BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c11965_g1_i1 len=181 path=[1:0-66 355:67-180]

Length=181
                                                                      Score     E

gb|AGX93054.1|  geraniol 10-hydroxylase-like protein                    100   2e-23   
gb|AGX93052.1|  geraniol 10-hydroxylase-like protein                    100   4e-23   
dbj|BAP90522.1|  geraniol 10-hydroxylase                              99.8    7e-23   
gb|AGX93055.1|  geraniol 10-hydroxylase-like protein                  95.9    1e-21   
sp|Q8VWZ7.1|C76B6_CATRO  RecName: Full=Geraniol 8-hydroxylase; Al...  95.9    2e-21   Catharanthus roseus [chatas]
gb|AGX93053.1|  geraniol 10-hydroxylase-like protein                  95.5    2e-21   
emb|CDP02458.1|  unnamed protein product                              93.2    6e-21   
ref|XP_011099226.1|  PREDICTED: geraniol 8-hydroxylase-like           93.6    1e-20   
gb|AGX93051.1|  geraniol 10-hydroxylase-like protein                  93.2    1e-20   
gb|AFS28686.1|  putative geraniol 10-hydroxylase                      92.0    2e-20   
gb|AGX93050.1|  geraniol 10-hydroxylase-like protein                  92.0    4e-20   
ref|XP_009763141.1|  PREDICTED: geraniol 8-hydroxylase-like           90.9    1e-19   
gb|AFS28687.1|  putative geraniol 10-hydroxylase                      89.7    1e-19   
sp|D1MI46.1|C76BA_SWEMU  RecName: Full=Geraniol 8-hydroxylase; Al...  90.5    1e-19   Swertia mussotii
ref|XP_006338232.1|  PREDICTED: geraniol 8-hydroxylase-like           90.5    2e-19   
ref|XP_009630529.1|  PREDICTED: geraniol 8-hydroxylase-like           90.5    2e-19   
gb|ADX99241.1|  geraniol 10-hydroxylase                               89.4    4e-19   
ref|XP_009793557.1|  PREDICTED: geraniol 8-hydroxylase-like           88.6    6e-19   
ref|XP_009763140.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...  88.6    7e-19   
ref|XP_009763139.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...  88.6    7e-19   
gb|EYU29984.1|  hypothetical protein MIMGU_mgv1a026778mg              88.6    7e-19   
ref|XP_004232063.1|  PREDICTED: geraniol 8-hydroxylase-like           87.0    2e-18   
ref|XP_009596429.1|  PREDICTED: geraniol 8-hydroxylase-like           87.0    2e-18   
ref|XP_006360234.1|  PREDICTED: geraniol 8-hydroxylase-like           87.0    3e-18   
ref|XP_006338234.1|  PREDICTED: geraniol 8-hydroxylase-like           86.7    3e-18   
ref|XP_004233427.1|  PREDICTED: geraniol 8-hydroxylase-like           86.7    4e-18   
ref|XP_009757342.1|  PREDICTED: geraniol 8-hydroxylase-like           85.1    1e-17   
ref|XP_009607443.1|  PREDICTED: geraniol 8-hydroxylase-like           85.1    1e-17   
gb|ADJ68324.1|  geraniol 10-hydroxylase                               84.7    1e-17   
ref|XP_009613834.1|  PREDICTED: geraniol 8-hydroxylase-like           84.0    3e-17   
ref|XP_006338233.1|  PREDICTED: geraniol 8-hydroxylase-like           82.8    8e-17   
dbj|BAE97672.1|  CYP76J1                                              83.2    8e-17   Petunia x hybrida [garden petunia]
gb|AGI97015.1|  geraniol 10-hydroxylase                               82.4    1e-16   
ref|XP_009794425.1|  PREDICTED: geraniol 8-hydroxylase-like           82.0    1e-16   
ref|XP_004232064.1|  PREDICTED: geraniol 8-hydroxylase-like           81.6    2e-16   
ref|XP_009774376.1|  PREDICTED: geraniol 8-hydroxylase-like           81.3    3e-16   
ref|XP_009801952.1|  PREDICTED: geraniol 8-hydroxylase-like           78.2    5e-16   
ref|XP_004233425.1|  PREDICTED: geraniol 8-hydroxylase-like           80.1    7e-16   
gb|AAQ05825.1|AF479661_1  cytochrome P450                             80.1    8e-16   Pastinaca sativa
ref|XP_006360237.1|  PREDICTED: geraniol 8-hydroxylase-like           80.1    8e-16   
ref|XP_009780149.1|  PREDICTED: geraniol 8-hydroxylase-like           80.1    9e-16   
ref|XP_006358837.1|  PREDICTED: geraniol 8-hydroxylase-like           79.7    9e-16   
gb|EYU44354.1|  hypothetical protein MIMGU_mgv11b004416mg             79.7    1e-15   
ref|XP_009787971.1|  PREDICTED: geraniol 8-hydroxylase-like           79.3    1e-15   
ref|XP_004233426.2|  PREDICTED: geraniol 8-hydroxylase-like           79.7    1e-15   
ref|XP_003631427.1|  PREDICTED: geraniol 8-hydroxylase-like           79.3    1e-15   
ref|XP_006358804.1|  PREDICTED: geraniol 8-hydroxylase-like           79.0    2e-15   
ref|XP_004248012.1|  PREDICTED: geraniol 8-hydroxylase-like           79.0    2e-15   
emb|CAN79423.1|  hypothetical protein VITISV_011260                   78.2    3e-15   Vitis vinifera
dbj|BAC53893.1|  cytochrome P450                                      78.6    3e-15   Petunia x hybrida [garden petunia]
ref|XP_006360239.1|  PREDICTED: geraniol 8-hydroxylase-like           77.4    6e-15   
gb|AAS90125.1|  cytochrome P450                                       77.4    6e-15   Ammi majus [ameo mayor]
ref|XP_006358817.1|  PREDICTED: geraniol 8-hydroxylase-like           77.0    7e-15   
ref|XP_006360240.1|  PREDICTED: geraniol 8-hydroxylase-like           77.0    1e-14   
ref|XP_010658029.1|  PREDICTED: ripening-related P-450 enzyme-lik...  77.0    1e-14   
ref|XP_006358811.1|  PREDICTED: geraniol 8-hydroxylase-like           76.6    1e-14   
ref|XP_009631781.1|  PREDICTED: geraniol 8-hydroxylase-like           76.6    1e-14   
ref|XP_002276561.1|  PREDICTED: geraniol 8-hydroxylase                76.6    2e-14   Vitis vinifera
gb|AHB33945.1|  bergamotene oxidase                                   76.6    2e-14   
gb|AHB33942.1|  bergamotene oxidase                                   76.3    2e-14   
gb|AHB33941.1|  bergamotene oxidase                                   76.3    2e-14   
ref|XP_006360238.1|  PREDICTED: geraniol 8-hydroxylase-like           76.3    2e-14   
emb|CBI33813.3|  unnamed protein product                              76.6    2e-14   
ref|NP_001268152.1|  ripening-related P-450 enzyme-like               76.3    2e-14   
gb|AHB33939.1|  bergamotene oxidase                                   76.3    2e-14   
ref|XP_011029123.1|  PREDICTED: geraniol 8-hydroxylase-like           76.3    2e-14   
ref|XP_006360236.1|  PREDICTED: geraniol 8-hydroxylase-like           75.9    2e-14   
gb|AHB33946.1|  santalene/bergamotene oxidase                         75.5    3e-14   
ref|XP_009777857.1|  PREDICTED: geraniol 8-hydroxylase-like           74.7    6e-14   
ref|XP_002303546.2|  hypothetical protein POPTR_0003s11810g           74.7    7e-14   Populus trichocarpa [western balsam poplar]
ref|XP_007153084.1|  hypothetical protein PHAVU_003G005500g           74.3    8e-14   
ref|XP_006358801.1|  PREDICTED: geraniol 8-hydroxylase-like           74.3    8e-14   
gb|KDO63687.1|  hypothetical protein CISIN_1g040285mg                 72.4    9e-14   
ref|XP_009788701.1|  PREDICTED: geraniol 8-hydroxylase-like           72.8    1e-13   
ref|XP_004232059.1|  PREDICTED: geraniol 8-hydroxylase                73.9    1e-13   
gb|AHB33948.1|  santalene/bergamotene oxidase                         73.6    2e-13   
gb|AHB33940.1|  santalene/bergamotene oxidase                         73.6    2e-13   
gb|AHB33943.1|  CYP76F43                                              73.6    2e-13   
ref|XP_009794426.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...  73.6    2e-13   
ref|XP_006360235.1|  PREDICTED: geraniol 8-hydroxylase-like           73.6    2e-13   
gb|AIO11760.1|  cytochrome p450                                       73.6    2e-13   
gb|AHB33947.1|  santalene/bergamotene oxidase                         73.2    2e-13   
ref|XP_006358802.1|  PREDICTED: geraniol 8-hydroxylase-like           73.2    2e-13   
ref|XP_010105781.1|  7-ethoxycoumarin O-deethylase                    73.2    2e-13   
ref|XP_004233424.1|  PREDICTED: geraniol 8-hydroxylase-like           72.8    3e-13   
ref|XP_006477331.1|  PREDICTED: geraniol 8-hydroxylase-like           72.8    3e-13   
ref|XP_002299579.2|  hypothetical protein POPTR_0001s08320g           72.4    4e-13   Populus trichocarpa [western balsam poplar]
ref|XP_006358805.1|  PREDICTED: geraniol 8-hydroxylase-like           72.4    4e-13   
ref|XP_006440464.1|  hypothetical protein CICLE_v10019826mg           72.4    4e-13   
gb|KHG21745.1|  Cytochrome P450 protein                               72.0    6e-13   
gb|AHB33944.1|  santalene/bergamotene oxidase                         71.6    8e-13   
ref|XP_006338229.1|  PREDICTED: geraniol 8-hydroxylase-like           71.6    9e-13   
ref|XP_006338756.1|  PREDICTED: geraniol 8-hydroxylase-like           71.6    9e-13   
ref|XP_007040051.1|  Cytochrome P450, putative                        71.2    1e-12   
gb|EYU44352.1|  hypothetical protein MIMGU_mgv1a007369mg              70.9    1e-12   
gb|EPS71897.1|  geraniol 10-hydroxylase                               70.9    1e-12   
ref|XP_011033851.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...  70.9    1e-12   
ref|XP_004310184.1|  PREDICTED: geraniol 8-hydroxylase-like           70.9    1e-12   
ref|XP_011033850.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...  70.9    2e-12   
ref|XP_004298300.1|  PREDICTED: geraniol 8-hydroxylase-like           70.5    2e-12   
ref|XP_010326942.1|  PREDICTED: geraniol 8-hydroxylase-like           69.7    3e-12   
ref|XP_010069286.1|  PREDICTED: geraniol 8-hydroxylase-like           69.7    4e-12   
ref|XP_010692298.1|  PREDICTED: geraniol 8-hydroxylase-like           69.7    4e-12   
ref|XP_009794427.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...  69.3    5e-12   
ref|XP_008389841.1|  PREDICTED: geraniol 8-hydroxylase-like           69.3    5e-12   
ref|XP_010277464.1|  PREDICTED: geraniol 8-hydroxylase-like           69.3    5e-12   
ref|XP_007040049.1|  Cytochrome P450, putative                        68.9    7e-12   
ref|XP_010920218.1|  PREDICTED: geraniol 8-hydroxylase-like           68.9    7e-12   
gb|KDO43348.1|  hypothetical protein CISIN_1g039787mg                 67.0    7e-12   
ref|XP_009787972.1|  PREDICTED: geraniol 8-hydroxylase-like           66.2    8e-12   
ref|XP_006440463.1|  hypothetical protein CICLE_v10019651mg           68.9    8e-12   
gb|KDO35818.1|  hypothetical protein CISIN_1g038027mg                 65.9    1e-11   
ref|XP_009362819.1|  PREDICTED: geraniol 8-hydroxylase-like           68.2    1e-11   
ref|XP_009375456.1|  PREDICTED: geraniol 8-hydroxylase-like           65.5    2e-11   
ref|XP_006419188.1|  hypothetical protein CICLE_v10030448mg           67.8    2e-11   
ref|XP_010050611.1|  PREDICTED: geraniol 8-hydroxylase-like           67.8    2e-11   
ref|XP_006362199.1|  PREDICTED: geraniol 8-hydroxylase-like           67.8    2e-11   
ref|XP_008222069.1|  PREDICTED: geraniol 8-hydroxylase-like           67.8    2e-11   
ref|XP_006477330.1|  PREDICTED: geraniol 8-hydroxylase-like           67.8    2e-11   
ref|XP_007225781.1|  hypothetical protein PRUPE_ppa004617mg           67.8    2e-11   
emb|CDP04799.1|  unnamed protein product                              68.2    2e-11   
gb|KHG03596.1|  Cytochrome P450 protein                               67.4    2e-11   
gb|KHG20073.1|  Cytochrome P450 protein                               67.4    2e-11   
ref|XP_010691517.1|  PREDICTED: geraniol 8-hydroxylase-like           67.4    2e-11   
emb|CAA71178.1|  7-ethoxycoumarin O-deethylase                        67.4    2e-11   Helianthus tuberosus [Jerusalem artichoke]
sp|O23976.1|C76B1_HELTU  RecName: Full=7-ethoxycoumarin O-deethyl...  67.4    3e-11   Helianthus tuberosus [Jerusalem artichoke]
ref|XP_009372320.1|  PREDICTED: geraniol 8-hydroxylase-like           67.4    3e-11   
gb|KHG25715.1|  7-ethoxycoumarin O-deethylase                         67.0    3e-11   
ref|XP_007224832.1|  hypothetical protein PRUPE_ppa023299mg           67.0    3e-11   
ref|XP_010326943.1|  PREDICTED: geraniol 8-hydroxylase-like           67.0    4e-11   
ref|XP_006494536.1|  PREDICTED: geraniol 8-hydroxylase-like           67.0    4e-11   
ref|XP_006423673.1|  hypothetical protein CICLE_v10028257mg           67.0    4e-11   
ref|XP_010053375.1|  PREDICTED: geraniol 8-hydroxylase-like           67.0    4e-11   
ref|XP_006494410.1|  PREDICTED: geraniol 8-hydroxylase-like           67.0    4e-11   
ref|XP_009372315.1|  PREDICTED: geraniol 8-hydroxylase-like           66.6    4e-11   
ref|XP_007209932.1|  hypothetical protein PRUPE_ppa004606mg           66.6    4e-11   
ref|XP_009372314.1|  PREDICTED: geraniol 8-hydroxylase-like           66.6    4e-11   
ref|XP_010040683.1|  PREDICTED: geraniol 8-hydroxylase-like           66.6    4e-11   
gb|KCW45005.1|  hypothetical protein EUGRSUZ_L01405                   66.6    4e-11   
gb|KCW89351.1|  hypothetical protein EUGRSUZ_A01647                   66.6    5e-11   
ref|XP_006494407.1|  PREDICTED: geraniol 8-hydroxylase-like           66.6    5e-11   
gb|KDO41057.1|  hypothetical protein CISIN_1g043641mg                 66.6    5e-11   
ref|XP_010692295.1|  PREDICTED: geraniol 8-hydroxylase-like           66.6    5e-11   
ref|XP_010105780.1|  Cytochrome P450 76C2                             66.2    5e-11   
ref|XP_006423671.1|  hypothetical protein CICLE_v10028269mg           66.2    6e-11   
ref|XP_002509652.1|  cytochrome P450, putative                        65.9    6e-11   Ricinus communis
ref|XP_006477329.1|  PREDICTED: geraniol 8-hydroxylase-like           66.2    7e-11   
gb|KCW77276.1|  hypothetical protein EUGRSUZ_D01633                   65.9    7e-11   
ref|XP_010053037.1|  PREDICTED: geraniol 8-hydroxylase-like           66.2    7e-11   
ref|XP_010069299.1|  PREDICTED: geraniol 8-hydroxylase-like           65.5    8e-11   
ref|XP_006487472.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...  65.9    8e-11   
ref|XP_002509653.1|  cytochrome P450, putative                        65.9    8e-11   Ricinus communis
ref|XP_006423678.1|  hypothetical protein CICLE_v10028268mg           65.9    9e-11   
ref|XP_010667620.1|  PREDICTED: geraniol 8-hydroxylase-like           63.9    1e-10   
ref|XP_008390127.1|  PREDICTED: geraniol 8-hydroxylase-like           65.9    1e-10   
ref|XP_004492652.1|  PREDICTED: geraniol 8-hydroxylase-like           65.9    1e-10   
ref|XP_010324706.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...  65.5    1e-10   
ref|XP_004247615.1|  PREDICTED: geraniol 8-hydroxylase-like           65.5    1e-10   
ref|XP_010053381.1|  PREDICTED: geraniol 8-hydroxylase-like           65.5    1e-10   
gb|KDP25563.1|  hypothetical protein JCGZ_20719                       65.9    1e-10   
ref|XP_010105779.1|  Cytochrome P450 76C4                             65.9    1e-10   
ref|XP_002276121.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...  65.1    1e-10   Vitis vinifera
ref|XP_008389839.1|  PREDICTED: geraniol 8-hydroxylase-like           65.5    1e-10   
ref|XP_010050589.1|  PREDICTED: geraniol 8-hydroxylase-like           65.5    1e-10   
ref|XP_010324705.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...  65.1    1e-10   
emb|CDP20560.1|  unnamed protein product                              65.1    2e-10   
ref|XP_010661587.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...  65.1    2e-10   
ref|XP_006423657.1|  hypothetical protein CICLE_v10030181mg           64.7    2e-10   
gb|KEH40908.1|  cytochrome P450 family protein                        64.7    2e-10   
ref|XP_006494538.1|  PREDICTED: geraniol 8-hydroxylase-like           65.1    2e-10   
ref|XP_010676619.1|  PREDICTED: geraniol 8-hydroxylase-like           64.7    2e-10   
ref|XP_004310057.1|  PREDICTED: geraniol 8-hydroxylase-like           64.7    2e-10   
gb|AES93118.1|  geraniol-10-hydroxylase                               64.7    3e-10   
ref|XP_010680621.1|  PREDICTED: geraniol 8-hydroxylase-like           64.3    3e-10   
ref|XP_006423714.1|  hypothetical protein CICLE_v10028277mg           64.3    3e-10   
ref|XP_010053039.1|  PREDICTED: geraniol 8-hydroxylase-like           64.3    3e-10   
ref|XP_006487471.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...  64.3    3e-10   
ref|XP_006423672.1|  hypothetical protein CICLE_v10028278mg           63.9    4e-10   
ref|XP_008340390.1|  PREDICTED: geraniol 8-hydroxylase-like           61.6    4e-10   
ref|XP_011089001.1|  PREDICTED: geraniol 8-hydroxylase-like           63.9    4e-10   
ref|XP_010692297.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...  63.9    4e-10   
ref|XP_008447652.1|  PREDICTED: geraniol 8-hydroxylase-like           62.8    5e-10   
ref|XP_006451465.1|  hypothetical protein CICLE_v10008099mg           63.9    5e-10   
ref|XP_010057715.1|  PREDICTED: geraniol 8-hydroxylase-like           63.9    5e-10   
gb|KDO57775.1|  hypothetical protein CISIN_1g011069mg                 63.5    5e-10   
ref|XP_006451469.1|  hypothetical protein CICLE_v10008095mg           63.5    5e-10   
ref|XP_006487474.1|  PREDICTED: geraniol 8-hydroxylase-like           63.5    5e-10   
ref|XP_010692296.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...  63.5    6e-10   
ref|XP_010108078.1|  Cytochrome P450 76C4                             63.5    6e-10   
ref|XP_006423716.1|  hypothetical protein CICLE_v10028276mg           63.2    7e-10   
ref|XP_004232060.1|  PREDICTED: geraniol 8-hydroxylase-like           63.2    7e-10   
gb|KCW74940.1|  hypothetical protein EUGRSUZ_E03685                   63.2    7e-10   
gb|KGN58318.1|  Cytochrome P450                                       62.0    7e-10   
gb|ACU20890.1|  unknown                                               63.2    7e-10   Glycine max [soybeans]
ref|XP_003521519.1|  PREDICTED: geraniol 8-hydroxylase-like           63.2    7e-10   
gb|KCW74943.1|  hypothetical protein EUGRSUZ_E03687                   62.8    8e-10   
ref|XP_010920220.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...  62.8    9e-10   
ref|XP_010920219.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...  63.2    9e-10   
gb|AJD25185.1|  cytochrome P450 CYP76S7                               63.2    9e-10   
gb|KCW75045.1|  hypothetical protein EUGRSUZ_E03822                   62.8    9e-10   
emb|CAB56741.1|  cytochrome P450 monooxygenase                        62.8    1e-09   Cicer arietinum [garbanzo]
ref|XP_006487449.1|  PREDICTED: geraniol 8-hydroxylase-like           62.8    1e-09   
ref|XP_006487435.1|  PREDICTED: geraniol 8-hydroxylase-like           62.8    1e-09   
ref|XP_004164278.1|  PREDICTED: geraniol 8-hydroxylase-like           62.8    1e-09   
ref|XP_006423661.1|  hypothetical protein CICLE_v10028273mg           62.8    1e-09   
ref|XP_010057761.1|  PREDICTED: geraniol 8-hydroxylase-like           62.8    1e-09   
ref|XP_006423715.1|  hypothetical protein CICLE_v10028276mg           62.8    1e-09   
gb|KDO47864.1|  hypothetical protein CISIN_1g043423mg                 62.8    1e-09   
ref|XP_004516468.1|  PREDICTED: geraniol 8-hydroxylase-like           62.8    1e-09   
ref|XP_006494719.1|  PREDICTED: geraniol 8-hydroxylase-like           62.8    1e-09   
gb|KDO36937.1|  hypothetical protein CISIN_1g044449mg                 60.5    1e-09   
ref|XP_007034575.1|  Cytochrome P450, putative                        62.8    1e-09   
emb|CDP20559.1|  unnamed protein product                              62.4    1e-09   
ref|XP_006495031.1|  PREDICTED: geraniol 8-hydroxylase-like           62.4    1e-09   
gb|KHG16052.1|  Cytochrome P450 protein                               62.4    2e-09   
ref|XP_003628247.1|  Cytochrome P450                                  62.0    2e-09   
gb|AET02723.2|  cytochrome P450 family protein                        62.0    2e-09   
gb|KCW74933.1|  hypothetical protein EUGRSUZ_E03678                   62.4    2e-09   
ref|XP_006423622.1|  hypothetical protein CICLE_v10028275mg           62.0    2e-09   
ref|XP_010057714.1|  PREDICTED: geraniol 8-hydroxylase-like           62.0    2e-09   
ref|XP_010057720.1|  PREDICTED: geraniol 8-hydroxylase-like           62.0    2e-09   
ref|XP_006423677.1|  hypothetical protein CICLE_v10028488mg           61.6    2e-09   
ref|XP_004152069.1|  PREDICTED: geraniol 8-hydroxylase-like           62.0    2e-09   
gb|ABC59105.1|  cytochrome P450 monooxygenase CYP76X2                 61.6    2e-09   Medicago truncatula
ref|XP_009397045.1|  PREDICTED: geraniol 8-hydroxylase-like           60.5    2e-09   
ref|XP_008447356.1|  PREDICTED: geraniol 8-hydroxylase-like           62.0    2e-09   
ref|XP_003628244.1|  Cytochrome P450                                  62.0    2e-09   
gb|KHG15916.1|  7-ethoxycoumarin O-deethylase                         59.3    2e-09   
ref|XP_006346655.1|  PREDICTED: geraniol 8-hydroxylase-like           62.0    2e-09   
ref|XP_006487694.1|  PREDICTED: geraniol 8-hydroxylase-like           61.6    2e-09   
gb|KDO36667.1|  hypothetical protein CISIN_1g011040mg                 61.6    2e-09   
ref|XP_008389819.1|  PREDICTED: geraniol 8-hydroxylase-like           61.6    3e-09   
ref|XP_006388387.1|  hypothetical protein POPTR_0201s00200g           61.6    3e-09   
ref|XP_004983330.1|  PREDICTED: geraniol 8-hydroxylase-like           61.6    3e-09   
ref|XP_008447650.1|  PREDICTED: geraniol 8-hydroxylase-like           59.3    3e-09   
ref|XP_006362198.1|  PREDICTED: geraniol 8-hydroxylase-like           61.6    3e-09   
gb|AFK40472.1|  unknown                                               60.8    3e-09   
ref|XP_008222068.1|  PREDICTED: geraniol 8-hydroxylase-like           61.6    3e-09   
ref|XP_008389814.1|  PREDICTED: geraniol 8-hydroxylase-like           61.2    3e-09   
ref|XP_010057717.1|  PREDICTED: geraniol 8-hydroxylase-like           61.2    4e-09   
ref|XP_006423653.1|  hypothetical protein CICLE_v10028270mg           61.2    4e-09   
gb|AAS92624.1|  cytochrome P450                                       61.2    4e-09   Hypericum androsaemum
ref|XP_010057762.1|  PREDICTED: geraniol 8-hydroxylase-like           60.8    4e-09   
gb|KHN20460.1|  Cytochrome P450 76C4                                  59.7    5e-09   
ref|XP_006603565.1|  PREDICTED: geraniol 8-hydroxylase-like           59.7    5e-09   
ref|XP_003614649.1|  Cytochrome P450 71D95                            60.8    5e-09   
ref|XP_010053379.1|  PREDICTED: geraniol 8-hydroxylase-like           60.8    5e-09   
gb|KCW77657.1|  hypothetical protein EUGRSUZ_D01955                   60.8    5e-09   
ref|XP_006423660.1|  hypothetical protein CICLE_v10030225mg           60.8    5e-09   
ref|XP_010053380.1|  PREDICTED: geraniol 8-hydroxylase-like           60.8    6e-09   
ref|XP_010667793.1|  PREDICTED: geraniol 8-hydroxylase-like           60.5    6e-09   
ref|XP_007227491.1|  hypothetical protein PRUPE_ppa004517mg           60.8    6e-09   
ref|XP_006487469.1|  PREDICTED: geraniol 8-hydroxylase-like           60.5    7e-09   
ref|XP_007219031.1|  hypothetical protein PRUPE_ppa004503mg           60.5    8e-09   
ref|XP_008222072.1|  PREDICTED: geraniol 8-hydroxylase-like           60.1    8e-09   
ref|XP_010691493.1|  PREDICTED: geraniol 8-hydroxylase-like           60.1    9e-09   
emb|CDP17802.1|  unnamed protein product                              60.1    9e-09   
gb|KCW75046.1|  hypothetical protein EUGRSUZ_E03823                   59.7    9e-09   
gb|KDO40719.1|  hypothetical protein CISIN_1g038222mg                 57.4    9e-09   
gb|AET02720.2|  cytochrome P450 family protein                        60.1    9e-09   
ref|XP_010680509.1|  PREDICTED: geraniol 8-hydroxylase-like           60.1    9e-09   
ref|XP_006423666.1|  hypothetical protein CICLE_v10030214mg           58.2    9e-09   
ref|XP_007143842.1|  hypothetical protein PHAVU_007G106300g           60.1    1e-08   
gb|AFK46798.1|  unknown                                               60.1    1e-08   
ref|XP_006423711.1|  hypothetical protein CICLE_v10028239mg           60.1    1e-08   
ref|XP_004514899.1|  PREDICTED: geraniol 8-hydroxylase-like           59.7    1e-08   
gb|KEH38563.1|  cytochrome P450 family 76 protein                     59.7    1e-08   
gb|KEH41855.1|  cytochrome P450 family protein                        59.7    1e-08   
ref|XP_003623759.1|  Cytochrome P450                                  59.7    1e-08   
dbj|BAE71205.1|  putative cytochrome P450                             59.7    1e-08   Trifolium pratense [peavine clover]
ref|XP_003528904.1|  PREDICTED: geraniol 8-hydroxylase-like           59.7    1e-08   
gb|KDO42533.1|  hypothetical protein CISIN_1g048119mg                 58.2    1e-08   
gb|EYU30849.1|  hypothetical protein MIMGU_mgv1a006027mg              59.3    2e-08   
ref|XP_007226839.1|  hypothetical protein PRUPE_ppa017329mg           59.3    2e-08   
ref|XP_007134022.1|  hypothetical protein PHAVU_010G012700g           58.9    2e-08   
ref|XP_004982584.1|  PREDICTED: geraniol 8-hydroxylase-like           59.3    2e-08   
ref|XP_009397046.1|  PREDICTED: geraniol 8-hydroxylase-like           58.5    2e-08   
ref|XP_009372317.1|  PREDICTED: geraniol 8-hydroxylase-like           58.9    2e-08   
ref|XP_011091112.1|  PREDICTED: geraniol 8-hydroxylase-like           58.9    3e-08   
ref|XP_003610828.1|  Cytochrome P450 monooxygenase                    58.9    3e-08   
ref|XP_010691516.1|  PREDICTED: geraniol 8-hydroxylase-like           58.9    3e-08   
ref|XP_010691514.1|  PREDICTED: geraniol 8-hydroxylase-like           58.9    3e-08   
gb|KEH38561.1|  cytochrome P450 family protein                        58.5    3e-08   
ref|XP_004496721.1|  PREDICTED: geraniol 8-hydroxylase-like           58.9    3e-08   
ref|XP_011091126.1|  PREDICTED: geraniol 8-hydroxylase-like           58.5    3e-08   
gb|KEH43874.1|  cytochrome P450 family protein                        58.5    3e-08   
ref|XP_010911502.1|  PREDICTED: geraniol 8-hydroxylase-like           58.5    3e-08   
gb|KFK25691.1|  hypothetical protein AALP_AA8G146600                  58.5    3e-08   
ref|XP_004310208.1|  PREDICTED: geraniol 8-hydroxylase-like           58.5    3e-08   
ref|XP_009372318.1|  PREDICTED: geraniol 8-hydroxylase-like           58.5    3e-08   
gb|AAZ07704.1|  cytochrome P450 monooxygenase isoform I               58.5    3e-08   
gb|KEH43386.1|  cytochrome P450 family protein                        58.5    3e-08   
tpg|DAA49282.1|  TPA: putative cytochrome P450 superfamily protein    58.2    3e-08   
ref|XP_011017516.1|  PREDICTED: geraniol 8-hydroxylase-like           58.5    3e-08   
ref|XP_002464359.1|  hypothetical protein SORBIDRAFT_01g016910        58.5    3e-08   
ref|XP_004310205.1|  PREDICTED: geraniol 8-hydroxylase-like           58.9    4e-08   
ref|XP_010687566.1|  PREDICTED: geraniol 8-hydroxylase-like           58.5    4e-08   
gb|KEH43873.1|  cytochrome P450 family protein                        58.5    4e-08   
ref|XP_004506725.1|  PREDICTED: geraniol 8-hydroxylase-like           58.2    4e-08   
ref|XP_011069677.1|  PREDICTED: ferruginol synthase-like              58.2    4e-08   
ref|XP_004172542.1|  PREDICTED: geraniol 8-hydroxylase-like           57.0    4e-08   
ref|XP_011091100.1|  PREDICTED: geraniol 8-hydroxylase-like           58.2    4e-08   
gb|KEH38560.1|  cytochrome P450 family monooxygenase                  58.2    4e-08   
ref|XP_011071574.1|  PREDICTED: geraniol 8-hydroxylase-like           58.2    4e-08   
gb|KGN50167.1|  hypothetical protein Csa_5G157260                     57.0    5e-08   
ref|XP_010506520.1|  PREDICTED: cytochrome P450 76C2-like isoform X2  57.4    5e-08   
ref|XP_008653482.1|  PREDICTED: geraniol 8-hydroxylase-like           57.8    5e-08   
ref|XP_004496304.1|  PREDICTED: geraniol 8-hydroxylase-like           57.8    5e-08   
gb|KCW48249.1|  hypothetical protein EUGRSUZ_K01977                   57.8    6e-08   
ref|XP_004496164.1|  PREDICTED: geraniol 8-hydroxylase-like           57.8    6e-08   
gb|KHN02716.1|  Cytochrome P450 76C1                                  57.4    6e-08   
ref|XP_010506519.1|  PREDICTED: cytochrome P450 76C2-like isoform X1  57.8    6e-08   
ref|XP_007226135.1|  hypothetical protein PRUPE_ppa014656mg           55.1    6e-08   
gb|KEH43384.1|  cytochrome P450 family protein                        57.8    6e-08   
gb|KHN15752.1|  Cytochrome P450 76C4                                  57.4    6e-08   
gb|KHN20459.1|  Cytochrome P450 76C2                                  57.4    7e-08   
ref|XP_010038950.1|  PREDICTED: geraniol 8-hydroxylase-like           57.4    7e-08   
ref|XP_003556053.1|  PREDICTED: geraniol 8-hydroxylase-like           57.4    7e-08   
gb|KHN15753.1|  Cytochrome P450 76C1                                  57.4    7e-08   
ref|XP_010523703.1|  PREDICTED: cytochrome P450 76C4-like             57.4    7e-08   
gb|EAY77795.1|  hypothetical protein OsI_32835                        57.4    7e-08   
gb|AAS92626.1|  cytochrome P450                                       57.4    7e-08   
gb|AAK92618.1|AC078944_29  Putative Cytochrome P450                   57.4    7e-08   
ref|XP_003557080.2|  PREDICTED: geraniol 8-hydroxylase-like           57.4    7e-08   
ref|XP_010544670.1|  PREDICTED: cytochrome P450 76C4-like isoform X1  57.4    8e-08   
ref|XP_006606065.1|  PREDICTED: geraniol 8-hydroxylase-like           57.4    8e-08   
ref|XP_010544671.1|  PREDICTED: cytochrome P450 76C2-like isoform X2  57.4    8e-08   
ref|XP_011091088.1|  PREDICTED: ferruginol synthase-like              57.4    8e-08   
ref|XP_010508143.1|  PREDICTED: cytochrome P450 76C2-like             57.4    8e-08   
ref|XP_010103208.1|  Cytochrome P450 76C1                             57.4    9e-08   
ref|XP_004147597.1|  PREDICTED: LOW QUALITY PROTEIN: geraniol 8-h...  57.4    9e-08   
ref|XP_004496849.1|  PREDICTED: geraniol 8-hydroxylase-like           57.4    9e-08   
emb|CDX74750.1|  BnaA05g04960D                                        57.0    1e-07   
gb|ABF94965.1|  Cytochrome P450 family protein, expressed             57.0    1e-07   
ref|XP_010518180.1|  PREDICTED: cytochrome P450 76C3-like             57.0    1e-07   
ref|XP_002450934.1|  hypothetical protein SORBIDRAFT_05g021400        57.0    1e-07   
ref|XP_004488992.1|  PREDICTED: geraniol 8-hydroxylase-like           57.0    1e-07   
ref|XP_003556289.1|  PREDICTED: geraniol 8-hydroxylase-like           57.0    1e-07   
ref|XP_007222122.1|  hypothetical protein PRUPE_ppa004639mg           57.0    1e-07   
gb|KHN37858.1|  7-ethoxycoumarin O-deethylase                         56.2    1e-07   
ref|XP_002301307.2|  cytochrome P450 family protein                   57.0    1e-07   
ref|XP_009143151.1|  PREDICTED: cytochrome P450 76C3-like             56.6    1e-07   
ref|XP_002301305.2|  cytochrome P450 family protein                   56.6    1e-07   
emb|CDP17803.1|  unnamed protein product                              56.6    1e-07   
ref|XP_007224897.1|  hypothetical protein PRUPE_ppa022132mg           56.6    1e-07   
ref|XP_011071509.1|  PREDICTED: geraniol 8-hydroxylase-like           56.6    2e-07   
gb|EYU32021.1|  hypothetical protein MIMGU_mgv1a005095mg              56.6    2e-07   
emb|CDY27376.1|  BnaC04g50290D                                        55.5    2e-07   
ref|NP_001168348.1|  putative cytochrome P450 superfamily protein     56.6    2e-07   
ref|XP_002301302.2|  hypothetical protein POPTR_0002s15110g           56.2    2e-07   
gb|KFK37347.1|  hypothetical protein AALP_AA4G244800                  56.6    2e-07   
gb|ACG37332.1|  cytochrome P450 CYP76H18                              56.6    2e-07   
ref|XP_011071197.1|  PREDICTED: geraniol 8-hydroxylase-like           56.2    2e-07   
gb|KHN36931.1|  7-ethoxycoumarin O-deethylase                         56.2    2e-07   
ref|XP_003537814.1|  PREDICTED: geraniol 8-hydroxylase-like           56.2    2e-07   
gb|EYU25445.1|  hypothetical protein MIMGU_mgv1a018354mg              56.2    2e-07   
gb|KEH43383.1|  cytochrome P450 family protein                        56.2    2e-07   
ref|XP_006853508.1|  hypothetical protein AMTR_s00032p00219670        56.2    2e-07   
ref|XP_002301306.2|  hypothetical protein POPTR_0002s15150g           56.2    2e-07   
ref|XP_003543189.1|  PREDICTED: geraniol 8-hydroxylase-like           56.2    2e-07   
emb|CDP04819.1|  unnamed protein product                              55.8    2e-07   
ref|XP_006662211.1|  PREDICTED: geraniol 8-hydroxylase-like           56.2    2e-07   
gb|EMS49735.1|  Cytochrome P450 76C4                                  55.8    2e-07   
gb|KHN30008.1|  7-ethoxycoumarin O-deethylase                         53.1    3e-07   
ref|XP_006661654.1|  PREDICTED: geraniol 8-hydroxylase-like           55.8    3e-07   
ref|XP_003623780.1|  Cytochrome P450                                  55.8    3e-07   
ref|XP_004511453.1|  PREDICTED: geraniol 8-hydroxylase-like           55.8    3e-07   
gb|AAC06159.1|  putative cytochrome P450                              55.8    3e-07   
ref|XP_011013817.1|  PREDICTED: geraniol 8-hydroxylase-like           55.8    3e-07   
ref|XP_011017515.1|  PREDICTED: geraniol 8-hydroxylase-like           55.8    3e-07   
gb|EYU25446.1|  hypothetical protein MIMGU_mgv1a005044mg              55.8    3e-07   
ref|NP_182082.2|  cytochrome P450 76C3                                55.8    3e-07   
dbj|BAC42787.1|  putative cytochrome P450                             55.8    3e-07   
emb|CDY18919.1|  BnaC04g04310D                                        55.8    3e-07   
ref|XP_010413500.1|  PREDICTED: cytochrome P450 76C3                  55.8    3e-07   
ref|XP_010103209.1|  Cytochrome P450 76C4                             55.5    3e-07   
ref|NP_001276177.1|  7-ethoxycoumarin O-deethylase-like precursor     55.5    3e-07   
ref|XP_004982583.1|  PREDICTED: geraniol 8-hydroxylase-like           55.5    3e-07   
ref|XP_002276094.1|  PREDICTED: geraniol 8-hydroxylase                55.5    3e-07   
ref|XP_002878357.1|  hypothetical protein ARALYDRAFT_486570           55.5    4e-07   
emb|CDX71765.1|  BnaC08g31090D                                        55.1    4e-07   
ref|XP_010544668.1|  PREDICTED: cytochrome P450 76C1-like             55.5    4e-07   
ref|XP_004505593.1|  PREDICTED: geraniol 8-hydroxylase-like           55.5    4e-07   
sp|S4UX02.1|CYPH1_SALMI  RecName: Full=Ferruginol synthase; AltNa...  55.1    5e-07   
ref|NP_850731.1|  cytochrome P450, family 76, subfamily C, polype...  54.7    5e-07   
ref|XP_003623774.1|  Cytochrome P450                                  55.1    5e-07   
ref|XP_003623758.1|  Cytochrome P450                                  55.1    5e-07   
ref|XP_003609742.1|  Cytochrome P450                                  54.7    5e-07   
ref|XP_004310207.1|  PREDICTED: geraniol 8-hydroxylase-like           55.1    5e-07   
gb|AJD25181.1|  cytochrome P450 CYP76AH1                              55.1    6e-07   
gb|AES79992.2|  cytochrome P450 family protein                        55.1    6e-07   
emb|CBI38803.3|  unnamed protein product                              55.5    6e-07   
ref|XP_004492664.1|  PREDICTED: geraniol 8-hydroxylase-like           54.7    6e-07   
ref|XP_010508139.1|  PREDICTED: cytochrome P450 76C3-like             54.7    7e-07   
ref|XP_003558352.1|  PREDICTED: LOW QUALITY PROTEIN: geraniol 8-h...  54.7    7e-07   
ref|XP_003589660.1|  Cytochrome P450 monooxygenase                    54.7    7e-07   
emb|CDY27378.1|  BnaC04g50270D                                        54.7    7e-07   
ref|NP_191663.1|  cytochrome P450, family 76, subfamily C, polype...  54.7    7e-07   
ref|XP_008437178.1|  PREDICTED: geraniol 8-hydroxylase-like           54.7    7e-07   
ref|XP_009116769.1|  PREDICTED: cytochrome P450 76C3                  54.7    7e-07   
gb|ABF94963.1|  Cytochrome P450 family protein, expressed             54.7    7e-07   
emb|CDY52338.1|  BnaA09g38870D                                        54.7    8e-07   
emb|CDY27377.1|  BnaC04g50280D                                        54.7    8e-07   
gb|AET00611.2|  cytochrome P450 family protein, putative              51.2    8e-07   
gb|EAY89257.1|  hypothetical protein OsI_10754                        54.3    8e-07   
gb|EYU25533.1|  hypothetical protein MIMGU_mgv1a022818mg              53.9    9e-07   
ref|NP_001049554.2|  Os03g0248200                                     54.3    9e-07   
emb|CBI38805.3|  unnamed protein product                              54.3    9e-07   
ref|XP_010523700.1|  PREDICTED: cytochrome P450 76C4-like             54.3    9e-07   
ref|NP_001064221.1|  Os10g0166600                                     54.3    9e-07   
ref|XP_004505635.1|  PREDICTED: geraniol 8-hydroxylase-like           54.3    1e-06   
gb|EEC66607.1|  hypothetical protein OsI_32839                        54.3    1e-06   
ref|XP_003536316.1|  PREDICTED: geraniol 8-hydroxylase-like           54.3    1e-06   
ref|XP_007224608.1|  hypothetical protein PRUPE_ppa026952mg           53.9    1e-06   
ref|NP_001169124.1|  uncharacterized protein LOC100382969             53.9    1e-06   
ref|XP_009142346.1|  PREDICTED: cytochrome P450 76C4-like             53.9    1e-06   
ref|XP_003610827.1|  Cytochrome P450                                  53.9    1e-06   
emb|CDY37049.1|  BnaA04g26270D                                        53.9    1e-06   
dbj|BAB32886.1|  cytochrome P450 (CYP76C2)                            51.6    1e-06   
gb|EYU25443.1|  hypothetical protein MIMGU_mgv1a006310mg              53.9    1e-06   
ref|XP_006293636.1|  hypothetical protein CARUB_v10022591mg           54.3    1e-06   
gb|KGN50170.1|  hypothetical protein Csa_5G157290                     53.9    1e-06   
ref|XP_004166926.1|  PREDICTED: geraniol 8-hydroxylase-like           53.9    1e-06   
gb|AES93793.2|  cytochrome P450 family 71 protein                     53.9    1e-06   
dbj|BAE72877.1|  cytochrome P450                                      53.9    1e-06   
emb|CDY27374.1|  BnaC04g50310D                                        53.9    2e-06   
gb|EMT03552.1|  Cytochrome P450 76C4                                  53.5    2e-06   
gb|AAM74370.1|AC116603_6  Putative cytochrome P450                    53.9    2e-06   
ref|XP_010540267.1|  PREDICTED: geraniol 8-hydroxylase-like           53.5    2e-06   
ref|XP_003610835.1|  Cytochrome P450                                  53.5    2e-06   
ref|XP_004147600.1|  PREDICTED: geraniol 8-hydroxylase-like           53.5    2e-06   
gb|EYU25535.1|  hypothetical protein MIMGU_mgv1a025588mg              53.1    2e-06   
ref|XP_011074592.1|  PREDICTED: ferruginol synthase-like              53.5    2e-06   
ref|XP_010508153.1|  PREDICTED: cytochrome P450 76C4-like             53.5    2e-06   
ref|XP_006293419.1|  hypothetical protein CARUB_v10025190mg           53.9    2e-06   
ref|XP_010508148.1|  PREDICTED: cytochrome P450 76C4-like             52.8    2e-06   
ref|XP_003623750.1|  Cytochrome P450                                  52.0    2e-06   
gb|EYU30850.1|  hypothetical protein MIMGU_mgv1a005599mg              53.1    2e-06   
ref|XP_010461235.1|  PREDICTED: cytochrome P450 76C1-like             51.6    2e-06   
emb|CDY27375.1|  BnaC04g50300D                                        53.1    2e-06   
ref|XP_002463677.1|  hypothetical protein SORBIDRAFT_01g004060        53.1    2e-06   
dbj|BAJ91009.1|  predicted protein                                    53.1    2e-06   
ref|XP_007221750.1|  hypothetical protein PRUPE_ppb022807mg           52.0    3e-06   
emb|CAN75686.1|  hypothetical protein VITISV_010578                   53.1    3e-06   
ref|XP_010540221.1|  PREDICTED: geraniol 8-hydroxylase-like           53.1    3e-06   
emb|CDP11103.1|  unnamed protein product                              53.1    3e-06   
gb|EMS67389.1|  Cysteine protease 1                                   52.8    3e-06   
ref|XP_002276053.1|  PREDICTED: geraniol 8-hydroxylase-like           53.1    3e-06   
gb|EYU25534.1|  hypothetical protein MIMGU_mgv1a013436mg              51.2    3e-06   
dbj|BAJ95014.1|  predicted protein                                    52.4    3e-06   
emb|CDY71033.1|  BnaCnng71000D                                        50.4    3e-06   
gb|AHV78227.1|  CYP76                                                 51.6    3e-06   
ref|XP_003623781.1|  Cytochrome P450                                  52.8    3e-06   
ref|XP_006404367.1|  hypothetical protein EUTSA_v10010304mg           52.8    4e-06   
emb|CDY54862.1|  BnaC01g22670D                                        50.4    4e-06   
gb|KDO44875.1|  hypothetical protein CISIN_1g042053mg                 50.4    4e-06   
ref|XP_006602759.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...  52.4    4e-06   
gb|KHG26828.1|  Cytochrome P450 protein                               52.4    4e-06   
ref|XP_002276576.1|  PREDICTED: geraniol 8-hydroxylase                52.4    4e-06   
ref|XP_002464358.1|  hypothetical protein SORBIDRAFT_01g016900        52.4    4e-06   
ref|XP_010695803.1|  PREDICTED: LOW QUALITY PROTEIN: geraniol 8-h...  52.4    4e-06   
gb|EEC66608.1|  hypothetical protein OsI_32841                        52.4    4e-06   
ref|XP_002271652.1|  PREDICTED: geraniol 8-hydroxylase                52.4    4e-06   
ref|XP_008791859.1|  PREDICTED: geraniol 8-hydroxylase-like           52.4    4e-06   
gb|AET43289.1|  CYP76AD1                                              52.4    4e-06   
ref|XP_003576588.1|  PREDICTED: cytochrome P450 76M5-like             52.4    4e-06   
ref|XP_010518174.1|  PREDICTED: cytochrome P450 76C4-like             52.4    5e-06   
emb|CDY27371.1|  BnaC04g50340D                                        52.4    5e-06   
ref|XP_008222093.1|  PREDICTED: geraniol 8-hydroxylase-like           52.4    5e-06   
ref|XP_002882021.1|  CYP76C2                                          52.4    5e-06   
ref|XP_006397736.1|  hypothetical protein EUTSA_v10001282mg           52.8    5e-06   
gb|EAY89258.1|  hypothetical protein OsI_10756                        52.4    5e-06   
emb|CBI38806.3|  unnamed protein product                              52.8    5e-06   
emb|CDP07751.1|  unnamed protein product                              52.0    5e-06   
ref|XP_007226675.1|  hypothetical protein PRUPE_ppa021147mg           52.4    5e-06   
emb|CDP09849.1|  unnamed protein product                              51.6    5e-06   
gb|KHN20457.1|  Cytochrome P450 76C2                                  52.0    5e-06   
gb|AGI78466.1|  CYP76AD4                                              52.0    5e-06   
ref|XP_010056209.1|  PREDICTED: geraniol 8-hydroxylase-like           52.0    6e-06   
ref|XP_003551637.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...  52.0    6e-06   
gb|KCW72821.1|  hypothetical protein EUGRSUZ_E01263                   52.0    6e-06   
emb|CAN81642.1|  hypothetical protein VITISV_036426                   52.0    6e-06   
ref|XP_004505592.1|  PREDICTED: geraniol 8-hydroxylase-like           52.0    6e-06   
gb|EYU30852.1|  hypothetical protein MIMGU_mgv1a020394mg              51.2    6e-06   
emb|CDP11720.1|  unnamed protein product                              52.0    6e-06   
ref|XP_008437176.1|  PREDICTED: geraniol 8-hydroxylase-like           52.0    7e-06   
ref|XP_010506515.1|  PREDICTED: cytochrome P450 76C4-like             52.0    7e-06   
ref|XP_003623778.1|  Cytochrome P450                                  51.6    7e-06   
dbj|BAJ99998.1|  predicted protein                                    51.6    8e-06   
ref|XP_010692294.1|  PREDICTED: geraniol 8-hydroxylase-like           51.6    8e-06   
emb|CAN81641.1|  hypothetical protein VITISV_036425                   51.6    8e-06   
ref|XP_002451262.1|  hypothetical protein SORBIDRAFT_05g026610        51.6    8e-06   
gb|AET43291.1|  CYP76AD2                                              51.6    8e-06   
ref|XP_010661589.1|  PREDICTED: geraniol 8-hydroxylase-like           51.6    8e-06   
ref|XP_002445615.1|  hypothetical protein SORBIDRAFT_07g022640        51.6    8e-06   
ref|XP_003617652.1|  Cytochrome P450 76C3                             49.7    9e-06   
dbj|BAJ97899.1|  predicted protein                                    51.6    1e-05   
ref|XP_010528787.1|  PREDICTED: cytochrome P450 76C4-like isoform X2  51.6    1e-05   
gb|AFK44017.1|  unknown                                               50.8    1e-05   
ref|XP_010528786.1|  PREDICTED: cytochrome P450 76C4-like isoform X1  51.2    1e-05   



>gb|AGX93054.1| geraniol 10-hydroxylase-like protein [Tabernaemontana elegans]
Length=493

 Score =   100 bits (250),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/58 (76%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            RS+PDA+   N FQFSVVWLPVAS WR+LRKI+NSNIFSGN+LD NQ LR RK+QELI
Sbjct  97   RSVPDALHAHNQFQFSVVWLPVASRWRSLRKILNSNIFSGNRLDANQHLRCRKVQELI  154



>gb|AGX93052.1| geraniol 10-hydroxylase-like protein [Amsonia hubrichtii]
Length=493

 Score =   100 bits (248),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            RS+PDA+   N FQFSVVWLPVAS WR+LRKI+NSNIFSGN+LD NQ LR+RK++ELI
Sbjct  97   RSVPDALHAHNQFQFSVVWLPVASQWRSLRKILNSNIFSGNRLDANQHLRSRKVEELI  154



>dbj|BAP90522.1| geraniol 10-hydroxylase [Ophiorrhiza pumila]
Length=512

 Score = 99.8 bits (247),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            RSIPDA+   N FQ+SVVWLPVA+ WR+LRKI+NSNIFSGN+LD NQ LR RK+QELI
Sbjct  116  RSIPDAIHAHNQFQYSVVWLPVATRWRSLRKILNSNIFSGNRLDANQHLRCRKVQELI  173



>gb|AGX93055.1| geraniol 10-hydroxylase-like protein [Vinca minor]
Length=493

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 41/58 (71%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            RS+P+A+   N FQ+SVVWLPVAS WR+LRKI+NSNIFSGN+LD NQ LR RK++ELI
Sbjct  97   RSVPNALHAHNQFQYSVVWLPVASRWRSLRKILNSNIFSGNRLDANQHLRCRKVEELI  154



>sp|Q8VWZ7.1|C76B6_CATRO RecName: Full=Geraniol 8-hydroxylase; AltName: Full=Cytochrome 
P450 76B6; AltName: Full=Geraniol 10-hydroxylase; Short=CrG10H 
[Catharanthus roseus]
 emb|CAC80883.1| geraniol 10-hydroxylase [Catharanthus roseus]
 gb|AHA82034.1| geraniol 10-hydroxylase [Catharanthus roseus]
Length=493

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 41/58 (71%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            RS+P+A+   N F+FSVVWLPVAS WR+LRK++NSNIFSGN+LD NQ LR RK+QELI
Sbjct  97   RSVPNALHAHNQFKFSVVWLPVASRWRSLRKVLNSNIFSGNRLDANQHLRTRKVQELI  154



>gb|AGX93053.1| geraniol 10-hydroxylase-like protein [Rauvolfia serpentina]
Length=493

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 41/58 (71%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            RSIP+A+   N +QFSVVWLPVAS WR+LRK +NSNIFSGN+LD NQ LR+RK++ELI
Sbjct  97   RSIPNALHAHNQYQFSVVWLPVASRWRSLRKTLNSNIFSGNRLDANQHLRSRKVEELI  154



>emb|CDP02458.1| unnamed protein product [Coffea canephora]
Length=412

 Score = 93.2 bits (230),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 40/58 (69%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            RSIPDAV   NH  +SVVWLPVAS WR+LR+I+NSN+FS N LD NQ LR RK+QEL+
Sbjct  16   RSIPDAVHAQNHSHYSVVWLPVASRWRSLRRIMNSNMFSANSLDANQHLRCRKVQELV  73



>ref|XP_011099226.1| PREDICTED: geraniol 8-hydroxylase-like [Sesamum indicum]
Length=494

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 39/58 (67%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R+IPDA+   + F++SVVWLPVAS WR+LRK++NSNIFSG++LD NQ LR RK+QELI
Sbjct  97   RTIPDAIHAHDQFKYSVVWLPVASRWRSLRKVLNSNIFSGSRLDANQHLRCRKVQELI  154



>gb|AGX93051.1| geraniol 10-hydroxylase-like protein [Cinchona calisaya]
Length=493

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 39/58 (67%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            RSIPDA+   + +++SVVWLPVAS WR+LRKI+NSNIFSGN+LD NQ LR +K+QEL+
Sbjct  97   RSIPDALHAHDQYRYSVVWLPVASRWRSLRKILNSNIFSGNRLDANQHLRLKKVQELV  154



>gb|AFS28686.1| putative geraniol 10-hydroxylase, partial [Olea europaea]
Length=411

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R IP+A+   N F++SVVWLPVAS+WR+LRKI+NSN+FSGN+LD NQ LR RK+QELI
Sbjct  56   RHIPNAIHAHNQFKYSVVWLPVASTWRSLRKILNSNMFSGNRLDANQHLRVRKVQELI  113



>gb|AGX93050.1| geraniol 10-hydroxylase-like protein [Lonicera japonica]
Length=498

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R +PDA+   N F+FSVVWLPVA  WR+LRKI+NSNIFSGN+LD NQ LR RK++ELI
Sbjct  99   RHVPDALHAHNQFKFSVVWLPVAPQWRSLRKILNSNIFSGNRLDANQHLRCRKVEELI  156



>ref|XP_009763141.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana sylvestris]
Length=498

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R+IPDA+   NH+QFSV+WLPV S WR+LRKI+N+ IFSGN+LD NQ LR++KIQ+LI
Sbjct  101  RTIPDAIHALNHYQFSVIWLPVHSRWRSLRKIMNTYIFSGNRLDANQHLRSQKIQDLI  158



>gb|AFS28687.1| putative geraniol 10-hydroxylase, partial [Olea europaea]
Length=411

 Score = 89.7 bits (221),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R  P+A+   N F++SVVWLPVAS+WR+LRKI+NSN+FSGN+LD NQ LR RK+QELI
Sbjct  56   RHXPNAIHAHNQFKYSVVWLPVASTWRSLRKILNSNMFSGNRLDANQHLRVRKVQELI  113



>sp|D1MI46.1|C76BA_SWEMU RecName: Full=Geraniol 8-hydroxylase; AltName: Full=Cytochrome 
P450 76B10; AltName: Full=Geraniol 10-hydroxylase; Short=SmG10H 
[Swertia mussotii]
 gb|ACZ48680.1| geraniol 10-hydroxylase [Swertia mussotii]
Length=495

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 37/58 (64%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            RSIP+A+   + +++SV+WLPVAS WR LRK +NSN+FSGN+LD NQ LR+RK+QELI
Sbjct  99   RSIPNAIHAHDQYKYSVIWLPVASRWRGLRKALNSNMFSGNRLDANQHLRSRKVQELI  156



>ref|XP_006338232.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=495

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R+IPDA+   NH+QFSVVWLPVA+ WR+LRKI+NS IFSG++LD NQ LR+ KIQ+LI
Sbjct  98   RTIPDAIYALNHYQFSVVWLPVANRWRSLRKILNSYIFSGSRLDANQHLRSGKIQDLI  155



>ref|XP_009630529.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana tomentosiformis]
Length=499

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R+IPDA+   NH+QFSV+WLPV + WR+LRKI+N+ IFSGN+LD NQ LR RKIQ+LI
Sbjct  101  RTIPDAIHALNHYQFSVIWLPVNTRWRSLRKIMNTYIFSGNRLDANQHLRFRKIQDLI  158



>gb|ADX99241.1| geraniol 10-hydroxylase [Picrorhiza kurrooa]
Length=489

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 38/58 (66%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R  P+AV   + F++SVVWLPVA+ WR+LRK++NSNIFSGN+LD NQ LR RK+QELI
Sbjct  97   RMSPNAVHAHDQFKYSVVWLPVAARWRSLRKVLNSNIFSGNRLDANQHLRCRKVQELI  154



>ref|XP_009793557.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana sylvestris]
Length=498

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R+IPDA+   N +QFSV+WLPV + WR+LRKI+N+ IFSGNKLD NQ LR++KIQ+LI
Sbjct  101  RTIPDAIHAINQYQFSVIWLPVDTRWRSLRKIMNTYIFSGNKLDANQHLRSQKIQDLI  158



>ref|XP_009763140.1| PREDICTED: geraniol 8-hydroxylase-like isoform X2 [Nicotiana 
sylvestris]
Length=498

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R+IPDA+   +H+QFSV+WLPV + WR+LRKI+N+ IFSGN+LD NQ LR RKIQ+LI
Sbjct  101  RTIPDAIHALDHYQFSVIWLPVNTRWRSLRKIMNTYIFSGNRLDANQNLRFRKIQDLI  158



>ref|XP_009763139.1| PREDICTED: geraniol 8-hydroxylase-like isoform X1 [Nicotiana 
sylvestris]
Length=503

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R+IPDA+   +H+QFSV+WLPV + WR+LRKI+N+ IFSGN+LD NQ LR RKIQ+LI
Sbjct  101  RTIPDAIHALDHYQFSVIWLPVNTRWRSLRKIMNTYIFSGNRLDANQNLRFRKIQDLI  158



>gb|EYU29984.1| hypothetical protein MIMGU_mgv1a026778mg, partial [Erythranthe 
guttata]
Length=478

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 36/58 (62%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R++PDA+R  +H  +SV+WLPVA+ WR+LRK INSNIFSGN L+ N+QLR +K++ELI
Sbjct  80   RTVPDAIRAHDHSSYSVIWLPVAARWRSLRKTINSNIFSGNSLEGNRQLRHKKVEELI  137



>ref|XP_004232063.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum lycopersicum]
Length=495

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R+IPDA+   NH+QFSVVWLPVA+ WR+LRKI+NS IFS + LD NQ LR+ KIQ+LI
Sbjct  98   RTIPDAIYALNHYQFSVVWLPVANRWRSLRKILNSYIFSASSLDANQHLRSGKIQDLI  155



>ref|XP_009596429.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana tomentosiformis]
Length=497

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +RS+ DA+R  NH  FSVV+LPV S WR LRKI+NSNIFSGNKLD NQ LR +KIQEL+
Sbjct  98   NRSVADALRARNHSDFSVVFLPVNSRWRTLRKIMNSNIFSGNKLDANQHLRTKKIQELV  156



>ref|XP_006360234.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=491

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R IPDA+R  NH  FS +WLPV S WR LRKI+N +IFSGN+LD N+ LR++KIQELI
Sbjct  96   NRCIPDALRACNHNDFSAIWLPVDSQWRTLRKIMNYHIFSGNRLDANEHLRSKKIQELI  154



>ref|XP_006338234.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=496

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R+IPDA+R  NH QFSVV+LPVAS WR+LRKI+NSN+FS NKLD  Q LR +K+Q+ I
Sbjct  98   RTIPDAIRAHNHHQFSVVFLPVASRWRSLRKILNSNMFSSNKLDATQHLRTQKMQDFI  155



>ref|XP_004233427.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum lycopersicum]
Length=491

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R IPDA+R  NH  FS +WLPV S WR LRKI+N +IFSGN+LD N+ LR++KIQELI
Sbjct  96   NRCIPDALRACNHNDFSAIWLPVDSQWRKLRKIMNYHIFSGNRLDANEHLRSKKIQELI  154



>ref|XP_009757342.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana sylvestris]
Length=494

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R+IPDA+   NH+QFSVV+LPV + WR+LRKI+NSNIFSGN+LD  Q LR++KIQ+ I
Sbjct  101  RTIPDALHSHNHYQFSVVFLPVTTRWRSLRKILNSNIFSGNRLDEYQHLRSQKIQDFI  158



>ref|XP_009607443.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana tomentosiformis]
Length=500

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 36/58 (62%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            RS+PD++   NH Q SV+WLP+ + WR LRKI+N+ IFSGN+LD NQ LR+RKI ELI
Sbjct  103  RSVPDSMHAHNHHQSSVIWLPMDNRWRCLRKILNTYIFSGNRLDANQHLRSRKINELI  160



>gb|ADJ68324.1| geraniol 10-hydroxylase [Picrorhiza kurrooa]
Length=494

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 36/58 (62%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R  P+AV   + F++SVVWLPVA+ WR+LRK++NS IFSGN++D NQ LR RK QELI
Sbjct  97   RMSPNAVHAHDQFKYSVVWLPVAARWRSLRKVLNSKIFSGNRMDANQHLRGRKRQELI  154



>ref|XP_009613834.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana tomentosiformis]
Length=495

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 48/61 (79%), Gaps = 2/61 (3%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPV--ASSWRALRKIINSNIFSGNKLDTNQQLRARKIQEL  6
            +R +PDA+R  NH+ FSV+WLPV   S WR LRKI+ SNIFSGNKLD ++ LR +KIQEL
Sbjct  98   NRCVPDALRACNHYDFSVLWLPVNHDSRWRTLRKIMISNIFSGNKLDVSEHLRTKKIQEL  157

Query  5    I  3
            I
Sbjct  158  I  158



>ref|XP_006338233.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=495

 Score = 82.8 bits (203),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R+IPDA+R  NH   SVV+LPV S WR++RKI+NSN+FSGNKLD  Q LR++K+Q+ I
Sbjct  98   RTIPDAIRTNNHHHLSVVFLPVCSLWRSMRKILNSNLFSGNKLDATQHLRSQKMQDFI  155



>dbj|BAE97672.1| CYP76J1 [Petunia x hybrida]
Length=573

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R +PD V   NH  FS VWLPV S WR LRKI+NS+IFSGNKLD NQ LR++K+QELI
Sbjct  98   NRFVPDVVHVRNHSDFSFVWLPVNSRWRTLRKIMNSSIFSGNKLDGNQHLRSKKVQELI  156



>gb|AGI97015.1| geraniol 10-hydroxylase [Gentiana macrophylla]
Length=496

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 33/59 (56%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +RS+P+A+   +H+++S VWLP AS WR+LRK++N+NIFS  +LD NQ LR +K+QELI
Sbjct  98   NRSVPNALYAHDHYKYSAVWLPAASQWRSLRKVMNTNIFSVKRLDDNQHLRNKKVQELI  156



>ref|XP_009794425.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana sylvestris]
Length=499

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R IPDA++  NH++FSV WLPV + WR LR+I+N+NI S N+LD NQ LR++K++EL+
Sbjct  96   RFIPDALQAHNHYKFSVPWLPVCTQWRTLRRILNTNILSYNRLDANQHLRSQKVKELL  153



>ref|XP_004232064.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum lycopersicum]
Length=500

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R+IPDA+   NH QFSVV+LP AS WR+LRKI+NSN+FS NKLD  Q LR++++Q+ I
Sbjct  102  RTIPDAICANNHHQFSVVFLPAASRWRSLRKILNSNMFSSNKLDATQHLRSQRMQDFI  159



>ref|XP_009774376.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana sylvestris]
Length=500

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            RS+PD++   NH Q SV+WL + + WR LRKI+N+ IF+GN+LD NQ LR+RKI+ELI
Sbjct  103  RSVPDSMHAHNHHQSSVIWLSMDNRWRCLRKILNTYIFAGNRLDANQHLRSRKIKELI  160



>ref|XP_009801952.1| PREDICTED: geraniol 8-hydroxylase-like, partial [Nicotiana sylvestris]
Length=214

 Score = 78.2 bits (191),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +RS+ DA+R  NH   SVV+LPV + WR L KI+NSNIFSG+KLD NQ LR +KIQEL+
Sbjct  98   NRSVADALRARNHSDSSVVFLPVNTRWRTLCKIMNSNIFSGSKLDANQHLRTKKIQELV  156



>ref|XP_004233425.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum lycopersicum]
Length=492

 Score = 80.1 bits (196),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASS-WRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R + DA+R  NH  FSV+WLPV +S WR LRKI+NS+IFSGNKLD N+ LR +K+QELI
Sbjct  96   NRFVIDAIRACNHDDFSVIWLPVNNSQWRTLRKIMNSHIFSGNKLDANEHLRTKKMQELI  155



>gb|AAQ05825.1|AF479661_1 cytochrome P450 [Pastinaca sativa]
Length=496

 Score = 80.1 bits (196),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++P+AVR  +H ++S VWLPV S WR LRKI++ N+F+ NKLD NQ LR++K+ +LI
Sbjct  93   NRALPNAVRALDHNKYSAVWLPVGSQWRGLRKIMSMNLFTANKLDANQHLRSQKVHDLI  151



>ref|XP_006360237.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=492

 Score = 80.1 bits (196),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = -3

Query  164  DAVRGTNHFQFSVVWLPVASS-WRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            DA+R  NH  FSV+WLPV +S WR LRKI+NS+IFSGNKLD N+ LR +KIQELI
Sbjct  101  DAIRACNHNDFSVIWLPVNNSQWRTLRKIMNSHIFSGNKLDANEHLRTKKIQELI  155



>ref|XP_009780149.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana sylvestris]
Length=493

 Score = 80.1 bits (196),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +RS+ DA+R  NH   SVV+LPV + WR LRKI+NSNIFSG+KLD NQ LR +KIQEL+
Sbjct  98   NRSVADALRAQNHSDSSVVFLPVNTRWRTLRKIMNSNIFSGSKLDANQHLRNKKIQELV  156



>ref|XP_006358837.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=446

 Score = 79.7 bits (195),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R IP+A++G N+ +FSV WLPV   WR LR+I+N NIFS N+LD NQ LR++K++ELI
Sbjct  49   RFIPNAIQGHNYCEFSVGWLPVCPQWRTLRRILNINIFSPNRLDANQHLRSQKVKELI  106



>gb|EYU44354.1| hypothetical protein MIMGU_mgv11b004416mg [Erythranthe guttata]
Length=486

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            RSIP+A+   + F++SVVWLPV   WR+LRK + +N+FS ++LD+ Q+LR RK+QEL+
Sbjct  98   RSIPNAIHAHDQFKYSVVWLPVGPRWRSLRKALTANMFSSSRLDSGQKLRCRKVQELV  155



>ref|XP_009787971.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana sylvestris]
Length=492

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +RS+ DA+R  NH   SVV+LPV + WR LRKI+NSNIFSG+KLD NQ LR +KI+EL+
Sbjct  98   NRSVADALRARNHSDSSVVFLPVNTRWRTLRKIMNSNIFSGSKLDANQHLRTKKIEELV  156



>ref|XP_004233426.2| PREDICTED: geraniol 8-hydroxylase-like [Solanum lycopersicum]
Length=504

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASS-WRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R +PDA+R  +H   SVVWLPV +S WR LRK++NS+IFSGNKLD N+ LR +KIQ+LI
Sbjct  108  NRFVPDALRACDHSGLSVVWLPVNNSQWRTLRKVMNSHIFSGNKLDANEHLRTKKIQDLI  167



>ref|XP_003631427.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661621.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661624.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661630.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661639.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
Length=499

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R +PDA+R TNH Q S+ W+PV+++WR LRKI NS++F+  KLD+N  LR  K+QEL+
Sbjct  100  NRFVPDAIRATNHNQLSMAWMPVSTTWRVLRKICNSHLFTTQKLDSNTHLRHHKVQELL  158



>ref|XP_006358804.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=492

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            RS+P+A++  NH++FSV WLPV   WR LR+I+N+N+ S N++D NQ LR++K++ELI
Sbjct  95   RSVPNALQAHNHYKFSVAWLPVCPQWRMLRRILNTNLLSSNRVDANQHLRSQKVKELI  152



>ref|XP_004248012.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum lycopersicum]
Length=494

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R  P+A++  NH++FSV WLPV   WR LR+I+N+N+ S NKLD NQ LR++K+++LI
Sbjct  96   RFAPNALQAHNHYKFSVAWLPVCPQWRTLRRILNTNLLSSNKLDANQHLRSQKVKQLI  153



>emb|CAN79423.1| hypothetical protein VITISV_011260 [Vitis vinifera]
Length=479

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R +PDA+R TNH Q S+ W+PV+++WR LRKI NS++F+  KLD+N  LR  K+QEL+
Sbjct  80   NRFVPDAIRATNHNQLSMAWMPVSTTWRVLRKICNSHLFTTQKLDSNTHLRHHKVQELL  138



>dbj|BAC53893.1| cytochrome P450 [Petunia x hybrida]
Length=532

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R +PDA++  NH +FSVVWLPV+  WR LR+I+N+NI S N+LD+NQ LR++K++EL+
Sbjct  98   RFVPDALQTHNHNKFSVVWLPVSPQWRTLRRILNTNILSSNRLDSNQHLRSQKLKELL  155



>ref|XP_006360239.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=495

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASS-WRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R  PDA+R  N   FSVVWLPV +S WR LRKI+NS+IFSG KLD N+ LR +KI+ELI
Sbjct  97   NRFAPDALRACNQSDFSVVWLPVNNSQWRTLRKIMNSHIFSGTKLDANKHLRTKKIEELI  156



>gb|AAS90125.1| cytochrome P450 [Ammi majus]
Length=497

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R IPD++   +H  +S VWLP+   WR LRKI NSN+FS NKLD NQ LR RK+ ELI
Sbjct  97   RFIPDSLCACDHSLYSFVWLPIGPQWRNLRKISNSNLFSANKLDANQHLRGRKVNELI  154



>ref|XP_006358817.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=397

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R +P+A++  NH++FSV WLPV   WR LR+I+N+N+ S N++D NQ LR++K++ELI
Sbjct  95   RFVPNALQAHNHYKFSVAWLPVCPQWRMLRRILNTNLLSSNRVDANQHLRSQKVKELI  152



>ref|XP_006360240.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=492

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASS-WRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R +PD V   NH  +SVV LPV +S WR LRK++NS+IFSGNKLD N+ LR +KIQELI
Sbjct  97   RFVPDGVHACNHSNYSVVMLPVNNSQWRTLRKVMNSHIFSGNKLDANKHLRTKKIQELI  155



>ref|XP_010658029.1| PREDICTED: ripening-related P-450 enzyme-like isoform X1 [Vitis 
vinifera]
 ref|XP_010658036.1| PREDICTED: ripening-related P-450 enzyme-like isoform X1 [Vitis 
vinifera]
Length=499

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +RSIPDA+R   H Q S+ WLPV+++WRALR+  NS++F+  KLD+N  LR +K+QEL+
Sbjct  100  NRSIPDAIRAAKHNQLSMAWLPVSTTWRALRRTCNSHLFTPQKLDSNTHLRHQKVQELL  158



>ref|XP_006358811.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=496

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R IP+A++  NH++FSV WLPV   WR LR+I+N+N+ S N+LD NQ LR++K+++LI
Sbjct  98   RFIPNALQAHNHYKFSVAWLPVCPQWRTLRRILNTNLLSSNRLDANQHLRSQKVKQLI  155



>ref|XP_009631781.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana tomentosiformis]
 ref|XP_009631782.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana tomentosiformis]
Length=493

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R IP+A++  NH +FSV WLPV+ +WR LR+I+NSNI S  KLD+NQ LR++K+Q+L+
Sbjct  94   NRFIPNALQAHNHSKFSVTWLPVSPTWRTLRRILNSNILSLTKLDSNQHLRSQKVQQLV  152



>ref|XP_002276561.1| PREDICTED: geraniol 8-hydroxylase [Vitis vinifera]
Length=498

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+IPDA+R  NH Q S+VWLPV++ WR LRKI NS+IF+  KLD++  LR +K+Q+L+
Sbjct  99   NRTIPDALRALNHNQISMVWLPVSTKWRTLRKICNSHIFTNQKLDSSNYLRHQKVQDLL  157



>gb|AHB33945.1| bergamotene oxidase [Santalum album]
Length=509

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/59 (58%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+IPDAVR   H   S+VWLPV++ WR LRKI NS+IFS  +LD N  LR RK+ EL+
Sbjct  100  NRTIPDAVRAHRHDLHSMVWLPVSTRWRTLRKISNSHIFSSQRLDENHHLRRRKLDELL  158



>gb|AHB33942.1| bergamotene oxidase [Santalum album]
Length=509

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/59 (58%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+IPDAVR   H   S+VWLPV++ WR LRKI NS+IFS  +LD N  LR RK+ EL+
Sbjct  100  NRTIPDAVRAHRHDLHSMVWLPVSTRWRTLRKISNSHIFSSQRLDENHHLRRRKLDELL  158



>gb|AHB33941.1| bergamotene oxidase [Santalum album]
Length=509

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/59 (58%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+IPDAVR   H   S+VWLPV++ WR LRKI NS+IFS  +LD N  LR RK+ EL+
Sbjct  100  NRTIPDAVRAHRHDLHSMVWLPVSTRWRTLRKISNSHIFSSQRLDENHHLRRRKLDELL  158



>ref|XP_006360238.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=493

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVAS-SWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R + DA R  NH  FS +WLPV +  WR LRKI+NS+IFSGNKLD N+ LR +KIQELI
Sbjct  96   NRFVIDASRACNHNDFSAIWLPVDNYKWRTLRKIMNSHIFSGNKLDANEHLRTKKIQELI  155



>emb|CBI33813.3| unnamed protein product [Vitis vinifera]
Length=594

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+IPDA+R  NH Q S+VWLPV++ WR LRKI NS+IF+  KLD++  LR +K+Q+L+
Sbjct  99   NRTIPDALRALNHNQISMVWLPVSTKWRTLRKICNSHIFTNQKLDSSNYLRHQKVQDLL  157



>ref|NP_001268152.1| ripening-related P-450 enzyme-like [Vitis vinifera]
 emb|CAB85635.1| putative ripening-related P-450 enzyme [Vitis vinifera]
Length=499

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +RSIPDA+R   H Q S+ W+PV+++WRALR+  NS++F+  KLD+N  LR +K+QEL+
Sbjct  100  NRSIPDAIRAAKHNQLSMAWIPVSTTWRALRRTCNSHLFTSQKLDSNTHLRHQKVQELL  158



>gb|AHB33939.1| bergamotene oxidase [Santalum album]
Length=509

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/59 (58%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+IPDAVR   H   S+VWLPV++ WR LRKI NS+IFS  +LD N  LR RK+ EL+
Sbjct  100  NRTIPDAVRAHRHDLHSMVWLPVSTRWRTLRKISNSHIFSSQRLDENHHLRRRKLDELL  158



>ref|XP_011029123.1| PREDICTED: geraniol 8-hydroxylase-like [Populus euphratica]
Length=501

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 31/59 (53%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+IPDA+R   H +  + W+P+A  WR LRK+ NS IF+  KLD NQ+LR +KIQEL+
Sbjct  102  NRTIPDAIRSHKHHELGLPWVPIAMRWRNLRKVCNSYIFTNQKLDANQELRLKKIQELV  160



>ref|XP_006360236.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=493

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASS-WRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R +PDA+R  NH   SVVWL V +S WR LRK++NS+IFSGNKLD N+ +R +KIQ+LI
Sbjct  97   NRFVPDALRACNHSGLSVVWLSVNNSQWRTLRKVMNSHIFSGNKLDANEHVRTKKIQDLI  156



>gb|AHB33946.1| santalene/bergamotene oxidase [Santalum album]
Length=509

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+IPDAVR   H  +S+ WLPV++ WR LRKI NS+IF+  +LD N  LR RK+ EL+
Sbjct  100  NRTIPDAVRAYGHDLYSMAWLPVSTRWRTLRKISNSHIFTSQRLDENHHLRRRKLDELL  158



>ref|XP_009777857.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana sylvestris]
Length=495

 Score = 74.7 bits (182),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R IP+A++  NH++FSVVWL V   WR LR+I+N+N+ S N+LD NQ LR++K++EL+
Sbjct  98   RFIPNALQAHNHYKFSVVWLHVCPQWRTLRRILNTNLLSSNRLDANQHLRSQKVKELL  155



>ref|XP_002303546.2| hypothetical protein POPTR_0003s11810g [Populus trichocarpa]
 gb|EEE78525.2| hypothetical protein POPTR_0003s11810g [Populus trichocarpa]
Length=505

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 31/59 (53%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++ DAVR  +H +  + WLPVA+ WR LRKI NS+IF+  KLD NQ LR +K+Q+L+
Sbjct  101  NRTVVDAVRALDHHEAGIAWLPVATRWRNLRKICNSHIFTSQKLDANQDLRRKKVQDLL  159



>ref|XP_007153084.1| hypothetical protein PHAVU_003G005500g [Phaseolus vulgaris]
 gb|ESW25078.1| hypothetical protein PHAVU_003G005500g [Phaseolus vulgaris]
Length=507

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQEL  6
            +R +PDA+RG NH QFS  ++PV+  WR LRKI N  +FS   LD  Q+LR++KIQEL
Sbjct  106  NRKVPDAMRGANHHQFSFSFIPVSHQWRDLRKICNGLLFSSKNLDATQELRSKKIQEL  163



>ref|XP_006358801.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=489

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 32/58 (55%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R +P+ VR  N+  FSVV+LPV   WR +R+I N+NIFS N+LD NQ LR++K++ELI
Sbjct  94   RFVPNVVRTQNYCNFSVVYLPVCPQWRTIRRIWNTNIFSYNRLDANQHLRSQKVKELI  151



>gb|KDO63687.1| hypothetical protein CISIN_1g040285mg, partial [Citrus sinensis]
Length=298

 Score = 72.4 bits (176),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+IPDA+    H +F + WLPVA+ WR LRKI NS+ FS  +LD NQ LR +KIQ+L+
Sbjct  100  NRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLL  158



>ref|XP_009788701.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana sylvestris]
Length=310

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  164  DAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            DA++  NH++FSVVWLPV   WR L +I+N+N+ S N+LD NQ LR++K++EL+
Sbjct  91   DALQAHNHYKFSVVWLPVCPQWRTLPRILNTNLLSANRLDANQCLRSQKVKELL  144



>ref|XP_004232059.1| PREDICTED: geraniol 8-hydroxylase [Solanum lycopersicum]
Length=498

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVAS-SWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            RSIPD V+  N   FSVVWLP +   WR LRKI+NS+IFS NKLD  Q LR +K++EL+
Sbjct  101  RSIPDTVQVDNFHMFSVVWLPASGPQWRTLRKILNSHIFSVNKLDATQHLRYKKMEELV  159



>gb|AHB33948.1| santalene/bergamotene oxidase [Santalum album]
Length=509

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/59 (53%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+ PDAVR   H  +S+ WLPV++ WR LRKI NS+IF+  +LD N  LR RK+ EL+
Sbjct  100  NRTTPDAVRAHGHDLYSMAWLPVSTRWRTLRKISNSHIFTSQRLDENHHLRRRKLDELL  158



>gb|AHB33940.1| santalene/bergamotene oxidase [Santalum album]
Length=509

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/59 (53%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+ PDAVR   H  +S+ WLPV++ WR LRKI NS+IF+  +LD N  LR RK+ EL+
Sbjct  100  NRTTPDAVRAHGHDLYSMAWLPVSTRWRTLRKISNSHIFTSQRLDENHHLRRRKLDELL  158



>gb|AHB33943.1| CYP76F43 [Santalum album]
Length=509

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/59 (53%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+IPDAVR   H  +S+ WLPV++ WR LRKI NS+IF+  +LD N  LR +K+ EL+
Sbjct  100  NRTIPDAVRAHRHDLYSMAWLPVSTRWRTLRKISNSHIFTSQRLDENHHLRRQKLDELL  158



>ref|XP_009794426.1| PREDICTED: geraniol 8-hydroxylase-like isoform X1 [Nicotiana 
sylvestris]
Length=492

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R IP+A++  N+ +FSV WLPV  +WR LR+I+NSNI S  KLD+NQ LR++K+Q+L+
Sbjct  94   NRFIPNALQAHNYSKFSVTWLPVNPTWRTLRRILNSNILSLTKLDSNQHLRSQKVQQLV  152



>ref|XP_006360235.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=497

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASS-WRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R +PD +   NH  +SV W+PV +S W+ +RKI+N++IFSGNKLD N+ +R +KIQELI
Sbjct  96   NRFVPDTLHACNHSNYSVTWIPVNNSQWKTIRKIMNTHIFSGNKLDANKHIRTKKIQELI  155



>gb|AIO11760.1| cytochrome p450 [Croton stellatopilosus]
 emb|CDM63950.1| cytochrom p450 reductase [Croton stellatopilosus]
Length=507

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++ +A++   H Q SVVWLPV + WR LRKI NS IFS  KLD+NQ+LR +KIQ+L+
Sbjct  105  NRNVVEAIQAREHHQVSVVWLPVGAPWRNLRKICNSYIFSNQKLDSNQELRRKKIQDLV  163



>gb|AHB33947.1| santalene/bergamotene oxidase [Santalum album]
Length=509

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/59 (53%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+ PDAVR   H  +S+ WLPV++ WR LRKI NS+IF+  +LD N  LR RK+ EL+
Sbjct  100  NRTTPDAVRAHGHDLYSMAWLPVSTRWRTLRKISNSHIFTSQRLDENHHLRRRKLDELL  158



>ref|XP_006358802.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=492

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R IP  V+  N++ FSVVWLPV   WR +++I+N+NIFS  +LD NQ LR++K++ELI
Sbjct  95   RFIPKVVQAQNYWDFSVVWLPVCPQWRTIKRILNTNIFSYKRLDANQHLRSQKVKELI  152



>ref|XP_010105781.1| 7-ethoxycoumarin O-deethylase [Morus notabilis]
 gb|EXC06134.1| 7-ethoxycoumarin O-deethylase [Morus notabilis]
Length=507

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R++PDA+  ++H +FS+ W+P++ +WR LRKI NS++FS   LD N  LR +K+QEL+
Sbjct  101  RTVPDAIHASDHSEFSLPWMPISPTWRKLRKICNSHLFSAKVLDANMSLRHKKVQELL  158



>ref|XP_004233424.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum lycopersicum]
Length=493

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 44/56 (79%), Gaps = 1/56 (2%)
 Frame = -3

Query  167  PDAVRGTNHFQFSVVWLPVASS-WRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            PDA+   NH  FSVVWLPV +S WR+LRK +NS+IFS NKLD N+ LR +K+QELI
Sbjct  101  PDALCACNHNDFSVVWLPVNNSQWRSLRKSMNSHIFSVNKLDANKHLRTKKMQELI  156



>ref|XP_006477331.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=499

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/59 (53%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+IPDA+    H +F + WLPVA+ WR  RKI NS+ FS  +LD NQ LR +KIQ+L+
Sbjct  100  NRTIPDAIYAHGHHEFGMPWLPVATLWRNFRKICNSHAFSSRQLDANQHLRRKKIQDLL  158



>ref|XP_002299579.2| hypothetical protein POPTR_0001s08320g [Populus trichocarpa]
 gb|EEE84384.2| hypothetical protein POPTR_0001s08320g [Populus trichocarpa]
Length=502

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+IPDA+R   H +  + W+P+A  WR LRK+ NS IF+  KLD NQ LR +KIQEL+
Sbjct  102  NRTIPDALRAHKHHELGLPWVPIAMRWRNLRKVCNSYIFTNQKLDANQDLRRKKIQELV  160



>ref|XP_006358805.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=492

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R IPDA++  N+ +FS VWLPV   WR LRKI+N+ + S N+LD NQ LR++K +ELI
Sbjct  95   RFIPDALQAHNYSKFSAVWLPVCPQWRTLRKIMNTKLLSTNRLDANQHLRSQKEKELI  152



>ref|XP_006440464.1| hypothetical protein CICLE_v10019826mg [Citrus clementina]
 gb|ESR53704.1| hypothetical protein CICLE_v10019826mg [Citrus clementina]
Length=499

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+IPDA+    H +F + WLPVA+ WR LRKI NS+ FS  +LD NQ LR +KIQ+L+
Sbjct  100  NRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLL  158



>gb|KHG21745.1| Cytochrome P450 protein [Gossypium arboreum]
Length=500

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+I DAVR + H++F + WLPV+  WR LRK+ N++IFS  KLD+N+ LR  KIQ+LI
Sbjct  101  NRTIVDAVRASQHYEFGLPWLPVSPLWRTLRKVSNTHIFSSLKLDSNEYLRRHKIQQLI  159



>gb|AHB33944.1| santalene/bergamotene oxidase [Santalum album]
Length=509

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 30/59 (51%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+ PDAVR   H  +S+ WLPV++ WR LRKI NS+IF+  +LD N  LR +K+ EL+
Sbjct  100  NRTTPDAVRAHGHDLYSMAWLPVSTRWRTLRKISNSHIFTSQRLDENHHLRRQKLDELL  158



>ref|XP_006338229.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=503

 Score = 71.6 bits (174),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVA-SSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            RSIPD V+  N   FSV WLP +   WR LRKI+ S+IFS NKLD +Q LR +KIQEL+
Sbjct  106  RSIPDIVKEENFHMFSVGWLPASHPQWRTLRKIMTSHIFSINKLDASQHLRYKKIQELV  164



>ref|XP_006338756.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=501

 Score = 71.6 bits (174),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 34/59 (58%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVAS-SWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            RSIPD V+  N   FSV WLP +   WR LRKI+NS+IFS NKLD++Q LR +K++EL+
Sbjct  104  RSIPDTVQMDNFHMFSVSWLPASQPQWRNLRKIMNSHIFSVNKLDSSQNLRYKKMEELV  162



>ref|XP_007040051.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY24552.1| Cytochrome P450, putative [Theobroma cacao]
Length=550

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R++PDA R   H +F + W+PV+++WR LRKI N +IF+  KLD NQ LR  K++EL+
Sbjct  152  RTVPDAFRALQHDEFGMPWMPVSTTWRNLRKISNLHIFASQKLDANQYLRRSKVEELV  209



>gb|EYU44352.1| hypothetical protein MIMGU_mgv1a007369mg [Erythranthe guttata]
Length=410

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            RS+P+A+   + F++S VWLPV   WR+LRK +NSN+ S  +LD  Q LR RK+ EL+
Sbjct  16   RSVPNALLAHDQFKYSAVWLPVGPRWRSLRKALNSNMLSVGRLDFGQNLRCRKVDELV  73



>gb|EPS71897.1| geraniol 10-hydroxylase, partial [Genlisea aurea]
Length=465

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R IP+ VR  ++FQ SV+WLPV   WR LRK++N+++FS  KL+ ++ LR +K++ELI
Sbjct  71   RGIPETVRHYDYFQHSVIWLPVGLQWRLLRKVLNTHVFSSMKLEKDRALREKKVEELI  128



>ref|XP_011033851.1| PREDICTED: geraniol 8-hydroxylase-like isoform X2 [Populus euphratica]
Length=500

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+I DAVR  +H +  + WLPVA+ WR LR+I NS+IF+  KLD NQ LR +K+Q+++
Sbjct  101  NRTIVDAVRALDHHESGIAWLPVATRWRNLRRICNSHIFTAQKLDANQDLRRKKVQDIL  159



>ref|XP_004310184.1| PREDICTED: geraniol 8-hydroxylase-like [Fragaria vesca subsp. 
vesca]
Length=512

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++PDAV   NH ++S+VWLPV+  WR LRKI  S +FS   LD NQ  R  K+QELI
Sbjct  114  NRTVPDAVTSYNHCEYSMVWLPVSDRWRNLRKICTSQLFSPKVLDANQANRRVKVQELI  172



>ref|XP_011033850.1| PREDICTED: geraniol 8-hydroxylase-like isoform X1 [Populus euphratica]
Length=519

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+I DAVR  +H +  + WLPVA+ WR LR+I NS+IF+  KLD NQ LR +K+Q+++
Sbjct  120  NRTIVDAVRALDHHESGIAWLPVATRWRNLRRICNSHIFTAQKLDANQDLRRKKVQDIL  178



>ref|XP_004298300.1| PREDICTED: geraniol 8-hydroxylase-like [Fragaria vesca subsp. 
vesca]
Length=395

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R++PDAV   NH ++S+VWLPV+  WR LRKI  S +FS   LD NQ  R  K+QELI
Sbjct  103  RTVPDAVTSYNHCEYSMVWLPVSDRWRNLRKICTSQLFSPKVLDANQANRRVKVQELI  160



>ref|XP_010326942.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum lycopersicum]
Length=433

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R +P+A++  N+ +FSV +L V   WR LRKI+N NIFS   LD NQ LR++K++E+I
Sbjct  98   YRFVPNAIQAHNYSKFSVAFLHVCPQWRTLRKILNKNIFSSKSLDANQHLRSQKVKEMI  156



>ref|XP_010069286.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
 gb|KCW89350.1| hypothetical protein EUGRSUZ_A01644 [Eucalyptus grandis]
Length=499

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R +PD V   +H + S+VW+PV+  +R LRKI NS+IFS  KLD NQ +R++K+QEL+
Sbjct  101  NRMVPDCVMALDHDKLSLVWVPVSPFFRYLRKIYNSHIFSSKKLDLNQHVRSKKVQELV  159



>ref|XP_010692298.1| PREDICTED: geraniol 8-hydroxylase-like [Beta vulgaris subsp. 
vulgaris]
Length=488

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R++P+A R  +H +FS+VWLPV   WR LRKI    +F+  +LDT+Q LR +K++EL+
Sbjct  96   RTVPNAARAVDHDKFSMVWLPVCPKWRDLRKIATIQLFTTQRLDTSQFLRQKKVKELV  153



>ref|XP_009794427.1| PREDICTED: geraniol 8-hydroxylase-like isoform X2 [Nicotiana 
sylvestris]
Length=443

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQ  12
            +R IP+A++  N+ +FSV WLPV  +WR LR+I+NSNI S  KLD+NQ LR++K++
Sbjct  94   NRFIPNALQAHNYSKFSVTWLPVNPTWRTLRRILNSNILSLTKLDSNQHLRSQKVE  149



>ref|XP_008389841.1| PREDICTED: geraniol 8-hydroxylase-like [Malus domestica]
Length=500

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            HRSIPD+++   H ++S+ W+PV+ +WR LRK  NS +F+   LD NQ  R  K+QELI
Sbjct  101  HRSIPDSLQACKHSKYSMAWIPVSPAWRNLRKTCNSQLFTSKILDANQANRHLKVQELI  159



>ref|XP_010277464.1| PREDICTED: geraniol 8-hydroxylase-like [Nelumbo nucifera]
Length=504

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R IPD+VR  NH Q S+VW P +  WR +RKI N+ IFS  KLD+ Q LR +K+++L+
Sbjct  103  RIIPDSVRACNHHQVSMVWSPPSPQWRNMRKICNTEIFSSKKLDSMQGLRCQKVEKLV  160



>ref|XP_007040049.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY24550.1| Cytochrome P450, putative [Theobroma cacao]
Length=500

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+I DAVR + H +  + W+PV+  WR LRK+ N+++F+  KLD NQ LR +KIQELI
Sbjct  101  NRTIVDAVRASQHDEVGLPWIPVSPLWRTLRKVCNTHLFASQKLDANQYLRRKKIQELI  159



>ref|XP_010920218.1| PREDICTED: geraniol 8-hydroxylase-like [Elaeis guineensis]
Length=500

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            RSIPDAVR   H   SV W P A  WR+LR+I N+ +F+   LD +Q LR +K+QEL+
Sbjct  102  RSIPDAVRALGHADVSVAWQPPAKQWRSLRRICNTELFNSQTLDAHQSLRRQKVQELL  159



>gb|KDO43348.1| hypothetical protein CISIN_1g039787mg, partial [Citrus sinensis]
Length=278

 Score = 67.0 bits (162),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R +PDA    NH +  +VWLPV++ W+ LRKI N +IFS +KLD NQ +R +KI+ L+
Sbjct  107  RMVPDAACSYNHQEIGMVWLPVSTPWKNLRKICNLHIFSSHKLDANQDIRRKKIKHLL  164



>ref|XP_009787972.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana sylvestris]
Length=157

 Score = 66.2 bits (160),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASS-WRALRKIINSNIFSGN  54
            +R IPDA+R  NH+ FSV+WLPV  S WR LRKI+NSNIFSGN
Sbjct  98   NRCIPDALRACNHYDFSVIWLPVNDSRWRTLRKIMNSNIFSGN  140



>ref|XP_006440463.1| hypothetical protein CICLE_v10019651mg [Citrus clementina]
 gb|ESR53703.1| hypothetical protein CICLE_v10019651mg [Citrus clementina]
Length=536

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++PDA+R   H +FS+ WLP+++    LRKI NS+IF+  KLD NQ LR ++IQ+L+
Sbjct  137  NRTVPDALRAHQHDEFSMAWLPLSTPRTNLRKICNSHIFTTQKLDANQHLRRKRIQQLL  195



>gb|KDO35818.1| hypothetical protein CISIN_1g038027mg, partial [Citrus sinensis]
Length=167

 Score = 65.9 bits (159),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = -3

Query  176  RSIPDAV--RGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R +P+++  +   H +FS+VWLPV+  WR+LRKI N +IF+  KLD NQ LR +KI++L+
Sbjct  99   RKVPESILSQPYQHHEFSLVWLPVSPLWRSLRKICNMHIFTNQKLDANQDLRRKKIKDLL  158



>ref|XP_009362819.1| PREDICTED: geraniol 8-hydroxylase-like [Pyrus x bretschneideri]
Length=501

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+IPD++R  +H    + WLPV++ WR LRKI N+ +F+   LD+N+ LR RK+QEL+
Sbjct  102  NRTIPDSLRAHDHHTIGLPWLPVSTMWRNLRKICNTQLFANKMLDSNENLRRRKLQELL  160



>ref|XP_009375456.1| PREDICTED: geraniol 8-hydroxylase-like, partial [Pyrus x bretschneideri]
Length=190

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++PDAVR   H ++ + W+PV+ +WR LRKI N+ +F+   LD NQ  R  K+Q+LI
Sbjct  32   NRTVPDAVRACQHSKYGMAWIPVSPAWRNLRKICNTQLFATKILDANQANRHLKVQDLI  90



>ref|XP_006419188.1| hypothetical protein CICLE_v10030448mg [Citrus clementina]
 gb|ESR32428.1| hypothetical protein CICLE_v10030448mg [Citrus clementina]
Length=499

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++PDA+R   H +FS+ WLP+++    LRKI NS+IF+  KLD NQ LR ++IQ+L+
Sbjct  100  NRTVPDALRAHQHDEFSMGWLPLSTPRTNLRKICNSHIFTTQKLDANQHLRRKRIQQLL  158



>ref|XP_010050611.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
 gb|KCW89349.1| hypothetical protein EUGRSUZ_A01643 [Eucalyptus grandis]
Length=498

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+IPD +   NH QF + W+P++  +R LRKI NS++ S  KLD+NQ LR +K++EL+
Sbjct  100  NRTIPDTITAHNHDQFGLPWIPISPLFRNLRKIYNSHLLSNKKLDSNQHLRKKKVEELV  158



>ref|XP_006362199.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=495

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = -3

Query  164  DAVRGTNHFQFSVVWLPVASSWR-ALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            DAV   NH +FS+VWLP+ SS R +LR I+NS IFS NKLD NQ +R+ KI ELI
Sbjct  102  DAVEAHNHHKFSIVWLPIDSSRRKSLRTILNSCIFSANKLDANQNIRSTKISELI  156



>ref|XP_008222069.1| PREDICTED: geraniol 8-hydroxylase-like [Prunus mume]
Length=500

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/59 (51%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+IPDAV+   H ++ + WL VAS+WR LRKI NS +F+   LD NQ  R  K+QEL+
Sbjct  101  NRTIPDAVQACKHAKYGMPWLTVASTWRNLRKICNSQLFAAKVLDANQANRHLKVQELL  159



>ref|XP_006477330.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=499

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++PDA+R   H +FS+ WLP+++    LRKI NS+IF+  KLD NQ LR ++IQ+L+
Sbjct  100  NRTVPDALRAHQHDEFSMGWLPLSTPRTNLRKICNSHIFTTQKLDANQHLRRKRIQQLL  158



>ref|XP_007225781.1| hypothetical protein PRUPE_ppa004617mg [Prunus persica]
 gb|EMJ26980.1| hypothetical protein PRUPE_ppa004617mg [Prunus persica]
Length=499

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/59 (51%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+IPDAV+   H ++ + WL V+S+WR LRKI NS++F+   LD NQ  R  K+QELI
Sbjct  99   NRTIPDAVQACKHAKYGMPWLTVSSTWRNLRKICNSHLFAAKVLDANQANRHLKVQELI  157



>emb|CDP04799.1| unnamed protein product [Coffea canephora]
Length=814

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQEL  6
            R+IP A +  +H +FS+VWLP +S WR +RK+   NIF+  +LDT+Q LR  K+QEL
Sbjct  101  RAIPTAAQALDHHKFSLVWLPPSSQWRNMRKMCKENIFATQRLDTSQGLRQEKLQEL  157


 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -3

Query  134  FSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQEL  6
            F +VWLP +S WR +RK+   NIF+  +LD NQ LR  K+QEL
Sbjct  627  FLLVWLPPSSQWRNMRKMCKENIFATPRLDANQGLRQEKLQEL  669



>gb|KHG03596.1| Cytochrome P450 protein [Gossypium arboreum]
Length=498

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R+IPDA+R   H +  + W+PV+++WR LRKI N +IF+ +KLD NQ LR  K+++L+
Sbjct  101  RTIPDALRALQHHEAGLPWMPVSTTWRNLRKICNLHIFATHKLDANQYLRRSKVEQLL  158



>gb|KHG20073.1| Cytochrome P450 protein [Gossypium arboreum]
Length=494

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R++PDA+   +H +  + W+PV+++WR LRKI N +IF+  KLD NQ LR  KI++L+
Sbjct  96   RTVPDALHALHHHEAGIAWMPVSTTWRNLRKICNLHIFASQKLDANQHLRRNKIEQLL  153



>ref|XP_010691517.1| PREDICTED: geraniol 8-hydroxylase-like [Beta vulgaris subsp. 
vulgaris]
Length=491

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+IPD+V+ +NH + S+ WLPV++ WR LRKI    + S  +LD +Q LR  K+Q+L+
Sbjct  93   NRTIPDSVKASNHDKLSISWLPVSTKWRNLRKISTVQLLSTQRLDASQSLRQAKVQQLL  151



>emb|CAA71178.1| 7-ethoxycoumarin O-deethylase [Helianthus tuberosus]
Length=477

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R++PDAVR  NH + S+ +L V + WR LR+I++SNIFS + L+  Q LR++K++ELI
Sbjct  80   RNVPDAVRAYNHERHSISFLHVCTEWRTLRRIVSSNIFSNSSLEAKQHLRSKKVEELI  137



>sp|O23976.1|C76B1_HELTU RecName: Full=7-ethoxycoumarin O-deethylase; Short=ECOD; AltName: 
Full=Cytochrome P450 76B1; AltName: Full=Phenylurea dealkylase 
[Helianthus tuberosus]
 emb|CAA71054.1| 7-ethoxycoumarin O-deethylase [Helianthus tuberosus]
Length=490

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R++PDAVR  NH + S+ +L V + WR LR+I++SNIFS + L+  Q LR++K++ELI
Sbjct  95   RNVPDAVRAYNHERHSISFLHVCTEWRTLRRIVSSNIFSNSSLEAKQHLRSKKVEELI  152



>ref|XP_009372320.1| PREDICTED: geraniol 8-hydroxylase-like [Pyrus x bretschneideri]
Length=505

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++PDAV+  +H ++ + W PV+++WR LRKI NS +F+   LD NQ  R  K+QELI
Sbjct  101  NRTVPDAVQACDHAKYGMAWKPVSAAWRNLRKICNSQLFATKVLDANQANRRLKVQELI  159



>gb|KHG25715.1| 7-ethoxycoumarin O-deethylase [Gossypium arboreum]
Length=437

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+I DAVR + H++  + W+PV+  WR LRK+  ++IF+  KLD N+ LR  KIQELI
Sbjct  101  NRTIVDAVRASQHYEVGLPWIPVSPLWRTLRKVCKTHIFASIKLDANEYLRQNKIQELI  159



>ref|XP_007224832.1| hypothetical protein PRUPE_ppa023299mg [Prunus persica]
 gb|EMJ26031.1| hypothetical protein PRUPE_ppa023299mg [Prunus persica]
Length=468

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/59 (51%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+IPDAV+   H ++ + WL V+S+WR LRKI NS +F+   LD NQ  R  K+QELI
Sbjct  99   NRTIPDAVQACKHAKYGMPWLTVSSTWRNLRKICNSQLFAAKVLDANQANRHLKVQELI  157



>ref|XP_010326943.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum lycopersicum]
Length=491

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R IP+ V+  N+ +FS+VWLPV   WR LR+I+N+ + S + LD NQ LR++K++E+I
Sbjct  95   RFIPNVVQAHNYSKFSMVWLPVCPQWRMLRRILNTKMVSPHSLDANQHLRSQKVKEMI  152



>ref|XP_006494536.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=501

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R +PDA    NH +  +VWLPV++ W+ LRKI N +IFS +KLD NQ +R +KI+ L+
Sbjct  106  NRMVPDAACSYNHQEIGMVWLPVSTPWKNLRKICNLHIFSSHKLDANQDIRRKKIKHLL  164



>ref|XP_006423673.1| hypothetical protein CICLE_v10028257mg [Citrus clementina]
 gb|ESR36913.1| hypothetical protein CICLE_v10028257mg [Citrus clementina]
Length=501

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R +PDA    NH +  +VWLPV++ W+ LRKI N +IFS +KLD NQ +R +KI+ L+
Sbjct  106  NRMVPDAACSYNHQEIGMVWLPVSTPWKNLRKICNLHIFSSHKLDANQDIRRKKIKHLL  164



>ref|XP_010053375.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
 ref|XP_010053376.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
 ref|XP_010053377.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
 gb|KCW77654.1| hypothetical protein EUGRSUZ_D01952 [Eucalyptus grandis]
Length=498

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+ PDA+   +H Q  + W+PV+  +R LRKI NS++ S  KLD+NQ LR++K+QEL+
Sbjct  100  NRTTPDAITAHDHHQLGLPWIPVSPLFRNLRKIYNSHLLSSKKLDSNQHLRSKKVQELV  158



>ref|XP_006494410.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=488

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = -3

Query  176  RSIPDAV--RGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R +P+++  +   H +FS+VWLPV+  WR+LRKI N +IF+  KLD NQ LR +KI++L+
Sbjct  92   RKVPESILSQPYQHHEFSLVWLPVSPLWRSLRKICNMHIFTNQKLDANQDLRRKKIKDLL  151



>ref|XP_009372315.1| PREDICTED: geraniol 8-hydroxylase-like [Pyrus x bretschneideri]
Length=500

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++PDAVR   H ++ + W+PV+ +WR LRKI N+ +F+   LD NQ  R  K+Q+LI
Sbjct  101  NRTVPDAVRACQHSKYGMAWIPVSPAWRNLRKICNTQLFATKILDANQANRHLKVQDLI  159



>ref|XP_007209932.1| hypothetical protein PRUPE_ppa004606mg [Prunus persica]
 gb|EMJ11131.1| hypothetical protein PRUPE_ppa004606mg [Prunus persica]
Length=500

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+IPD++R  +H    + W+PV++ WR LRKI N+ +F+   LD+NQ LR  K+QELI
Sbjct  101  NRTIPDSIRAYDHHIVGLPWIPVSTLWRNLRKICNTELFANKMLDSNQNLRRNKVQELI  159



>ref|XP_009372314.1| PREDICTED: geraniol 8-hydroxylase-like [Pyrus x bretschneideri]
Length=504

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++PDAVR   H ++ + W+PV+ +WR LRKI N+ +F+   LD NQ  R  K+Q+LI
Sbjct  101  NRTVPDAVRACQHSKYGMAWIPVSPAWRNLRKICNTQLFATKILDANQANRHLKVQDLI  159



>ref|XP_010040683.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
Length=498

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+ PDA+   +H Q  V W+PV+  +R LRKI NS++ S  KLD+NQ LR++K+QEL+
Sbjct  100  NRTTPDAITVHDHHQLGVPWIPVSPLFRNLRKIYNSHLLSSKKLDSNQHLRSKKVQELV  158



>gb|KCW45005.1| hypothetical protein EUGRSUZ_L01405, partial [Eucalyptus grandis]
Length=511

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+ PDA+   +H Q  V W+PV+  +R LRKI NS++ S  KLD+NQ LR++K+QEL+
Sbjct  100  NRTTPDAITVHDHHQLGVPWIPVSPLFRNLRKIYNSHLLSSKKLDSNQHLRSKKVQELV  158



>gb|KCW89351.1| hypothetical protein EUGRSUZ_A01647, partial [Eucalyptus grandis]
Length=480

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R +PD V   +H + S+ W PV+  +R LRKI NS+IFS  KLD NQ +R++K+QEL+
Sbjct  101  NRMVPDCVMAHDHDKLSLAWAPVSPFFRYLRKIYNSHIFSSKKLDLNQHVRSKKVQELV  159



>ref|XP_006494407.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=495

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = -3

Query  176  RSIPDAV--RGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R +P+++  +   H +FS+VWLPV+  WR+LRKI N +IF+  KLD NQ LR +KI++L+
Sbjct  99   RKVPESILSQPYQHHEFSLVWLPVSPLWRSLRKICNMHIFTNQKLDANQDLRRKKIKDLL  158



>gb|KDO41057.1| hypothetical protein CISIN_1g043641mg [Citrus sinensis]
Length=478

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++P+++R     ++ + WLPV++ W+ LRKI N +IF+  KLD NQ LR +KIQ+L+
Sbjct  97   NRNVPESIRSIQKDEYGIPWLPVSTKWKKLRKICNLHIFTSQKLDANQDLRPKKIQQLV  155



>ref|XP_010692295.1| PREDICTED: geraniol 8-hydroxylase-like [Beta vulgaris subsp. 
vulgaris]
Length=488

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R  PDA R  NH +FS+VWLPV+  WR LRKI    +F+  +LD++Q+LR  K+ EL+
Sbjct  97   RPSPDASRVGNHNKFSIVWLPVSPKWRDLRKIATIQLFTTQRLDSSQELRQIKVNELV  154



>ref|XP_010105780.1| Cytochrome P450 76C2 [Morus notabilis]
 gb|EXC06133.1| Cytochrome P450 76C2 [Morus notabilis]
Length=451

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+I DA R + H +FS+++LPV++SWR LRKI+N ++ +   LD N  LR  K+QEL+
Sbjct  15   NRTISDAARASKHCEFSMIFLPVSTSWRDLRKILNVHLLASKVLDANMNLRHNKVQELL  73



>ref|XP_006423671.1| hypothetical protein CICLE_v10028269mg [Citrus clementina]
 gb|ESR36911.1| hypothetical protein CICLE_v10028269mg [Citrus clementina]
Length=495

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = -3

Query  176  RSIPDAV--RGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R +P+++  +   H +FS+VWLPV+  WR+LRKI N +IFS  KLD NQ LR +KI++L+
Sbjct  99   RKVPESILSQPYQHHEFSLVWLPVSPLWRSLRKICNMHIFSNQKLDANQDLRRKKIKDLL  158



>ref|XP_002509652.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF51039.1| cytochrome P450, putative [Ricinus communis]
Length=377

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++  A++  +H + S+ WLPV + WR LRKI +  IF+  KLD NQ LR +KIQEL+
Sbjct  97   NRTVVQAIQALDHHEASMPWLPVGAPWRNLRKICSFYIFTNQKLDANQDLRCKKIQELL  155



>ref|XP_006477329.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=499

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++PDA+R   H +FS+ WLP+++    LRKI NS+IF+  KLD NQ LR ++IQ+L+
Sbjct  100  NRTVPDALRAHQHDEFSMGWLPLSTPRTNLRKICNSHIFTTQKLDANQHLRRKRIQQLL  158



>gb|KCW77276.1| hypothetical protein EUGRSUZ_D01633 [Eucalyptus grandis]
Length=431

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R IPD V+ + H+  SVVWLP +  W+ LRK+    +FS  KLD  Q LR +K+ EL+
Sbjct  33   RQIPDTVKASGHYAESVVWLPASDKWKQLRKVCTVQMFSAQKLDAGQLLRRKKVDELV  90



>ref|XP_010053037.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
Length=501

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R IPD V+ + H+  SVVWLP +  W+ LRK+    +FS  KLD  Q LR +K+ EL+
Sbjct  103  RQIPDTVKASGHYAESVVWLPASDKWKQLRKVCTVQMFSAQKLDAGQLLRRKKVDELV  160



>ref|XP_010069299.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
Length=351

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R +PD+V    H + S++W+P++  +R LRK+ NS+I S  KLD NQ L ++K+QELI
Sbjct  101  NRMVPDSVMAHGHDKLSMLWVPISPPFRYLRKLYNSHILSNKKLDLNQHLHSKKVQELI  159



>ref|XP_006487472.1| PREDICTED: geraniol 8-hydroxylase-like isoform X2 [Citrus sinensis]
Length=457

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = -3

Query  176  RSIPDAV--RGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R +P+A   +   H +FS+VWLPV+  W+ LRK+ N +IF+  KLD NQ LR RKI++L+
Sbjct  99   RKVPEATLFQSYRHHEFSLVWLPVSPLWKNLRKVCNMHIFTSQKLDANQDLRRRKIKDLL  158



>ref|XP_002509653.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF51040.1| cytochrome P450, putative [Ricinus communis]
Length=501

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -3

Query  161  AVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            AV   +H + S+ WLPV + WR LRKI NS +FS  KLD NQ +R +KIQELI
Sbjct  108  AVHAHDHHEASMPWLPVGAPWRNLRKICNSYLFSNQKLDGNQDIRQKKIQELI  160



>ref|XP_006423678.1| hypothetical protein CICLE_v10028268mg [Citrus clementina]
 gb|ESR36918.1| hypothetical protein CICLE_v10028268mg [Citrus clementina]
Length=496

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R +PDA    NH +  +VWLPV++ W+ LRKI N +IFS +KLD N+ +R +KI+ L+
Sbjct  101  NRMVPDAACSYNHQEIGMVWLPVSTPWKNLRKICNLHIFSSHKLDANEDIRRKKIKHLL  159



>ref|XP_010667620.1| PREDICTED: geraniol 8-hydroxylase-like [Beta vulgaris subsp. 
vulgaris]
Length=265

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASS-WRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R + DA+R  NH Q+S+ WLP  SS WR LRK+ NS +FS +KLD  Q LR  KI +L+
Sbjct  99   NRYVVDAIRALNHHQYSIGWLPATSSEWRNLRKVCNSLVFSPSKLDETQSLRRDKINDLL  158



>ref|XP_008390127.1| PREDICTED: geraniol 8-hydroxylase-like [Malus domestica]
Length=500

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++PDA++   H ++S+ W+PV+++W+ LRK  NS +F+   LD NQ  R  K+QELI
Sbjct  101  NRTVPDALQACQHSKYSMAWIPVSATWKNLRKTCNSQLFTTKILDANQANRHLKVQELI  159



>ref|XP_004492652.1| PREDICTED: geraniol 8-hydroxylase-like [Cicer arietinum]
Length=506

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+IP AV  T H++FSV WLP+++ W  LRKI  + +FS   LD+ + +R +K+Q+L+
Sbjct  100  NRTIPHAVHATQHYKFSVAWLPLSTPWTKLRKICATKVFSPKMLDSTKIIREKKLQDLL  158



>ref|XP_010324706.1| PREDICTED: geraniol 8-hydroxylase-like isoform X2 [Solanum lycopersicum]
Length=404

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R I +A++   + +FSV  LPV   WR LRKI+N ++FS NKLD N+ LR++K++ELI
Sbjct  100  NRFITNALQAHMYSKFSVACLPVCPQWRMLRKILNKSVFSSNKLDANEHLRSQKVKELI  158



>ref|XP_004247615.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum lycopersicum]
Length=502

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = -3

Query  164  DAVRGTNHFQFSVVWLPVASSWRA-LRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            DAV   NH +FSVVWLPV SS R  LR I+NS I + NKLD NQ LR+ KI ELI
Sbjct  104  DAVEAHNHHKFSVVWLPVDSSRRKNLRTILNSCIVTANKLDANQDLRSTKISELI  158



>ref|XP_010053381.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
 gb|KCW77659.1| hypothetical protein EUGRSUZ_D01958 [Eucalyptus grandis]
Length=499

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R IPDAV   N    S+ W+PV+  WR LR+I N ++FS  KLD+ Q LR +K+QEL+
Sbjct  100  NRMIPDAVTAFNQGMHSLPWVPVSPLWRNLRRIFNVHLFSNMKLDSTQHLRRKKVQELL  158



>gb|KDP25563.1| hypothetical protein JCGZ_20719 [Jatropha curcas]
Length=722

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++  A++  +H Q S+ WLPV   WR LRKI N +IF+  KLD NQ LR +KIQEL+
Sbjct  68   NRTVIQAIKTYDHHQVSLPWLPVGPLWRNLRKICNCHIFTNQKLDENQGLRFKKIQELL  126


 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++ +A++   H + S+ W  V   WR LR+I +  I S  KLD+NQ L  +KIQEL+
Sbjct  542  NRTVGEAIQARGHQEVSLAWALVGGPWRNLRRICSPYI-SNQKLDSNQVLLQKKIQELV  599



>ref|XP_010105779.1| Cytochrome P450 76C4 [Morus notabilis]
 gb|EXC06132.1| Cytochrome P450 76C4 [Morus notabilis]
Length=645

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+I DA R + H +FS+++LPV++SWR LRKI+N ++ +   LD N  LR  K+QEL+
Sbjct  241  NRTISDAARASKHCEFSMIFLPVSTSWRDLRKILNVHLLASKVLDANMNLRHNKVQELL  299



>ref|XP_002276121.1| PREDICTED: geraniol 8-hydroxylase-like isoform X2 [Vitis vinifera]
Length=465

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R++PDAVR  NH + SVVW+P +  WR +RKI    IFS  +LD +Q LR + +QEL+
Sbjct  101  RTVPDAVRAHNHHESSVVWVPASVHWRKIRKICTREIFSVQQLDASQGLRRKIVQELL  158



>ref|XP_008389839.1| PREDICTED: geraniol 8-hydroxylase-like [Malus domestica]
Length=504

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+IP+AV+  +H ++ + WLPV+++WR LRKI NS +F+   LD NQ  R  K+QELI
Sbjct  100  NRTIPNAVQARDHAKYGMPWLPVSAAWRNLRKICNSQLFANKVLDANQANRHIKVQELI  158



>ref|XP_010050589.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
 gb|KCW89347.1| hypothetical protein EUGRSUZ_A01641 [Eucalyptus grandis]
Length=498

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+IPD +   NH Q  + W+P++  +R LRK+ NS++ S  KLD+NQ LR +K++EL+
Sbjct  100  NRTIPDTITAHNHDQLGLPWMPISPLFRNLRKMFNSHLLSNKKLDSNQHLRKKKVEELV  158



>ref|XP_010324705.1| PREDICTED: geraniol 8-hydroxylase-like isoform X1 [Solanum lycopersicum]
Length=499

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R I +A++   + +FSV  LPV   WR LRKI+N ++FS NKLD N+ LR++K++ELI
Sbjct  100  NRFITNALQAHMYSKFSVACLPVCPQWRMLRKILNKSVFSSNKLDANEHLRSQKVKELI  158



>emb|CDP20560.1| unnamed protein product [Coffea canephora]
Length=474

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQEL  6
            R+IP A +  +H +FS+VWLP +  WR +RK+   NIF+  +LD N+ LR  K+QEL
Sbjct  101  RAIPTAAQALDHHKFSLVWLPPSGQWRNIRKMCKENIFATPRLDANEGLRQEKLQEL  157



>ref|XP_010661587.1| PREDICTED: geraniol 8-hydroxylase-like isoform X1 [Vitis vinifera]
Length=496

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R++PDAVR  NH + SVVW+P +  WR +RKI    IFS  +LD +Q LR + +QEL+
Sbjct  101  RTVPDAVRAHNHHESSVVWVPASVHWRKIRKICTREIFSVQQLDASQGLRRKIVQELL  158



>ref|XP_006423657.1| hypothetical protein CICLE_v10030181mg [Citrus clementina]
 gb|ESR36897.1| hypothetical protein CICLE_v10030181mg [Citrus clementina]
Length=451

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = -3

Query  176  RSIPDAVRGTN--HFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R +P+AV      H +FS+ WLPV++ W+ LRKI N +IF+  KLD NQ+LR +KI++L+
Sbjct  99   RKVPEAVLSLPFPHHEFSLAWLPVSTMWKNLRKISNMHIFTSQKLDANQELRRKKIKDLL  158



>gb|KEH40908.1| cytochrome P450 family protein [Medicago truncatula]
Length=496

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQEL  6
            +R+IPDA++G NH  +S+ ++P++  W+ LRKI N+ +FS   LD N  LR +KI EL
Sbjct  97   NRTIPDAMKGANHHNYSLPFIPISQRWKDLRKICNNLLFSTKNLDMNHTLRKKKILEL  154



>ref|XP_006494538.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=739

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = -3

Query  176  RSIPDAV--RGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R +P+++  +   H +FS+VWLPV+  WR+LRKI N +IF+  KLD NQ LR +KI+ L+
Sbjct  96   RKVPESILSQPYQHHEFSLVWLPVSPLWRSLRKICNMHIFTTQKLDANQDLRRKKIKGLL  155



>ref|XP_010676619.1| PREDICTED: geraniol 8-hydroxylase-like [Beta vulgaris subsp. 
vulgaris]
Length=546

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R + DAV   NH + S+VWLP++  WR LRKI NS +F+ ++LD +Q LR +K+++L+
Sbjct  147  NRMVIDAVCAVNHHENSIVWLPLSPKWRNLRKICNSKVFATSRLDASQSLRTKKVKDLL  205



>ref|XP_004310057.1| PREDICTED: geraniol 8-hydroxylase-like [Fragaria vesca subsp. 
vesca]
Length=505

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++PDA+   NH  +S+ WLPV++ WR LR I N  +FS   LD NQ  R  K+Q+LI
Sbjct  102  NRTLPDAIHACNHSGYSMAWLPVSARWRNLRTICNLQLFSPKVLDANQANRHVKVQKLI  160



>gb|AES93118.1| geraniol-10-hydroxylase [Camptotheca acuminata]
Length=501

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -3

Query  164  DAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            DA+R  N  QFSV+WLPV + WR LRKI+N  + S  +L  NQ +R +K++ELI
Sbjct  107  DAIRALNQDQFSVIWLPVVTRWRNLRKILNLYMLSTERLGANQPIRCQKVEELI  160



>ref|XP_010680621.1| PREDICTED: geraniol 8-hydroxylase-like [Beta vulgaris subsp. 
vulgaris]
Length=499

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R +  AVR   H +FS+ WLPV   WRALRKI   ++FS  +LD++Q LR  K+ +LI
Sbjct  105  RHVSAAVRANGHDKFSMAWLPVGPKWRALRKIATIHLFSSQRLDSSQALRREKVSKLI  162



>ref|XP_006423714.1| hypothetical protein CICLE_v10028277mg [Citrus clementina]
 gb|ESR36954.1| hypothetical protein CICLE_v10028277mg [Citrus clementina]
 gb|KDO53970.1| hypothetical protein CISIN_1g011030mg [Citrus sinensis]
Length=495

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = -3

Query  176  RSIPDAV--RGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R +P+A   +   H +FS+VWLPV+  W+ LRK+ N +IF+  KLD NQ LR RKI++L+
Sbjct  99   RKVPEATLFQSYRHHEFSLVWLPVSPLWKNLRKVCNMHIFTSQKLDANQDLRRRKIKDLL  158



>ref|XP_010053039.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
 gb|KCW77278.1| hypothetical protein EUGRSUZ_D01636 [Eucalyptus grandis]
Length=506

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R IPD V+ + H+  SVVWLP +  W+ LRK+    +FS +KLD  Q L  +K+ EL+
Sbjct  103  RQIPDTVKASGHYAESVVWLPASDKWKQLRKVCTVQMFSAHKLDAGQLLHRKKVDELV  160



>ref|XP_006487471.1| PREDICTED: geraniol 8-hydroxylase-like isoform X1 [Citrus sinensis]
Length=495

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = -3

Query  176  RSIPDAV--RGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R +P+A   +   H +FS+VWLPV+  W+ LRK+ N +IF+  KLD NQ LR RKI++L+
Sbjct  99   RKVPEATLFQSYRHHEFSLVWLPVSPLWKNLRKVCNMHIFTSQKLDANQDLRRRKIKDLL  158



>ref|XP_006423672.1| hypothetical protein CICLE_v10028278mg [Citrus clementina]
 gb|ESR36912.1| hypothetical protein CICLE_v10028278mg [Citrus clementina]
Length=495

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = -3

Query  176  RSIPDAV--RGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R +P+++  +   H +FS+VWLPV+  WR+LRKI N +IF+  KLD NQ LR +KI+ L+
Sbjct  99   RKVPESILSQPYQHHEFSLVWLPVSPLWRSLRKICNMHIFTNQKLDANQDLRRKKIKGLL  158



>ref|XP_008340390.1| PREDICTED: geraniol 8-hydroxylase-like [Malus domestica]
Length=211

 Score = 61.6 bits (148),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +RS+PDA++   H ++ + W+PV+ +WR LRK  N+ +F+   LD NQ  R  K+QELI
Sbjct  32   NRSVPDALQACQHSKYGMGWIPVSPAWRNLRKTCNTQLFATKILDANQANRHLKVQELI  90



>ref|XP_011089001.1| PREDICTED: geraniol 8-hydroxylase-like [Sesamum indicum]
Length=500

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQEL  6
            R+ PDA+R  +H + SV W+PV + WR LRK+    +FS  +LD NQ LR  K+++L
Sbjct  102  RTHPDAIRALDHHKLSVAWMPVDNQWRKLRKLCKEKMFSVQRLDANQSLRREKLRQL  158



>ref|XP_010692297.1| PREDICTED: geraniol 8-hydroxylase-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=484

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R+  DA+R  NH Q S+V+LPV   WR LRKI    +F+G +LD +Q +R +K+ ELI
Sbjct  95   RANTDALRAANHDQLSMVFLPVGPKWRNLRKIATVQLFTGKRLDASQIIRQKKVDELI  152



>ref|XP_008447652.1| PREDICTED: geraniol 8-hydroxylase-like [Cucumis melo]
Length=297

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++PDA+   +H +    W+PV+S WR  RKI N+ +F+G  LD N+ LR +K++EL+
Sbjct  96   NRTVPDALTAHSHHELGFPWIPVSSLWRNYRKICNNMLFAGKILDMNENLRRKKVEELV  154



>ref|XP_006451465.1| hypothetical protein CICLE_v10008099mg [Citrus clementina]
 ref|XP_006451466.1| hypothetical protein CICLE_v10008099mg [Citrus clementina]
 ref|XP_006451467.1| hypothetical protein CICLE_v10008099mg [Citrus clementina]
 ref|XP_006451468.1| hypothetical protein CICLE_v10008099mg [Citrus clementina]
 ref|XP_006475423.1| PREDICTED: geraniol 8-hydroxylase-like isoform X1 [Citrus sinensis]
 ref|XP_006475424.1| PREDICTED: geraniol 8-hydroxylase-like isoform X2 [Citrus sinensis]
 ref|XP_006475425.1| PREDICTED: geraniol 8-hydroxylase-like isoform X3 [Citrus sinensis]
 gb|ESR64705.1| hypothetical protein CICLE_v10008099mg [Citrus clementina]
 gb|ESR64706.1| hypothetical protein CICLE_v10008099mg [Citrus clementina]
 gb|ESR64707.1| hypothetical protein CICLE_v10008099mg [Citrus clementina]
 gb|ESR64708.1| hypothetical protein CICLE_v10008099mg [Citrus clementina]
 gb|KDO57774.1| hypothetical protein CISIN_1g011093mg [Citrus sinensis]
Length=494

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++P++V      ++ + WLPV++ W+ LRKI N +IF+  KLD NQ LR +KIQ+L+
Sbjct  97   NRNVPESVGSIQKDEYGIPWLPVSTKWKKLRKICNLHIFTSQKLDANQDLRRKKIQQLV  155



>ref|XP_010057715.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
Length=499

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++P+++   +H +  V WLPV+  +R LRK+   +IFS  KLD NQ LR++K+QEL+
Sbjct  101  NRTVPNSITAHDHDKLGVPWLPVSPLFRNLRKVYKLHIFSSKKLDLNQHLRSKKVQELV  159



>gb|KDO57775.1| hypothetical protein CISIN_1g011069mg [Citrus sinensis]
Length=494

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++PD+V      ++ + WLP ++ W+ LRKI N +IF+  KLD NQ LR +KIQ+L+
Sbjct  97   NRNVPDSVSSHQKGEYGIPWLPASTQWKKLRKICNLHIFTSQKLDANQDLRRKKIQQLV  155



>ref|XP_006451469.1| hypothetical protein CICLE_v10008095mg [Citrus clementina]
 ref|XP_006475422.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
 gb|ESR64709.1| hypothetical protein CICLE_v10008095mg [Citrus clementina]
Length=494

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++PD+V      ++ + WLP ++ W+ LRKI N +IF+  KLD NQ LR +KIQ+L+
Sbjct  97   NRNVPDSVSSHQKGEYGIPWLPASTQWKKLRKICNLHIFTSQKLDANQDLRRKKIQQLV  155



>ref|XP_006487474.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=495

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = -3

Query  176  RSIPDAVRG--TNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R +P+AV      H +FS+VWLPV+  W+ LRKI N +IF+  KLD NQ LR +KI++L+
Sbjct  99   RKVPEAVLSLPNRHPEFSLVWLPVSPLWKNLRKICNMHIFTSQKLDANQDLRRKKIKDLL  158



>ref|XP_010692296.1| PREDICTED: geraniol 8-hydroxylase-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=487

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R+  DA+R  NH Q S+V+LPV   WR LRKI    +F+G +LD +Q +R +K+ ELI
Sbjct  95   RANTDALRAANHDQLSMVFLPVGPKWRNLRKIATVQLFTGKRLDASQIIRQKKVDELI  152



>ref|XP_010108078.1| Cytochrome P450 76C4 [Morus notabilis]
 gb|EXC17810.1| Cytochrome P450 76C4 [Morus notabilis]
Length=498

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQEL  6
            R+IPDA+    H    + W+PV++ WR LRKI N+ +F+   LDTNQ+LR RK++EL
Sbjct  101  RTIPDALHILGHQHTGLPWIPVSNHWRTLRKICNTQLFAVKVLDTNQELRRRKVREL  157



>ref|XP_006423716.1| hypothetical protein CICLE_v10028276mg [Citrus clementina]
 gb|ESR36956.1| hypothetical protein CICLE_v10028276mg [Citrus clementina]
Length=404

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = -3

Query  176  RSIPDAVRG--TNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R +P+AV      H +FS+VWLPV+  W+ LRK+ N +IF+  KLD NQ LR +KI++L+
Sbjct  99   RKVPEAVLSLPNRHPEFSLVWLPVSPLWKNLRKLCNMHIFTSQKLDANQDLRRKKIKDLL  158



>ref|XP_004232060.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum lycopersicum]
Length=501

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 30/59 (51%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVA-SSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            RSIPD V+  N   FSV WLP +   WR  RK + S+IFS NKLD +  LR +K++EL+
Sbjct  104  RSIPDIVKEENFHMFSVGWLPASHPQWRIFRKFMTSHIFSINKLDASHHLRYKKLEELV  162



>gb|KCW74940.1| hypothetical protein EUGRSUZ_E03685 [Eucalyptus grandis]
Length=499

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++P+++   +H +  + WLPV+  +R L+K+ N +IFS  KLD NQ LR++K+QEL+
Sbjct  101  NRTVPNSITAHDHDKLGLPWLPVSPLFRNLKKVYNLHIFSSKKLDLNQHLRSKKVQELV  159



>gb|KGN58318.1| Cytochrome P450 [Cucumis sativus]
Length=302

 Score = 62.0 bits (149),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R +PDA+   +H +    W+PV+S WR  RKI N+ +F+G  LD N+ LR +K++EL+
Sbjct  97   NRVVPDALTAHSHHEVGFPWIPVSSLWRNYRKICNNTLFAGKILDMNENLRRKKVEELV  155



>gb|ACU20890.1| unknown [Glycine max]
Length=516

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++PD +R  +H   SVVW+P  + WR LR++  + +FS  +LD+ Q  R RK+Q+L+
Sbjct  99   NRTVPDTLRALDHHILSVVWMPPLAQWRTLRRVCATKVFSSQQLDSTQVFRQRKVQDLM  157



>ref|XP_003521519.1| PREDICTED: geraniol 8-hydroxylase-like [Glycine max]
 gb|KHN04086.1| Cytochrome P450 76C4 [Glycine soja]
Length=516

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++PD +R  +H   SVVW+P  + WR LR++  + +FS  +LD+ Q  R RK+Q+L+
Sbjct  99   NRTVPDTLRALDHHILSVVWMPPLAQWRTLRRVCATKVFSSQQLDSTQVFRQRKVQDLM  157



>gb|KCW74943.1| hypothetical protein EUGRSUZ_E03687 [Eucalyptus grandis]
Length=411

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++P+++   +H + S+ WLPV+  +R LRK+ + +IFS  KLD NQ LR++K+QEL+
Sbjct  131  NRTVPNSITAHDHDKLSLPWLPVSPLFRNLRKVYSLHIFSSKKLDLNQHLRSKKVQELV  189



>ref|XP_010920220.1| PREDICTED: geraniol 8-hydroxylase-like isoform X2 [Elaeis guineensis]
Length=477

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            RS+ DA+R   H   S +WLP ++ WR+LR+I N+ +F+   LD  Q LR +KIQEL+
Sbjct  102  RSVADALRALGHADISTLWLPPSNQWRSLRRICNTTLFNSQTLDARQSLRRQKIQELL  159



>ref|XP_010920219.1| PREDICTED: geraniol 8-hydroxylase-like isoform X1 [Elaeis guineensis]
Length=501

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            RS+ DA+R   H   S +WLP ++ WR+LR+I N+ +F+   LD  Q LR +KIQEL+
Sbjct  102  RSVADALRALGHADISTLWLPPSNQWRSLRRICNTTLFNSQTLDARQSLRRQKIQELL  159



>gb|AJD25185.1| cytochrome P450 CYP76S7 [Salvia miltiorrhiza]
Length=494

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQEL  6
            R+IP A +   H +FS+VWLPV   WR LRKI   ++FS ++LD ++ LR  K+Q+L
Sbjct  100  RTIPSASKALRHDEFSMVWLPVGEQWRKLRKICKEHMFSTSRLDASEGLRREKLQKL  156



>gb|KCW75045.1| hypothetical protein EUGRSUZ_E03822 [Eucalyptus grandis]
Length=499

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++P ++   +H +  + W+PV+  +R LRK+ N +IFS  KLD NQ LR++K+QEL+
Sbjct  101  NRTVPSSITAHDHDRLGLPWIPVSPLFRNLRKVYNLHIFSSKKLDLNQHLRSKKVQELV  159



>emb|CAB56741.1| cytochrome P450 monooxygenase [Cicer arietinum]
Length=437

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++PDA+   NH Q+S+ ++ V+  WR LRKI N  +FS   LD++Q LR RK+Q+L+
Sbjct  37   NRTVPDALSVLNHDQYSLSFMRVSPRWRDLRKICNYQLFSNKTLDSSQALRRRKLQDLL  95



>ref|XP_006487449.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=495

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = -3

Query  176  RSIPDAVRGTN--HFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R +P+A+      H +FS+ WLPV++ W+ LRKI N +IF+  KLD NQ+LR +KI++L+
Sbjct  99   RMVPEAILSLPFPHHEFSLAWLPVSTMWKNLRKISNMHIFTSQKLDANQELRRKKIKDLL  158



>ref|XP_006487435.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=495

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/60 (45%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = -3

Query  176  RSIPDAV--RGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R +P+++  +   H +FS+VWLPV++ WR+ RKI N  IF+  KLD +Q LR +KI++L+
Sbjct  99   RKVPESILSQPYRHHEFSLVWLPVSTLWRSFRKICNMYIFTSQKLDASQDLRRKKIKDLL  158



>ref|XP_004164278.1| PREDICTED: geraniol 8-hydroxylase-like [Cucumis sativus]
Length=474

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R +PDA+   +H +    W+PV+S WR  RKI N+ +F+G  LD N+ LR +K++EL+
Sbjct  97   NRDVPDALTAHSHHEVGFPWIPVSSLWRNYRKICNNTLFAGKILDMNENLRRKKVEELV  155



>ref|XP_006423661.1| hypothetical protein CICLE_v10028273mg [Citrus clementina]
 gb|ESR36901.1| hypothetical protein CICLE_v10028273mg [Citrus clementina]
Length=495

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = -3

Query  176  RSIPDAVRGTN--HFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R +P+A+      H +FS+ WLPV++ W+ LRKI N +IF+  KLD NQ+LR +KI++L+
Sbjct  99   RMVPEAILSLPFPHHEFSLAWLPVSTMWKNLRKISNMHIFTSQKLDANQELRRKKIKDLL  158



>ref|XP_010057761.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
Length=529

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++P ++   +H +  + W+PV+  +R LRK+ N +IFS  KLD NQ LR++K+QEL+
Sbjct  131  NRTVPSSITAHDHDRLGLPWIPVSPLFRNLRKVYNLHIFSSKKLDLNQHLRSKKVQELV  189



>ref|XP_006423715.1| hypothetical protein CICLE_v10028276mg [Citrus clementina]
 gb|ESR36955.1| hypothetical protein CICLE_v10028276mg [Citrus clementina]
Length=495

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = -3

Query  176  RSIPDAVRG--TNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R +P+AV      H +FS+VWLPV+  W+ LRK+ N +IF+  KLD NQ LR +KI++L+
Sbjct  99   RKVPEAVLSLPNRHPEFSLVWLPVSPLWKNLRKLCNMHIFTSQKLDANQDLRRKKIKDLL  158



>gb|KDO47864.1| hypothetical protein CISIN_1g043423mg [Citrus sinensis]
Length=481

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = -3

Query  176  RSIPDAVRG--TNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R +P+AV      H +FS+VWLPV+  W+ LRK+ N +IF+  KLD NQ LR +KI++L+
Sbjct  99   RKVPEAVLSLPNRHPEFSLVWLPVSPLWKNLRKLCNMHIFTSQKLDANQDLRRKKIKDLL  158



>ref|XP_004516468.1| PREDICTED: geraniol 8-hydroxylase-like [Cicer arietinum]
Length=489

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++PDA+   NH Q+S+ ++ V+  WR LRKI N  +FS   LD++Q LR RK+Q+L+
Sbjct  105  NRTVPDALSVLNHDQYSLSFMRVSPRWRDLRKICNYQLFSNKTLDSSQALRRRKLQDLL  163



>ref|XP_006494719.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=495

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/60 (43%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = -3

Query  176  RSIPDAV--RGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R +P+++  +   H +FS+VWLPV++ WR+ RK+ N +IF+  KLD +Q LR +KI++L+
Sbjct  99   RKVPESILSQPYRHHEFSLVWLPVSTLWRSYRKMCNMHIFTSQKLDASQDLRRKKIKDLL  158



>gb|KDO36937.1| hypothetical protein CISIN_1g044449mg, partial [Citrus sinensis]
Length=200

 Score = 60.5 bits (145),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R + DA+    H +F +V LPV+++W+ LRK+ N +IF+  KLD NQ+LR +KI+ L+
Sbjct  109  NRMVKDAIFPHQHNEFGMVLLPVSTTWKNLRKLCNLHIFTTQKLDANQELRRKKIKNLL  167



>ref|XP_007034575.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY05501.1| Cytochrome P450, putative [Theobroma cacao]
Length=551

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+I DA+R   H +  + W+PV+  WR LRK+ +S+ FS  KLD +Q LR +KI+EL+
Sbjct  155  NRTIGDALRVNQHDEVGLPWMPVSPLWRTLRKVCSSHFFSNKKLDAHQYLRRKKIEELL  213



>emb|CDP20559.1| unnamed protein product [Coffea canephora]
Length=498

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQEL  6
            RS   A    +H + S+VWLPV+S WR LRK+   NIF+  +LDT+Q LR  K+QEL
Sbjct  101  RSATGAAHTLDHHKVSMVWLPVSSQWRNLRKMCKENIFATQRLDTSQGLRQEKLQEL  157



>ref|XP_006495031.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=477

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/60 (43%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = -3

Query  176  RSIPDAV--RGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R +P+++  +   H +FS+VWLPV++ WR+ RK+ N +IF+  KLD +Q LR +KI++L+
Sbjct  81   RKVPESILSQPYRHHEFSLVWLPVSTLWRSYRKMCNMHIFTSQKLDASQDLRRKKIKDLL  140



>gb|KHG16052.1| Cytochrome P450 protein [Gossypium arboreum]
Length=496

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R++PDA+R   H +  + W+P +++WR  RKI N +IF+ ++LD NQ LR  K+++L+
Sbjct  100  RTVPDAIRALRHHEVGLPWMPASTTWRNHRKICNLHIFASHRLDANQYLRRTKLEQLL  157



>ref|XP_003628247.1| Cytochrome P450 [Medicago truncatula]
Length=492

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++PDA+   NH Q+S+ ++ V+  WR LRKI N+ +F+   LD++Q LR RK+Q+L+
Sbjct  107  NRTVPDALSVLNHDQYSLSFMRVSPRWRDLRKICNNQLFANKTLDSSQTLRQRKLQDLL  165



>gb|AET02723.2| cytochrome P450 family protein [Medicago truncatula]
Length=509

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++PDA+   NH Q+S+ ++ V+  WR LRKI N+ +F+   LD++Q LR RK+Q+L+
Sbjct  107  NRTVPDALSVLNHDQYSLSFMRVSPRWRDLRKICNNQLFANKTLDSSQTLRQRKLQDLL  165



>gb|KCW74933.1| hypothetical protein EUGRSUZ_E03678 [Eucalyptus grandis]
Length=534

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++P+++   +H +  V WLPV+  +R LRK+   +IFS  KLD NQ LR++K+QEL+
Sbjct  136  NRTVPNSITAHDHDKLGVPWLPVSPLFRNLRKVYKLHIFSSKKLDLNQHLRSKKVQELV  194



>ref|XP_006423622.1| hypothetical protein CICLE_v10028275mg [Citrus clementina]
 gb|ESR36862.1| hypothetical protein CICLE_v10028275mg [Citrus clementina]
 gb|KDO50048.1| hypothetical protein CISIN_1g011032mg [Citrus sinensis]
Length=495

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = -3

Query  176  RSIPDAV--RGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R +P+++  +   H +FS+VWLPV++ WR+ RKI N  IF+  KLD +Q LR +KI++L+
Sbjct  99   RKVPESILSQPYRHHEFSLVWLPVSTLWRSFRKICNMYIFTSQKLDASQDLRRKKIKDLL  158



>ref|XP_010057714.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
 gb|KCW74934.1| hypothetical protein EUGRSUZ_E03679 [Eucalyptus grandis]
Length=499

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++P ++   +H +  + WLPV+  +R LRK+ + +IFS  KLD NQ LR++K+QEL+
Sbjct  101  NRTVPSSITAHDHDKLGLPWLPVSPLFRNLRKVYSLHIFSSKKLDLNQHLRSKKVQELV  159



>ref|XP_010057720.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
 gb|KCW74941.1| hypothetical protein EUGRSUZ_E03685 [Eucalyptus grandis]
Length=454

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++P+++   +H +  + WLPV+  +R L+K+ N +IFS  KLD NQ LR++K+QEL+
Sbjct  101  NRTVPNSITAHDHDKLGLPWLPVSPLFRNLKKVYNLHIFSSKKLDLNQHLRSKKVQELV  159



>ref|XP_006423677.1| hypothetical protein CICLE_v10028488mg [Citrus clementina]
 gb|ESR36917.1| hypothetical protein CICLE_v10028488mg [Citrus clementina]
Length=434

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 42/59 (71%), Gaps = 2/59 (3%)
 Frame = -3

Query  173  SIPDAV--RGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
             +P+++  +   H +FS+VWLPV+  WR+LRKI N +IF+  KLD NQ LR +KI+ L+
Sbjct  97   CVPESILSQPYQHHEFSLVWLPVSPLWRSLRKICNMHIFTNQKLDDNQDLRRKKIKGLL  155



>ref|XP_004152069.1| PREDICTED: geraniol 8-hydroxylase-like [Cucumis sativus]
Length=493

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R +PDA+   +H +    W+PV+S WR  RKI N+ +F+G  LD N+ LR +K++EL+
Sbjct  97   NRVVPDALTAHSHHEVGFPWIPVSSLWRNYRKICNNTLFAGKILDMNENLRRKKVEELV  155



>gb|ABC59105.1| cytochrome P450 monooxygenase CYP76X2 [Medicago truncatula]
Length=432

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            RS+PD     NH  FS+V+LP +  W+ LRKI ++N+FS   LD +Q+LR RK+++L+
Sbjct  101  RSVPDNTTTHNHNNFSLVFLPFSPLWQHLRKICHNNLFSTKTLDGSQELRRRKLKDLL  158



>ref|XP_009397045.1| PREDICTED: geraniol 8-hydroxylase-like, partial [Musa acuminata 
subsp. malaccensis]
Length=266

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = -3

Query  170  IPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            IP+AVR   H + S+VWLP    WR LR+I  + +F+  +LD+ Q LR  K+QEL+
Sbjct  105  IPEAVRVLAHSEASMVWLPPCQRWRNLRRICKTQLFTAQRLDSYQSLRREKVQELM  160



>ref|XP_008447356.1| PREDICTED: geraniol 8-hydroxylase-like [Cucumis melo]
Length=496

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R +P+A+   +H Q    W+PV+  WR  RKI N+ +F+G  LDTN+ LR +K++EL+
Sbjct  98   NRVVPEALTAHSHDQLGFPWIPVSPLWRNYRKICNNKLFAGKILDTNENLRRKKVEELV  156



>ref|XP_003628244.1| Cytochrome P450 [Medicago truncatula]
Length=496

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++PDA+   NH Q+S+ ++ V+  WR LRKI N+ +F+   LD++Q LR RK+Q+L+
Sbjct  107  NRTVPDALSVLNHDQYSLSFMRVSPRWRDLRKICNNQLFANKTLDSSQALRRRKLQDLL  165



>gb|KHG15916.1| 7-ethoxycoumarin O-deethylase [Gossypium arboreum]
Length=150

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -3

Query  164  DAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            DA+R   H +  + W+PV+  WR LRK+ N+ IF+  K+DT   LR  KIQELI
Sbjct  65   DAIRACQHHEVWLTWIPVSPLWRTLRKVCNTRIFASMKVDTTLYLRRNKIQELI  118



>ref|XP_006346655.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=515

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = -3

Query  164  DAVRGTNHFQFSVVWLPVASSWRA-LRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            DA+   +H QFSV++LP +SS R  +RK+++S+IFS N+LD  Q LRARKI+ELI
Sbjct  109  DALHAHDHNQFSVIFLPASSSRRKYVRKLLHSSIFSPNRLDAGQHLRARKIEELI  163



>ref|XP_006487694.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=495

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = -3

Query  176  RSIPDAVRGTNHF--QFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R +P+AV    +   +FS+VW+PV++ W+ LRKI N++IF+  KLD NQ LR  KI++L+
Sbjct  99   RKVPEAVMSKTYRRNEFSLVWMPVSALWKNLRKICNTHIFTNQKLDANQDLRRNKIKDLL  158



>gb|KDO36667.1| hypothetical protein CISIN_1g011040mg [Citrus sinensis]
Length=495

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = -3

Query  176  RSIPDAVRGTNHF--QFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R +P+AV    +   +FS+VW+PV++ W+ LRKI N++IF+  KLD NQ LR  KI++L+
Sbjct  99   RKVPEAVMSKTYRRNEFSLVWMPVSALWKNLRKICNTHIFTNQKLDANQDLRRNKIKDLL  158



>ref|XP_008389819.1| PREDICTED: geraniol 8-hydroxylase-like [Malus domestica]
Length=502

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++PDA++  +  Q S+ W+PV+  WR LRKI N+ +F+   LD NQ  R  K+QELI
Sbjct  99   NRTVPDAIQACDLRQDSLPWIPVSEKWRNLRKICNNQLFATKVLDANQANRHLKVQELI  157



>ref|XP_006388387.1| hypothetical protein POPTR_0201s00200g [Populus trichocarpa]
 gb|ERP47301.1| hypothetical protein POPTR_0201s00200g [Populus trichocarpa]
Length=496

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 43/58 (74%), Gaps = 2/58 (3%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R++PDAVRG  H + S++WLP +S W+ L+K+  + +F+  +LD ++ LR +K+QEL+
Sbjct  102  RTVPDAVRG--HHKNSILWLPASSHWKFLKKLTATQMFTSQRLDASRALRGKKVQELL  157



>ref|XP_004983330.1| PREDICTED: geraniol 8-hydroxylase-like [Setaria italica]
Length=498

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 43/59 (73%), Gaps = 2/59 (3%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +RS+PDAV   +H + SV WLP ++ WRALRKI+ + +F+ ++LD  Q LR  K+QEL+
Sbjct  99   NRSVPDAV--GDHARNSVPWLPHSARWRALRKIMATELFAPHRLDALQGLRCEKVQELV  155



>ref|XP_008447650.1| PREDICTED: geraniol 8-hydroxylase-like [Cucumis melo]
Length=191

 Score = 59.3 bits (142),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R+IPDA+   +H +    W+PV+  WR  RKI N+ +F+   LD N+ LR +K++EL+
Sbjct  96   NRTIPDALTAHSHHEVGFPWIPVSPLWRNYRKICNNTLFAAKILDMNENLRRKKVEELV  154



>ref|XP_006362198.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=499

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -3

Query  164  DAVRGTNHFQFSVVWLPVASSWRA-LRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            DAV   NH + SVVWLPV S  R  LR ++NS IFS  KLD NQ LR+ KI ELI
Sbjct  101  DAVEAHNHHKLSVVWLPVDSIRRKNLRAVVNSCIFSTKKLDANQNLRSTKISELI  155



>gb|AFK40472.1| unknown [Lotus japonicus]
Length=318

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R+IP A+   NH QF V +LP++  W+ +R++  + +FS   LD NQ LR +K+QEL+
Sbjct  99   RTIPHALTAFNHHQFGVGFLPLSPLWKDMRRVCKNQLFSVKSLDANQDLRRKKVQELL  156



>ref|XP_008222068.1| PREDICTED: geraniol 8-hydroxylase-like [Prunus mume]
Length=506

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++PDA++  +  Q S+ W+P ++ WR+LR+I NS +F+   LD NQ  R  K+QELI
Sbjct  102  NRTVPDAIQACDPRQDSLPWIPPSAKWRSLRQICNSQLFAAKILDANQPNRCVKVQELI  160



>ref|XP_008389814.1| PREDICTED: geraniol 8-hydroxylase-like [Malus domestica]
Length=504

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++PDA++  +  Q S+ W+PV+  WR LRKI N+ +F+   LD NQ  R  K+QELI
Sbjct  98   NRTVPDAIQACDLRQDSLPWIPVSEKWRNLRKICNNQLFATKVLDANQANRHLKVQELI  156



>ref|XP_010057717.1| PREDICTED: geraniol 8-hydroxylase-like, partial [Eucalyptus grandis]
Length=463

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 24/59 (41%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++P+++   +H +  + WLPV+  ++ LRK+ N +IFS  KLD NQ LR++K++EL+
Sbjct  65   NRTVPNSITAHDHDKLGLPWLPVSPLFQNLRKVYNLHIFSSKKLDLNQHLRSKKVRELV  123



>ref|XP_006423653.1| hypothetical protein CICLE_v10028270mg [Citrus clementina]
 gb|ESR36893.1| hypothetical protein CICLE_v10028270mg [Citrus clementina]
Length=495

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = -3

Query  176  RSIPDAVRGTNHF--QFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R +P+A+    +   +FS+VW+PV++ W+ LRKI N++IF+  KLD NQ LR  KI++L+
Sbjct  99   RKVPEAIMSKTYRRNEFSLVWMPVSALWKNLRKICNTHIFTNQKLDANQDLRRNKIKDLL  158



>gb|AAS92624.1| cytochrome P450 [Hypericum androsaemum]
Length=498

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 24/59 (41%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R I DA+R   H +  + W+PV  +WR  RK+  S+IF+  KL+++Q +R R IQ+L+
Sbjct  103  NRYIIDAIRAQGHHEAGLAWVPVGPTWRKFRKVCYSHIFTNQKLNSSQHVRQRTIQQLL  161



>ref|XP_010057762.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
Length=499

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -3

Query  179  HRSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            +R++P ++   +H +  + WLPV   +R LRK+ + +IFS  KLD NQ LR++K+QEL+
Sbjct  101  NRTVPSSITAHDHDKLGLPWLPVLPLFRNLRKVYSLHIFSSKKLDLNQHLRSKKVQELV  159



>gb|KHN20460.1| Cytochrome P450 76C4 [Glycine soja]
Length=287

 Score = 59.7 bits (143),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R+IP +V+  +H +FS+VWLP +  WR LR++  + +FS   LD+ Q LR +K+ +L+
Sbjct  98   RTIPHSVQALDHHRFSIVWLPPSPKWRNLRRVCATKVFSPQLLDSTQILRQQKVHDLL  155



>ref|XP_006603565.1| PREDICTED: geraniol 8-hydroxylase-like [Glycine max]
Length=287

 Score = 59.7 bits (143),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R+IP +V+  +H +FS+VWLP +  WR LR++  + +FS   LD+ Q LR +K+ +L+
Sbjct  98   RTIPHSVQALDHHRFSIVWLPPSPKWRNLRRVCATKVFSPQLLDSTQILRQQKVHDLL  155



>ref|XP_003614649.1| Cytochrome P450 71D95 [Medicago truncatula]
 gb|AES97607.1| cytochrome P450 family protein [Medicago truncatula]
Length=425

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R++PDA +   H + S+VW+P ++ WR LRK   + IFS  +LD+ +  R RK+Q+LI
Sbjct  64   RTVPDAAKTLGHDKVSMVWIPPSAKWRTLRKACATKIFSSQQLDSTKFHRKRKVQDLI  121



>ref|XP_010053379.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
Length=498

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R+IPD+V      +  + W+PV+  WR LRKI N +IFS  KL+ NQ +R  K+QEL+
Sbjct  101  RTIPDSVTALRQNELGLPWIPVSPLWRNLRKICNLHIFSHKKLEANQHIRQEKVQELL  158



>gb|KCW77657.1| hypothetical protein EUGRSUZ_D01955 [Eucalyptus grandis]
Length=487

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R+IPD+V      +  + W+PV+  WR LRKI N +IFS  KL+ NQ +R  K+QEL+
Sbjct  101  RTIPDSVTALRQNELGLPWIPVSPLWRNLRKICNLHIFSHKKLEANQHIRQEKVQELL  158



>ref|XP_006423660.1| hypothetical protein CICLE_v10030225mg, partial [Citrus clementina]
 gb|ESR36900.1| hypothetical protein CICLE_v10030225mg, partial [Citrus clementina]
Length=483

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = -3

Query  176  RSIPDAV--RGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R +P+++  +   H +FS+VWLP+++ WR+ RK+ N +IF+  KLD +Q LR +K+++L+
Sbjct  81   RKVPESILSQPYRHHEFSLVWLPISTLWRSYRKMCNMHIFTSQKLDASQDLRRKKMKDLL  140



>ref|XP_010053380.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
 gb|KCW77658.1| hypothetical protein EUGRSUZ_D01956 [Eucalyptus grandis]
Length=498

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  RSIPDAVRGTNHFQFSVVWLPVASSWRALRKIINSNIFSGNKLDTNQQLRARKIQELI  3
            R+IPD++      +  + W+PV+  WR LRKI N +IFS  KL+ NQ +R  KIQEL+
Sbjct  101  RTIPDSITALRQNELGLPWIPVSPLWRNLRKICNLHIFSHKKLEANQHIRQEKIQELL  158



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 508434916518