNYFRPYSNHPSYMSNTQSFNAKLRSYSA  366

Query  955  PKQRPQ  972
            PKQRP+
Sbjct  367  PKQRPE  372



>emb|CDX70019.1| BnaA10g23680D [Brassica napus]
Length=354

 Score = 82.4 bits (202),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 112/316 (35%), Positives = 145/316 (46%), Gaps = 103/316 (33%)
 Frame = +1

Query  31   GSTVNSTACINRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVR  210
             S+VN T   NRN   +  +E  AA+KIQS FR YL+RRALRALKALV+LQALVKG++VR
Sbjct  98   ASSVNQT---NRNNRRWS-QEYAAAIKIQSAFRGYLARRALRALKALVKLQALVKGHIVR  153

Query  211  KHTADMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSG  390
            K TADMLR +Q LVR Q+RAR+     S S H S                          
Sbjct  154  KQTADMLRRMQTLVRLQARARA-----SRSSHVSES------------------------  184

Query  391  QNDDTIMLKRNLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSR-SGPIDDGKSDKILE  567
                             + + E ++   MD+  +  S    GSSR + P+    +DKILE
Sbjct  185  -----------------LSEAEYIKLIAMDHHHNHRS--QMGSSRWNAPLYSEDNDKILE  225

Query  568  IDTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNF  747
            +DT KP                                      H PSY +    SP+  
Sbjct  226  VDTWKP--------------------------------------HFPSYHKE---SPRKR  244

Query  748  GQQINESCFCTADNSPQFYSASSKGGSSRVG---PFTPSKSDARSCLSGYSDHPNYMSYT  918
            G  +      + +NSPQ  S              PFTP++S+     SGY  HPNYM+ T
Sbjct  245  GSLM---VPTSVNNSPQVRSRPGSSSGGGSRRRTPFTPTRSEY-EYYSGY--HPNYMANT  298

Query  919  ESAKAKMRSLSAPKQR  966
            ES +AK+RS SAP+QR
Sbjct  299  ESYRAKVRSQSAPRQR  314



>ref|NP_196341.1| IQ-domain 24 protein [Arabidopsis thaliana]
 emb|CAB87280.1| putative protein [Arabidopsis thaliana]
 gb|AAP04041.1| unknown protein [Arabidopsis thaliana]
 gb|AED91126.1| IQ-domain 24 protein [Arabidopsis thaliana]
Length=401

 Score = 82.8 bits (203),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 112/311 (36%), Positives = 145/311 (47%), Gaps = 71/311 (23%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             E  AA+KIQS FR YL+RRALRALKALV+LQALVKG++VRK TADMLR +Q LVR Q+RA
Sbjct  105   EYKAAMKIQSAFRGYLARRALRALKALVKLQALVKGHIVRKQTADMLRRMQTLVRLQARA  164

Query  271   RSGLPKISESP-HSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIG  447
             R+          H  T  +      P +P+ F       +  +    M   + + R  +G
Sbjct  165   RASRSSHVSDSSHPPTLMI------PSSPQSFHARCVSEAEYSKVIAMDHHHNNHRSPMG  218

Query  448   DQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhssh  627
                   S+R+   +D W  E   S  S P  +   DKILE+DT KP F            
Sbjct  219   ------SSRL---LDQWRTEE--SLWSAPKYNEDDDKILEVDTWKPHFRE----------  257

Query  628   lslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYS  807
                                                SP+  G  +      + +NSPQ  S
Sbjct  258   -----------------------------------SPRKRGSLV---VPTSVENSPQLRS  279

Query  808   ASSKGGSSRVG--PFTPSKSDARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQYER  981
              +           PFTP++S+     SGY  HPNYM+ TES KAK+RS SAP+QR Q   
Sbjct  280   RTGSSSGGSRRKTPFTPARSEY-EYYSGY--HPNYMANTESYKAKVRSQSAPRQRLQDLP  336

Query  982   SSSTKRYSIHG  1014
             S S  + SI G
Sbjct  337   SESGYKRSIQG  347



>ref|XP_007204806.1| hypothetical protein PRUPE_ppa025288mg [Prunus persica]
 gb|EMJ06005.1| hypothetical protein PRUPE_ppa025288mg [Prunus persica]
Length=423

 Score = 83.2 bits (204),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 117/341 (34%), Positives = 174/341 (51%), Gaps = 76/341 (22%)
 Frame = +1

Query  82    GIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQ  261
             G RE  AAVK+Q+ FR YL+R+ALRALK LV+LQALV+GYLVRK     L  +QAL+RAQ
Sbjct  117   GGRERWAAVKVQTVFRGYLARKALRALKGLVKLQALVRGYLVRKQATATLHSMQALIRAQ  176

Query  262   SRARS----GLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLS  429
             +  RS    GL  I+ + ++   + +F+     + E+F           DDT       S
Sbjct  177   ATVRSHKTRGL--INTTTNNIEANSRFEIRARKSMERF-----------DDTG------S  217

Query  430   KRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRn  609
             +        ++ ++ +D  +D                  +S KI+E+DTG+P    K R+
Sbjct  218   EHTAPSHSRRLSASNLDANID------------------ESPKIVEVDTGRP----KSRS  255

Query  610   lfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYC---------EAQSLSPQNFGQQIN  762
                ++ +S  SD          D T  Q + SP  C         ++++    ++G   +
Sbjct  256   RRTNTCVSEFSD----------DPTYQQALSSPIPCRGPARLSIPDSRNFPESDWGLAGD  305

Query  763   ESCFC-TADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAK  936
             E  F  TA ++P+F ++    G+S + P TPSKS  A +   GY+  PNYM+ T+S KAK
Sbjct  306   ECRFVSTAQSTPRFVNSC---GASNL-PGTPSKSVCADNFFRGYA--PNYMASTQSFKAK  359

Query  937   MRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQ  1059
             +RS SAPKQRP    +   +R S+H   E R NS  G  +Q
Sbjct  360   LRSHSAPKQRPD---TGPKRRLSLHEMLESR-NSLSGVRMQ  396



>gb|AAM14074.1| unknown protein [Arabidopsis thaliana]
Length=437

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 112/311 (36%), Positives = 145/311 (47%), Gaps = 71/311 (23%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             E  AA+KIQS FR YL+RRALRALKALV+LQALVKG++VRK TADMLR +Q LVR Q+RA
Sbjct  141   EYKAAMKIQSAFRGYLARRALRALKALVKLQALVKGHIVRKQTADMLRRMQTLVRLQARA  200

Query  271   RSGLPKISESP-HSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIG  447
             R+          H  T  +      P +P+ F       +  +    M   + + R  +G
Sbjct  201   RASRSSHVSDSSHPPTLMI------PSSPQSFHARCVSEAEYSKVIAMDHHHNNHRSPMG  254

Query  448   DQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhssh  627
                   S+R+   +D W  E   S  S P  +   DKILE+DT KP F            
Sbjct  255   ------SSRL---LDQWRTEE--SLWSAPKYNEDDDKILEVDTWKPHFRE----------  293

Query  628   lslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYS  807
                                                SP+  G  +      + +NSPQ  S
Sbjct  294   -----------------------------------SPRKRGSLV---VPTSVENSPQLRS  315

Query  808   ASSKGGSSRVG--PFTPSKSDARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQYER  981
              +           PFTP++S+     SGY  HPNYM+ TES KAK+RS SAP+QR Q   
Sbjct  316   RTGSSSGGSRRKTPFTPARSEY-EYYSGY--HPNYMANTESYKAKVRSQSAPRQRLQDLP  372

Query  982   SSSTKRYSIHG  1014
             S S  + SI G
Sbjct  373   SESGYKRSIQG  383



>ref|XP_003524408.1| PREDICTED: protein IQ-DOMAIN 14-like, partial [Glycine max]
Length=368

 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 110/305 (36%), Positives = 149/305 (49%), Gaps = 51/305 (17%)
 Frame = +1

Query  76   GYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVR  255
            G G +E LA VKIQ+ FR YL+R+ALRALK LV+LQALV+GYLVRK  A  L  +QAL+R
Sbjct  107  GGGGQERLAVVKIQTFFRGYLARKALRALKGLVKLQALVRGYLVRKQAAATLHSMQALIR  166

Query  256  AQSRARS----GLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRN  423
            AQ+  RS    GL       H       FQ     + E+F+ +                 
Sbjct  167  AQATVRSKKSHGLSSTKNEAH------LFQTQARRSMERFDDI-----------------  203

Query  424  LSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKH  603
              K   I     + S R+    DA       +  +    DG S KI+E+DTG     PK 
Sbjct  204  --KSEYIA---PIHSRRLSSSFDA-------TMNNANSVDG-SPKIVEVDTGSG--RPKS  248

Query  604  RnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTA  783
            R+   ++ +S   D  S+    S    AH  +  PS+   ++     +G    E  F TA
Sbjct  249  RSRRSNTSMSDFGDDPSFQALPSPLPFAHLSI--PSH---RNYHDSEWGLTREECRFSTA  303

Query  784  DNSPQFYSASSKGGSSRVGPF--TPSKSDARSCLSG-YSDHPNYMSYTESAKAKMRSLSA  954
             ++P+F ++ S  GS  V P   TP      +   G Y + PNYM+ T+S KAK+RS SA
Sbjct  304  QSTPRFTNSCS-CGSVVVAPMSMTPKSVCTENFFYGQYHNFPNYMASTQSFKAKLRSHSA  362

Query  955  PKQRP  969
            PKQRP
Sbjct  363  PKQRP  367



>ref|XP_008360734.1| PREDICTED: uncharacterized protein LOC103424428 [Malus domestica]
 ref|XP_008360735.1| PREDICTED: uncharacterized protein LOC103424428 [Malus domestica]
Length=405

 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 107/308 (35%), Positives = 145/308 (47%), Gaps = 70/308 (23%)
 Frame = +1

Query  79   YGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRA  258
            +G RE  AA+KIQ+ FR YL+R+A RALK LV+LQALV+G+LVRK  A  L  +QAL RA
Sbjct  120  FGKRERWAAMKIQTVFRGYLARKAHRALKGLVKLQALVRGFLVRKRAAATLYSMQALFRA  179

Query  259  QSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRR  438
            Q+                  +V++Q                R   N +   L   ++ R+
Sbjct  180  QT------------------TVRYQR--------------ARRSFNKENRFLP-EINARK  206

Query  439  VIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfh  618
             +   E  RS     R+ A ++E   +S     D+  S KI+EIDT KP           
Sbjct  207  SVERFEDARSEFYSRRLSA-TYETSVNS----FDE--SPKIVEIDTFKP-----------  248

Query  619  sshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEA-------QSLSPQNFGQQIN--ESC  771
                   S +++  L+   +   +Q + SP  C          S  PQ+F    N  E  
Sbjct  249  ----RSRSHRFNTILSDCGEDLPYQTISSPLPCPMPARISIPDSKKPQDFEWYFNGNECK  304

Query  772  FCTADNSPQFYSASSKGGSSRVGPFTPSKSDA-RSCLSGYSDHPNYMSYTESAKAKMRSL  948
            F TA N+P+F ++          P TPSKS    S    YSD PNYMS T+S  AK RS 
Sbjct  305  FPTAHNTPRFATSFRSNA-----PGTPSKSVCGDSFFRPYSDSPNYMSSTQSFNAKSRSH  359

Query  949  SAPKQRPQ  972
            SAPKQRP+
Sbjct  360  SAPKQRPE  367



>ref|XP_009338738.1| PREDICTED: uncharacterized protein LOC103931052 [Pyrus x bretschneideri]
 ref|XP_009338739.1| PREDICTED: uncharacterized protein LOC103931052 [Pyrus x bretschneideri]
Length=405

 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 108/308 (35%), Positives = 145/308 (47%), Gaps = 70/308 (23%)
 Frame = +1

Query  79   YGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRA  258
            +G RE  AA+KIQ+ FR YL+R+A RALK LV+LQALV+G+LVRK  A  L  +QAL RA
Sbjct  120  FGKRERWAAMKIQTVFRGYLARKAHRALKGLVKLQALVRGFLVRKRAAAALYSMQALFRA  179

Query  259  QSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRR  438
            Q++ R        +  S  K  +F       PE                      ++ R+
Sbjct  180  QTKVR-----YQRARRSFNKENRF------LPE----------------------INARK  206

Query  439  VIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfh  618
             +   E  RS     R+ A ++E   +S     D+  S KI+EIDT KP           
Sbjct  207  SVERFEDARSEFYSRRLSA-TYETSVNS----FDE--SPKIVEIDTFKP-----------  248

Query  619  sshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEA-------QSLSPQNFGQQIN--ESC  771
                   S +++  L+   +   +Q + SP  C          S  PQ+F    N  E  
Sbjct  249  ----RSRSRRFNTILSDCGEDLPYQTISSPLPCPMPARISIPDSKKPQDFEWYFNGNECK  304

Query  772  FCTADNSPQFYSASSKGGSSRVGPFTPSKSDA-RSCLSGYSDHPNYMSYTESAKAKMRSL  948
            F TA N+P+F ++          P TPSKS    S    YSD PNYMS T+S  AK RS 
Sbjct  305  FPTAHNTPRFATSFRSNA-----PGTPSKSVCGDSFFRPYSDSPNYMSSTQSFNAKSRSH  359

Query  949  SAPKQRPQ  972
            SAPKQRP+
Sbjct  360  SAPKQRPE  367



>ref|XP_010249482.1| PREDICTED: protein IQ-DOMAIN 31-like [Nelumbo nucifera]
Length=435

 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 113/316 (36%), Positives = 148/316 (47%), Gaps = 83/316 (26%)
 Frame = +1

Query  82   GIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQ  261
            G RE LAA KIQ+ FR YL+R+ALRALK LV+LQALV+GYLVRK  A  L  +QAL+RAQ
Sbjct  119  GRRENLAAAKIQTVFRGYLARKALRALKGLVKLQALVRGYLVRKQAAATLHSMQALIRAQ  178

Query  262  SRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRV  441
            +  RS                                               R L  R  
Sbjct  179  ATVRS--------------------------------------------QKARTLHNREH  194

Query  442  IGDQEKVRSNRMDYRMDAWSWEHQGS--SR--SGPIDDG-----KSDKILEIDTGKPVFL  594
            I   E     +   R D    EH  S  SR  S  ID       +S KI+EIDT +P   
Sbjct  195  ISQPETRPPRKSIERFDETRSEHTASFHSRRLSASIDPATTTFEESPKIVEIDTVRP---  251

Query  595  PKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCE--AQSLSP-----QNFGQ  753
             K R             + + S++   +   +Q V SP  C+  A+   P     Q+F  
Sbjct  252  -KSRFR-----------RTNTSMSECGEDPTYQTVSSPLPCQIPARLSIPDCRNFQDFDW  299

Query  754  QI--NESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTES  924
                +E  F TA ++P+F ++   GGS+   P TP+KS    S   G+S+ PNYM+ T+S
Sbjct  300  SFTGDECRFSTAQSTPRFVNS---GGSN--APVTPAKSVCGDSFFRGHSNFPNYMADTQS  354

Query  925  AKAKMRSLSAPKQRPQ  972
             KAK+RS SAPKQRP+
Sbjct  355  FKAKVRSYSAPKQRPE  370



>ref|XP_008380848.1| PREDICTED: uncharacterized protein LOC103443739 [Malus domestica]
 ref|XP_008380849.1| PREDICTED: uncharacterized protein LOC103443739 [Malus domestica]
Length=410

 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 105/308 (34%), Positives = 145/308 (47%), Gaps = 70/308 (23%)
 Frame = +1

Query  79   YGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRA  258
            +G RE  AA+KIQ+ FR YL+R+A RAL+ LV+LQALV+G+LVRK  A  L  +QAL+RA
Sbjct  119  FGKRERWAAMKIQTVFRGYLARKAHRALRGLVKLQALVRGFLVRKRAAATLYSMQALLRA  178

Query  259  QSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRR  438
            Q+                  +V++Q                R   N +   L   ++ R+
Sbjct  179  QT------------------TVRYQR--------------ARRSFNKENRFLP-EINARK  205

Query  439  VIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfh  618
             +   E  RS     R+ A ++E    S     D+  S KI+EIDT KP           
Sbjct  206  CVERFEDARSEFYSRRLSA-TYETSVDS----FDE--SPKIVEIDTFKP-----------  247

Query  619  sshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEA-------QSLSPQNFGQQIN--ESC  771
                   S +++  L+   +   +Q + SP  C          S  PQ+F    N  E  
Sbjct  248  ----RSRSRRFNTILSDRGEDLHYQTISSPLPCPMPTRISIPDSQKPQDFEWYFNGDECK  303

Query  772  FCTADNSPQFYSASSKGGSSRVGPFTPSKSDA-RSCLSGYSDHPNYMSYTESAKAKMRSL  948
            F TA N+P+F ++          P TPSKS    S    YS+ PNYMS T+S  AK RS 
Sbjct  304  FLTAHNTPRFATSFRSNA-----PGTPSKSVCGDSFFRPYSNFPNYMSSTQSFNAKSRSH  358

Query  949  SAPKQRPQ  972
            SAPKQRP+
Sbjct  359  SAPKQRPE  366



>ref|XP_006451315.1| hypothetical protein CICLE_v10008287mg [Citrus clementina]
 ref|XP_006451316.1| hypothetical protein CICLE_v10008287mg [Citrus clementina]
 ref|XP_006451317.1| hypothetical protein CICLE_v10008287mg [Citrus clementina]
 ref|XP_006451318.1| hypothetical protein CICLE_v10008287mg [Citrus clementina]
 ref|XP_006451319.1| hypothetical protein CICLE_v10008287mg [Citrus clementina]
 gb|ESR64555.1| hypothetical protein CICLE_v10008287mg [Citrus clementina]
 gb|ESR64556.1| hypothetical protein CICLE_v10008287mg [Citrus clementina]
 gb|ESR64557.1| hypothetical protein CICLE_v10008287mg [Citrus clementina]
 gb|ESR64558.1| hypothetical protein CICLE_v10008287mg [Citrus clementina]
 gb|ESR64559.1| hypothetical protein CICLE_v10008287mg [Citrus clementina]
 gb|KDO66596.1| hypothetical protein CISIN_1g013213mg [Citrus sinensis]
Length=447

 Score = 81.6 bits (200),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 103/300 (34%), Positives = 152/300 (51%), Gaps = 46/300 (15%)
 Frame = +1

Query  76   GYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVR  255
            G    E+ AAVKIQS FR YL+RRALRALK LV+LQA V+GYLVRK T   L G+QAL+R
Sbjct  128  GGATHEKWAAVKIQSVFRGYLARRALRALKGLVKLQAHVRGYLVRKQTTATLHGMQALIR  187

Query  256  AQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKR  435
            AQ  ARS   +      ++  S + +     + E+++          D+T   +  +S  
Sbjct  188  AQVTARSQRARAC-GGLTNNNSNRLESRARKSMERYD----------DETRSEQAAVS--  234

Query  436  RVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlf  615
                    + S R+   +D              ID+  S KI+E+DTG     PK R+  
Sbjct  235  --------IHSRRLSASIDT------------TIDE--SPKIVEVDTGSN--RPKSRSRR  270

Query  616  hsshlslnsDQYSY-SLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNS  792
             ++ +S  SD   Y ++++   S  +Q +  P   + ++    ++G   +E  F TA ++
Sbjct  271  TNTSVSDFSDDPHYQTISSPLPSRIYQCLSIP---DGRNFQESDWGLTGDECKFSTAQST  327

Query  793  PQFYSASSKGGSSRVGPFTPSKSDARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQ  972
            P+F S           P TP+KS          + PNYM+ T+S KAK+RS SAPKQRP+
Sbjct  328  PRFVSFDRSKA-----PATPAKSVCADNFFRQYNFPNYMANTKSFKAKLRSHSAPKQRPE  382



>ref|XP_006475587.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X1 [Citrus sinensis]
 ref|XP_006475588.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X2 [Citrus sinensis]
Length=455

 Score = 81.3 bits (199),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 103/300 (34%), Positives = 152/300 (51%), Gaps = 46/300 (15%)
 Frame = +1

Query  76   GYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVR  255
            G    E+ AAVKIQS FR YL+RRALRALK LV+LQA V+GYLVRK T   L G+QAL+R
Sbjct  136  GGATHEKWAAVKIQSVFRGYLARRALRALKGLVKLQAHVRGYLVRKQTTATLHGMQALIR  195

Query  256  AQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKR  435
            AQ  ARS   +      ++  S + +     + E+++          D+T   +  +S  
Sbjct  196  AQVTARSQRARAC-GGLTNNNSNRLESRARKSMERYD----------DETRSEQAAVS--  242

Query  436  RVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlf  615
                    + S R+   +D              ID+  S KI+E+DTG     PK R+  
Sbjct  243  --------IHSRRLSASIDT------------TIDE--SPKIVEVDTGSN--RPKSRSRR  278

Query  616  hsshlslnsDQYSY-SLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNS  792
             ++ +S  SD   Y ++++   S  +Q +  P   + ++    ++G   +E  F TA ++
Sbjct  279  TNTSVSDFSDDPHYQTISSPLPSRIYQCLSIP---DGRNFQESDWGLTGDECKFSTAQST  335

Query  793  PQFYSASSKGGSSRVGPFTPSKSDARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQ  972
            P+F S           P TP+KS          + PNYM+ T+S KAK+RS SAPKQRP+
Sbjct  336  PRFVSFDRSKA-----PATPAKSVCADNFFRQYNFPNYMANTKSFKAKLRSHSAPKQRPE  390



>ref|XP_011072442.1| PREDICTED: protein IQ-DOMAIN 31-like [Sesamum indicum]
Length=386

 Score = 80.9 bits (198),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 110/308 (36%), Positives = 151/308 (49%), Gaps = 72/308 (23%)
 Frame = +1

Query  82   GIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQ  261
            G RE  AAVKIQ+ FR YL+R+ALRALK LV+LQALV+GYLVRK  A  L  +QAL+RAQ
Sbjct  100  GGRERCAAVKIQTVFRGYLARKALRALKGLVKLQALVRGYLVRKRAAATLHSMQALIRAQ  159

Query  262  SRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRV  441
            +  RS       +  S +   +FQ      PE       MR+               R+ 
Sbjct  160  AAVRS-----QRARRSISADCRFQ------PE-------MRA---------------RKS  186

Query  442  IGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhs  621
            I   E+   NR ++     S  +  S  +   D+  S KI+EIDT +P    K R+    
Sbjct  187  I---ERFDENRSEFHSKRLSASYDPSLNA--FDE--SPKIVEIDTCRP----KSRSR---  232

Query  622  shlslnsDQYSYSLATSKDSTAHQIVHSPSYC---------EAQSLSPQNFGQQINESCF  774
                    + +  ++   D   +Q + SP  C         + + L   ++G    +  F
Sbjct  233  --------RINTCMSEYGDDQYYQAISSPLPCPVPARLSIPDCRHLQDFDWGFITEDYKF  284

Query  775  CTADNSPQFYSASSKGGSSRV-GPFTPSKSDA-RSCLSGYSDHPNYMSYTESAKAKMRSL  948
             TA N+P+F      G S R   P TPSKS    S    YS+ PNYM+ T+S +AK+RS 
Sbjct  285  PTAQNTPRF------GCSGRAYAPVTPSKSVCGDSFFRPYSNCPNYMANTQSFRAKLRSQ  338

Query  949  SAPKQRPQ  972
            SAPKQRP+
Sbjct  339  SAPKQRPE  346



>ref|XP_007034845.1| Iq-domain 31 isoform 1 [Theobroma cacao]
 gb|EOY05771.1| Iq-domain 31 isoform 1 [Theobroma cacao]
Length=534

 Score = 81.3 bits (199),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 117/337 (35%), Positives = 164/337 (49%), Gaps = 52/337 (15%)
 Frame = +1

Query  106   VKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRARSGLP  285
             +KIQS FR+YL+R+AL ALK LV+LQALV+G+LVRK     LR +QALV AQ+RAR+   
Sbjct  141   IKIQSVFRSYLARKALNALKGLVKLQALVRGHLVRKQATATLRCMQALVTAQARARAQRI  200

Query  286   KISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGDQEKVR  465
             ++ E    S  + Q Q P            H RS  +         + +    G +E ++
Sbjct  201   RMVEE---SNPASQRQSP------------HRRSTPDHRFRHAYHEIDR----GMEENIK  241

Query  466   SNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshlslnsD  645
                MD      S + + S    P    ++++++E           HR             
Sbjct  242   IVEMDLGDLKGSLKSRNSYSHYP----QAERVVE-----------HRFST----------  276

Query  646   QYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYSASSKGG  825
              YS + A SK    +Q+  SP+      +SP+       +  F TA +SP +YSA SK  
Sbjct  277   HYSSNHAYSKQDN-YQV--SPAPSALTDMSPRACSGHFEDYSFSTAQSSPPYYSAISKPD  333

Query  826   SSRVGPFT-PSKSDARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQ-YERSSSTKR  999
              S++ PF  P    A S    Y   PNYM+ TES++AK+RS SAPK RP  +ER  S +R
Sbjct  334   PSKL-PFAFPRPEYAESVSYDYPLFPNYMANTESSRAKVRSQSAPKSRPDSFERQPSRRR  392

Query  1000  YSIHGYGELR-TNSQRGSS-LQANFTSKAYPGSGRLD  1104
              SI G    R    QR SS + A   +  YP S +LD
Sbjct  393   ASIEGRNVPRAVRMQRSSSHVGATAQNYQYPWSIKLD  429



>ref|XP_006280595.1| hypothetical protein CARUB_v10026553mg [Capsella rubella]
 gb|EOA13493.1| hypothetical protein CARUB_v10026553mg [Capsella rubella]
Length=396

 Score = 80.9 bits (198),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 115/314 (37%), Positives = 150/314 (48%), Gaps = 79/314 (25%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             E LAA KIQS FR YL+RRALRALKALV+LQALV+G++VRK TADMLR +Q LVR QS+A
Sbjct  112   ENLAARKIQSAFRGYLARRALRALKALVKLQALVRGHIVRKQTADMLRRMQTLVRLQSQA  171

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGD  450
             R+   + S S  S   S                 +   S  +    +  R +S   VI  
Sbjct  172   RARASRSSHSSASFHSST---------------ALLFPSSSSSPRSLHTRCVSSAEVISM  216

Query  451   QEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshl  630
               +  S R+D++ +              + D   DKILE+DT KP F PK          
Sbjct  217   DHRGGSKRLDWQTE-------------EVQD--EDKILEVDTWKPHFHPK----------  251

Query  631   slnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYSA  810
                       L + +++       SP   +   L P+            + +NSPQ  S+
Sbjct  252   ---------PLRSERNN------ESPRKRQQSLLGPR------------STENSPQVGSS  284

Query  811   SSKGGSSRVGPFTPSKSDARSC------LSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQ  972
                 GS R  PFTP+     S        SGY  HPNYM+ TES KAK+RS SAPKQR  
Sbjct  285   ----GSRRRTPFTPTSRSEYSWGCNNYYYSGY--HPNYMANTESYKAKVRSQSAPKQRAD  338

Query  973   YERSSSTKRYSIHG  1014
                 +S  + S+HG
Sbjct  339   VSNETSGYKRSVHG  352



>ref|XP_007034846.1| Iq-domain 31 isoform 2 [Theobroma cacao]
 gb|EOY05772.1| Iq-domain 31 isoform 2 [Theobroma cacao]
Length=466

 Score = 81.3 bits (199),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 117/337 (35%), Positives = 164/337 (49%), Gaps = 52/337 (15%)
 Frame = +1

Query  106   VKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRARSGLP  285
             +KIQS FR+YL+R+AL ALK LV+LQALV+G+LVRK     LR +QALV AQ+RAR+   
Sbjct  141   IKIQSVFRSYLARKALNALKGLVKLQALVRGHLVRKQATATLRCMQALVTAQARARAQRI  200

Query  286   KISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGDQEKVR  465
             ++ E    S  + Q Q P            H RS  +         + +    G +E ++
Sbjct  201   RMVEE---SNPASQRQSP------------HRRSTPDHRFRHAYHEIDR----GMEENIK  241

Query  466   SNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshlslnsD  645
                MD      S + + S    P    ++++++E           HR             
Sbjct  242   IVEMDLGDLKGSLKSRNSYSHYP----QAERVVE-----------HRFST----------  276

Query  646   QYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYSASSKGG  825
              YS + A SK    +Q+  SP+      +SP+       +  F TA +SP +YSA SK  
Sbjct  277   HYSSNHAYSKQDN-YQV--SPAPSALTDMSPRACSGHFEDYSFSTAQSSPPYYSAISKPD  333

Query  826   SSRVGPFT-PSKSDARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQ-YERSSSTKR  999
              S++ PF  P    A S    Y   PNYM+ TES++AK+RS SAPK RP  +ER  S +R
Sbjct  334   PSKL-PFAFPRPEYAESVSYDYPLFPNYMANTESSRAKVRSQSAPKSRPDSFERQPSRRR  392

Query  1000  YSIHGYGELR-TNSQRGSS-LQANFTSKAYPGSGRLD  1104
              SI G    R    QR SS + A   +  YP S +LD
Sbjct  393   ASIEGRNVPRAVRMQRSSSHVGATAQNYQYPWSIKLD  429



>ref|XP_007224458.1| hypothetical protein PRUPE_ppa022210mg [Prunus persica]
 gb|EMJ25657.1| hypothetical protein PRUPE_ppa022210mg [Prunus persica]
Length=484

 Score = 80.9 bits (198),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 119/363 (33%), Positives = 172/363 (47%), Gaps = 66/363 (18%)
 Frame = +1

Query  106   VKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRARSGLP  285
             VKIQS FR+YL+R+AL ALK LV+LQALV+G+LVRK     LR +QALV AQ+RA     
Sbjct  155   VKIQSVFRSYLARKALCALKGLVKLQALVRGHLVRKQAKATLRCMQALVTAQARA-----  209

Query  286   KISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGDQE-KV  462
                                        Q I M   ++++T++  R+ + RR + +   + 
Sbjct  210   -------------------------LAQRIRM--AEDENTVIPPRHSTPRRSLQENRFRH  242

Query  463   RSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshlslns  642
               N MD  M+                  ++ KI+E+D G+   + K RN  +S+      
Sbjct  243   TYNEMDRGME------------------ENIKIVEMDLGESKGILKSRNSSYSNLSQTER  284

Query  643   DQYSYSL------ATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFY  804
              ++ +S       A S   + +Q+  +PS      LSP      + +  F TA +SPQ Y
Sbjct  285   TEHRFSTQHAPNQAYSNQDSYNQLSPAPS--ALTDLSPGACSAHLEDYSFGTAQSSPQCY  342

Query  805   SASSKGGSSRVGPFTPSKSDARSCLS-GYSDHPNYMSYTESAKAKMRSLSAPKQRP--QY  975
             SA SK   SR  PF   + D    LS  Y   PNYM+ T+S+KAK RS SAPKQRP    
Sbjct  343   SAMSKLDPSR-APFAFPRPDYGEPLSYDYPLFPNYMANTQSSKAKARSQSAPKQRPADSI  401

Query  976   ERSSS-TKRYSIHGYGELRTNSQRGSSLQANFTSK--AYPGSGRLDSFGMPVIRDQVGFS  1146
             ER  S  +R S+ G    R    + SS   + T++   YP   +LD   + +   + G S
Sbjct  402   ERQPSRPRRASMEGRNIPRAVKMQRSSSHVSSTAQNYQYPWYIKLDRSTVSLKESECGSS  461

Query  1147  GGL  1155
               +
Sbjct  462   STV  464



>ref|XP_009122359.1| PREDICTED: LOW QUALITY PROTEIN: protein IQ-DOMAIN 14 [Brassica 
rapa]
Length=370

 Score = 80.1 bits (196),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 115/314 (37%), Positives = 151/314 (48%), Gaps = 101/314 (32%)
 Frame = +1

Query  34   STVNSTACINRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRK  213
            S+VN T   NRN   +  +E  AA+KIQS FR YL+RRALRALKALV+LQALVKG++VRK
Sbjct  99   SSVNQT---NRNNRRWS-QEYAAAIKIQSAFRGYLARRALRALKALVKLQALVKGHIVRK  154

Query  214  HTADMLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQ  393
             TADMLR +Q LVR Q+RAR+     S S H S            +  ++ ++I M    
Sbjct  155  QTADMLRRMQTLVRLQARARA-----SRSSHVSES---------LSEAEYIKLIAMDHHH  200

Query  394  NDDTIMLKRNLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEID  573
            N                            Y+M +  W       + P+ +  +DKILE+D
Sbjct  201  NHR--------------------------YQMGSSRW-------NAPLYNEDNDKILEVD  227

Query  574  TGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQ  753
            T KP                                      H PSY +    SP+  G 
Sbjct  228  TWKP--------------------------------------HFPSYHKE---SPRKRGS  246

Query  754  QINESCFCTADNSPQ---FYSASSKGGSSRVGPFTPSKSDARSCLSGYSDHPNYMSYTES  924
             +  +     +NSPQ      +SS GGS R  PFTP++S+     SGY  HPNYM+ TES
Sbjct  247  LMVPTGM---ENSPQARSRPGSSSGGGSRRRTPFTPTRSEY-EYYSGY--HPNYMANTES  300

Query  925  AKAKMRSLSAPKQR  966
             +AK+RS SAP+QR
Sbjct  301  YRAKVRSQSAPRQR  314



>ref|XP_010932804.1| PREDICTED: protein IQ-DOMAIN 14 isoform X1 [Elaeis guineensis]
Length=443

 Score = 80.5 bits (197),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 118/384 (31%), Positives = 166/384 (43%), Gaps = 100/384 (26%)
 Frame = +1

Query  46    STACINRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTAD  225
             ++A  ++N+      EE AA+KIQ+ FR+YL+R+AL ALK LV+LQALV+G+LVRK    
Sbjct  115   TSAATDKNSSNI---EEAAAIKIQAAFRSYLARKALCALKGLVKLQALVRGHLVRKQATA  171

Query  226   MLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDT  405
              LR +QALV AQ+RA                                Q I M        
Sbjct  172   TLRRMQALVTAQARA------------------------------CAQRIQM--------  193

Query  406   IMLKRNLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSD--KILEIDTG  579
                   + + +VI  Q+ +      YR    S +H  S  S  +D    +  KI+E+D G
Sbjct  194   ------VEEYKVISQQQSI------YRR---SPQHPRSRYSYELDRSAEENAKIVEMDLG  238

Query  580   KPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIV--------------HSPSYC  717
             +     K R            + YS +   +KD  A                   SP+  
Sbjct  239   ESRSTSKSR------------NSYSITQTETKDHRAFAYYGSARPPLRAEQYQQFSPAPS  286

Query  718   EAQSLSPQNFGQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSDARSCLSGYSDH  897
                 +SP+ +     E  F TA +SPQ+ SA S              SDA      YS +
Sbjct  287   AITDMSPRAYSGHFEEFSFTTAQSSPQYLSALSA-------------SDATQASFDYSFY  333

Query  898   PNYMSYTESAKAKMRSLSAPKQRPQ-YERSSSTKRYSIHGYGELRTNSQRGSSLQANFTS  1074
             PNYM+ TES++AK RS SAP+QR   YER +S +R S+ G    R    + SS     T+
Sbjct  334   PNYMANTESSRAKARSQSAPRQRTDTYERQTSRRRPSVEGRNIPRGVRMQRSSSHVGLTA  393

Query  1075  KA--YPGSGRLDSFGMPVIRDQVG  1140
                 YP   +LD   M +   + G
Sbjct  394   NGYQYPWPIKLDRSSMSLKDSECG  417



>ref|XP_008777374.1| PREDICTED: protein IQ-DOMAIN 14 [Phoenix dactylifera]
Length=441

 Score = 80.5 bits (197),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 118/369 (32%), Positives = 163/369 (44%), Gaps = 97/369 (26%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             EE AA+KIQ+ FR+YL+R+AL ALK LV+LQALV+G+LVRK     LR +QALV AQ+RA
Sbjct  126   EEAAAIKIQAAFRSYLARKALCALKGLVKLQALVRGHLVRKQATATLRCMQALVTAQARA  185

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGD  450
             R+                              Q I M              + + +VI  
Sbjct  186   RA------------------------------QRIRM--------------VEEYKVISQ  201

Query  451   QEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSD--KILEIDTGKPVFLPKHRnlfhss  624
             ++ +      YR    S +H  S  S  +D G  +  KI+E+D G+     K R      
Sbjct  202   RQSI------YRR---SPQHPRSRHSYEMDRGADENVKIVEMDLGESRGTTKSR------  246

Query  625   hlslnsDQYSYSLATSKDS-------------TAHQIVH-SPSYCEAQSLSPQNFGQQIN  762
                   + YS +   +KD               A Q    SP+      +SP+ +     
Sbjct  247   ------NSYSITRTEAKDHGISAYYGNGHPPFRAEQYQQFSPAPSAITDMSPRVYSGHFE  300

Query  763   ESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSDARSCLSGYSDHPNYMSYTESAKAKMR  942
             E  F TA +SPQ+ SA S           P   DA      Y  +PNYM+ TES++AK R
Sbjct  301   EFSFTTAQSSPQYLSALS----------VP---DATQASFDYPFYPNYMANTESSRAKTR  347

Query  943   SLSAPKQRPQ-YERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSKA--YPGSGRLDSFG  1113
             S SAP+QR   YER +S +R S+ G    R    + SS     T+    YP S +LD   
Sbjct  348   SQSAPRQRTDSYERQTSRRRPSVEGRNIPRGVRMQRSSSHVGLTANGYQYPWSIKLDRSS  407

Query  1114  MPVIRDQVG  1140
             M +   + G
Sbjct  408   MSLKDSECG  416



>ref|XP_010656256.1| PREDICTED: protein IQ-DOMAIN 14 [Vitis vinifera]
 ref|XP_010656257.1| PREDICTED: protein IQ-DOMAIN 14 [Vitis vinifera]
 ref|XP_010656258.1| PREDICTED: protein IQ-DOMAIN 14 [Vitis vinifera]
 ref|XP_010656259.1| PREDICTED: protein IQ-DOMAIN 14 [Vitis vinifera]
 ref|XP_010656260.1| PREDICTED: protein IQ-DOMAIN 14 [Vitis vinifera]
 ref|XP_010656261.1| PREDICTED: protein IQ-DOMAIN 14 [Vitis vinifera]
 emb|CBI27990.3| unnamed protein product [Vitis vinifera]
Length=435

 Score = 80.5 bits (197),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 107/331 (32%), Positives = 154/331 (47%), Gaps = 75/331 (23%)
 Frame = +1

Query  82    GIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQ  261
             G RE   AVKIQ+ FR YL+R+ALRALK LV+LQALV+GYLVRK     L G+QAL+RAQ
Sbjct  119   GGRERWGAVKIQTVFRGYLARKALRALKGLVKLQALVRGYLVRKQATATLHGMQALIRAQ  178

Query  262   SRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRV  441
             +  R+   + +    S+ K  + Q     T +  E+    RS                  
Sbjct  179   ATVRA---QKARELISNEKRFEIQ-----TRKSMERFDESRSEHT---------------  215

Query  442   IGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhs  621
                   + S R+   +D         +    ID   S KI+E+DTG+P            
Sbjct  216   ----ASIHSRRLSASLD---------TTFNAIDG--SPKIVEVDTGRP------------  248

Query  622   shlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSP-------------QNFGQQIN  762
                   S + + S++ S D   +Q + SP  C      P              ++G   +
Sbjct  249   ---KSRSRRTNTSVSDSGDDQHYQTLSSPLPCRTPIPVPVRLSTPDHRNYQDSDWGLTGD  305

Query  763   ESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKM  939
             E  F TA ++P+F ++          P TP+K+  A S    Y++ PNYM+ T+S KAK+
Sbjct  306   ECRFSTAQSTPRFMNSERSNV-----PITPAKTVCADSFFRQYTNFPNYMANTQSFKAKL  360

Query  940   RSLSAPKQRPQYERSSSTKRYSIHGYGELRT  1032
             RS SAPKQRP+       KR S++   E R+
Sbjct  361   RSHSAPKQRPE---PGPKKRLSLNEMMESRS  388



>ref|XP_010932805.1| PREDICTED: protein IQ-DOMAIN 14 isoform X2 [Elaeis guineensis]
Length=442

 Score = 80.5 bits (197),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 118/384 (31%), Positives = 166/384 (43%), Gaps = 100/384 (26%)
 Frame = +1

Query  46    STACINRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTAD  225
             ++A  ++N+      EE AA+KIQ+ FR+YL+R+AL ALK LV+LQALV+G+LVRK    
Sbjct  115   TSAATDKNSSNI---EEAAAIKIQAAFRSYLARKALCALKGLVKLQALVRGHLVRKQATA  171

Query  226   MLRGLQALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDT  405
              LR +QALV AQ+RA                                Q I M        
Sbjct  172   TLRRMQALVTAQARA------------------------------CAQRIQM--------  193

Query  406   IMLKRNLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSD--KILEIDTG  579
                   + + +VI  Q+ +      YR    S +H  S  S  +D    +  KI+E+D G
Sbjct  194   ------VEEYKVISQQQSI------YRR---SPQHPRSRYSYELDRSAEENAKIVEMDLG  238

Query  580   KPVFLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIV--------------HSPSYC  717
             +     K R            + YS +   +KD  A                   SP+  
Sbjct  239   ESRSTSKSR------------NSYSITQTETKDHRAFAYYGSARPPLRAEQYQQFSPAPS  286

Query  718   EAQSLSPQNFGQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSDARSCLSGYSDH  897
                 +SP+ +     E  F TA +SPQ+ SA S              SDA      YS +
Sbjct  287   AITDMSPRAYSGHFEEFSFTTAQSSPQYLSALSA-------------SDATQASFDYSFY  333

Query  898   PNYMSYTESAKAKMRSLSAPKQRPQ-YERSSSTKRYSIHGYGELRTNSQRGSSLQANFTS  1074
             PNYM+ TES++AK RS SAP+QR   YER +S +R S+ G    R    + SS     T+
Sbjct  334   PNYMANTESSRAKARSQSAPRQRTDTYERQTSRRRPSVEGRNIPRGVRMQRSSSHVGLTA  393

Query  1075  KA--YPGSGRLDSFGMPVIRDQVG  1140
                 YP   +LD   M +   + G
Sbjct  394   NGYQYPWPIKLDRSSMSLKDSECG  417



>ref|XP_010483943.1| PREDICTED: protein IQ-DOMAIN 14-like [Camelina sativa]
Length=400

 Score = 80.1 bits (196),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 114/314 (36%), Positives = 151/314 (48%), Gaps = 79/314 (25%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             E LAA+KIQS FR YL+RRALRALKALV+LQALV+G++VRK TADMLR +Q LVR QS+A
Sbjct  115   ENLAAMKIQSSFRGYLARRALRALKALVKLQALVRGHIVRKQTADMLRRMQTLVRLQSQA  174

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGD  450
             R+   + S S  S   S                 +   S  +    +  R +S   VI  
Sbjct  175   RARASRSSHSSVSFHSST---------------ALLFPSSSSSPRSLHTRCVSNAEVISM  219

Query  451   QEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshl  630
               +  S R+D++ +              + D   DKILE+DT KP F PK          
Sbjct  220   DHRGGSKRLDWQAE-------------EVQD--EDKILEVDTWKPQFHPK----------  254

Query  631   slnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYSA  810
                       L + +++       SP   +   L P+            + +NSPQ  S+
Sbjct  255   ---------PLRSERNN------ESPRKRQQSLLGPR------------STENSPQVGSS  287

Query  811   SSKGGSSRVGPFTPSKSDARSC------LSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQ  972
                 GS R  PFTP+     S        SGY  HPNYM+ TES KAK+RS SAPKQR +
Sbjct  288   ----GSRRRTPFTPTSRSEYSWGCNNYYYSGY--HPNYMANTESYKAKVRSQSAPKQRSE  341

Query  973   YERSSSTKRYSIHG  1014
                 +S  + S+ G
Sbjct  342   VSNDTSGYKRSVQG  355



>ref|XP_002871260.1| IQ-domain 24 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47519.1| IQ-domain 24 [Arabidopsis lyrata subsp. lyrata]
Length=401

 Score = 80.1 bits (196),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 107/311 (34%), Positives = 142/311 (46%), Gaps = 69/311 (22%)
 Frame = +1

Query  88    REELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSR  267
             RE  AA+KIQS FR YL+RRALRALKALV+LQALVKG++VRK TADMLR +Q LVR Q+R
Sbjct  104   REYKAAMKIQSAFRGYLARRALRALKALVKLQALVKGHIVRKQTADMLRRMQTLVRLQAR  163

Query  268   ARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIG  447
             AR+           S   +      P +P+ F       +  +    M   N + R  +G
Sbjct  164   ARASRSSHVSDSSHSPTLMI-----PSSPQSFHARCVSEAEYSKVIAMDHHNNNHRSPMG  218

Query  448   DQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhssh  627
                 +   R +  +  W         + P  +  +DKILE+DT KP F            
Sbjct  219   SSRLLGQRRTEESL--W---------NAPQYNEDNDKILEVDTWKPHFRE----------  257

Query  628   lslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYS  807
                                                SP+  G  +      + +NSPQ  S
Sbjct  258   -----------------------------------SPRKRGSLM---VTTSVENSPQLRS  279

Query  808   ASSKGGSSRVG--PFTPSKSDARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQYER  981
              +           PFTP++S+     SGY  HPNYM+ TES +AK+RS SAP+QR Q   
Sbjct  280   RTGGSSGGSRRKTPFTPTRSEY-EYYSGY--HPNYMANTESYRAKVRSQSAPRQRLQDLS  336

Query  982   SSSTKRYSIHG  1014
             S S  + SI G
Sbjct  337   SESGYKRSIQG  347



>ref|XP_010458214.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X1 [Camelina sativa]
 ref|XP_010458223.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X2 [Camelina sativa]
Length=399

 Score = 79.3 bits (194),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 114/314 (36%), Positives = 149/314 (47%), Gaps = 79/314 (25%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             E LAA+KIQS FR YL+RRALRALKALV+LQALV+G +VRK TADMLR +Q LVR QS+A
Sbjct  114   ENLAAMKIQSSFRGYLARRALRALKALVKLQALVRGNIVRKQTADMLRRMQTLVRLQSQA  173

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGD  450
             R+   + S S  S   S     P   +     + +H R   N + I +      +R+   
Sbjct  174   RARASRSSHSSVSFHSSTALLFP---SSSSSPRSLHTRCVSNAEVISMDHRGGSKRLDWQ  230

Query  451   QEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshl  630
              E+V+                             DKILE+DT KP F PK          
Sbjct  231   AEEVQDE---------------------------DKILEVDTWKPHFHPKQ---------  254

Query  631   slnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYSA  810
                       L + +++       SP   +   L P+            + +NSPQ  S+
Sbjct  255   ----------LRSDRNN------ESPRKRQQSLLCPR------------STENSPQVGSS  286

Query  811   SSKGGSSRVGPFTPSKSDARS--C----LSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQ  972
                 GS R  PFTP+     S  C     SGY  HPNYM+ TES KAK+RS SAPKQR +
Sbjct  287   ----GSRRRTPFTPTSRSEYSWGCNNYYYSGY--HPNYMANTESYKAKVRSQSAPKQRAE  340

Query  973   YERSSSTKRYSIHG  1014
                 +S  + S+ G
Sbjct  341   VSNDTSGYKRSVQG  354



>gb|KDP40224.1| hypothetical protein JCGZ_02222 [Jatropha curcas]
Length=453

 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 116/345 (34%), Positives = 159/345 (46%), Gaps = 67/345 (19%)
 Frame = +1

Query  103   AVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRARSGL  282
             A+KIQS FR+YL+R+AL ALK LV+LQALV+G+LVRK     LR +QALV  Q+RAR+  
Sbjct  128   AIKIQSVFRSYLARKALCALKGLVKLQALVRGHLVRKQATATLRCMQALVTVQARARAQR  187

Query  283   PKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGDQEKV  462
               ++E     TK           P    Q IH +S  ++                     
Sbjct  188   ILMAEE----TK-----------PASQRQSIHKKSTHDN---------------------  211

Query  463   RSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshlslns  642
             R   ++Y  D    E+               KI+E+D G+     K RN +         
Sbjct  212   RFRHLNYDTDRGMEEN--------------IKIVEMDLGQAKGSTKSRNSYSHQPQPEYE  257

Query  643   DQYSYSLATSKDSTAHQIVHSPSYCEA-------QSLSPQNFGQQINESCFCTADNSPQF  801
             D      +T  +S  H +   P  C+          +SP+       +    TA++SP +
Sbjct  258   DP---RFSTYYESLNH-VYSKPDKCQLSPAPSALTDMSPRGCSGHFEDYSLNTAESSP-Y  312

Query  802   YSASSKGGSSRVGPFT-PSKSDARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQ-Y  975
             YSA SK   SRV PF  P    A S    Y   PNYM+ TES++AK+RS SAPKQRP  +
Sbjct  313   YSAVSKPEPSRV-PFAFPQPEYAESLSYDYPLFPNYMANTESSRAKVRSHSAPKQRPDSF  371

Query  976   ERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSK--AYPGSGRLD  1104
             ER  S +R S+ G    R    + SS     T++   YP S +LD
Sbjct  372   ERQPSRRRASVEGRNIPRAMRMQRSSSHVGATAQNYQYPWSTKLD  416



>ref|XP_007013015.1| Iq-domain 31 [Theobroma cacao]
 gb|EOY30634.1| Iq-domain 31 [Theobroma cacao]
Length=445

 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 107/326 (33%), Positives = 158/326 (48%), Gaps = 69/326 (21%)
 Frame = +1

Query  82    GIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQ  261
             G RE  AAVKIQ+ FR YL+R+ALRALK LV++QALV+GYLVRK     L  +QAL+RAQ
Sbjct  133   GGRERWAAVKIQTVFRGYLARKALRALKGLVKIQALVRGYLVRKQATATLHSMQALIRAQ  192

Query  262   SRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRV  441
             +  RS                          +K   +I+  + + D              
Sbjct  193   ATIRS--------------------------QKARGLINHDANRFD--------------  212

Query  442   IGDQEKVRSNRMDYRMDAWSWEHQGS--------SRSGPIDDGKSDKILEIDTGKPVFLP  597
                   +R+ +   R D    EH  S        S    I+  +S KI+E+DTG+P    
Sbjct  213   ------IRARKSMERFDDTRSEHTVSFHSRRLSASLDTAINIDESPKIVEVDTGRP----  262

Query  598   KHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFC  777
             K R+   ++ +S  SD   Y   +S      ++    S  +++     ++G   +E  F 
Sbjct  263   KSRSRRTNTSVSDFSDDPPYQTLSS--PLPSRVPARLSLPDSRHCQETDWGLTGDECRFS  320

Query  778   TADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSA  954
             TA ++P+F ++    GS+   P TP+KS  A +    Y + PNYM+ T+S KAK+RS SA
Sbjct  321   TAQSTPRFINSC---GSN--APVTPAKSVCAENLFRHYGNFPNYMASTQSFKAKLRSHSA  375

Query  955   PKQRPQYERSSSTKRYSIHGYGELRT  1032
             PKQRP+       KR S++   E R+
Sbjct  376   PKQRPE---PGPKKRLSLNEMMESRS  398



>ref|XP_006363480.1| PREDICTED: protein IQ-DOMAIN 14-like [Solanum tuberosum]
Length=464

 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 113/368 (31%), Positives = 172/368 (47%), Gaps = 67/368 (18%)
 Frame = +1

Query  70    AGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQAL  249
             A  Y + EE AA KIQ+ FR YL+R+AL ALK LV+LQALV+G+LVRK  A  LR +QAL
Sbjct  127   ARAYAL-EEDAAAKIQAVFRGYLARKALNALKGLVKLQALVRGHLVRKQAAATLRCMQAL  185

Query  250   VRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLS  429
             V  Q+RAR+   +++E                 +P    Q +H +S Q++          
Sbjct  186   VTVQARARAQRIRMAEDE---------------SPNNPRQSVHRKSTQDN----------  220

Query  430   KRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRn  609
                      K R +  DY  D                     KI+E+D G+     K RN
Sbjct  221   ---------KFRHSYQDYEEDI--------------------KIVEMDLGESKGNTKSRN  251

Query  610   lfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNF-GQQINESCFCTAD  786
              + +   +  ++    +     +   HQ + SP        SP+ + G   + + + T  
Sbjct  252   CYSNQGETERTEHRFSTHNAYTNQEHHQQIISPVPSAITDQSPKAYSGHFEDYTSYPTTQ  311

Query  787   NSPQFYSAS-SKGGSSRVGPFTP----SKSDARSCLSGYSDHPNYMSYTESAKAKMRSLS  951
             +SPQ+Y+ + SK   SR+ P++       ++  S  + Y  +P+YM+ T+S+ AK RS S
Sbjct  312   SSPQYYNNTMSKPDPSRI-PYSSYARSEYAEPESLYNEYPFYPSYMANTKSSMAKARSHS  370

Query  952   APKQRPQ---YERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSK--AYPGSGRLDSFGM  1116
             APKQRP    +ER  S +R SI G    R    + SS     T++   YP S +LD   +
Sbjct  371   APKQRPDQTSFERQPSRRRPSIEGRNVPRAVKMQRSSSHVGSTAQNYQYPWSIKLDKSNI  430

Query  1117  PVIRDQVG  1140
              +   + G
Sbjct  431   SIKDSECG  438



>ref|XP_011073614.1| PREDICTED: protein IQ-DOMAIN 32-like, partial [Sesamum indicum]
Length=340

 Score = 78.2 bits (191),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 114/349 (33%), Positives = 166/349 (48%), Gaps = 73/349 (21%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             EE AAVKIQS FRA+L+R+AL ALK LV+LQALV+G+LVR+     LR +QAL+  Q+RA
Sbjct  21    EEAAAVKIQSVFRAHLARKALNALKGLVKLQALVRGHLVRRQATATLRCMQALLSVQARA  80

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGD  450
             R+    ++E     TKSV                      Q   T+        RR    
Sbjct  81    RARRLLMAEE----TKSV---------------------AQKQSTL--------RRP---  104

Query  451   QEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSD--KILEIDTGKPVFLPKHRnlfhss  624
                             S E++  + +   D G  D  KI+E+D G    + + RN   + 
Sbjct  105   ----------------SQENKSRNFNQEFDRGHEDDIKIVEMDPGNNKPVARARNSHSNY  148

Query  625   hlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFY  804
                   +Q + + +T       Q+  SP       ++P+      +E     A +SPQ  
Sbjct  149   TQLDKFEQRTSTHSTPVKQEYQQL--SP----LTDMTPRTCSNHFDEYLCSAALSSPQCC  202

Query  805   SASSKGGSSRVGPFT-PSKSDARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRP--QY  975
             SA SK   + +  F+ P    A S  + Y  +PNYM+ T+S++AK+RS SAPKQRP   +
Sbjct  203   SAVSKPDQAMLQTFSYPRLEYAESLYNEYPFYPNYMANTKSSRAKLRSHSAPKQRPVEMF  262

Query  976   ERSSSTKRYSIHG------YGELRTNSQRGSSLQANFTSKAYPGSGRLD  1104
             ER +S +R S+ G          R++S  GS+ Q N+    YP S +LD
Sbjct  263   ERQTSRRRASMEGRNFPKAVKMQRSSSHVGSTGQ-NYQ---YPWSVKLD  307



>ref|XP_009108597.1| PREDICTED: protein IQ-DOMAIN 14-like [Brassica rapa]
 emb|CDX76341.1| BnaA08g10590D [Brassica napus]
Length=420

 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 130/386 (34%), Positives = 179/386 (46%), Gaps = 104/386 (27%)
 Frame = +1

Query  4     RSTSAAAWCGSTVNSTACINRNAGGYGIREELAAVKIQSHFraylsrralralkalvrlq  183
             R TS A +     +  A ++R       R+ LAA+KIQS FR YL++RALRALK LV+LQ
Sbjct  122   RLTSTANFSSGFNDVVAHVSRFDRYRSGRDSLAAIKIQSTFRGYLAKRALRALKGLVKLQ  181

Query  184   alVKGYLVRKHTADMLRGLQALVRAQ----SRARSGLPKISESPHSSTKSVQFQHP---G  342
             A+V+G++ RK  +  LR + ALVRAQ    +R      + S S  ++TKS  FQ+P   G
Sbjct  182   AIVRGHIERKKMSVHLRRMHALVRAQARVRARRVVVSSESSSSKSNNTKSSHFQNPIDKG  241

Query  343   PPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGDQEKVRSNRMD------YRMDAWSW  504
             P TPEK E  I  RS +   + + KRN S         K R NR D        +D   W
Sbjct  242   PTTPEKLEYSISSRSSKLGHSHLSKRNGS---------KARGNRPDIFYSSHLVLDNSGW  292

Query  505   EHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshlslnsDQYSYSLATSKDST  684
                    SGP+                                       Y++  S  S+
Sbjct  293   -------SGPV---------------------------------------YAMPFSPSSS  306

Query  685   AHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSD  864
               + V    +C A++ S Q +          T+ N P  ++ SS           PS+S 
Sbjct  307   HEETVS--QFCNAEN-STQLYS--------ATSINKPSVFTTSS---------IAPSEST  346

Query  865   ARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRTNSQR  1044
                C   Y+DHP+YM+ TES++A+ RS SAPK RPQ              Y E   + Q 
Sbjct  347   KSCC---YTDHPSYMACTESSRARARSASAPKSRPQL-------------YHEQSLSKQF  390

Query  1045  GSSLQANFTSKAYPGSGRLDSFGMPV  1122
             G +LQ +F +KAYPGSGRL+  GMP+
Sbjct  391   GDALQTSFMNKAYPGSGRLNRLGMPI  416



>emb|CAN69979.1| hypothetical protein VITISV_011284 [Vitis vinifera]
Length=387

 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 110/328 (34%), Positives = 154/328 (47%), Gaps = 72/328 (22%)
 Frame = +1

Query  82    GIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQ  261
             G R+  AA KIQ+ FR YL+R+A RALK LV+LQALV+G+LVRK  A  L  +QAL+RAQ
Sbjct  103   GGRDRWAATKIQTVFRGYLARKAHRALKGLVKLQALVRGFLVRKRAAATLHSMQALIRAQ  162

Query  262   SRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRV  441
             +  RS                             ++ +  R+ +N         +  RR 
Sbjct  163   AAVRS-----------------------------QRTLRARNKENR----FPPEMRPRRS  189

Query  442   IGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhs  621
             I   E+ RS     RM   S+E   ++     D+  S KI+EIDT    F PK R+    
Sbjct  190   IERFEETRSEFHSKRMST-SFETSVNA----FDE--SPKIVEIDT----FKPKSRSRR--  236

Query  622   shlslnsDQYSYSLATSKDSTAHQIVHSPSYCE--AQSLSPQNFGQQINESCFC------  777
                       + S + S +   +Q + SP  C   A+   P     Q  E CF       
Sbjct  237   --------MMNTSTSDSGEDPPYQTLSSPLPCPVPARLSIPDCRNFQDFEWCFTGDECRF  288

Query  778   -TADNSPQFYSASSKGGSSRVGPFTPSKSDA-RSCLSGYSDHPNYMSYTESAKAKMRSLS  951
              TA ++P+  + S       V P TP+KS    S    YS+ PNYM+ T+S KAK+RS S
Sbjct  289   STAQSTPRLANTSRA-----VAPVTPAKSVCGDSFFRPYSNFPNYMANTQSFKAKLRSHS  343

Query  952   APKQRPQYERSSSTKRYSIHGYGELRTN  1035
             APKQRP+       +R+S++     RT+
Sbjct  344   APKQRPE---PGPKRRFSLNEIMASRTS  368



>gb|KHG17476.1| Protein IQ-DOMAIN 14 -like protein [Gossypium arboreum]
Length=408

 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 109/334 (33%), Positives = 158/334 (47%), Gaps = 91/334 (27%)
 Frame = +1

Query  82    GIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQ  261
             G+ E+ AAVKIQ+ FR YL+R+ALRALK LV++QALV+GYLVRK  +     +QAL+RAQ
Sbjct  101   GVHEKWAAVKIQTVFRGYLARKALRALKGLVKIQALVRGYLVRKQASATFHSMQALMRAQ  160

Query  262   SRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRV  441
             +  +S                          +K   +I      N+D I           
Sbjct  161   ATIKS--------------------------QKARAII------NNDAIRFD--------  180

Query  442   IGDQEKVRSNRMDYRMDAWSWEHQGS--SR--SGPIDDGKSDKILEIDTGKPVFLPKHRn  609
                   +R+ +   R D    EH  S  SR  S  +D  +S KI+E+DTG     PK R+
Sbjct  181   ------IRARKSMERFDDTRSEHTVSIHSRRLSASLDIDESPKIVEVDTG---IKPKARS  231

Query  610   lfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQ-------NFGQQINES  768
                ++ +S   D ++Y    S           P  C A+   P        ++G   +E 
Sbjct  232   RRTNTSISDFIDDHTYQTLPSP---------LPCRCPARLSIPDSRHYQDIDWGFSGDEC  282

Query  769   CFCTADNSPQFYSASSKGGSSRVGPFTPSKSDARSCLSGYS------DHPNYMSYTESAK  930
              F TA ++P+F ++          P TP+KS     +SG++      D PNYM+ T+S K
Sbjct  283   RFSTAHSTPRFINS--------CAPATPAKS-----VSGHNFFRPCGDSPNYMANTQSFK  329

Query  931   AKMRSLSAPKQRPQYERSSSTKRYSIHGYGELRT  1032
             AK+RS SAPKQRP+       KR S++   E R+
Sbjct  330   AKLRSHSAPKQRPE---PGPKKRLSLNEMMESRS  360



>gb|KHN26986.1| Protein IQ-DOMAIN 31 [Glycine soja]
Length=435

 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 110/306 (36%), Positives = 149/306 (49%), Gaps = 51/306 (17%)
 Frame = +1

Query  76   GYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVR  255
            G G +E LA VKIQ+ FR YL+R+ALRALK LV+LQALV+GYLVRK  A  L  +QAL+R
Sbjct  107  GGGGQERLAVVKIQTFFRGYLARKALRALKGLVKLQALVRGYLVRKQAAATLHSMQALIR  166

Query  256  AQSRARS----GLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRN  423
            AQ+  RS    GL       H       FQ     + E+F+ +                 
Sbjct  167  AQATVRSKKSHGLSSTKNEAH------LFQTQARRSMERFDDI-----------------  203

Query  424  LSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKH  603
              K   I     + S R+    DA       +  +    DG S KI+E+DTG     PK 
Sbjct  204  --KSEYIAP---IHSRRLSSSFDA-------TMNNANSVDG-SPKIVEVDTGSG--RPKS  248

Query  604  RnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESC-FCT  780
            R+   ++ +S   D  S+    S    AH  +  P+     +      G++  E C F T
Sbjct  249  RSRRSNTSMSDFGDDPSFQALPSPLPFAHLSI--PNLRNYHNSEWGLTGEE--EECRFST  304

Query  781  ADNSPQFYSASSKGGSSRVGPF--TPSKSDARSCLSG-YSDHPNYMSYTESAKAKMRSLS  951
            A ++P+F ++ S  GS  V P   TP      +   G Y + PNYM+ T+S KAK+RS S
Sbjct  305  AQSTPRFTNSCS-CGSVVVAPMSMTPKSVCTENFFYGQYHNFPNYMASTQSFKAKLRSHS  363

Query  952  APKQRP  969
            APKQRP
Sbjct  364  APKQRP  369



>gb|KFK27942.1| hypothetical protein AALP_AA8G451100 [Arabis alpina]
Length=394

 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 112/315 (36%), Positives = 144/315 (46%), Gaps = 85/315 (27%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             E LA VKIQS FR YL+RRALRALKALV+LQALV+G++VRK TADM R +Q LVR QS+A
Sbjct  114   EYLAVVKIQSAFRGYLARRALRALKALVKLQALVRGHIVRKQTADMFRRMQTLVRLQSQA  173

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGD  450
             R+   + S S  S   S     P   +     + +H R   N + I +            
Sbjct  174   RARASRSSHSSASFHSSTALLFP---SSSSSPRSLHTRCVSNAEIIPI------------  218

Query  451   QEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshl  630
                               +H+GS R     +   DKILE+DT KP + PK          
Sbjct  219   ------------------DHRGSKRLDWQGEENEDKILEVDTWKPHYHPKR---------  251

Query  631   slnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYSA  810
                                          E  + SP+   Q +   C  + +NSPQ  S+
Sbjct  252   ----------------------------SERNNESPRKRQQSL--LCPRSTENSPQVGSS  281

Query  811   SSKGGSSRVGPFTPSKSDARSC-------LSGYSDHPNYMSYTESAKAKMRSLSAPKQRP  969
                 GS R  PFTP+     S         SGY  HPNYM+ TES KAK+RS SAPKQR 
Sbjct  282   ----GSRRRTPFTPTSRSEYSWGGTNNYYYSGY--HPNYMANTESYKAKVRSQSAPKQRI  335

Query  970   QYERSSSTKRYSIHG  1014
             +    +S  + S+ G
Sbjct  336   EVSNETSGYKRSVQG  350



>gb|KEH43814.1| IQ calmodulin-binding motif protein [Medicago truncatula]
Length=455

 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 113/356 (32%), Positives = 174/356 (49%), Gaps = 74/356 (21%)
 Frame = +1

Query  103   AVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRARSGL  282
             AVKIQ  FR++L+R+ALRAL+ LV+LQAL++G+LVRK     LR +Q LV AQ+RAR+  
Sbjct  139   AVKIQCVFRSHLARKALRALRGLVKLQALIRGHLVRKQAKATLRCMQDLVTAQARARA--  196

Query  283   PKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGDQEKV  462
                        + ++    G P       + H  + +ND    L R +      G ++ +
Sbjct  197   -----------QRIRMVSEGKP------HLNHRNAMEND----LFRQIYNEMDRGLEDNI  235

Query  463   RSNRMDYRMDAWSWEHQG--SSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshlsl  636
             +   MD+       E +G  +SRS  ++    ++                          
Sbjct  236   KIVEMDF------CESKGNSTSRSSSVNRQHYEQ--------------------------  263

Query  637   nsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYSASS  816
             + ++YS + + +K+   +++  +PS      LSP+       E CF TA +SPQ YSA S
Sbjct  264   SENRYSINGSYTKEEN-YKVSPAPS--ALTELSPKACSGHF-EDCFSTAQSSPQCYSAIS  319

Query  817   KGGSSRVGPFT-PSKSDARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQ-YERSSS  990
             K   S   PF  P  S A      Y  +P+YM+ TES++AK+RS SAPKQRP  +ER  S
Sbjct  320   KTDESN-HPFAFPRPSYAEQMSYDYPLYPSYMANTESSRAKVRSQSAPKQRPDSFERQLS  378

Query  991   TKRYSIHGYG------ELRTNSQRGSSLQANFTSKAYPGSGRLDSFGMPVIRDQVG  1140
              +R S+ G          R++SQ G++ Q N+    YP S +LD   + +   + G
Sbjct  379   RRRISVEGRNVPRPVRMQRSSSQVGAAAQ-NY---QYPWSIKLDRSAVSLKDSECG  430



>ref|XP_004503492.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X1 [Cicer arietinum]
Length=462

 Score = 78.2 bits (191),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 108/322 (34%), Positives = 156/322 (48%), Gaps = 52/322 (16%)
 Frame = +1

Query  82    GIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQ  261
             G  +  AAVKIQ+ FR YL+R+ALRALK LV+LQALV+GYLVRK     L  +QAL+RAQ
Sbjct  144   GGHQRFAAVKIQTIFRGYLARKALRALKGLVKLQALVRGYLVRKQATATLHSMQALIRAQ  203

Query  262   SRARS----GLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLS  429
             +  RS    GL       H S                  Q    RS +       + N S
Sbjct  204   ATVRSHKSRGLINTKNETHRS------------------QTQARRSTE-------RYNES  238

Query  430   KRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRn  609
              R        + S R+    DA       ++ S  I+   S KI+E+DTG+P    K R+
Sbjct  239   NRSEYTASIPIHSRRLSSSFDA----TMNNTNSYEIE---SPKIVEVDTGRP----KSRS  287

Query  610   lfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADN  789
                ++ +S   D  S+   +S        +  P+    ++ +  ++G    E  F TA +
Sbjct  288   RRSNTSISDFGDDPSFQTLSSPLPITPSQLFIPN---QRNFNESDWGITGEEYKFSTAQS  344

Query  790   SPQFYSASSKGGSSRVGPFTPSKSDARSCLSG-YSDHPNYMSYTESAKAKMRSLSAPKQR  966
             +P+F ++ + G    + P TP      +   G Y D PNYM+ T+S KAK+RS SAPKQR
Sbjct  345   TPRFKNSCTCGF---IAPSTPKTICGDNFYIGEYGDFPNYMANTQSFKAKLRSHSAPKQR  401

Query  967   PQYERSSSTKRYSIHGYGELRT  1032
             P+ +     KR S++   E R+
Sbjct  402   PEPK-----KRVSLNEMMESRS  418



>ref|XP_004503494.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X3 [Cicer arietinum]
 ref|XP_004503495.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X4 [Cicer arietinum]
Length=435

 Score = 78.2 bits (191),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 108/322 (34%), Positives = 156/322 (48%), Gaps = 52/322 (16%)
 Frame = +1

Query  82    GIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQ  261
             G  +  AAVKIQ+ FR YL+R+ALRALK LV+LQALV+GYLVRK     L  +QAL+RAQ
Sbjct  117   GGHQRFAAVKIQTIFRGYLARKALRALKGLVKLQALVRGYLVRKQATATLHSMQALIRAQ  176

Query  262   SRARS----GLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLS  429
             +  RS    GL       H S                  Q    RS +       + N S
Sbjct  177   ATVRSHKSRGLINTKNETHRS------------------QTQARRSTE-------RYNES  211

Query  430   KRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRn  609
              R        + S R+    DA       ++ S  I+   S KI+E+DTG+P    K R+
Sbjct  212   NRSEYTASIPIHSRRLSSSFDA----TMNNTNSYEIE---SPKIVEVDTGRP----KSRS  260

Query  610   lfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADN  789
                ++ +S   D  S+   +S        +  P+    ++ +  ++G    E  F TA +
Sbjct  261   RRSNTSISDFGDDPSFQTLSSPLPITPSQLFIPN---QRNFNESDWGITGEEYKFSTAQS  317

Query  790   SPQFYSASSKGGSSRVGPFTPSKSDARSCLSG-YSDHPNYMSYTESAKAKMRSLSAPKQR  966
             +P+F ++ + G    + P TP      +   G Y D PNYM+ T+S KAK+RS SAPKQR
Sbjct  318   TPRFKNSCTCGF---IAPSTPKTICGDNFYIGEYGDFPNYMANTQSFKAKLRSHSAPKQR  374

Query  967   PQYERSSSTKRYSIHGYGELRT  1032
             P+ +     KR S++   E R+
Sbjct  375   PEPK-----KRVSLNEMMESRS  391



>ref|XP_004503493.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X2 [Cicer arietinum]
Length=453

 Score = 78.2 bits (191),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 108/322 (34%), Positives = 156/322 (48%), Gaps = 52/322 (16%)
 Frame = +1

Query  82    GIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQ  261
             G  +  AAVKIQ+ FR YL+R+ALRALK LV+LQALV+GYLVRK     L  +QAL+RAQ
Sbjct  135   GGHQRFAAVKIQTIFRGYLARKALRALKGLVKLQALVRGYLVRKQATATLHSMQALIRAQ  194

Query  262   SRARS----GLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLS  429
             +  RS    GL       H S                  Q    RS +       + N S
Sbjct  195   ATVRSHKSRGLINTKNETHRS------------------QTQARRSTE-------RYNES  229

Query  430   KRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRn  609
              R        + S R+    DA       ++ S  I+   S KI+E+DTG+P    K R+
Sbjct  230   NRSEYTASIPIHSRRLSSSFDA----TMNNTNSYEIE---SPKIVEVDTGRP----KSRS  278

Query  610   lfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADN  789
                ++ +S   D  S+   +S        +  P+    ++ +  ++G    E  F TA +
Sbjct  279   RRSNTSISDFGDDPSFQTLSSPLPITPSQLFIPN---QRNFNESDWGITGEEYKFSTAQS  335

Query  790   SPQFYSASSKGGSSRVGPFTPSKSDARSCLSG-YSDHPNYMSYTESAKAKMRSLSAPKQR  966
             +P+F ++ + G    + P TP      +   G Y D PNYM+ T+S KAK+RS SAPKQR
Sbjct  336   TPRFKNSCTCGF---IAPSTPKTICGDNFYIGEYGDFPNYMANTQSFKAKLRSHSAPKQR  392

Query  967   PQYERSSSTKRYSIHGYGELRT  1032
             P+ +     KR S++   E R+
Sbjct  393   PEPK-----KRVSLNEMMESRS  409



>gb|KFK25118.1| hypothetical protein AALP_AA8G068100 [Arabis alpina]
Length=396

 Score = 77.8 bits (190),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 108/319 (34%), Positives = 148/319 (46%), Gaps = 86/319 (27%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             E ++A KIQS FR YL+RRALRALK LV+LQALVKG++VRK TADMLR +Q LVR Q+RA
Sbjct  100   EYVSATKIQSAFRGYLARRALRALKGLVKLQALVKGHIVRKQTADMLRRMQTLVRLQARA  159

Query  271   RSGLP-KISESPHSSTKSVQFQHPGPP--------TPEKFEQVIHMRSGQNDDTIMLKRN  423
             R+     +S+S HSST       P  P        +  ++ +VI M    N++       
Sbjct  160   RASRSSHVSDSFHSSTT---LMLPASPNSFHARCISEAEYSKVIAMDHHHNNN-------  209

Query  424   LSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKH  603
                R  +G      S+R+   +D W  E +  +      D  +DKILE+DT KP +    
Sbjct  210   ---RSHMG------SSRL---LDQWKTEERLWN--AAQYDESNDKILEVDTWKPHY----  251

Query  604   RnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTA  783
                                                      + SP+  G  +      + 
Sbjct  252   -----------------------------------------NQSPRKRGSLM---VPTSV  267

Query  784   DNSPQFYSASSKGGSSRVG--PFTPSKSDARSCLSGYSDHPNYMSYTESAKAKMRSLSAP  957
             DNSPQ  S             PFTP++S+          +PNYM+ TES +AK+RS SAP
Sbjct  268   DNSPQLRSRPGSSSGGSRRRTPFTPTRSEYEYYSGY---YPNYMANTESYRAKVRSQSAP  324

Query  958   KQRPQYERSSSTKRYSIHG  1014
             +QR Q   S S  + S+ G
Sbjct  325   RQRLQELSSESGYKRSVQG  343



>ref|XP_002514224.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48178.1| conserved hypothetical protein [Ricinus communis]
Length=429

 Score = 78.2 bits (191),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 107/336 (32%), Positives = 157/336 (47%), Gaps = 71/336 (21%)
 Frame = +1

Query  82    GIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQ  261
             G +E  AA+KIQ+ FR YL+R+ALRALK LV+LQA  +GYLVRK     L  +QAL+RAQ
Sbjct  115   GGQERWAAIKIQTVFRGYLARKALRALKGLVKLQAHFRGYLVRKQATATLHSMQALIRAQ  174

Query  262   SRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRV  441
             +  RS       + +      +F+     + E+F++     +                  
Sbjct  175   ATVRS-----QRARNLIKTENRFEIRARKSMERFDETRSEHTAS----------------  213

Query  442   IGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhs  621
                   V S R+   +DA        +   PID+  S KI+E+DTG     PK R+    
Sbjct  214   ------VHSRRLSSSLDA--------TFVNPIDE--SPKIVEVDTGG--CRPKSRSR---  252

Query  622   shlslnsDQYSYSLATSKDSTAHQIVHSP---------SYCEAQSLSPQNFGQQINESCF  774
                     + + S++   D   +Q + SP         S  + ++    ++G   +E  F
Sbjct  253   --------RTNTSVSDFSDDPFYQTLSSPLPSRFPPRLSMLDTRNFQDSDWGLTGDECRF  304

Query  775   CTADNSPQFYSASSKGGSSRVGPFTPSKSDAR-SCLSGYSDHPNYMSYTESAKAKMRSLS  951
              TA ++P+F       G S   P TP+KS    +    Y + PNYM+ T+S KAK+RS S
Sbjct  305   STAQSTPRF-------GGSNNPPLTPAKSVCEDNFFRQYGNCPNYMANTKSFKAKVRSYS  357

Query  952   APKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQ  1059
             APKQRP        KR S++   E R NS  G  +Q
Sbjct  358   APKQRPD---PGPKKRLSLNELMESR-NSISGVRMQ  389



>ref|XP_007145905.1| hypothetical protein PHAVU_007G277500g [Phaseolus vulgaris]
 gb|ESW17899.1| hypothetical protein PHAVU_007G277500g [Phaseolus vulgaris]
Length=429

 Score = 77.8 bits (190),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 110/342 (32%), Positives = 157/342 (46%), Gaps = 58/342 (17%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             +E AA++IQS FR+YL+R+AL AL+ +V+LQALV+G+LVRK   + LR +QALV AQ+RA
Sbjct  120   QETAAIQIQSVFRSYLARKALCALRGIVKLQALVRGHLVRKQARETLRCMQALVIAQARA  179

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGD  450
             R    +I     S  K  Q   P   T E       M SG                    
Sbjct  180   RVQRARIV----SEGKVHQNLSPYRRTTEDNFMYNEMESGL-------------------  216

Query  451   QEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshl  630
               ++  N     M  W  +     R+  ++   SD               HR   +    
Sbjct  217   --ELEENAKIVEMAVWEAKANLRGRNNTVNHELSD---------------HRFCAY----  255

Query  631   slnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYSA  810
                   YS + + SK+   +    SP+      LSP+ +     E  F TA +SP + SA
Sbjct  256   ------YSSNGSYSKEENCNA---SPAPSTLTELSPRAYSGHFEECSFSTAQSSPYYCSA  306

Query  811   SSKGGSSRVGPFTPSKSDARSCLS-GYSDHPNYMSYTESAKAKMRSLSAPKQRPQ-YERS  984
              S+  ++++ PF   K      +S  Y   PNYM+ TES++AK RS SAPK RP  +ER 
Sbjct  307   VSRVDNTKL-PFALPKPAYTEPMSYDYPLFPNYMANTESSRAKSRSQSAPKARPDSFERQ  365

Query  985   SSTKRYSIHGYGELRTNSQRGSSLQANFTSK--AYPGSGRLD  1104
              S +R S+ G    R    + SS     T++   YP S +LD
Sbjct  366   PSRRRASMEGRNVPRPVRMQRSSSHVGVTAQNYQYPWSIKLD  407



>gb|KHG26933.1| Protein IQ-DOMAIN 31 -like protein [Gossypium arboreum]
Length=414

 Score = 77.8 bits (190),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 102/305 (33%), Positives = 146/305 (48%), Gaps = 86/305 (28%)
 Frame = +1

Query  91   EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
            E+ AA+KIQS FR YL+++ALRALK LV++QALV+GYL+RK  +  L G+QAL+RAQ+  
Sbjct  121  EKWAAIKIQSVFRGYLAKKALRALKGLVKIQALVRGYLLRKQASATLHGMQALIRAQATI  180

Query  271  RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGD  450
            RS           + KS++                     Q DDT       S+R V   
Sbjct  181  RS---------QKARKSME---------------------QFDDT------RSERTV---  201

Query  451  QEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshl  630
                 S R+   +D  + E             +S KI+EIDTG+P    K R+   ++ +
Sbjct  202  --SFHSRRLSASLDTLNIE-------------ESPKIVEIDTGRP----KSRSRRTNTSV  242

Query  631  slnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQ---NFGQQINESCFCTADNSPQF  801
            S   D  S+ + +S           PS   A+   P    ++G   +E  F TA ++P+F
Sbjct  243  SDFGDDPSFQILSSS---------VPSRVPARLSVPDSHTDWGLTGDECRFSTAQSTPRF  293

Query  802  YSASSKGGSSRVGPFTPSKSDARSCLSGYSDH--------PNYMSYTESAKAKMRSLSAP  957
             +           P TP+KS    C   +  H        PNYM+ T+S KAK+RS SAP
Sbjct  294  INCCVSNA-----PVTPAKS---VCADNFFRHYGIGNLNFPNYMANTQSFKAKLRSHSAP  345

Query  958  KQRPQ  972
            KQRP+
Sbjct  346  KQRPE  350



>ref|XP_002866468.1| hypothetical protein ARALYDRAFT_496381 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42727.1| hypothetical protein ARALYDRAFT_496381 [Arabidopsis lyrata subsp. 
lyrata]
Length=396

 Score = 77.4 bits (189),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 115/314 (37%), Positives = 153/314 (49%), Gaps = 79/314 (25%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             E LAA KIQS FR YL+RRALRALKALV+LQALV+G++VRK TADMLR +Q LVR QS+A
Sbjct  111   ENLAARKIQSAFRGYLARRALRALKALVKLQALVRGHIVRKQTADMLRRMQTLVRLQSQA  170

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGD  450
             R+   + S S  S   S                 +   S  +    +  R +S   VI  
Sbjct  171   RARASRSSHSSASFHSST---------------ALLFPSSSSSPRSLHTRCVSSAEVISM  215

Query  451   QEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshl  630
               +  S R+D++ +      +G       +DG  DKILE+DT KP + PK          
Sbjct  216   DHRGGSKRLDWQAE------EG-------EDG--DKILEVDTWKPHYHPK----------  250

Query  631   slnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYSA  810
                       L + +++       SP   +   L P+            + +NSPQ  S+
Sbjct  251   ---------PLRSERNN------ESPRKRQQSLLGPR------------STENSPQVGSS  283

Query  811   SSKGGSSRVGPFTPSKSDARSC------LSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQ  972
                 GS R  PFTP+     S        SGY  HPNYM+ TES KAK+RS SAPKQR +
Sbjct  284   ----GSRRRTPFTPTSRSEYSWGCNNYYYSGY--HPNYMANTESYKAKVRSQSAPKQRVE  337

Query  973   YERSSSTKRYSIHG  1014
                 +S  + S+ G
Sbjct  338   VSNETSGYKRSVQG  351



>ref|XP_004244720.1| PREDICTED: protein IQ-DOMAIN 31-like [Solanum lycopersicum]
Length=234

 Score = 75.5 bits (184),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +1

Query  91   EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
            EE AAV IQS+FRAYLSRRALRALK LV+LQALV+G++VRK  ADMLR +QAL+RAQSRA
Sbjct  81   EEWAAVVIQSYFRAYLSRRALRALKGLVKLQALVRGHIVRKQAADMLRRMQALIRAQSRA  140

Query  271  RSGLPKISESPHSSTKSVQFQHPGPPT  351
            R G   + ESP  STKS Q  H GP T
Sbjct  141  RLGRSMVFESPPFSTKSTQSIHHGPTT  167


 Score = 68.9 bits (167),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 46/61 (75%), Gaps = 2/61 (3%)
 Frame = +1

Query  805  SASSKGGSSRVGPFTPSKSDARSCLSG-YSD-HPNYMSYTESAKAKMRSLSAPKQRPQYE  978
            + SS+   SR GPFTP+KS  RS  S  YS+ HPNYMSYTE+AKAK RS+SAP+ R QY+
Sbjct  166  TTSSRCTRSRTGPFTPTKSSTRSYTSDEYSNNHPNYMSYTEAAKAKTRSMSAPRLRSQYD  225

Query  979  R  981
            +
Sbjct  226  K  226



>ref|XP_010098153.1| Protein IQ-DOMAIN 31 [Morus notabilis]
 gb|EXB74590.1| Protein IQ-DOMAIN 31 [Morus notabilis]
Length=288

 Score = 75.9 bits (185),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 101/312 (32%), Positives = 145/312 (46%), Gaps = 80/312 (26%)
 Frame = +1

Query  82   GIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQ  261
            G RE+LAAVKIQ+ FR YL+R+ALRALK LV++QALV+GYLVRK  A  L  +QAL+RAQ
Sbjct  4    GKREKLAAVKIQTVFRGYLARKALRALKGLVKIQALVRGYLVRKRAAATLHSMQALIRAQ  63

Query  262  SRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRV  441
            +  R                                           T   +R+ +K   
Sbjct  64   TAVR-------------------------------------------TQRARRSFNKENR  80

Query  442  IGDQEKVRSN--RMDYRMDAWSWEHQGSSRSGPIDD-GKSDKILEIDTGKPVFLPKHRnl  612
            +G +   R +  R D     +  +   ++    I+   +S KI+EIDT KP         
Sbjct  81   LGPEFYPRKSIERFDEPRSEFHSKRLSTTCEASINAFDESPKIVEIDTYKP---------  131

Query  613  fhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYC---------EAQSLSPQNFGQQI--  759
                     S ++S +L+   +   +Q + SP  C         + Q L  Q+F      
Sbjct  132  ------RSRSRRFSTALSECSEDLPYQTISSPLPCPVPARISIPDCQHL--QDFEWYFSG  183

Query  760  NESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSDA-RSCLSGYSDHPNYMSYTESAKAK  936
            NE  F TA ++P+F + +         P TP+KS    S    YS+ P+YM+ T+S  AK
Sbjct  184  NECKFSTAHSTPRFANPTWSNA-----PATPAKSVCGDSFFRPYSNFPSYMANTQSFNAK  238

Query  937  MRSLSAPKQRPQ  972
            +RS SAPKQRP+
Sbjct  239  LRSHSAPKQRPE  250



>ref|XP_004247593.1| PREDICTED: protein IQ-DOMAIN 14 [Solanum lycopersicum]
Length=467

 Score = 77.4 bits (189),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 112/360 (31%), Positives = 171/360 (48%), Gaps = 64/360 (18%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             EE AA KIQ+ FR YL+R+AL ALK LV+LQALV+G+LVRK  A  LR +QALV  Q+RA
Sbjct  136   EEDAASKIQAVFRGYLARKALNALKGLVKLQALVRGHLVRKQAAATLRCMQALVTVQARA  195

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGD  450
             R+   +++E           ++P  P      Q +H +S Q++                 
Sbjct  196   RAQRIRMTEE----------ENPNNP-----RQSVHRKSTQDN-----------------  223

Query  451   QEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshl  630
               K R +  DY  D                     KI+E+D G+     K RN + +   
Sbjct  224   --KFRHSYQDYEEDI--------------------KIVEMDLGESKGNTKSRNCYSNQGQ  261

Query  631   slnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNF-GQQINESCFCTADNSPQFYS  807
             +  ++    +     +   HQ + SP        SP+ + G   + + + T  +SPQ+Y+
Sbjct  262   TERTEHRFSTHNAYTNQEHHQHIISPVPSAITEQSPKAYSGHFEDYTSYPTTHSSPQYYN  321

Query  808   AS-SKGGSSRVGPFTPSKSD---ARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQ-  972
              + SK   SR+   + ++S+     S  + Y  +P+YM+ T+S+ AK RS SAPKQRP  
Sbjct  322   NTMSKPDPSRILYSSYARSEYAEPESLYNEYPFYPSYMANTKSSIAKARSHSAPKQRPDQ  381

Query  973   --YERSSSTKRYSIHGYGELRTNSQRGSSLQANFTSK--AYPGSGRLDSFGMPVIRDQVG  1140
               +ER  S +R SI G    R    + SS     T++   YP S +LD   + +   + G
Sbjct  382   TSFERQPSRRRPSIEGRNVPRAVRMQRSSSHVGSTAQNYQYPWSIKLDKSNISINDSECG  441



>ref|XP_008450788.1| PREDICTED: protein IQ-DOMAIN 14-like [Cucumis melo]
Length=410

 Score = 77.0 bits (188),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 109/337 (32%), Positives = 156/337 (46%), Gaps = 80/337 (24%)
 Frame = +1

Query  82    GIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQ  261
             G RE  A+VKIQ+ FR YL+R+ALRALK LV+LQALV+GYLVRK     L  +QAL+RAQ
Sbjct  110   GGRERWASVKIQTCFRGYLARKALRALKGLVKLQALVRGYLVRKQATATLHSMQALIRAQ  169

Query  262   SRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRV  441
             +  RS             ++ +F +    + E+FE        +++ T+           
Sbjct  170   ATVRS------------QRTRRFINDSRKSTERFEDT------KSEHTV-----------  200

Query  442   IGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhs  621
                   V S R+   +D  ++  +            S KI+EIDTG+P            
Sbjct  201   -----SVHSRRLSASLDNTTFMEE------------SPKIVEIDTGRP------------  231

Query  622   shlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINE-SCFC-------  777
                   S + + S +   D   +Q + SP  C   S       +  +E S FC       
Sbjct  232   ---KSWSRRTNTSASELSDDPFNQTLSSPLPCRTPSRLQIPDCRHFHENSDFCGGDDWRL  288

Query  778   --TADNSPQFYSASSKGGSSRVGPFTPSKSDA-RSCLSGYSDHPNYMSYTESAKAKMRSL  948
               TA ++P+F  +            TP+KS    +   GY + PNYM+ T+S KAK+RS 
Sbjct  289   ISTAQSTPRFMGSGGGSNGPP----TPAKSMCGENFFRGYLNFPNYMANTQSFKAKLRSQ  344

Query  949   SAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQ  1059
             SAPKQRP+     S KR S++   E R NS  G  +Q
Sbjct  345   SAPKQRPEI---GSKKRVSLNELMESR-NSLSGVKMQ  377



>ref|XP_004510319.1| PREDICTED: protein IQ-DOMAIN 14-like [Cicer arietinum]
Length=410

 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 115/337 (34%), Positives = 167/337 (50%), Gaps = 61/337 (18%)
 Frame = +1

Query  82    GIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQ  261
             G RE+ AAVKIQ+ FR YL+R+ALRALK LV++QALV+GYLVRK  A  L  +QAL+RAQ
Sbjct  118   GSREKWAAVKIQTFFRGYLARKALRALKGLVKIQALVRGYLVRKRAAATLHSMQALIRAQ  177

Query  262   SRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRV  441
             +  R+       +  S +K  +F       PE                ++ +++L   R 
Sbjct  178   TSVRT-----QRARRSMSKENRF------LPE----------------VLARKSLE--RF  208

Query  442   IGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhs  621
                + +  S R+    +        +S +G  DD +S KI+EIDT K     K R    +
Sbjct  209   DETRSEFHSKRVPTLYE--------TSMNG-FDD-QSPKIVEIDTYKT--RSKSRRFTST  256

Query  622   shlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQIN-ESCF--CTADNS  792
                      + + +++    +    V  P +C       Q+F    N E C    TA N+
Sbjct  257   MSECGEDLPHCHGISSPLPCSIPGRVSVPDHCRHVQ---QDFDWYFNVEECRFPTTAHNT  313

Query  793   PQFYSASSKGGSSRVGPFTPSKSDARSCL--SGYSDHPNYMSYTESAKAKMRSLSAPKQR  966
             P+F ++S +  ++ +G  TPSKS        S YS+ PNYM+ T+S KAK+RS SAPKQR
Sbjct  314   PRFNNSSMRPNNNGLG--TPSKSVCGDTFFRSYYSNFPNYMANTQSFKAKLRSHSAPKQR  371

Query  967   PQYERSSSTK-----RYSIHGYGELRTNSQRGSSLQA  1062
             P+ ++  S       R SI G        QR S+LQ 
Sbjct  372   PEPKKRLSLNEMMAARNSISG-----VRMQRPSNLQT  403



>ref|XP_004241751.1| PREDICTED: protein IQ-DOMAIN 14-like [Solanum lycopersicum]
 ref|XP_010322697.1| PREDICTED: protein IQ-DOMAIN 14-like [Solanum lycopersicum]
Length=405

 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 111/323 (34%), Positives = 147/323 (46%), Gaps = 88/323 (27%)
 Frame = +1

Query  64   RNAGGYGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQ  243
            R A   G RE+ AA KIQ+ FR YL+R+ALRALK LV+LQALV+GYLVRK  A  L  +Q
Sbjct  114  RGAMFTGGREKWAAAKIQTVFRGYLARKALRALKGLVKLQALVRGYLVRKRAAATLHSMQ  173

Query  244  ALVRAQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRN  423
            AL+RAQ+  RS   +                               RS  ND        
Sbjct  174  ALIRAQAAVRSQRAR-------------------------------RSMTNDTR------  196

Query  424  LSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPID---DG--KSDKILEIDTGKPV  588
                    +Q + R+ R   R D +  E      S   D   DG  +S KI+EIDT    
Sbjct  197  --------NQPETRARRSIERFDEYRSEFHSKRLSTSNDTSYDGFDESPKIVEIDT----  244

Query  589  FLPKHRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYC---------EAQSLSPQ  741
            F  K R+   ++            ++ S D    Q + SP  C         + + L   
Sbjct  245  FRTKSRSRRMNNA----------CMSESGDEQHSQAMSSPLPCPLPARLSIPDCRHLQDV  294

Query  742  NFGQQINESC-FCTADNSPQFYSASSKGGSSRV-GPFTPSKSDARSCLSGY----SDHPN  903
            N+    +E C F +A  +P+F       GS R   P TP+KS    C  GY    ++ PN
Sbjct  295  NWSFLADEQCKFASAQTTPRF------AGSGRSNAPPTPAKS---ICGDGYFRAYANFPN  345

Query  904  YMSYTESAKAKMRSLSAPKQRPQ  972
            YMS T+S +AK+RS SAPKQRP+
Sbjct  346  YMSNTQSFRAKLRSHSAPKQRPE  368



>ref|XP_002277925.2| PREDICTED: protein IQ-DOMAIN 14-like [Vitis vinifera]
 ref|XP_010654610.1| PREDICTED: protein IQ-DOMAIN 14-like [Vitis vinifera]
 ref|XP_010654611.1| PREDICTED: protein IQ-DOMAIN 14-like [Vitis vinifera]
 ref|XP_010654612.1| PREDICTED: protein IQ-DOMAIN 14-like [Vitis vinifera]
 ref|XP_010654613.1| PREDICTED: protein IQ-DOMAIN 14-like [Vitis vinifera]
Length=402

 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 109/327 (33%), Positives = 152/327 (46%), Gaps = 72/327 (22%)
 Frame = +1

Query  82    GIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQ  261
             G R+  AA KIQ+ FR YL+R+A RALK LV+LQALV+G+LVRK  A  L  +QAL+RAQ
Sbjct  118   GGRDRWAATKIQTVFRGYLARKAHRALKGLVKLQALVRGFLVRKRAAATLHSMQALIRAQ  177

Query  262   SRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRV  441
             +  RS                             ++ +  R+ +N         +  RR 
Sbjct  178   AAVRS-----------------------------QRTLRARNKENR----FPPEMRPRRS  204

Query  442   IGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhs  621
             I   E+ RS     RM   S+E   ++     D+  S KI+EIDT    F PK R+    
Sbjct  205   IERFEETRSEFHSKRMST-SFETSVNA----FDE--SPKIVEIDT----FKPKSRSRR--  251

Query  622   shlslnsDQYSYSLATSKDSTAHQIVHSPSYCE--AQSLSPQNFGQQINESCFC------  777
                       + S + S +   +  + SP  C   A+   P     Q  E CF       
Sbjct  252   --------MMNTSTSDSGEDPPYLTLSSPLPCPVPARLSIPDCRNFQDFEWCFTGDECRF  303

Query  778   -TADNSPQFYSASSKGGSSRVGPFTPSKSDA-RSCLSGYSDHPNYMSYTESAKAKMRSLS  951
              TA ++P+  + S       V P TP+KS    S    YS+ PNYM+ T+S KAK+RS S
Sbjct  304   STAQSTPRLANTSRA-----VAPVTPAKSVCGDSFFRPYSNFPNYMANTQSFKAKLRSHS  358

Query  952   APKQRPQYERSSSTKRYSIHGYGELRT  1032
             APKQRP+       +R+S++     RT
Sbjct  359   APKQRPE---PGPKRRFSLNEIMASRT  382



>ref|XP_003517637.1| PREDICTED: protein IQ-DOMAIN 14-like [Glycine max]
 gb|KHN40376.1| Protein IQ-DOMAIN 31 [Glycine soja]
Length=420

 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 112/335 (33%), Positives = 160/335 (48%), Gaps = 61/335 (18%)
 Frame = +1

Query  79    YGIREEL-AAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVR  255
             +G+  E+ AA+KIQ+ FR +L+R+ALRALK LV+LQALV+GYLVRK     L  +QALVR
Sbjct  115   FGVGPEMWAAIKIQTVFRGFLARKALRALKGLVKLQALVRGYLVRKLATATLHSMQALVR  174

Query  256   AQSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQN----DDTI-MLKR  420
             AQ+R RS         H S +        P T +      H R+ ++    DDT      
Sbjct  175   AQARMRS---------HKSLR--------PMTTKNEAYKPHNRARRSMERFDDTKSECAV  217

Query  421   NLSKRRVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPK  600
              +  RRV    +   +N +D                       S KI+E+DT    F PK
Sbjct  218   PIHSRRVSSSFDATINNSVD----------------------GSPKIVEVDT----FRPK  251

Query  601   HRnlfhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCT  780
              R+    S      D+ S    +S     ++     S  + +++    +G    E  F T
Sbjct  252   SRSRRAISDFG---DEPSLEALSSPLPVPYRTPTRLSIPDQRNIQDSEWGLTGEECRFST  308

Query  781   ADNSPQFYSASSKGGSSRVGPFTPSK--SDARSCLSGYSDHPNYMSYTESAKAKMRSLSA  954
             A ++P+F ++ + G    V P TP    +D    L  Y + PNYM+ T+S KAK+RS SA
Sbjct  309   AHSTPRFTNSCTCGS---VAPLTPKSVCTDNYLFLRQYGNFPNYMTSTQSFKAKLRSHSA  365

Query  955   PKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQ  1059
             PKQRP+       KR S++   E R NS  G  +Q
Sbjct  366   PKQRPE---PGPRKRISLNEMMESR-NSLSGVRMQ  396



>gb|EYU25070.1| hypothetical protein MIMGU_mgv1a007392mg [Erythranthe guttata]
Length=409

 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 104/303 (34%), Positives = 154/303 (51%), Gaps = 60/303 (20%)
 Frame = +1

Query  88   REELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSR  267
            R   AA+KIQS FRAYL+RRALRALK LV+LQA+V+G++VRK +A+MLR +Q++ R Q+R
Sbjct  118  RRVTAAIKIQSAFRAYLARRALRALKGLVKLQAIVRGHIVRKQSAEMLRRMQSMARIQAR  177

Query  268  A---RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQ-VIHMRSGQNDDTIMLKRNLSKR  435
            A   RS LP  S+S          + PG   P  + Q + + + G +       R  +  
Sbjct  178  ASAHRSYLPDFSDS----------RRPGIVNPRNYYQRLTNTKHGGSMTNQYNSRLHTSN  227

Query  436  RVIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlf  615
              + ++E   S  +D   D W  +     R    D+  SDKILE+DT KP+   +H    
Sbjct  228  NSMNEEEA--SEWLD--EDHWMEQQSTWDRHRHYDNETSDKILEVDTWKPL---RH----  276

Query  616  hsshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSP  795
                           ++   D T         +  +QS S +     IN S   ++++SP
Sbjct  277  ---------------VSRRADRT---------FPTSQSFSEKLQKPIINPS--VSSESSP  310

Query  796  QFYSASSKGGSSR------VGPFTPSKSDARSCLSGYSDHPNYMSYTESAKAKMRSLSAP  957
            +   +SS   S+R       G  TP++S+    L G   + NYM+ TES++AK+RS S P
Sbjct  311  RVCGSSS---STRPNVDHLRGVVTPTRSECSRSLFGDYYYRNYMANTESSRAKVRSQSVP  367

Query  958  KQR  966
            KQR
Sbjct  368  KQR  370



>ref|XP_011080380.1| PREDICTED: protein IQ-DOMAIN 14-like [Sesamum indicum]
Length=398

 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 102/307 (33%), Positives = 154/307 (50%), Gaps = 69/307 (22%)
 Frame = +1

Query  82   GIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQ  261
            G RE  AAVKIQ+ FR +L+R+ALRALK LV+LQALV+GYLVRK  A  L  +QAL+RAQ
Sbjct  114  GGRERWAAVKIQTVFRGFLARKALRALKGLVKLQALVRGYLVRKRAAATLHSMQALIRAQ  173

Query  262  SRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRV  441
            +  RS       +  S+    +FQ      PE                      +  R+ 
Sbjct  174  AAIRS-----QRARRSTNNEHRFQ------PE----------------------MRVRKS  200

Query  442  IGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhs  621
            I   ++ RS++   +  + S+    ++     D+  S KI+EIDT    + PK R+    
Sbjct  201  IERFDEARSDQFHSKRISASYNPYLNA----FDE--SPKIVEIDT----YGPKSRSR---  247

Query  622  shlslnsDQYSYSLATSKDSTAHQIVHSPSYC---------EAQSLSPQNFGQQINESCF  774
                    + S  ++   D   +Q+  SP  C         + + +   ++G    +  F
Sbjct  248  --------RMSTCMSEYGDDQYYQVTSSPLPCSFPNHFPIPDCRHVQDSDWGYTEEDYKF  299

Query  775  CTADNSPQFYSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLS  951
             TA ++P+F   +  G S+   P TP+KS  A S    YS++P+YM+ T+S +AK+RS S
Sbjct  300  ATAQSTPRF---ACTGRSN--APATPAKSVCADSLFRPYSNYPSYMANTQSFRAKLRSHS  354

Query  952  APKQRPQ  972
            APKQRP+
Sbjct  355  APKQRPE  361



>gb|AAM65934.1| unknown [Arabidopsis thaliana]
Length=403

 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 115/314 (37%), Positives = 153/314 (49%), Gaps = 79/314 (25%)
 Frame = +1

Query  91    EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
             E +AA+KIQS FR YL+RRALRALKALV+LQALV+G++VRK TADMLR +Q LVR QS+A
Sbjct  116   ENIAAMKIQSAFRGYLARRALRALKALVKLQALVRGHIVRKQTADMLRRMQTLVRLQSQA  175

Query  271   RSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIGD  450
             R+   + S S  S   S     P   +     + +H R   N +   L            
Sbjct  176   RARASRSSHSSASFHSSTALLFP---SSSSSPRSLHTRCVSNAEVSSL------------  220

Query  451   QEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhsshl  630
               +  S R+D       W+ + S      ++G  DKILE+DT KP + PK          
Sbjct  221   DHRGGSKRLD-------WQAEES------ENG--DKILEVDTWKPHYHPK----------  255

Query  631   slnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYSA  810
                       L + K++       SP   +   L P+            + +NSPQ  S+
Sbjct  256   ---------PLRSEKNN------ESPRKRQQSLLGPR------------STENSPQVGSS  288

Query  811   SSKGGSSRVGPFTPSKSDARSC------LSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQ  972
                 GS R  PFTP+     S        SGY  HPNYM+ TES KAK+RS SAPKQR +
Sbjct  289   ----GSRRRTPFTPTSRSEYSWGCNNYYYSGY--HPNYMANTESYKAKVRSQSAPKQRVE  342

Query  973   YERSSSTKRYSIHG  1014
                 +S  + S+ G
Sbjct  343   VSNETSGYKRSVQG  356



>ref|XP_004158419.1| PREDICTED: uncharacterized protein LOC101226199 [Cucumis sativus]
Length=410

 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 109/337 (32%), Positives = 156/337 (46%), Gaps = 80/337 (24%)
 Frame = +1

Query  82    GIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQ  261
             G RE  A+VKIQ+ FRAYL+R+ALRALK LV+LQALV+GYLVRK     L  +QAL+RAQ
Sbjct  110   GGRERWASVKIQTCFRAYLARKALRALKGLVKLQALVRGYLVRKQATATLYSMQALIRAQ  169

Query  262   SRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRV  441
             +  RS             ++ +F +    + E+FE        +++ T+           
Sbjct  170   ATVRS------------QRTRRFINDARKSTERFEDT------KSEHTV-----------  200

Query  442   IGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhs  621
                   V S R+   +D  ++  +            S KI+EIDTG+P            
Sbjct  201   -----SVHSRRLSASLDNTTFMEE------------SPKIVEIDTGRP------------  231

Query  622   shlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINE-SCFC-------  777
                   S + + S +   D   +  + SP  C   S       +  +E S FC       
Sbjct  232   ---KSWSRRTNTSASELSDDPFNHTLSSPLPCRTPSRLQIPDCRHFHENSDFCGGDDWRL  288

Query  778   --TADNSPQFYSASSKGGSSRVGPFTPSKSDA-RSCLSGYSDHPNYMSYTESAKAKMRSL  948
               TA ++P+F  +            TP+KS    +   GY + PNYM+ T+S KAK+RS 
Sbjct  289   ISTAQSTPRFMGSGGGSNGPP----TPAKSMCGENFFRGYLNFPNYMANTQSFKAKLRSQ  344

Query  949   SAPKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQ  1059
             SAPKQRP+     S KR S++   E R NS  G  +Q
Sbjct  345   SAPKQRPEI---GSKKRVSLNELMESR-NSLSGVKMQ  377



>ref|XP_006356137.1| PREDICTED: protein IQ-DOMAIN 14-like [Solanum tuberosum]
Length=400

 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 107/315 (34%), Positives = 145/315 (46%), Gaps = 88/315 (28%)
 Frame = +1

Query  88   REELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSR  267
            RE+ AA KIQ+ FR YL+R+ALRALK LV+LQALV+GYLVRK  A  L  +QAL+RAQ+ 
Sbjct  117  REKWAAAKIQTVFRGYLARKALRALKGLVKLQALVRGYLVRKRAAATLHSMQALIRAQAA  176

Query  268  ARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIG  447
             RS   +                               RS  ND                
Sbjct  177  VRSQRAR-------------------------------RSMTNDTR--------------  191

Query  448  DQEKVRSNRMDYRMDAWSWEHQGSSRSGPID---DG--KSDKILEIDTGKPVFLPKHRnl  612
             Q ++R+ R   R D +  E      S   D   DG  +S KI+EIDT    F  K R+ 
Sbjct  192  HQPEIRARRSIERFDEYRSEFHSKRLSTSNDTSYDGFDESPKIVEIDT----FRTKSRSR  247

Query  613  fhsshlslnsDQYSYSLATSKDSTAHQIVHSPSYC---------EAQSLSPQNFGQQINE  765
              ++            ++ S D   +Q + SP  C         + + L   N+    +E
Sbjct  248  RMNNA----------CMSESGDEQHYQAMSSPLPCPLPTRLSIPDCRHLQDVNWSFLADE  297

Query  766  SC-FCTADNSPQFYSASSKGGSSRV-GPFTPSKSDARSCLSGY----SDHPNYMSYTESA  927
             C F +A  +P+F       GS R   P TP+KS    C  GY    ++ PNYM+ T+S 
Sbjct  298  QCKFASAQTTPRF------AGSGRSNAPPTPAKS---ICGDGYFRAYANFPNYMTNTQSF  348

Query  928  KAKMRSLSAPKQRPQ  972
            +AK+RS SAPKQRP+
Sbjct  349  RAKLRSHSAPKQRPE  363



>ref|XP_004135807.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101215651, 
partial [Cucumis sativus]
Length=345

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 108/335 (32%), Positives = 155/335 (46%), Gaps = 80/335 (24%)
 Frame = +1

Query  88    REELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSR  267
             RE  A+VKIQ+ FRAYL+R+ALRALK LV+LQALV+GYLVRK     L  +QAL+RAQ+ 
Sbjct  47    RERWASVKIQTCFRAYLARKALRALKGLVKLQALVRGYLVRKQATATLYSMQALIRAQAT  106

Query  268   ARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIG  447
              RS             ++ +F +    + E+FE        +++ T+             
Sbjct  107   VRS------------QRTRRFINDARKSTERFEDT------KSEHTV-------------  135

Query  448   DQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhssh  627
                 V S R+   +D  ++  +            S KI+EIDTG+P              
Sbjct  136   ---SVHSRRLSASLDNTTFMEE------------SPKIVEIDTGRP--------------  166

Query  628   lslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINE-SCFC---------  777
                 S + + S +   D   +  + SP  C   S       +  +E S FC         
Sbjct  167   -KSWSRRTNTSASELSDDPFNHTLSSPLPCRTPSRLQIPDCRHFHENSDFCGGDDWRLIS  225

Query  778   TADNSPQFYSASSKGGSSRVGPFTPSKSDA-RSCLSGYSDHPNYMSYTESAKAKMRSLSA  954
             TA ++P+F  +            TP+KS    +   GY + PNYM+ T+S KAK+RS SA
Sbjct  226   TAQSTPRFMGSGGGSNGPP----TPAKSMCGENFFRGYLNFPNYMANTQSFKAKLRSQSA  281

Query  955   PKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQ  1059
             PKQRP+     S KR S++   E R NS  G  +Q
Sbjct  282   PKQRPEI---GSKKRVSLNELMESR-NSLSGVKMQ  312



>emb|CBI26300.3| unnamed protein product [Vitis vinifera]
Length=430

 Score = 75.5 bits (184),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 75/138 (54%), Gaps = 5/138 (4%)
 Frame = +1

Query  703   SPSYCEAQSLSPQNFGQQINESCFCTADNSPQFYSASSKGGSSRVGPFTPSKSDARSCLS  882
             SP+      +SP+       E CF T  +SPQ YSA SK   + + PF   ++D    LS
Sbjct  257   SPAPSALTDMSPRACSGHFEEYCFTTTQSSPQCYSAVSKPDCTGL-PFAFPQTDCAESLS  315

Query  883   -GYSDHPNYMSYTESAKAKMRSLSAPKQRPQ-YERSSSTKRYSIHGYGELRTNSQRGSSL  1056
               Y   PNYM+ TES+KAK+RS SAPKQRP+ +ER  S +R S+ G    R    + SS 
Sbjct  316   YDYPFFPNYMANTESSKAKVRSHSAPKQRPESFERQPSRRRASMEGRNIPRAMRMQRSSS  375

Query  1057  QANFTSKA--YPGSGRLD  1104
                 T++   YP S +LD
Sbjct  376   HVGSTAQGYQYPWSIKLD  393



>gb|KGN66184.1| hypothetical protein Csa_1G575000 [Cucumis sativus]
Length=366

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 108/335 (32%), Positives = 155/335 (46%), Gaps = 80/335 (24%)
 Frame = +1

Query  88    REELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSR  267
             RE  A+VKIQ+ FRAYL+R+ALRALK LV+LQALV+GYLVRK     L  +QAL+RAQ+ 
Sbjct  68    RERWASVKIQTCFRAYLARKALRALKGLVKLQALVRGYLVRKQATATLYSMQALIRAQAT  127

Query  268   ARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRVIG  447
              RS             ++ +F +    + E+FE        +++ T+             
Sbjct  128   VRS------------QRTRRFINDARKSTERFEDT------KSEHTV-------------  156

Query  448   DQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhssh  627
                 V S R+   +D  ++  +            S KI+EIDTG+P              
Sbjct  157   ---SVHSRRLSASLDNTTFMEE------------SPKIVEIDTGRP--------------  187

Query  628   lslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINE-SCFC---------  777
                 S + + S +   D   +  + SP  C   S       +  +E S FC         
Sbjct  188   -KSWSRRTNTSASELSDDPFNHTLSSPLPCRTPSRLQIPDCRHFHENSDFCGGDDWRLIS  246

Query  778   TADNSPQFYSASSKGGSSRVGPFTPSKSDA-RSCLSGYSDHPNYMSYTESAKAKMRSLSA  954
             TA ++P+F  +            TP+KS    +   GY + PNYM+ T+S KAK+RS SA
Sbjct  247   TAQSTPRFMGSGGGSNGPP----TPAKSMCGENFFRGYLNFPNYMANTQSFKAKLRSQSA  302

Query  955   PKQRPQYERSSSTKRYSIHGYGELRTNSQRGSSLQ  1059
             PKQRP+     S KR S++   E R NS  G  +Q
Sbjct  303   PKQRPEI---GSKKRVSLNELMESR-NSLSGVKMQ  333



>ref|XP_008228411.1| PREDICTED: protein IQ-DOMAIN 14 [Prunus mume]
Length=406

 Score = 75.1 bits (183),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 103/308 (33%), Positives = 145/308 (47%), Gaps = 69/308 (22%)
 Frame = +1

Query  79   YGIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRA  258
            +G +E  AA+KIQ+ FR YL+R+A RAL+ LV+LQALV+GYLVRK  A  L  +QAL RA
Sbjct  112  FGKKERCAAMKIQTVFRGYLARKAHRALRGLVKLQALVRGYLVRKRAAATLHSMQALFRA  171

Query  259  QSRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRR  438
            Q+                  +V+FQ                R   N +   L    +++ 
Sbjct  172  QT------------------TVRFQR--------------ARRSFNKENRFLPEIKARKS  199

Query  439  VIGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfh  618
            V    +  RS     R+ A ++E   +S +G  D+  S KI+EIDT K            
Sbjct  200  VQERFDDARSEFYSRRLSA-TYE---TSING-FDE--SPKIVEIDTFK------------  240

Query  619  sshlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSL-------SPQNFGQQIN--ESC  771
                   S +++  L+   +   +Q + SP  C   +         PQ+F    N  E  
Sbjct  241  ---TRSRSRRFNTILSECSEELPYQTISSPLPCPFPTRISIPDRQQPQDFEWCFNGDECK  297

Query  772  FCTADNSPQFYSASSKGGSSRVGPFTPSKSDA-RSCLSGYSDHPNYMSYTESAKAKMRSL  948
            F TA N+P+F ++          P TP+KS    S    YS+ PNYMS T+S  AK RS 
Sbjct  298  FSTAHNTPRFTNSFRSNA-----PDTPAKSVCGDSFFRPYSNFPNYMSSTQSFNAKSRSH  352

Query  949  SAPKQRPQ  972
            SAPKQRP+
Sbjct  353  SAPKQRPE  360



>gb|KDP33804.1| hypothetical protein JCGZ_07375 [Jatropha curcas]
Length=432

 Score = 75.1 bits (183),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 106/327 (32%), Positives = 162/327 (50%), Gaps = 47/327 (14%)
 Frame = +1

Query  82    GIREELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQ  261
             G +E  AAVKIQ+ FR YL+R+ALRALK LV+LQA  +GYLVRK     L  +QAL+RAQ
Sbjct  114   GGQERWAAVKIQTVFRGYLARKALRALKGLVKLQAYFRGYLVRKQATATLHSMQALIRAQ  173

Query  262   SRARSGLPKISESPHSSTKSVQFQHPGPPTPEKFEQVIHMRSGQNDDTIMLKRNLSKRRV  441
             +  RS       + + +    +F+     + E+F++     +           ++  RR+
Sbjct  174   ATVRS-----QRTRNLNGADNRFEARARKSMERFDETRSEHTA----------SIHSRRL  218

Query  442   IGDQEKVRSNRMDYRMDAWSWEHQGSSRSGPIDDGKSDKILEIDTGKPVFLPKHRnlfhs  621
                     S+ +D++          ++    ID   S KI+E+DTG     PK R+   +
Sbjct  219   --------SSSLDFQ----------ATLINSIDG--SPKIVEVDTGNNC-RPKSRSRRTN  257

Query  622   shlslnsDQYSYSLATSKDSTAHQIVHSPSYCEAQSLSPQNFGQQINESCFCTADNSPQF  801
             + +S  SD   Y   T       +I    S  + ++    ++G   +E  F TA ++P+F
Sbjct  258   TSVSDFSDDPFYQ--TLPSPLPSRIPPRLSMLDTRNFQDSDWGLTGDECRFSTAQSTPRF  315

Query  802   YSASSKGGSSRVGPFTPSKSD-ARSCLSGYSDHPNYMSYTESAKAKMRSLSAPKQRPQYE  978
              ++          P TPSKS  A +    + + PNYM+ T+S KAK+RS SAPKQRP+  
Sbjct  316   INSERLSNP----PLTPSKSVCADNLFRQFGNFPNYMANTQSFKAKVRSHSAPKQRPE--  369

Query  979   RSSSTKRYSIHGYGELRTNSQRGSSLQ  1059
                  KR S++   E R NS  G  +Q
Sbjct  370   -PGPKKRLSLNELMESR-NSISGVRMQ  394



>ref|XP_004244721.2| PREDICTED: uncharacterized protein LOC101261345 [Solanum lycopersicum]
Length=151

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = +1

Query  91   EELAAVKIQSHFraylsrralralkalvrlqalVKGYLVRKHTADMLRGLQALVRAQSRA  270
            EE AAV IQSHFRA+LSRRALRALK LV+ QAL +G++VRK  ADMLR +QAL+RAQSRA
Sbjct  5    EEWAAVVIQSHFRAHLSRRALRALKGLVKFQALARGHIVRKQAADMLRRMQALIRAQSRA  64

Query  271  RSGLPKISESPHSSTKSVQFQHPGPPT  351
            R G   + ESP  + KS Q  H GP T
Sbjct  65   RLGRSMVFESPPFNAKSTQSIHHGPTT  91


 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 46/61 (75%), Gaps = 2/61 (3%)
 Frame = +1

Query  805  SASSKGGSSRVGPFTPSKSDARSCLSG-YSD-HPNYMSYTESAKAKMRSLSAPKQRPQYE  978
            + SS+   SR GPFTP+KS  RS  S  YS+ HPNYMSYTE+AKAK RS+SAP+ R QY+
Sbjct  90   TTSSRCTRSRTGPFTPTKSSTRSYTSDEYSNNHPNYMSYTEAAKAKTRSMSAPRLRSQYD  149

Query  979  R  981
            +
Sbjct  150  K  150



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3958969345722