BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c119595_g1_i1 len=172 path=[150:0-171]

Length=172
                                                                      Score     E

emb|CAA81749.1|  1-aminocyclopropane-1-carboxylate synthase             121   5e-31   Solanum tuberosum [potatoes]
ref|XP_009778720.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    120   9e-31   
ref|XP_009629400.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    120   9e-31   
emb|CBI27945.3|  unnamed protein product                                119   1e-30   
ref|XP_004242974.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    120   1e-30   
gb|EYU30660.1|  hypothetical protein MIMGU_mgv1a006645mg                119   2e-30   
ref|XP_002279881.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    119   2e-30   Vitis vinifera
ref|XP_010090013.1|  1-aminocyclopropane-1-carboxylate synthase 7       119   2e-30   
emb|CAN66901.1|  hypothetical protein VITISV_029694                     119   2e-30   Vitis vinifera
gb|AAK94922.1|  ripening-related ACC synthase                           118   3e-30   Annona x atemoya [atemoya]
ref|XP_011078426.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    119   3e-30   
gb|KHM99840.1|  1-aminocyclopropane-1-carboxylate synthase 7            118   4e-30   
gb|EYU41606.1|  hypothetical protein MIMGU_mgv1a018671mg                118   4e-30   
emb|CAB86187.1|  1-aminocyclopropane-1-carboxylate synthase             118   4e-30   Carica papaya [mamon]
ref|XP_006580895.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    118   4e-30   
gb|KHN16675.1|  1-aminocyclopropane-1-carboxylate synthase 7            117   5e-30   
ref|XP_009771829.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    118   5e-30   
ref|XP_008242429.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    118   6e-30   
ref|XP_007201928.1|  hypothetical protein PRUPE_ppa022214mg             118   6e-30   
ref|XP_003530532.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    118   7e-30   
ref|XP_008387640.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   1e-29   
ref|XP_009589682.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   1e-29   
gb|KDP33744.1|  hypothetical protein JCGZ_07315                         117   1e-29   
dbj|BAA76388.1|  1-aminocyclopropane -1-carboxylate synthase            117   1e-29   Pyrus pyrifolia [sha li]
ref|XP_010925479.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   1e-29   
gb|KHN32906.1|  1-aminocyclopropane-1-carboxylate synthase 7            117   1e-29   
ref|XP_010262212.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   1e-29   
ref|XP_010262213.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   1e-29   
gb|AAM80890.1|  1-aminocyclopropane-1-carboxylate synthase              116   2e-29   Betula pendula [white birch]
ref|XP_006371987.1|  1-aminocyclopropene-1-carboxylate synthase 3...    117   2e-29   
ref|XP_011013607.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   2e-29   
ref|XP_009352610.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   2e-29   
emb|CAA78123.1|  ACC synthase                                           116   2e-29   Vigna radiata var. radiata [golden gram]
gb|AFA25803.1|  ACC synthase                                            117   2e-29   
ref|XP_002869623.1|  1-amino-cyclopropane-1-carboxylate synthase 7      117   2e-29   
ref|XP_007160245.1|  hypothetical protein PHAVU_002G305000g             117   2e-29   
gb|AAS17855.1|  1-aminocyclopropane-1-carboxylate synthase              111   2e-29   Rosa hybrid cultivar
ref|XP_006573922.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   2e-29   
ref|XP_010915315.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   2e-29   
gb|AAR38503.1|  1-aminocyclopropane-1-carboxylate synthase 2b           116   2e-29   Pyrus communis
ref|NP_194350.1|  1-aminocyclopropane-1-carboxylate synthase 7          116   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007152930.1|  hypothetical protein PHAVU_004G172300g             116   3e-29   
gb|ACT78959.1|  1-aminocyclopropane-1-carboxylate synthase              116   3e-29   Cucumis sativus [cucumbers]
ref|XP_010313742.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    116   3e-29   
emb|CAA78122.1|  ACC synthase                                           115   3e-29   Vigna radiata var. radiata [golden gram]
ref|XP_002308289.1|  1-aminocyclopropene-1-carboxylate synthase 3...    116   3e-29   Populus trichocarpa [western balsam poplar]
ref|XP_004170907.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    116   3e-29   
ref|XP_004288918.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    116   3e-29   
ref|XP_010448309.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    116   3e-29   
ref|XP_006285008.1|  hypothetical protein CARUB_v10006315mg             116   3e-29   
dbj|BAF79596.1|  1-aminocyclopropane-1-carboxylate synthase             116   3e-29   Cucumis sativus [cucumbers]
gb|AAP14020.1|AF380837_1  putative ACC synthase 2                       116   3e-29   Lactuca sativa [cultivated lettuce]
ref|XP_011094001.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    116   3e-29   
ref|XP_008793196.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    116   3e-29   
ref|XP_011078213.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    115   4e-29   
ref|XP_007202323.1|  hypothetical protein PRUPE_ppa008124mg             115   4e-29   
ref|XP_008450824.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    115   4e-29   
ref|XP_002514161.1|  acc synthase, putative                             115   4e-29   Ricinus communis
gb|KGN66211.1|  hypothetical protein Csa_1G580750                       115   4e-29   
gb|ACG70849.1|  1-aminocyclopropane-1-carboxylic acid synthase          115   4e-29   Cucumis melo [Oriental melon]
ref|XP_011004709.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    115   4e-29   
ref|XP_008367258.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    115   5e-29   
gb|AAB67989.1|  ACC synthase                                            115   5e-29   Malus domestica [apple tree]
ref|XP_006353581.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    115   5e-29   
ref|XP_010433537.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    115   5e-29   
emb|CDY71142.1|  BnaCnng71530D                                          115   5e-29   
gb|AEP82201.1|  1-aminocyclopropane-1-carboxylic acid synthase 3a-2     115   5e-29   
gb|AEP82200.1|  1-aminocyclopropane-1-carboxylic acid synthase 3a-1     115   5e-29   
ref|XP_008391508.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    115   5e-29   
dbj|BAE94691.1|  1-aminocyclopropane-1-carboxylic acid synthase 3b      115   5e-29   Malus domestica [apple tree]
gb|AAF61233.1|AF239663_1  ACC synthase                                  115   6e-29   Prunus persica
ref|XP_007012906.1|  1-amino-cyclopropane-1-carboxylate synthase 7      116   6e-29   
gb|AAX09641.1|  ACS3                                                    115   6e-29   Malus domestica [apple tree]
emb|CDX89355.1|  BnaA01g15380D                                          115   6e-29   
emb|CDX94359.1|  BnaC01g18250D                                          115   6e-29   
ref|XP_006451409.1|  hypothetical protein CICLE_v10010572mg             115   7e-29   
ref|XP_010438788.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    115   7e-29   
ref|XP_008242430.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    115   7e-29   
gb|AAF22112.1|AF119414_1  1-aminocyclopropane-1-carboxylate synth...    115   7e-29   Lupinus albus
ref|XP_009142057.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    115   8e-29   
ref|XP_003530192.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    115   8e-29   
gb|AEI84820.1|  1-aminocyclopropane-1-carboxylate synthase 3            114   9e-29   
gb|AAC70352.2|  ACC synthase 2                                          114   9e-29   Antirrhinum majus [garden snapdragon]
ref|XP_003630647.1|  1-aminocyclopropane-1-carboxylate synthase         114   1e-28   
gb|AET05123.2|  1-aminocyclopropane-1-carboxylate synthase              114   1e-28   
gb|KEH21318.1|  1-aminocyclopropane-1-carboxylate synthase              114   1e-28   
dbj|BAA37134.1|  ACC synthase                                           114   1e-28   Passiflora edulis [passion fruit]
ref|XP_006475545.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    114   1e-28   
ref|XP_010666828.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    113   2e-28   
dbj|BAE94692.1|  1-aminocyclopropane-1-carboxylic acid synthase 3c      114   2e-28   Malus domestica [apple tree]
ref|XP_009137583.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    114   2e-28   
ref|XP_010536854.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    113   3e-28   
gb|AAR12136.1|  1-aminocyclopropene-1-carboxylate synthase 3a           113   3e-28   Pyrus communis
gb|ABR53738.1|  1-aminocyclopropane-1-carboxylate synthase 3            112   3e-28   Linum usitatissimum
gb|ABR53736.1|  1-aminocyclopropane-1-carboxylate synthase 1            112   4e-28   Linum usitatissimum
gb|ABR53737.1|  1-aminocyclopropane-1-carboxylate synthase 2            112   4e-28   Linum usitatissimum
ref|XP_004513132.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    113   4e-28   
ref|XP_004502555.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    113   4e-28   
ref|XP_004503531.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    113   4e-28   
gb|KFK29127.1|  hypothetical protein AALP_AA7G092400                    112   5e-28   
ref|XP_010666827.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    112   5e-28   
ref|XP_008387653.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    112   6e-28   
ref|XP_004135814.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    109   6e-28   
ref|XP_008344120.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    112   6e-28   
gb|AAB67882.1|  ACC synthase                                            112   6e-28   Dendrobium crumenatum
gb|AAF22108.1|AF119410_1  1-aminocyclopropane-1-carboxylate synth...    112   7e-28   Lupinus albus
emb|CAI64501.1|  1-aminocyclopropane-1-carboxylate synthase             112   7e-28   Prunus domestica subsp. insititia [damson plum]
gb|ABW03082.1|  1-aminocyclopropane 1-carboxylate synthase 3            112   9e-28   Prunus salicina [Japanese plum]
ref|XP_006413217.1|  hypothetical protein EUTSA_v10027427mg             112   9e-28   
gb|ABO76788.1|  1-aminocyclopropane-1-carboxylate synthase              108   1e-27   Citrullus colocynthis x Citrullus lanatus var. lanatus
ref|XP_009381856.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    111   2e-27   
gb|AAS17854.1|  1-aminocyclopropane-1-carboxylate synthase              107   2e-27   Rosa hybrid cultivar
gb|AAL37503.1|AF338651_1  ACC synthase                                  110   2e-27   Brassica oleracea var. italica [asparagus broccoli]
gb|AGE15420.1|  1-aminocyclopropane-1-carboxylate synthase              111   2e-27   
gb|AAU10812.1|  putative 1-aminocyclopropane-1-carboxylate synthase     110   3e-27   Oryza sativa Japonica Group [Japonica rice]
emb|CDY72652.1|  BnaCnng78650D                                          107   3e-27   
gb|ACY72181.1|  ACC synthase                                            110   4e-27   Dendrobium hybrid cultivar
ref|XP_010267362.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    110   4e-27   
gb|AAG12247.1|AF184078_1  ACC synthase                                  109   4e-27   Prunus armeniaca
gb|ABO68835.2|  1-aminocyclopropane-1-carboxylate synthase              110   4e-27   Dendrobium hybrid cultivar
ref|XP_006643867.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    110   5e-27   
ref|XP_009397466.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    109   6e-27   
gb|AAL66201.1|AF386519_1  1-aminocyclopropane 1-carboxylate synth...    110   6e-27   Pyrus communis
gb|AFL91700.1|  1-aminocyclopropane-1-carboxylate synthase 3            108   7e-27   
ref|XP_003620879.1|  1-aminocyclopropane-1-carboxylate synthase         109   7e-27   
ref|XP_002455019.1|  hypothetical protein SORBIDRAFT_03g003070          109   8e-27   Sorghum bicolor [broomcorn]
ref|XP_004968508.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    109   8e-27   
ref|XP_004968507.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    109   9e-27   
gb|AHN49645.1|  1-aminocyclopropane-1-carboxylate synthase              109   1e-26   
gb|AGB13769.1|  ACC synthase                                            109   1e-26   
gb|ADZ96244.1|  ACC synthase 2                                          109   1e-26   
gb|AAR88653.1|  1-aminocyclopropane-1-carboxylate synthase              108   2e-26   Cattleya bicolor
ref|XP_004963524.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    108   3e-26   
emb|CAB01401.1|  1-aminocyclopropane-carboxylate synthase homologue     107   4e-26   Phalaenopsis hybrid cultivar
emb|CDM81650.1|  unnamed protein product                                107   4e-26   
gb|EMT29346.1|  1-aminocyclopropane-1-carboxylate synthase 7            107   4e-26   
gb|AFO63005.1|  ACC synthase                                            107   4e-26   
gb|EMS52267.1|  1-aminocyclopropane-1-carboxylate synthase 7            107   4e-26   
gb|AID66718.1|  1-aminocyclopropane-1-carboxylate synthase 7            106   7e-26   
gb|ABO68836.2|  1-aminocyclopropane-1-carboxylate synthase              107   7e-26   Dendrobium hybrid cultivar
tpg|DAA53016.1|  TPA: hypothetical protein ZEAMMB73_777642              107   8e-26   
ref|XP_006837379.1|  hypothetical protein AMTR_s00111p00124560          106   9e-26   
dbj|BAC66951.1|  ACC synthase                                           106   1e-25   Striga hermonthica [purple witchweed]
gb|EEE54037.1|  hypothetical protein OsJ_00716                          104   3e-25   Oryza sativa Japonica Group [Japonica rice]
emb|CAA65776.1|  1-aminocyclopropane-1-carboxylic acid synthase         104   5e-25   Oryza sativa [red rice]
ref|NP_001042279.1|  Os01g0192900                                       104   5e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006655071.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    103   5e-25   
gb|EAY72868.1|  hypothetical protein OsI_00740                          104   6e-25   Oryza sativa Indica Group [Indian rice]
emb|CDX92755.1|  BnaC07g40130D                                          103   8e-25   
gb|AAR00507.1|  1-aminocyclopropane-1-carboxylate synthase              103   8e-25   Phalaenopsis hybrid cultivar
gb|AAB05849.1|  1-aminocyclopropane-1-carboxylate synthase              103   9e-25   x Doritaenopsis sp.
emb|CDP03198.1|  unnamed protein product                                102   1e-24   
ref|XP_010050459.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    103   1e-24   
gb|AAR11524.1|  1-aminocyclopropane-1-carboxylate synthase 2            102   2e-24   Pinus sylvestris [Scotch pine]
emb|CAA11158.1|  ACC syntase                                            102   2e-24   Musa acuminata [banana]
ref|XP_003564782.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    102   3e-24   
gb|ABM60747.1|  ACC synthase                                            102   5e-24   Picea glauca
ref|XP_006655194.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    102   7e-24   
gb|AAL35386.1|  ACC synthase                                            100   8e-24   Annona cherimola [cherimoya]
gb|EEE63240.1|  hypothetical protein OsJ_18050                          100   2e-23   Oryza sativa Japonica Group [Japonica rice]
gb|AAV44081.1|  putative 1-aminocyclopropane-1-carboxylate synthase     100   3e-23   Oryza sativa Japonica Group [Japonica rice]
gb|EAY97524.1|  hypothetical protein OsI_19452                          100   3e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_006829176.1|  hypothetical protein AMTR_s00001p00270760        99.8    4e-23   
gb|ACZ54911.3|  1-aminocyclopropane-1-carboxylic acid synthase        99.8    4e-23   Narcissus tazetta subsp. chinensis
gb|AAM21682.1|AF500119_1  1-aminocyclopropane-1-carboxylate synth...  99.4    8e-23   Persea americana
gb|AAM80889.1|  1-aminocyclopropane-1-carboxylate synthase            97.4    1e-22   Betula pendula [white birch]
dbj|BAA34923.1|  1-aminocyclopropane-1-carboxylate synthase           98.6    1e-22   Solanum lycopersicum
ref|NP_001234164.1|  1-aminocyclopropane-1-carboxylate synthase       98.2    2e-22   
dbj|BAA25916.1|  1-aminocyclopropane-1-carboxylate synthase           98.2    2e-22   Solanum lycopersicum
ref|XP_006853996.1|  hypothetical protein AMTR_s00036p00235090        97.1    2e-22   
gb|AAB67988.1|  ACC synthase                                          96.7    2e-22   Malus domestica [apple tree]
gb|AAB96880.1|  1-aminocyclopropane-1-carboxylate synthase            96.7    2e-22   Solanum tuberosum [potatoes]
gb|AAD33789.1|AF144746_1  1-aminocyclopropane-1-carboxylate synthase  96.3    3e-22   Solanum melongena [aubergine]
gb|AAB05848.1|  1-aminocyclopropane-1-carboxylate synthase            96.7    3e-22   x Doritaenopsis sp.
pdb|1IAX|A  Chain A, Crystal Structure Of Acc Synthase Complexed ...  96.3    5e-22   
gb|AAC41663.1|  1-aminocyclopropane-1-carboxylate synthase            96.7    5e-22   Solanum tuberosum [potatoes]
ref|XP_010503635.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  96.7    5e-22   
ref|XP_010053217.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  97.1    6e-22   
gb|AAR11523.1|  1-aminocyclopropane-1-carboxylate synthase 1          95.5    6e-22   Pinus sylvestris [Scotch pine]
emb|CAD44993.1|  putative 1-aminocyclopropane-1-carboxylate synthase  94.7    6e-22   Solanum lycopersicum
emb|CAA44397.1|  1-aminocyclopropane 1-carboxylate synthase           96.7    6e-22   Solanum lycopersicum
gb|AAA81580.1|  1-aminocyclopropane-1-carboxylate synthase            96.7    7e-22   Solanum lycopersicum
emb|CAA41856.1|  1-aminocyclopropane 1-carboxylate synthase           96.7    7e-22   Solanum lycopersicum
sp|P18485.2|1A12_SOLLC  RecName: Full=1-aminocyclopropane-1-carbo...  96.7    7e-22   Solanum lycopersicum
ref|NP_001234178.1|  1-aminocyclopropane-1-carboxylate synthase 2     96.7    7e-22   
ref|XP_006343931.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  96.7    7e-22   
dbj|BAB89349.1|  1-aminocyclopropane-1-carboxylate synthase           96.7    7e-22   Diospyros kaki [Japanese persimmon]
ref|XP_003622479.1|  1-aminocyclopropane-1-carboxylate synthase       96.3    8e-22   
ref|NP_001275367.1|  1-aminocyclopropane-1-carboxylate synthase       96.7    8e-22   
gb|AAT84611.1|  ACC synthase ALSACS2-1                                92.4    8e-22   Alstroemeria peruviana
dbj|BAG30910.1|  ACC synthase                                         96.3    1e-21   Capsicum chinense [bonnet pepper]
emb|CAA57716.1|  1-aminocyclopropane-1-carboxylate synthase           94.7    1e-21   Capsicum annuum
gb|AAF97615.1|U18057_1  1-amino-cyclopropane-1-carboxylate synthase   95.9    1e-21   Solanum lycopersicum
ref|XP_006339629.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  95.9    1e-21   
gb|AAF97614.1|U18056_1  1-amino-cyclopropane-1-carboxylate synthase   95.9    1e-21   Solanum lycopersicum
ref|NP_001233922.1|  1-aminocyclopropane-1-carboxylate synthase       95.9    1e-21   
ref|NP_001266271.1|  1-aminocyclopropane-1-carboxylate synthase-like  95.9    1e-21   
gb|AEI60174.1|  1-aminocyclopropane-1-carboxylate synthase            94.4    2e-21   
emb|CDP08761.1|  unnamed protein product                              95.1    2e-21   
ref|XP_006343930.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  95.5    2e-21   
gb|AEM65195.1|  ACC synthase                                          94.4    2e-21   
ref|XP_009590053.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  95.1    3e-21   
gb|ACI32113.1|  1-aminocyclopropane-1-carboxylate synthase            91.7    3e-21   Musa acuminata AAA Group [Cavendish banana]
gb|AAC32840.1|  1-aminocyclopropane-1-carboxylate synthase 5          92.8    3e-21   Sinapis arvensis [charlock mustard]
emb|CDX81296.1|  BnaC09g07070D                                        94.4    3e-21   
emb|CDY18674.1|  BnaA09g07210D                                        94.4    3e-21   
gb|AAR99393.1|  ACC synthase ACS3b                                    94.7    3e-21   Nicotiana attenuata
dbj|BAF33503.1|  ACC synthase                                         94.7    3e-21   Orobanche minor
ref|XP_009771943.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  94.7    4e-21   
gb|AAC32839.1|  1-aminocyclopropane-1-carboxylate synthase 4          92.4    4e-21   Sinapis arvensis [charlock mustard]
ref|XP_006292599.1|  hypothetical protein CARUB_v10018840mg           94.7    4e-21   
ref|XP_010484425.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  94.4    4e-21   
ref|XP_010463583.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  94.4    4e-21   
ref|XP_009112200.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  94.4    4e-21   
ref|XP_009130528.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  94.4    4e-21   
gb|KFK28459.1|  hypothetical protein AALP_AA8G517100                  94.4    4e-21   
ref|XP_006393985.1|  hypothetical protein EUTSA_v10004145mg           94.4    4e-21   
ref|XP_006280412.1|  hypothetical protein CARUB_v10026345mg           94.4    4e-21   
ref|NP_201381.1|  1-aminocyclopropane-1-carboxylate synthase 5        94.4    4e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010444599.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  94.4    4e-21   
gb|AAC70351.2|  ACC synthase 1                                        92.8    5e-21   Antirrhinum majus [garden snapdragon]
gb|AAL50560.1|  1-aminocyclopropane-1-carboxylate synthase 9          89.0    5e-21   Nicotiana tabacum [American tobacco]
gb|AAC32838.1|  1-aminocyclopropane-1-carboxylate synthase 3          92.0    5e-21   Sinapis arvensis [charlock mustard]
emb|CDY23035.1|  BnaC07g31520D                                        94.0    5e-21   
ref|XP_010515330.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  94.0    6e-21   
emb|CDY05953.1|  BnaC08g21300D                                        94.0    6e-21   
emb|CDY08163.1|  BnaA06g15630D                                        94.0    6e-21   
ref|XP_010426493.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  94.0    6e-21   
ref|XP_009136516.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  94.0    6e-21   
ref|NP_190539.1|  1-aminocyclopropane-1-carboxylate synthase 9        94.0    6e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006293030.1|  hypothetical protein CARUB_v10019310mg           94.0    6e-21   
ref|XP_002877694.1|  hypothetical protein ARALYDRAFT_348080           94.0    6e-21   
ref|XP_011023276.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  94.0    6e-21   
emb|CAD44267.2|  putative aminocyclopropane carboxylic acid synthase  94.0    6e-21   Musa acuminata [banana]
gb|KHG22476.1|  1-aminocyclopropane-1-carboxylate synthase            94.0    7e-21   
gb|AAC70353.2|  ACC synthase 3                                        93.2    7e-21   Antirrhinum majus [garden snapdragon]
ref|XP_004492797.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  94.0    7e-21   
gb|AES80302.2|  1-aminocyclopropane-1-carboxylate synthase            94.0    7e-21   
ref|XP_002271055.2|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  94.0    7e-21   Vitis vinifera
dbj|BAG30909.1|  ACC synthase                                         94.0    7e-21   Capsicum chinense [bonnet pepper]
ref|XP_010279043.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  94.0    7e-21   
ref|XP_006404112.1|  hypothetical protein EUTSA_v10011085mg           93.6    7e-21   
gb|ADF31934.1|  1-aminocyclopropane-1-carboxylate synthase 5          89.4    8e-21   
gb|ABJ99502.1|  1-aminocyclopropane-1-carboxylate synthase            93.6    8e-21   Gossypium hirsutum [American cotton]
emb|CAN77934.1|  hypothetical protein VITISV_021265                   93.6    8e-21   Vitis vinifera
ref|XP_009109390.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  93.6    8e-21   
emb|CDX69326.1|  BnaC01g01270D                                        93.6    8e-21   
emb|CDY69462.1|  BnaAnng30490D                                        93.6    8e-21   
gb|ABC75833.1|  1-aminocyclopropane-1-carboxylate synthase            93.6    8e-21   Gossypium hirsutum [American cotton]
ref|XP_010026543.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  93.6    9e-21   
ref|XP_009150670.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  93.6    9e-21   
emb|CDX75675.1|  BnaA01g00270D                                        93.2    1e-20   
ref|XP_003624084.1|  1-aminocyclopropane-1-carboxylate synthase       94.0    1e-20   
dbj|BAB89348.1|  1-aminocyclopropane-1-carboxylate synthase           93.2    1e-20   Diospyros kaki [Japanese persimmon]
gb|AAM80888.1|  1-aminocyclopropane-1-carboxylate synthase            93.6    1e-20   Betula pendula [white birch]
ref|XP_002866689.1|  hypothetical protein ARALYDRAFT_332796           93.2    1e-20   
gb|AAF97611.1|U17974_1  1-aminocyclopropane-1-carboxylate synthase    91.3    1e-20   Solanum lycopersicum
ref|XP_006360739.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  93.2    1e-20   
ref|XP_009133375.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  93.2    1e-20   
ref|XP_010261352.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  93.2    1e-20   
ref|XP_006598931.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  93.2    1e-20   
ref|XP_011029354.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  93.2    1e-20   
gb|KHG05668.1|  1-aminocyclopropane-1-carboxylate synthase            93.2    1e-20   
ref|XP_003552421.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  93.2    1e-20   
ref|XP_006472343.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  92.8    1e-20   
ref|XP_009590054.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  93.2    1e-20   
gb|ABK95257.1|  unknown                                               92.4    1e-20   Populus trichocarpa [western balsam poplar]
ref|XP_004510689.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  92.8    1e-20   
ref|XP_004252649.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  92.8    2e-20   
emb|CAA06288.1|  1-cyclopropane-1-carboxylate synthase                92.8    2e-20   Nicotiana tabacum [American tobacco]
emb|CAB86186.1|  1-aminocyclopropane-1-carboxylate synthase           91.7    2e-20   Carica papaya [mamon]
dbj|BAB47123.1|  ACC synthase                                         92.8    2e-20   Cucurbita maxima [Boston marrow]
ref|XP_004137286.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  92.4    2e-20   
ref|XP_002278489.2|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  92.8    2e-20   Vitis vinifera
ref|XP_010518692.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  92.8    2e-20   
ref|XP_010547570.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  92.8    2e-20   
emb|CAB76930.1|  ACC synthase                                         91.7    2e-20   Citrus sinensis [apfelsine]
gb|AFJ06625.1|  1-aminocyclopropane-1-carboxylic acid synthase        90.9    2e-20   
emb|CAA10063.1|  1-aminocyclopropane-1-carboxylate synthase           91.3    2e-20   Carica papaya [mamon]
emb|CDY66472.1|  BnaC03g76570D                                        91.7    2e-20   
gb|AER35096.1|  1-aminocyclopropane-1-carboxylate synthase            92.4    2e-20   
gb|KCW46264.1|  hypothetical protein EUGRSUZ_K00141                   90.9    2e-20   
ref|XP_007040349.1|  1-aminocyclopropane-1-carboxylate synthase i...  92.4    2e-20   
ref|XP_010676415.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  92.4    2e-20   
emb|CDP10864.1|  unnamed protein product                              92.0    2e-20   
gb|ACV33064.1|  1-aminocyclopropane-1-carboxylate synthase            92.4    2e-20   
gb|ACV30003.1|  ACC synthase family protein                           92.4    2e-20   
gb|AAC83147.1|  1-aminocyclopropane-1-carboxylate synthase            92.4    2e-20   
emb|CDP02644.1|  unnamed protein product                              92.4    2e-20   
ref|XP_009362620.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  92.4    2e-20   
gb|AAC31571.1|  1-aminocyclopropane-1-carboxylate synthase            92.4    2e-20   
gb|AAD53173.1|  1-aminocyclopropane-1-carboxylic acid synthase ACS1   91.7    2e-20   
gb|AAD22099.2|  1-aminocyclopropane-1-carboxylate synthase            92.4    2e-20   
gb|AAM74940.1|AF518327_1  1-aminocyclopropane-1-carboxylate synth...  90.9    2e-20   
gb|ABM60749.1|  ACC synthase                                          92.8    2e-20   
ref|XP_009397633.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  92.4    2e-20   
gb|AAO91942.1|  1-aminocyclopropane-1-carboxylate synthase            92.4    2e-20   
dbj|BAA84945.1|  ACC synthase                                         92.4    2e-20   
ref|XP_008342238.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...  92.4    2e-20   
gb|EYU44527.1|  hypothetical protein MIMGU_mgv1a019082mg              92.4    3e-20   
ref|XP_009149709.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  92.0    3e-20   
ref|XP_002298013.1|  1-aminocyclopropane-1-carboxylate synthase f...  92.4    3e-20   
gb|AES80303.2|  1-aminocyclopropane-1-carboxylate synthase            90.9    3e-20   
dbj|BAB89350.1|  1-aminocyclopropane-1-carboxylate synthase           92.4    3e-20   
ref|XP_006404746.1|  hypothetical protein EUTSA_v10000582mg           92.0    3e-20   
emb|CDP00998.1|  unnamed protein product                              91.7    3e-20   
dbj|BAA94599.1|  1-aminocyclopropane-1-carboxylate synthase           92.0    3e-20   
gb|AAF01279.1|  1-aminocyclopropane-1-carboxylate synthase            90.9    3e-20   
ref|NP_191710.1|  1-aminocyclopropane-1-carboxylate synthase          92.0    3e-20   
emb|CAA47174.1|  1-aminocyclopropane 1-carboxylate synthase           90.9    3e-20   
gb|ACU15501.1|  unknown                                               89.0    3e-20   
ref|XP_009626021.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  92.0    4e-20   
emb|CAA67118.1|  ACC synthase                                         92.0    4e-20   
gb|ABM60748.1|  ACC synthase                                          91.7    4e-20   
gb|ABM60750.1|  ACC synthase                                          92.0    4e-20   
ref|XP_002509858.1|  acc synthase, putative                           91.7    4e-20   
gb|AFD50699.1|  ACC synthase                                          89.4    4e-20   
gb|ABB40579.2|  1-aminocyclopropane-1-carboxylate synthase            92.0    4e-20   
ref|XP_009791163.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  91.7    4e-20   
gb|AAM74939.1|AF518326_1  1-aminocyclopropane-1-carboxylate synth...  90.5    4e-20   
ref|XP_009757887.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  91.7    4e-20   
gb|AAK83366.1|  1-aminocyclopropane-1-carboxylate synthase            86.7    4e-20   
pdb|3PIU|A  Chain A, High-Resolution Structure Of Native Malus Do...  90.9    4e-20   
gb|AAF22109.1|AF119411_1  1-aminocyclopropane-1-carboxylate synth...  91.7    4e-20   
dbj|BAA31137.1|  1-aminocyclopropane-1-carboxylate synthase           91.7    4e-20   
dbj|BAA28860.1|  1-aminocyclopropane-1-carboxylate synthase           90.5    4e-20   
gb|AAK83367.1|  1-aminocyclopropane-1-carboxylate synthase            86.7    4e-20   
gb|AAC05376.1|  1-aminocyclopropane-1-carboxylate synthase 3          90.9    4e-20   
ref|XP_010413389.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  91.7    5e-20   
gb|AFV50545.1|  1-aminocyclopropane-1-carboxylate synthase            89.7    5e-20   
gb|ABD16181.1|  1-aminocyclopropane-1-carboxylate synthase            91.3    5e-20   
gb|AAC15777.1|  ACC synthase                                          91.7    5e-20   
ref|XP_009776307.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  91.7    5e-20   
gb|AAR99392.1|  ACC synthase ACS3a                                    91.7    5e-20   
gb|AAC49154.1|  1-aminocyclopropane 1-carboxylate synthase            90.5    5e-20   
gb|AAA86471.1|  1-aminocyclopropane 1-carboxylate synthase            90.5    5e-20   
ref|XP_009759300.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  91.7    5e-20   
gb|ABW97851.1|  ACS5                                                  91.3    5e-20   
ref|XP_006855760.1|  hypothetical protein AMTR_s00044p00180330        91.3    5e-20   
ref|XP_010541198.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  91.7    5e-20   
ref|XP_006356827.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  91.3    5e-20   
pdb|1B8G|A  Chain A, 1-aminocyclopropane-1-carboxylate Synthase       90.9    5e-20   
emb|CDP12072.1|  unnamed protein product                              91.7    5e-20   
ref|XP_006364400.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  91.3    5e-20   
ref|XP_006364401.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  91.3    5e-20   
emb|CAA81748.1|  1-aminocyclopropane-1-carboxylate synthase           91.3    5e-20   
emb|CAA81747.1|  Amino cyclopropane carboxylate acid synthase         91.3    5e-20   
ref|XP_009624194.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  91.7    5e-20   
gb|KHG06607.1|  1-aminocyclopropane-1-carboxylate synthase            91.3    5e-20   
ref|XP_010555438.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  91.3    5e-20   
pdb|1M7Y|A  Chain A, Crystal Structure Of Apple Acc Synthase In C...  90.9    5e-20   
gb|KCW68601.1|  hypothetical protein EUGRSUZ_F02211                   90.9    6e-20   
ref|XP_010469085.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  91.3    6e-20   
gb|AAL50559.1|  1-aminocyclopropane-1-carboxylate synthase 6          86.3    6e-20   
ref|XP_010544767.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  91.3    6e-20   
ref|XP_011099419.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  91.3    6e-20   
ref|XP_011017064.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  89.4    6e-20   
emb|CAE53271.1|  1-aminocyclopropane-1-carboxylate synthase           91.3    6e-20   
ref|XP_007224106.1|  hypothetical protein PRUPE_ppa015636mg           90.9    6e-20   
ref|XP_009626433.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  91.3    6e-20   
gb|KDO76335.1|  hypothetical protein CISIN_1g011570mg                 91.3    6e-20   
dbj|BAA94600.1|  1-aminocyclopropane-1-carboxylate synthase           91.3    7e-20   
gb|AAP14019.1|AF380836_1  putative ACC synthase 1                     91.3    7e-20   
gb|AAG28795.1|  ACC synthase                                          90.9    7e-20   
gb|ACM48506.3|  1-aminocyclopropane-carboxylate synthase              90.9    7e-20   
gb|AAD28181.1|AF109927_1  1-aminocyclopropane-1-carboxylate synthase  91.3    7e-20   
gb|EYU23426.1|  hypothetical protein MIMGU_mgv1a010964mg              89.4    7e-20   
ref|XP_010061610.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  90.9    8e-20   
ref|XP_002510038.1|  acc synthase, putative                           90.9    8e-20   
gb|ABC69166.2|  1-aminocyclopropane-1-carboxylate synthase            91.3    8e-20   
sp|P37821.2|1A1C_MALDO  RecName: Full=1-aminocyclopropane-1-carbo...  90.9    8e-20   
gb|AGG19162.1|  ACC synthase                                          90.9    8e-20   
dbj|BAA35057.1|  1-aminocyclopropane-1-carboxylate synthase           90.9    8e-20   
dbj|BAF44094.1|  1-aminocyclopropane-1-carboxylate synthase           90.9    8e-20   
gb|ABA03056.1|  ACC synthase                                          90.9    8e-20   
ref|XP_009339376.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  90.9    8e-20   
ref|XP_008337023.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...  90.9    8e-20   
ref|NP_001275831.1|  1-aminocyclopropane-1-carboxylate synthase-like  90.9    8e-20   
gb|KHG14845.1|  1-aminocyclopropane-1-carboxylate synthase            90.9    8e-20   
prf||1808332A  aminocyclopropane carboxylate synthase                 90.5    8e-20
gb|AAU09672.1|  ACC synthase                                          90.9    8e-20   
ref|NP_001234280.1|  1-aminocyclopropane-1-carboxylate synthase 4     90.9    8e-20   
emb|CAH56693.1|  1-aminocyclopropane-1-carboxylate synthase           90.9    8e-20   
emb|CAH56694.1|  1-aminocyclopropane-1-carboxylate synthase           90.9    8e-20   
ref|NP_001233875.1|  1-aminocyclopropane 1-carboxylate synthase       90.9    8e-20   
ref|XP_002302608.2|  1-aminocyclopropane-1-carboxylate synthase f...  90.9    8e-20   
gb|AAQ13597.1|  1-aminocyclopropane-1-carboxylate synthase            90.9    9e-20   
ref|XP_006362080.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  90.9    9e-20   
ref|NP_001234160.1|  1-aminocyclopropane-1-carboxylate synthase 8     90.9    9e-20   
gb|AAL34980.1|  1-aminocyclopropane-1-carboxylate                     89.4    9e-20   
dbj|BAA76389.1|  1-aminocyclopropane-1-carboxylic acid synthase       90.9    9e-20   
gb|AAA03472.1|  1-aminocyclopropane-1-carboxylate (ACC) synthase      90.5    9e-20   
ref|XP_010099412.1|  1-aminocyclopropane-1-carboxylate synthase       90.9    9e-20   
dbj|BAB33423.1|  ACC synthase                                         90.9    9e-20   
gb|ACX69843.1|  ACC synthase                                          90.9    9e-20   
ref|XP_010248312.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  90.9    9e-20   
ref|XP_007205128.1|  hypothetical protein PRUPE_ppa004987mg           90.9    9e-20   
gb|ABA01475.2|  1-aminocyclopropane-1-carboxylate synthase            90.5    1e-19   
ref|XP_002302380.2|  hypothetical protein POPTR_0002s11460g           90.1    1e-19   
ref|XP_002310878.1|  1-aminocyclopropane-1-carboxylic acid syntha...  90.5    1e-19   
gb|AFT92042.2|  1-aminocyclopropane-1-carboxylate synthase            90.9    1e-19   
gb|ACN78835.1|  1-aminocyclopropane-1-carboxylate synthase            90.9    1e-19   
gb|ABQ51840.1|  1-aminocyclopropane-1-carboxylate synthase            90.9    1e-19   
ref|XP_004503673.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  90.9    1e-19   
ref|XP_008364813.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  90.9    1e-19   
ref|XP_007047625.1|  1-aminocyclopropane-1-carboxylate synthase       90.5    1e-19   
gb|AAC98809.1|  ACC synthase                                          90.5    1e-19   
ref|XP_008236043.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  90.5    1e-19   
gb|ABW03081.1|  1-aminocyclopropane 1-carboxylate synthase 1          90.5    1e-19   
ref|XP_011080907.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  90.5    1e-19   
ref|XP_009366562.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  90.5    1e-19   
ref|NP_195491.1|  1-aminocyclopropane-1-carboxylate synthase 8        90.5    1e-19   
ref|XP_002304518.2|  1-aminocyclopropane-1-carboxylate synthase f...  90.5    1e-19   
gb|EYU23427.1|  hypothetical protein MIMGU_mgv1a005590mg              90.5    1e-19   
ref|XP_008380117.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  90.1    1e-19   
gb|AEY82446.1|  1-aminocyclopropane-1-carboxylate synthase            90.5    1e-19   
ref|XP_010919134.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...  89.7    1e-19   
gb|KDP25384.1|  hypothetical protein JCGZ_20540                       90.5    1e-19   
gb|AAQ17608.1|AF167425_1  1-aminocyclopropane-1-carboxylate synthase  90.1    1e-19   
gb|ABR53739.1|  1-aminocyclopropane-1-carboxylate synthase 4          89.4    1e-19   
gb|AAF97612.1|U17975_1  1-aminocyclopropane-1-carboxylate synthase    87.8    1e-19   
gb|ADF31936.1|  1-aminocyclopropane-1-carboxylate synthase 11         86.7    1e-19   
ref|XP_008452008.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  90.5    1e-19   
gb|AAF61236.1|AF239989_1  ACC synthase ACS25                          89.0    1e-19   
gb|ABM60753.1|  truncated ACC synthase                                89.4    1e-19   
gb|AAB70885.1|  1-aminocyclopropane-1-carboxylate synthase            90.5    1e-19   
dbj|BAA93713.1|  1-aminocyclopropane-1-carboxylate synthase           90.5    1e-19   
ref|NP_001267589.1|  1-aminocyclopropane-1-carboxylate synthase-like  90.5    1e-19   
ref|XP_004288284.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  90.1    1e-19   
ref|XP_006411853.1|  hypothetical protein EUTSA_v10027155mg           90.1    1e-19   
gb|AAC49764.1|  1-aminocyclopropane-1-carboxylate synthase            88.2    1e-19   
gb|AAC83146.1|  1-aminocyclopropane-1-carboxylate synthase            90.1    1e-19   
ref|XP_011022618.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  90.1    1e-19   
dbj|BAB18464.1|  1-aminocyclopropane-1-carboxylate synthase           90.1    2e-19   
gb|AAG12246.1|AF184077_1  ACC synthase                                89.0    2e-19   
ref|XP_011073274.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  90.1    2e-19   
ref|XP_010109428.1|  1-aminocyclopropane-1-carboxylate synthase 3     90.1    2e-19   
ref|XP_004160953.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  90.1    2e-19   
gb|AEI84819.1|  1-aminocyclopropane-1-carboxylate synthase 2          89.7    2e-19   
ref|XP_010035004.1|  PREDICTED: probable aminotransferase ACS12       90.1    2e-19   
ref|XP_008362641.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  90.1    2e-19   
emb|CBI40404.3|  unnamed protein product                              89.7    2e-19   
ref|XP_010512497.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  90.1    2e-19   
ref|XP_010556490.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  89.7    2e-19   
gb|ACD87812.1|  putative ACC synthase                                 85.5    2e-19   
gb|AAD51755.1|AF177769_1  1-aminocyclopropane-1-carboxylate synthase  89.0    2e-19   
ref|XP_003534540.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  90.1    2e-19   
gb|AFD50700.1|  ACC synthase 2                                        87.0    2e-19   
gb|EMS62632.1|  1-aminocyclopropane-1-carboxylate synthase            89.7    2e-19   
ref|XP_010053212.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  89.7    2e-19   
ref|XP_010092578.1|  1-aminocyclopropane-1-carboxylate synthase 1     90.1    2e-19   
ref|XP_002276774.2|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  89.7    2e-19   
gb|AAC08356.1|  1-aminocyclopropane-1-carboxylic acid synthase        87.8    2e-19   
ref|XP_009591161.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  89.7    2e-19   
gb|ADZ54056.1|  1-aminocyclopropane-1-carboxylate synthase            89.7    2e-19   
ref|XP_011073663.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  89.7    2e-19   
emb|CAN69483.1|  hypothetical protein VITISV_035777                   89.7    2e-19   
ref|XP_006402473.1|  hypothetical protein EUTSA_v10005927mg           89.7    2e-19   
gb|KCW59599.1|  hypothetical protein EUGRSUZ_H02344                   89.4    2e-19   
ref|XP_009398061.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  89.7    2e-19   
gb|AFO63004.1|  ACC synthase                                          89.7    2e-19   
dbj|BAJ95898.1|  predicted protein                                    89.7    2e-19   
ref|XP_002878386.1|  predicted protein                                89.7    2e-19   
gb|ACO59910.1|  1-aminocyclopropane-1-carboxylate synthase            88.2    2e-19   
ref|XP_010023345.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  89.4    2e-19   
ref|XP_011017063.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  89.4    2e-19   
gb|AGF95121.1|  1-aminocyclopropane-1-carboxylate synthase            87.8    2e-19   
ref|XP_009786813.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  89.7    2e-19   
ref|XP_010446626.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  89.4    3e-19   
ref|XP_010040891.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  89.7    3e-19   
gb|KFK35337.1|  hypothetical protein AALP_AA5G271900                  89.4    3e-19   
gb|AAA84895.1|  1-aminocyclopropane-carboxylate synthase              88.2    3e-19   
gb|ABW03085.1|  1-aminocyclopropane 1-carboxylate synthase 4          89.7    3e-19   
gb|ABL96612.1|  1-aminocyclopropane-1-carboxylate synthase            85.1    3e-19   
dbj|BAA84946.1|  ACC synthase                                         88.2    3e-19   
sp|Q07262.1|1A1C_TOBAC  RecName: Full=1-aminocyclopropane-1-carbo...  89.7    3e-19   
gb|AAL35745.1|  1-aminocyclopropanecarboxylic acid synthase           89.4    3e-19   
ref|XP_010559100.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  89.4    3e-19   
ref|XP_006345579.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  89.7    3e-19   
ref|XP_008345341.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  89.4    3e-19   
gb|KEH21137.1|  1-aminocyclopropane-1-carboxylate synthase            89.4    3e-19   
gb|AAB18417.1|  1-aminocyclopropane-1-carboxylate synthase            87.4    3e-19   
gb|AAR99391.1|  ACC synthase ACS2                                     89.4    3e-19   
gb|AFK42980.1|  unknown                                               87.0    3e-19   
ref|XP_006294127.1|  hypothetical protein CARUB_v10023122mg           89.4    3e-19   
gb|ADO34169.1|  1-aminocyclopropane-1-carboxylate synthase            87.8    3e-19   
ref|XP_007219056.1|  hypothetical protein PRUPE_ppa004774mg           89.4    3e-19   
gb|ADO11888.1|  1-aminocyclopropane-1-carboxylate synthase 3          89.0    3e-19   
ref|NP_001280199.1|  1-aminocyclopropane-1-carboxylate synthase 1     89.4    3e-19   
ref|XP_003529924.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  89.7    3e-19   
gb|ADO34170.1|  1-aminocyclopropane-1-carboxylate synthase            87.4    3e-19   
gb|AAB18416.1|  ACC synthase                                          89.4    3e-19   
ref|XP_010457119.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  89.4    4e-19   
ref|XP_010480237.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  89.4    4e-19   
gb|AAX99362.1|  1-aminocyclopropane-1-carboxylate synthase            89.4    4e-19   
dbj|BAA96743.1|  1-aminocyclopropane-1-carboxylate synthase           89.4    4e-19   
gb|AAB96658.1|  1-aminocyclopropane-1-carboxylate synthase            89.0    4e-19   
emb|CAA79478.1|  1-aminocyclopropane-1-carboxylate synthase           89.0    4e-19   
gb|ACJ85187.1|  unknown                                               84.7    4e-19   
gb|AAF61235.1|AF239987_1  ACC synthase ACS1                           87.8    4e-19   



>emb|CAA81749.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum tuberosum]
Length=441

 Score =   121 bits (303),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 53/56 (95%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            +FMEQ+RGGRARFDP+RVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL
Sbjct  104  TFMEQVRGGRARFDPDRVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  159



>ref|XP_009778720.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Nicotiana sylvestris]
Length=441

 Score =   120 bits (301),  Expect = 9e-31, Method: Composition-based stats.
 Identities = 53/56 (95%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+F+PER+VITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL
Sbjct  105  SFMEQIRGGRAKFNPERIVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  160



>ref|XP_009629400.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Nicotiana tomentosiformis]
Length=442

 Score =   120 bits (301),  Expect = 9e-31, Method: Composition-based stats.
 Identities = 53/56 (95%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+F+PER+VITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL
Sbjct  105  SFMEQIRGGRAKFNPERIVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  160



>emb|CBI27945.3| unnamed protein product [Vitis vinifera]
Length=387

 Score =   119 bits (299),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 53/56 (95%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FDP+RVV+TAGATAANELLTFILADPGDALLVPTPYYPGFDRDL
Sbjct  105  SFMEQIRGGRAKFDPDRVVLTAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  160



>ref|XP_004242974.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Solanum lycopersicum]
Length=441

 Score =   120 bits (300),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 53/56 (95%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRGGRARFDP+RVVITAGATAANELLTFILADPGDALL+PTPYYPGFDRDL
Sbjct  104  SFMEKIRGGRARFDPDRVVITAGATAANELLTFILADPGDALLLPTPYYPGFDRDL  159



>gb|EYU30660.1| hypothetical protein MIMGU_mgv1a006645mg [Erythranthe guttata]
Length=436

 Score =   119 bits (299),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 53/56 (95%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FDP+R+VITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL
Sbjct  101  SFMEQIRGGRAKFDPDRIVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  156



>ref|XP_002279881.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7 [Vitis 
vinifera]
Length=445

 Score =   119 bits (299),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 53/56 (95%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FDP+RVV+TAGATAANELLTFILADPGDALLVPTPYYPGFDRDL
Sbjct  105  SFMEQIRGGRAKFDPDRVVLTAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  160



>ref|XP_010090013.1| 1-aminocyclopropane-1-carboxylate synthase 7 [Morus notabilis]
 gb|EXB38810.1| 1-aminocyclopropane-1-carboxylate synthase 7 [Morus notabilis]
Length=446

 Score =   119 bits (299),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 54/56 (96%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FDP RVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL
Sbjct  108  SFMEQIRGGRAKFDPNRVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  163



>emb|CAN66901.1| hypothetical protein VITISV_029694 [Vitis vinifera]
Length=453

 Score =   119 bits (299),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 53/56 (95%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FDP+RVV+TAGATAANELLTFILADPGDALLVPTPYYPGFDRDL
Sbjct  105  SFMEQIRGGRAKFDPDRVVLTAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  160



>gb|AAK94922.1| ripening-related ACC synthase [Annona x atemoya]
Length=359

 Score =   118 bits (296),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 53/56 (95%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FDPER+V+TAGATAANELLTFILADPGDALLVPTPYYPGFDRDL
Sbjct  55   SFMEQIRGGRAKFDPERIVLTAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  110



>ref|XP_011078426.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Sesamum indicum]
Length=449

 Score =   119 bits (297),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 52/56 (93%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FDP+RVVITAGATAANELLTFILADPGDA+L+PTPYYPGFDRDL
Sbjct  101  SFMEQIRGGRAKFDPDRVVITAGATAANELLTFILADPGDAMLIPTPYYPGFDRDL  156



>gb|KHM99840.1| 1-aminocyclopropane-1-carboxylate synthase 7 [Glycine soja]
Length=388

 Score =   118 bits (296),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 52/56 (93%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FDP+RVV+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  54   SFMEQIRGGRAKFDPDRVVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  109



>gb|EYU41606.1| hypothetical protein MIMGU_mgv1a018671mg [Erythranthe guttata]
Length=438

 Score =   118 bits (296),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 52/56 (93%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRGGRA+F+PER+VITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL
Sbjct  102  SFMEEIRGGRAKFNPERIVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  157



>emb|CAB86187.1| 1-aminocyclopropane-1-carboxylate synthase [Carica papaya]
Length=367

 Score =   118 bits (295),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 52/56 (93%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FDPER+V+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  55   SFMEQIRGGRAKFDPERIVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  110



>ref|XP_006580895.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Glycine max]
Length=440

 Score =   118 bits (296),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 52/56 (93%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FDP+RVV+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  106  SFMEQIRGGRAKFDPDRVVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  161



>gb|KHN16675.1| 1-aminocyclopropane-1-carboxylate synthase 7 [Glycine soja]
Length=337

 Score =   117 bits (294),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 52/56 (93%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FDP+RVV+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  3    SFMEQIRGGRAKFDPDRVVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  58



>ref|XP_009771829.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Nicotiana sylvestris]
Length=440

 Score =   118 bits (296),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 53/56 (95%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRGGRARFDP+RVVITAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  101  SFMEKIRGGRARFDPDRVVITAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  156



>ref|XP_008242429.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7 [Prunus 
mume]
Length=442

 Score =   118 bits (295),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 52/56 (93%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FDP+RVV+TAGATAANELLTFI+ADPGDALLVPTPYYPGFDRDL
Sbjct  107  SFMEQIRGGRAKFDPDRVVLTAGATAANELLTFIIADPGDALLVPTPYYPGFDRDL  162



>ref|XP_007201928.1| hypothetical protein PRUPE_ppa022214mg [Prunus persica]
 gb|EMJ03127.1| hypothetical protein PRUPE_ppa022214mg [Prunus persica]
Length=421

 Score =   118 bits (295),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 52/56 (93%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FDP+RVV+TAGATAANELLTFI+ADPGDALLVPTPYYPGFDRDL
Sbjct  105  SFMEQIRGGRAKFDPDRVVLTAGATAANELLTFIIADPGDALLVPTPYYPGFDRDL  160



>ref|XP_003530532.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Glycine max]
Length=440

 Score =   118 bits (295),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 52/56 (93%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FDP+RVV+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  106  SFMEQIRGGRAKFDPDRVVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  161



>ref|XP_008387640.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Malus domestica]
Length=447

 Score =   117 bits (294),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FDP+R+V+TAGATAANELLTFI+ADPGDALLVPTPYYPGFDRDL
Sbjct  111  SFMEQIRGGRAKFDPDRIVLTAGATAANELLTFIIADPGDALLVPTPYYPGFDRDL  166



>ref|XP_009589682.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Nicotiana tomentosiformis]
Length=438

 Score =   117 bits (293),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 52/56 (93%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRGGRARFDP+RVVITAGAT+ANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  101  SFMEKIRGGRARFDPDRVVITAGATSANELLTFILANPGDALLVPTPYYPGFDRDL  156



>gb|KDP33744.1| hypothetical protein JCGZ_07315 [Jatropha curcas]
Length=447

 Score =   117 bits (293),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGR +FDP+R+V+TAGATAANELLTFILADPGDALLVPTPYYPGFDRDL
Sbjct  107  SFMEQIRGGRPKFDPDRIVLTAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  162



>dbj|BAA76388.1| 1-aminocyclopropane -1-carboxylate synthase [Pyrus pyrifolia]
Length=446

 Score =   117 bits (293),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FDP RVV+TAGATAANELLTFI+ADPGDALLVPTPYYPGFDRDL
Sbjct  111  SFMEQIRGGRAKFDPARVVLTAGATAANELLTFIIADPGDALLVPTPYYPGFDRDL  166



>ref|XP_010925479.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Elaeis guineensis]
Length=441

 Score =   117 bits (293),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FDP+R+V+TAGATAANELLTFILADPGDALL+PTPYYPGFDRDL
Sbjct  101  SFMEQIRGGRAKFDPDRIVLTAGATAANELLTFILADPGDALLIPTPYYPGFDRDL  156



>gb|KHN32906.1| 1-aminocyclopropane-1-carboxylate synthase 7 [Glycine soja]
Length=396

 Score =   117 bits (292),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQ+RGGRA+FDP+RVV+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  54   SFMEQVRGGRAKFDPQRVVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  109



>ref|XP_010262212.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
isoform X1 [Nelumbo nucifera]
Length=448

 Score =   117 bits (293),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FDP R+V+TAGATAANELLTF+LADPGDALL+PTPYYPGFDRDL
Sbjct  105  SFMEQIRGGRAKFDPNRIVLTAGATAANELLTFVLADPGDALLIPTPYYPGFDRDL  160



>ref|XP_010262213.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
isoform X2 [Nelumbo nucifera]
Length=436

 Score =   117 bits (292),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FDP R+V+TAGATAANELLTF+LADPGDALL+PTPYYPGFDRDL
Sbjct  93   SFMEQIRGGRAKFDPNRIVLTAGATAANELLTFVLADPGDALLIPTPYYPGFDRDL  148



>gb|AAM80890.1| 1-aminocyclopropane-1-carboxylate synthase [Betula pendula]
Length=368

 Score =   116 bits (291),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRG R +FDPERVV+TAGATAANELLTFILADPGDALLVPTPYYPGFDRDL
Sbjct  55   SFMEQIRGDRVKFDPERVVLTAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  110



>ref|XP_006371987.1| 1-aminocyclopropene-1-carboxylate synthase 3c family protein 
[Populus trichocarpa]
 gb|ERP49784.1| 1-aminocyclopropene-1-carboxylate synthase 3c family protein 
[Populus trichocarpa]
Length=446

 Score =   117 bits (292),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 52/56 (93%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRGGRA+FDP+RVV+TAGATAANELLTFILADPGDALLVPTPYYPGFDRDL
Sbjct  104  SFMEKIRGGRAKFDPDRVVLTAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  159



>ref|XP_011013607.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Populus euphratica]
Length=446

 Score =   117 bits (292),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRGGRA+FDP+R+V+TAGATAANELLTFILADPGDALLVPTPYYPGFDRDL
Sbjct  104  SFMEKIRGGRAKFDPDRIVLTAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  159



>ref|XP_009352610.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7 [Pyrus 
x bretschneideri]
Length=446

 Score =   117 bits (292),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FDP RVV+TAGATAANELLTF++ADPGDALLVPTPYYPGFDRDL
Sbjct  111  SFMEQIRGGRAKFDPARVVLTAGATAANELLTFVIADPGDALLVPTPYYPGFDRDL  166



>emb|CAA78123.1| ACC synthase [Vigna radiata var. radiata]
Length=388

 Score =   116 bits (291),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 52/56 (93%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FDP+RVV+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  75   SFMEQIRGGRAKFDPDRVVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  130



>gb|AFA25803.1| ACC synthase [Pyrus pyrifolia]
 gb|AGE45704.1| 1-aminocyclopropane-1-carboxylic acid synthase [Pyrus pyrifolia]
Length=446

 Score =   117 bits (292),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FDP RVV+TAGATAANELLTF++ADPGDALLVPTPYYPGFDRDL
Sbjct  111  SFMEQIRGGRAKFDPARVVLTAGATAANELLTFVIADPGDALLVPTPYYPGFDRDL  166



>ref|XP_002869623.1| 1-amino-cyclopropane-1-carboxylate synthase 7 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH45882.1| 1-amino-cyclopropane-1-carboxylate synthase 7 [Arabidopsis lyrata 
subsp. lyrata]
Length=442

 Score =   117 bits (292),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGG+ARFDP+R+V+TAGATAANELLTFILADP DALLVPTPYYPGFDRDL
Sbjct  107  SFMEQIRGGKARFDPDRIVLTAGATAANELLTFILADPNDALLVPTPYYPGFDRDL  162



>ref|XP_007160245.1| hypothetical protein PHAVU_002G305000g [Phaseolus vulgaris]
 gb|ESW32239.1| hypothetical protein PHAVU_002G305000g [Phaseolus vulgaris]
Length=438

 Score =   117 bits (292),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 52/56 (93%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FDP+RVV+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  104  SFMEQIRGGRAKFDPDRVVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  159



>gb|AAS17855.1| 1-aminocyclopropane-1-carboxylate synthase [Rosa hybrid cultivar]
Length=136

 Score =   111 bits (278),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FDP R+V+TAGATAANELLTFILADPGDALLVPTPYYPGFDRDL
Sbjct  52   SFMEQIRGGRAKFDPSRIVLTAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  107



>ref|XP_006573922.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Glycine max]
Length=446

 Score =   117 bits (292),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQ+RGGRA+FDP+RVV+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  104  SFMEQVRGGRAKFDPQRVVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  159



>ref|XP_010915315.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7 [Elaeis 
guineensis]
Length=440

 Score =   117 bits (292),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQ+RGGRA+FDP+R+V+TAGATAANELLTFILADPGDALL+PTPYYPGFDRDL
Sbjct  102  SFMEQVRGGRAKFDPDRIVLTAGATAANELLTFILADPGDALLIPTPYYPGFDRDL  157



>gb|AAR38503.1| 1-aminocyclopropane-1-carboxylate synthase 2b [Pyrus communis]
Length=446

 Score =   116 bits (291),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FDP RVV+TAGATAANELLTF++ADPGDALLVPTPYYPGFDRDL
Sbjct  111  SFMEQIRGGRAKFDPARVVLTAGATAANELLTFVIADPGDALLVPTPYYPGFDRDL  166



>ref|NP_194350.1| 1-aminocyclopropane-1-carboxylate synthase 7 [Arabidopsis thaliana]
 sp|Q9STR4.1|1A17_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate synthase 7; Short=ACC 
synthase 7; AltName: Full=S-adenosyl-L-methionine methylthioadenosine-lyase 
7 [Arabidopsis thaliana]
 gb|AAG48754.1|AF332390_1 1-aminocyclopropane-1-carboxylate synthase ACS7 [Arabidopsis 
thaliana]
 emb|CAB38949.1| 1-aminocyclopropane-1-carboxylate synthase-like protein [Arabidopsis 
thaliana]
 emb|CAB79475.1| 1-aminocyclopropane-1-carboxylate synthase-like protein [Arabidopsis 
thaliana]
 gb|AEE85169.1| 1-aminocyclopropane-1-carboxylate synthase 7 [Arabidopsis thaliana]
Length=447

 Score =   116 bits (291),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGG+ARFDP+R+V+TAGATAANELLTFILADP DALLVPTPYYPGFDRDL
Sbjct  112  SFMEQIRGGKARFDPDRIVLTAGATAANELLTFILADPNDALLVPTPYYPGFDRDL  167



>ref|XP_007152930.1| hypothetical protein PHAVU_004G172300g [Phaseolus vulgaris]
 gb|ESW24924.1| hypothetical protein PHAVU_004G172300g [Phaseolus vulgaris]
Length=440

 Score =   116 bits (291),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQ+RGGRA+FDP+R+V+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  104  SFMEQVRGGRAKFDPQRIVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  159



>gb|ACT78959.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus]
 gb|ACT78960.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus]
 gb|ACT78961.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus]
Length=445

 Score =   116 bits (291),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRGGRA+FDP RVV+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  106  SFMEEIRGGRAKFDPNRVVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  161



>ref|XP_010313742.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7 [Solanum 
lycopersicum]
Length=434

 Score =   116 bits (290),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 51/55 (93%), Positives = 55/55 (100%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+IRGGRA+F+P+RVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL
Sbjct  99   FMEKIRGGRAKFNPDRVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  153



>emb|CAA78122.1| ACC synthase [Vigna radiata var. radiata]
 gb|AAA34236.1| 1-aminocyclopropane-1-carboxylate synthase [Vigna radiata]
Length=391

 Score =   115 bits (289),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQ+RGGRA+FDP+RVV+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  78   SFMEQVRGGRAKFDPQRVVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  133



>ref|XP_002308289.1| 1-aminocyclopropene-1-carboxylate synthase 3c family protein 
[Populus trichocarpa]
 gb|EEE91812.1| 1-aminocyclopropene-1-carboxylate synthase 3c family protein 
[Populus trichocarpa]
Length=440

 Score =   116 bits (290),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 51/55 (93%), Positives = 55/55 (100%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FMEQIRGGRA+FDP+RVV+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  105  FMEQIRGGRAKFDPDRVVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  159



>ref|XP_004170907.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Cucumis sativus]
Length=445

 Score =   116 bits (290),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRGGRA+FDP RVV+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  106  SFMEEIRGGRAKFDPNRVVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  161



>ref|XP_004288918.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Fragaria vesca subsp. vesca]
Length=439

 Score =   116 bits (290),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FDP R+V+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  104  SFMEQIRGGRAKFDPSRIVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  159



>ref|XP_010448309.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7 [Camelina 
sativa]
Length=452

 Score =   116 bits (290),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGG+ARFDP+R+V+TAGATAANELLTFILADP DALLVPTPYYPGFDRDL
Sbjct  117  SFMEQIRGGKARFDPDRIVLTAGATAANELLTFILADPNDALLVPTPYYPGFDRDL  172



>ref|XP_006285008.1| hypothetical protein CARUB_v10006315mg [Capsella rubella]
 gb|EOA17906.1| hypothetical protein CARUB_v10006315mg [Capsella rubella]
Length=450

 Score =   116 bits (290),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGG+ARFDP+R+V+TAGATAANELLTFILADP DALLVPTPYYPGFDRDL
Sbjct  115  SFMEQIRGGKARFDPDRIVLTAGATAANELLTFILADPNDALLVPTPYYPGFDRDL  170



>dbj|BAF79596.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus]
 gb|ACT78790.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus]
 gb|ACT78957.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus]
 gb|ACT78958.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus]
Length=445

 Score =   116 bits (290),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRGGRA+FDP RVV+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  106  SFMEEIRGGRAKFDPNRVVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  161



>gb|AAP14020.1|AF380837_1 putative ACC synthase 2 [Lactuca sativa]
Length=445

 Score =   116 bits (290),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQ+RGG+A+F+P+RVV+TAGATAANELLTFILADPGDALLVPTPYYPGFDRDL
Sbjct  104  SFMEQVRGGKAKFNPDRVVLTAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  159



>ref|XP_011094001.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7 [Sesamum 
indicum]
Length=443

 Score =   116 bits (290),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+F P+R+VITAGATAANELLTFILADPGDALL+PTPYYPGFDRDL
Sbjct  109  SFMEQIRGGRAKFSPDRIVITAGATAANELLTFILADPGDALLIPTPYYPGFDRDL  164



>ref|XP_008793196.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7 [Phoenix 
dactylifera]
Length=441

 Score =   116 bits (290),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FDP+R+V+TAGATAANELLTFILADPGDALL+P PYYPGFDRDL
Sbjct  101  SFMEQIRGGRAKFDPDRIVLTAGATAANELLTFILADPGDALLIPIPYYPGFDRDL  156



>ref|XP_011078213.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Sesamum indicum]
Length=436

 Score =   115 bits (289),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 50/55 (91%), Positives = 55/55 (100%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FMEQIRGGRA+F+P+R+VITAGATAANELLTFILADPGDALL+PTPYYPGFDRDL
Sbjct  105  FMEQIRGGRAKFNPDRIVITAGATAANELLTFILADPGDALLIPTPYYPGFDRDL  159



>ref|XP_007202323.1| hypothetical protein PRUPE_ppa008124mg [Prunus persica]
 gb|EMJ03522.1| hypothetical protein PRUPE_ppa008124mg [Prunus persica]
Length=344

 Score =   115 bits (287),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFM QIRGGRA+FDP+R+V+TAGATAANELLTFI+ADPGDALLVPTPYYPGFDRDL
Sbjct  3    SFMGQIRGGRAKFDPDRIVLTAGATAANELLTFIIADPGDALLVPTPYYPGFDRDL  58



>ref|XP_008450824.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7 [Cucumis 
melo]
 gb|ACG70850.1| 1-aminocyclopropane-1-carboxylic acid synthase [Cucumis melo]
Length=445

 Score =   115 bits (289),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRGGRA+FDP RVV+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  106  SFMEEIRGGRAKFDPNRVVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  161



>ref|XP_002514161.1| acc synthase, putative [Ricinus communis]
 gb|EEF48115.1| acc synthase, putative [Ricinus communis]
Length=440

 Score =   115 bits (289),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FD +R+V+TAGATAANELLTFILADPGDALLVPTPYYPGFDRDL
Sbjct  104  SFMEQIRGGRAKFDSDRIVLTAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  159



>gb|KGN66211.1| hypothetical protein Csa_1G580750 [Cucumis sativus]
Length=445

 Score =   115 bits (289),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRGGRA+FDP RVV+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  106  SFMEEIRGGRAKFDPNRVVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  161



>gb|ACG70849.1| 1-aminocyclopropane-1-carboxylic acid synthase [Cucumis melo]
 gb|AIY24601.1| 1-aminocyclopropane-1-carboxylic acid synthase [Cucumis melo]
Length=445

 Score =   115 bits (289),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRGGRA+FDP RVV+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  106  SFMEEIRGGRAKFDPNRVVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  161



>ref|XP_011004709.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Populus euphratica]
Length=440

 Score =   115 bits (289),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 51/55 (93%), Positives = 55/55 (100%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FMEQIRGGRA+FDP+RVV+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  105  FMEQIRGGRAKFDPDRVVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  159



>ref|XP_008367258.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Malus domestica]
Length=446

 Score =   115 bits (289),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            +FMEQIRGGRA+FDP RVV+TAGATAANELLTFI+ADPGDALLVPTPYYPGFDRDL
Sbjct  111  NFMEQIRGGRAKFDPVRVVLTAGATAANELLTFIIADPGDALLVPTPYYPGFDRDL  166



>gb|AAB67989.1| ACC synthase [Malus domestica]
 dbj|BAE94690.1| 1-aminocyclopropane-1-carboxylic acid synthase 3a [Malus domestica]
Length=446

 Score =   115 bits (289),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            +FMEQIRGGRA+FDP RVV+TAGATAANELLTFI+ADPGDALLVPTPYYPGFDRDL
Sbjct  111  NFMEQIRGGRAKFDPVRVVLTAGATAANELLTFIIADPGDALLVPTPYYPGFDRDL  166



>ref|XP_006353581.1| PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclopropane-1-carboxylate 
synthase 7-like [Solanum tuberosum]
Length=464

 Score =   115 bits (289),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 50/55 (91%), Positives = 55/55 (100%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+IRGGRA+F+P+R+VITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL
Sbjct  99   FMEKIRGGRAKFNPDRIVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  153



>ref|XP_010433537.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Camelina sativa]
Length=452

 Score =   115 bits (289),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGG++RFDP+R+V+TAGATAANELLTFILADP DALLVPTPYYPGFDRDL
Sbjct  117  SFMEQIRGGKSRFDPDRIVLTAGATAANELLTFILADPNDALLVPTPYYPGFDRDL  172



>emb|CDY71142.1| BnaCnng71530D [Brassica napus]
Length=448

 Score =   115 bits (288),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFM+QIRGG+ARFDP+R+V+TAGATAANELLTFILADP DALLVPTPYYPGFDRDL
Sbjct  113  SFMQQIRGGKARFDPDRIVLTAGATAANELLTFILADPNDALLVPTPYYPGFDRDL  168



>gb|AEP82201.1| 1-aminocyclopropane-1-carboxylic acid synthase 3a-2 [Malus domestica]
Length=446

 Score =   115 bits (288),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            +FMEQIRGGRA+FDP RVV+TAGATAANELLTFI+ADPGDALLVPTPYYPGFDRDL
Sbjct  111  NFMEQIRGGRAKFDPVRVVLTAGATAANELLTFIIADPGDALLVPTPYYPGFDRDL  166



>gb|AEP82200.1| 1-aminocyclopropane-1-carboxylic acid synthase 3a-1 [Malus domestica]
Length=446

 Score =   115 bits (288),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            +FMEQIRGGRA+FDP RVV+TAGATAANELLTFI+ADPGDALLVPTPYYPGFDRDL
Sbjct  111  NFMEQIRGGRAKFDPVRVVLTAGATAANELLTFIIADPGDALLVPTPYYPGFDRDL  166



>ref|XP_008391508.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Malus domestica]
Length=446

 Score =   115 bits (288),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            +FMEQIRGGRA+FDP RVV+TAGATAANELLTFI+ADPGDALLVPTPYYPGFDRDL
Sbjct  111  NFMEQIRGGRAKFDPVRVVLTAGATAANELLTFIIADPGDALLVPTPYYPGFDRDL  166



>dbj|BAE94691.1| 1-aminocyclopropane-1-carboxylic acid synthase 3b [Malus domestica]
Length=445

 Score =   115 bits (288),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+ DP RVV+TAGATAANELLTFI+ADPGDALLVPTPYYPGFDRDL
Sbjct  110  SFMEQIRGGRAKIDPARVVLTAGATAANELLTFIIADPGDALLVPTPYYPGFDRDL  165



>gb|AAF61233.1|AF239663_1 ACC synthase, partial [Prunus persica]
Length=366

 Score =   115 bits (287),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFM QIRGGRA+FDP+R+V+TAGATAANELLTFI+ADPGDALLVPTPYYPGFDRDL
Sbjct  56   SFMGQIRGGRAKFDPDRIVLTAGATAANELLTFIIADPGDALLVPTPYYPGFDRDL  111



>ref|XP_007012906.1| 1-amino-cyclopropane-1-carboxylate synthase 7 [Theobroma cacao]
 gb|EOY30525.1| 1-amino-cyclopropane-1-carboxylate synthase 7 [Theobroma cacao]
Length=531

 Score =   116 bits (290),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            +FMEQIRGGRA+FDP+R+V+TAGATAANELLTFILADPGDALLVPTPYYPG DRDL
Sbjct  195  NFMEQIRGGRAKFDPDRIVLTAGATAANELLTFILADPGDALLVPTPYYPGLDRDL  250



>gb|AAX09641.1| ACS3 [Malus domestica]
Length=408

 Score =   115 bits (287),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            +FMEQIRGGRA+FDP RVV+TAGATAANELLTFI+ADPGDALLVPTPYYPGFDRDL
Sbjct  89   NFMEQIRGGRAKFDPVRVVLTAGATAANELLTFIIADPGDALLVPTPYYPGFDRDL  144



>emb|CDX89355.1| BnaA01g15380D [Brassica napus]
Length=448

 Score =   115 bits (288),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFM+QIRGG+ARFDP+R+V+TAGATAANELLTFILADP DALLVPTPYYPGFDRDL
Sbjct  113  SFMQQIRGGKARFDPDRIVLTAGATAANELLTFILADPNDALLVPTPYYPGFDRDL  168



>emb|CDX94359.1| BnaC01g18250D [Brassica napus]
Length=448

 Score =   115 bits (288),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFM+QIRGG+ARFDP+R+V+TAGATAANELLTFILADP DALLVPTPYYPGFDRDL
Sbjct  113  SFMQQIRGGKARFDPDRIVLTAGATAANELLTFILADPNDALLVPTPYYPGFDRDL  168



>ref|XP_006451409.1| hypothetical protein CICLE_v10010572mg [Citrus clementina]
 gb|ESR64649.1| hypothetical protein CICLE_v10010572mg [Citrus clementina]
Length=409

 Score =   115 bits (287),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FD  R+V+TAGATAANELLTFILADPGDALLVPTPYYPGFDRDL
Sbjct  73   SFMEQIRGGRAKFDLNRIVVTAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  128



>ref|XP_010438788.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
isoform X1 [Camelina sativa]
 ref|XP_010438789.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
isoform X2 [Camelina sativa]
Length=450

 Score =   115 bits (287),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGG++RFDP+R+V+TAGATAANELLTFILADP DALLVPTPYYPGFDRDL
Sbjct  115  SFMEQIRGGKSRFDPDRIVLTAGATAANELLTFILADPNDALLVPTPYYPGFDRDL  170



>ref|XP_008242430.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Prunus mume]
Length=446

 Score =   115 bits (287),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFM QIRGGRA+FDP+R+V+TAGATAANELLTFI+ADPGDALLVPTPYYPGFDRDL
Sbjct  105  SFMGQIRGGRAKFDPDRIVLTAGATAANELLTFIIADPGDALLVPTPYYPGFDRDL  160



>gb|AAF22112.1|AF119414_1 1-aminocyclopropane-1-carboxylate synthase 5 [Lupinus albus]
Length=448

 Score =   115 bits (287),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FDP R+V+TAGATAANELLTFI+A+PGDALL+PTPYYPGFDRDL
Sbjct  104  SFMEQIRGGRAKFDPSRIVLTAGATAANELLTFIIANPGDALLLPTPYYPGFDRDL  159



>ref|XP_009142057.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7 [Brassica 
rapa]
Length=448

 Score =   115 bits (287),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFM+QIRGG+ARFDP+R+V+TAGATAANELLTFILADP DALLVPTPYYPGFDRDL
Sbjct  113  SFMQQIRGGKARFDPDRIVLTAGATAANELLTFILADPNDALLVPTPYYPGFDRDL  168



>ref|XP_003530192.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Glycine max]
 gb|KHN40343.1| 1-aminocyclopropane-1-carboxylate synthase 7 [Glycine soja]
Length=446

 Score =   115 bits (287),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQ+RGGRA+FDP+R+V+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  104  SFMEQVRGGRAKFDPQRLVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  159



>gb|AEI84820.1| 1-aminocyclopropane-1-carboxylate synthase 3 [Prunus armeniaca]
Length=440

 Score =   114 bits (286),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFM QIRGGRA+FDP+R+V+TAGATAANELLTFI+ADPGDALLVPTPYYPGFDRDL
Sbjct  105  SFMGQIRGGRAKFDPDRIVLTAGATAANELLTFIIADPGDALLVPTPYYPGFDRDL  160



>gb|AAC70352.2| ACC synthase 2 [Antirrhinum majus]
Length=347

 Score =   114 bits (285),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA FDPERVVITAGA  ANELLTFILA+PGDALL+PTPYYPGFDRDL
Sbjct  47   SFMEQIRGGRATFDPERVVITAGAPPANELLTFILANPGDALLIPTPYYPGFDRDL  102



>ref|XP_003630647.1| 1-aminocyclopropane-1-carboxylate synthase [Medicago truncatula]
Length=420

 Score =   114 bits (285),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGG+A FD ER+VITAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  98   SFMEQIRGGKATFDSERIVITAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  153



>gb|AET05123.2| 1-aminocyclopropane-1-carboxylate synthase [Medicago truncatula]
Length=422

 Score =   114 bits (285),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGG+A FD ER+VITAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  98   SFMEQIRGGKATFDSERIVITAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  153



>gb|KEH21318.1| 1-aminocyclopropane-1-carboxylate synthase [Medicago truncatula]
Length=435

 Score =   114 bits (285),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGG+A FD ER+VITAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  98   SFMEQIRGGKATFDSERIVITAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  153



>dbj|BAA37134.1| ACC synthase [Passiflora edulis]
Length=351

 Score =   114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FDP+R+V+TAGATAANELLTFILADPGDALLVPTPYYPGFDRDL
Sbjct  48   SFMEQIRGGRAKFDPDRIVLTAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  103



>ref|XP_006475545.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Citrus sinensis]
 gb|KDO59268.1| hypothetical protein CISIN_1g046900mg [Citrus sinensis]
Length=442

 Score =   114 bits (285),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FD  R+V+TAGATAANELLTFILADPGDALLVPTPYYPGFDRDL
Sbjct  106  SFMEQIRGGRAKFDLNRIVVTAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  161



>ref|XP_010666828.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=397

 Score =   113 bits (283),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FD  R+V+TAGATAANELLTFI+ADPGDALLVPTPYYPGFDRDL
Sbjct  55   SFMEQIRGGRAKFDYNRIVLTAGATAANELLTFIIADPGDALLVPTPYYPGFDRDL  110



>dbj|BAE94692.1| 1-aminocyclopropane-1-carboxylic acid synthase 3c [Malus domestica]
Length=446

 Score =   114 bits (284),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FDP+R+V+TAGATAANELLTFI+A PGDALLVP+PYYPGFDRDL
Sbjct  111  SFMEQIRGGRAKFDPDRIVLTAGATAANELLTFIIAGPGDALLVPSPYYPGFDRDL  166



>ref|XP_009137583.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Brassica rapa]
 emb|CDY42751.1| BnaA03g47880D [Brassica napus]
Length=451

 Score =   114 bits (284),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRGG+ARFDP+R+V+TAGATAANELLTFILA+P DALLVPTPYYPGFDRDL
Sbjct  113  SFMEKIRGGKARFDPDRIVLTAGATAANELLTFILANPNDALLVPTPYYPGFDRDL  168



>ref|XP_010536854.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7 [Tarenaya 
hassleriana]
Length=443

 Score =   113 bits (283),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRG R +FDPER+V+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  109  SFMEQIRGKRVKFDPERIVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  164



>gb|AAR12136.1| 1-aminocyclopropene-1-carboxylate synthase 3a [Pyrus communis]
 gb|AAR38502.1| 1-aminocyclopropane-1-carboxylate synthase 3 [Pyrus communis]
Length=446

 Score =   113 bits (283),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            +FMEQIRGGRA+FDP RVV+TAGATAA+ELLTFI+ADPGDALLVPTPYYPGFDRDL
Sbjct  111  NFMEQIRGGRAKFDPVRVVLTAGATAADELLTFIIADPGDALLVPTPYYPGFDRDL  166



>gb|ABR53738.1| 1-aminocyclopropane-1-carboxylate synthase 3 [Linum usitatissimum]
Length=363

 Score =   112 bits (281),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFM QIRGGRA FDP+R+V+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  53   SFMSQIRGGRATFDPDRIVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  108



>gb|ABR53736.1| 1-aminocyclopropane-1-carboxylate synthase 1 [Linum usitatissimum]
Length=363

 Score =   112 bits (281),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFM QIRGGRA FDP+R+V+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  53   SFMSQIRGGRATFDPDRIVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  108



>gb|ABR53737.1| 1-aminocyclopropane-1-carboxylate synthase 2 [Linum usitatissimum]
Length=363

 Score =   112 bits (281),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFM QIRGGRA FDP+R+V+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  53   SFMSQIRGGRATFDPDRIVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  108



>ref|XP_004513132.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Cicer arietinum]
Length=444

 Score =   113 bits (282),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRG RA+FDP+R+V+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  106  SFMEKIRGERAKFDPDRIVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  161



>ref|XP_004502555.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Cicer arietinum]
Length=444

 Score =   113 bits (282),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRG RA+FDP+R+V+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  106  SFMEKIRGERAKFDPDRIVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  161



>ref|XP_004503531.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Cicer arietinum]
Length=443

 Score =   113 bits (282),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            +FMEQIRGGRA+FD ER+V+TAGATAANELLTFI+A+PGDALLVPTPYYPGFDRDL
Sbjct  105  NFMEQIRGGRAKFDHERIVLTAGATAANELLTFIIANPGDALLVPTPYYPGFDRDL  160



>gb|KFK29127.1| hypothetical protein AALP_AA7G092400 [Arabis alpina]
Length=451

 Score =   112 bits (281),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SF+EQIRGG+ RFDP+R+V+TAGATAANELLTFILADP DALLVPTPYYPGFDRDL
Sbjct  116  SFVEQIRGGKVRFDPDRIVLTAGATAANELLTFILADPNDALLVPTPYYPGFDRDL  171



>ref|XP_010666827.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=447

 Score =   112 bits (281),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FD  R+V+TAGATAANELLTFI+ADPGDALLVPTPYYPGFDRDL
Sbjct  105  SFMEQIRGGRAKFDYNRIVLTAGATAANELLTFIIADPGDALLVPTPYYPGFDRDL  160



>ref|XP_008387653.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Malus domestica]
Length=445

 Score =   112 bits (281),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIR GRA+ DP RVV+TAGATAANELLTFI+ADPGDALLVPTPYYPGFDRDL
Sbjct  110  SFMEQIRXGRAKIDPARVVLTAGATAANELLTFIIADPGDALLVPTPYYPGFDRDL  165



>ref|XP_004135814.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Cucumis sativus]
Length=207

 Score =   109 bits (273),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRGGRA+FDP RVV+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  106  SFMEEIRGGRAKFDPNRVVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  161



>ref|XP_008344120.1| PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclopropane-1-carboxylate 
synthase 7-like, partial [Malus domestica]
Length=429

 Score =   112 bits (280),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIR GRA+ DP RVV+TAGATAANELLTFI+ADPGDALLVPTPYYPGFDRDL
Sbjct  94   SFMEQIRXGRAKIDPARVVLTAGATAANELLTFIIADPGDALLVPTPYYPGFDRDL  149



>gb|AAB67882.1| ACC synthase [Dendrobium crumenatum]
Length=435

 Score =   112 bits (280),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRGGR++FDP+R+V+TAGATAANELLTFILADPGDALLVPTPYYPGF RDL
Sbjct  103  SFMEKIRGGRSKFDPDRIVLTAGATAANELLTFILADPGDALLVPTPYYPGFLRDL  158



>gb|AAF22108.1|AF119410_1 1-aminocyclopropane-1-carboxylate synthase 4 [Lupinus albus]
Length=446

 Score =   112 bits (280),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIR GR +FDP R+V+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  104  SFMEQIREGRVKFDPSRIVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  159



>emb|CAI64501.1| 1-aminocyclopropane-1-carboxylate synthase [Prunus domestica 
subsp. insititia]
Length=356

 Score =   112 bits (279),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFM QIRG RA+FDP+R+V+TAGATAANELLTFI+ADPGDALLVPTPYYPGFDRDL
Sbjct  56   SFMGQIRGERAKFDPDRIVLTAGATAANELLTFIIADPGDALLVPTPYYPGFDRDL  111



>gb|ABW03082.1| 1-aminocyclopropane 1-carboxylate synthase 3 [Prunus salicina]
Length=446

 Score =   112 bits (279),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFM QIRG RA+FDP+R+V+TAGATAANELLTFI+ADPGDALLVPTPYYPGFDRDL
Sbjct  105  SFMGQIRGERAKFDPDRIVLTAGATAANELLTFIIADPGDALLVPTPYYPGFDRDL  160



>ref|XP_006413217.1| hypothetical protein EUTSA_v10027427mg [Eutrema salsugineum]
 gb|ESQ54670.1| hypothetical protein EUTSA_v10027427mg [Eutrema salsugineum]
Length=450

 Score =   112 bits (279),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGG A FDP+R+V+TAGATAANELLTFILADP DALLVPTPYYPGFDRDL
Sbjct  115  SFMEQIRGGLASFDPDRIVLTAGATAANELLTFILADPNDALLVPTPYYPGFDRDL  170



>gb|ABO76788.1| 1-aminocyclopropane-1-carboxylate synthase [Citrullus colocynthis 
x Citrullus lanatus var. lanatus]
Length=218

 Score =   108 bits (271),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+IRGGRA+FDP RVV+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  17   FMEEIRGGRAKFDPNRVVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  71



>ref|XP_009381856.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Musa acuminata subsp. malaccensis]
Length=430

 Score =   111 bits (277),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 47/55 (85%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FMEQIRGGR +FDP+ +V+TAGATAANELLTFILADPGD LL+PTPYYPGFDRDL
Sbjct  91   FMEQIRGGRTQFDPQHIVLTAGATAANELLTFILADPGDGLLIPTPYYPGFDRDL  145



>gb|AAS17854.1| 1-aminocyclopropane-1-carboxylate synthase [Rosa hybrid cultivar]
Length=161

 Score =   107 bits (267),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRG RA+FDP+R+V+TAGATAANELLTFILADPGDALLVPTPYYPG DRDL
Sbjct  52   SFMEQIRGRRAKFDPQRIVLTAGATAANELLTFILADPGDALLVPTPYYPGSDRDL  107



>gb|AAL37503.1|AF338651_1 ACC synthase [Brassica oleracea var. italica]
Length=371

 Score =   110 bits (276),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+ RGG+ARFDP+R+V+TAGATAANELLTFILA+P DALLVPTPYYPGFDRDL
Sbjct  57   SFMEKNRGGKARFDPDRIVLTAGATAANELLTFILANPNDALLVPTPYYPGFDRDL  112



>gb|AGE15420.1| 1-aminocyclopropane-1-carboxylate synthase [Hosta ventricosa]
Length=448

 Score =   111 bits (277),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IR GR  FDPER+++TAGATAANELLTF+LADPGDALLVPTPYYPGFDRDL
Sbjct  104  SFMEKIRAGRVSFDPERIILTAGATAANELLTFVLADPGDALLVPTPYYPGFDRDL  159



>gb|AAU10812.1| putative 1-aminocyclopropane-1-carboxylate synthase [Oryza sativa 
Japonica Group]
 gb|AAV59454.1| putative 1-aminocyclopropane-1-carboxylate synthase [Oryza sativa 
Japonica Group]
 gb|EEE62644.1| hypothetical protein OsJ_17447 [Oryza sativa Japonica Group]
Length=437

 Score =   110 bits (276),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME IRGG+ARFDP+RVV+TAGATAANELLTFILADPGDALLVPTPYYPGFDRDL
Sbjct  87   SFMETIRGGKARFDPDRVVLTAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  142



>emb|CDY72652.1| BnaCnng78650D, partial [Brassica napus]
Length=201

 Score =   107 bits (267),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRGG+ARFDP+R+V+TAGATAANELLTFILA+P DALLVPTPYYPGFDRDL
Sbjct  113  SFMEKIRGGKARFDPDRIVLTAGATAANELLTFILANPNDALLVPTPYYPGFDRDL  168



>gb|ACY72181.1| ACC synthase [Dendrobium hybrid cultivar]
Length=435

 Score =   110 bits (275),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRGGR++FDP RVV+TAGATAANEL+TFILADPGDALLVPTPYYPGF RDL
Sbjct  103  SFMEKIRGGRSKFDPNRVVLTAGATAANELITFILADPGDALLVPTPYYPGFLRDL  158



>ref|XP_010267362.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7 [Nelumbo 
nucifera]
Length=440

 Score =   110 bits (274),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 47/55 (85%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FMEQIRGGRA+FDPER+V+TAGATAANELL F+LA+PGDALL+PTPYYPGF RDL
Sbjct  105  FMEQIRGGRAKFDPERIVLTAGATAANELLAFVLANPGDALLIPTPYYPGFGRDL  159



>gb|AAG12247.1|AF184078_1 ACC synthase [Prunus armeniaca]
Length=368

 Score =   109 bits (273),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 46/55 (84%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FM+QI+GGRA+FDP+RV +TAGATAANELLTFI+ADPGDALLVPTPYYPGFD++L
Sbjct  59   FMDQIKGGRAKFDPDRVFLTAGATAANELLTFIIADPGDALLVPTPYYPGFDKNL  113



>gb|ABO68835.2| 1-aminocyclopropane-1-carboxylate synthase [Dendrobium hybrid 
cultivar]
Length=435

 Score =   110 bits (274),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRGGR++FDP R+V+TAGATAANEL+TFILADPGDALLVPTPYYPGF RDL
Sbjct  103  SFMEKIRGGRSKFDPNRIVLTAGATAANELITFILADPGDALLVPTPYYPGFLRDL  158



>ref|XP_006643867.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Oryza brachyantha]
Length=457

 Score =   110 bits (274),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME++RGG+ARFDP+R+V+TAGATAANELLTFILADPGDALL+PTPYYPGFDRDL
Sbjct  108  SFMEKVRGGKARFDPDRIVLTAGATAANELLTFILADPGDALLIPTPYYPGFDRDL  163



>ref|XP_009397466.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Musa acuminata subsp. malaccensis]
Length=391

 Score =   109 bits (273),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            +FMEQIR GRA+FDPER+V+TAGATAANELLTFILADPGD LL+PTPYYPGFDRDL
Sbjct  54   TFMEQIREGRAKFDPERIVLTAGATAANELLTFILADPGDCLLIPTPYYPGFDRDL  109



>gb|AAL66201.1|AF386519_1 1-aminocyclopropane 1-carboxylate synthase 2a [Pyrus communis]
Length=446

 Score =   110 bits (274),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRGGRA+FDP RVV+TAGAT A ELLTF +ADPGDALLVPTPYYPGFDRDL
Sbjct  111  SFMEQIRGGRAKFDPARVVLTAGATRAIELLTFCIADPGDALLVPTPYYPGFDRDL  166



>gb|AFL91700.1| 1-aminocyclopropane-1-carboxylate synthase 3, partial [Eriobotrya 
japonica]
Length=333

 Score =   108 bits (271),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 48/52 (92%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +3

Query  15   QIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            QIRGGRA+FDP RVV+TAGATAANELLTFI+ADPGDALLVPTPYYPGFDRDL
Sbjct  2    QIRGGRAKFDPARVVLTAGATAANELLTFIIADPGDALLVPTPYYPGFDRDL  53



>ref|XP_003620879.1| 1-aminocyclopropane-1-carboxylate synthase [Medicago truncatula]
 gb|AES77097.1| 1-aminocyclopropane-1-carboxylate synthase [Medicago truncatula]
Length=444

 Score =   109 bits (273),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRG +A+FD ER+V+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  106  SFMEKIRGNKAKFDYERIVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  161



>ref|XP_002455019.1| hypothetical protein SORBIDRAFT_03g003070 [Sorghum bicolor]
 gb|EES00139.1| hypothetical protein SORBIDRAFT_03g003070 [Sorghum bicolor]
Length=463

 Score =   109 bits (273),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRGG+ARFDP+R+V+TAGATAANELLTFILA+PGDALL+PTPYYPGFDRDL
Sbjct  120  SFMEKIRGGKARFDPDRIVLTAGATAANELLTFILANPGDALLIPTPYYPGFDRDL  175



>ref|XP_004968508.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
isoform X2 [Setaria italica]
Length=431

 Score =   109 bits (272),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRGG+ARFDP+R+V+TAGATAANELLTFILA+PGDALL+PTPYYPGFDRDL
Sbjct  115  SFMEKIRGGKARFDPDRIVLTAGATAANELLTFILANPGDALLIPTPYYPGFDRDL  170



>ref|XP_004968507.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
isoform X1 [Setaria italica]
Length=459

 Score =   109 bits (272),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRGG+ARFDP+R+V+TAGATAANELLTFILA+PGDALL+PTPYYPGFDRDL
Sbjct  115  SFMEKIRGGKARFDPDRIVLTAGATAANELLTFILANPGDALLIPTPYYPGFDRDL  170



>gb|AHN49645.1| 1-aminocyclopropane-1-carboxylate synthase [Oncidium hybrid cultivar]
Length=435

 Score =   109 bits (272),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            +FME+IRGGRA+FDP+R+V+TAGATAANELLTFILADPGDALLVPTP YPGF RDL
Sbjct  103  NFMEKIRGGRAKFDPDRIVLTAGATAANELLTFILADPGDALLVPTPCYPGFLRDL  158



>gb|AGB13769.1| ACC synthase [Oncidium hybrid cultivar]
Length=435

 Score =   109 bits (272),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            +FME+IRGGRA+FDP+R+V+TAGATAANELLTFILADPGDALLVPTP YPGF RDL
Sbjct  103  NFMEKIRGGRAKFDPDRIVLTAGATAANELLTFILADPGDALLVPTPCYPGFLRDL  158



>gb|ADZ96244.1| ACC synthase 2 [Saccharum hybrid cultivar SP80-3280]
Length=466

 Score =   109 bits (272),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRGG+ARFDP+R+V+TAGATAANELLTFILA+PGDALL+PTPYYPGFDRDL
Sbjct  117  SFMEKIRGGKARFDPDRIVLTAGATAANELLTFILANPGDALLIPTPYYPGFDRDL  172



>gb|AAR88653.1| 1-aminocyclopropane-1-carboxylate synthase [Cattleya bicolor]
Length=434

 Score =   108 bits (270),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 46/56 (82%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRGGR++FDP R+++TAGATAANELLTFILA+PGDA+LVPTPYYPGF RDL
Sbjct  103  SFMEKIRGGRSKFDPNRIILTAGATAANELLTFILANPGDAILVPTPYYPGFLRDL  158



>ref|XP_004963524.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Setaria italica]
Length=445

 Score =   108 bits (269),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME IRGG+ARFDP+R+V+TAGATAANELLTFILA+PGDALLVPTPYYPGFDRDL
Sbjct  104  SFMETIRGGKARFDPDRMVLTAGATAANELLTFILANPGDALLVPTPYYPGFDRDL  159



>emb|CAB01401.1| 1-aminocyclopropane-carboxylate synthase homologue [Phalaenopsis 
hybrid cultivar]
Length=445

 Score =   107 bits (268),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 47/56 (84%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            S MEQIRG R +F+P+R+V+TAGATAANELLTFILADPGDA+LVPTPYYPGFDRDL
Sbjct  103  SLMEQIRGKRVKFNPDRMVLTAGATAANELLTFILADPGDAVLVPTPYYPGFDRDL  158



>emb|CDM81650.1| unnamed protein product [Triticum aestivum]
 emb|CDM82536.1| unnamed protein product [Triticum aestivum]
Length=455

 Score =   107 bits (268),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRGG+ RFDP+R+V+TAGATAANELLTFILA+PGDALL+PTPYYPGFDRDL
Sbjct  111  SFMEKIRGGKVRFDPDRIVLTAGATAANELLTFILANPGDALLIPTPYYPGFDRDL  166



>gb|EMT29346.1| 1-aminocyclopropane-1-carboxylate synthase 7 [Aegilops tauschii]
Length=455

 Score =   107 bits (268),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRGG+ RFDP+R+V+TAGATAANELLTFILA+PGDALL+PTPYYPGFDRDL
Sbjct  111  SFMEKIRGGKVRFDPDRIVLTAGATAANELLTFILANPGDALLIPTPYYPGFDRDL  166



>gb|AFO63005.1| ACC synthase [Hordeum vulgare]
Length=458

 Score =   107 bits (268),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRGG+ RFDP+R+V+TAGATAANELLTFILA+PGDALL+PTPYYPGFDRDL
Sbjct  109  SFMEKIRGGKVRFDPDRIVLTAGATAANELLTFILANPGDALLIPTPYYPGFDRDL  164



>gb|EMS52267.1| 1-aminocyclopropane-1-carboxylate synthase 7 [Triticum urartu]
Length=344

 Score =   107 bits (266),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRGG+ RFDP+R+V+TAGATAANELLTFILA+PGDALL+PTPYYPGFDRDL
Sbjct  111  SFMEKIRGGKVRFDPDRIVLTAGATAANELLTFILANPGDALLIPTPYYPGFDRDL  166



>gb|AID66718.1| 1-aminocyclopropane-1-carboxylate synthase 7, partial [Oncidium 
hybrid cultivar]
Length=394

 Score =   106 bits (265),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 47/56 (84%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFMEQIRG R +FDP+R+V+TAGATAANELLT ILADPGDA LVPTPYYPGF RDL
Sbjct  49   SFMEQIRGKRVKFDPDRMVLTAGATAANELLTSILADPGDAFLVPTPYYPGFSRDL  104



>gb|ABO68836.2| 1-aminocyclopropane-1-carboxylate synthase [Dendrobium hybrid 
cultivar]
Length=435

 Score =   107 bits (266),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 47/56 (84%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IR GR++FDP R+V+TAGATAANEL+TFILADPGDALLVPTPYYPGF RDL
Sbjct  103  SFMEKIRDGRSKFDPNRIVLTAGATAANELITFILADPGDALLVPTPYYPGFLRDL  158



>tpg|DAA53016.1| TPA: hypothetical protein ZEAMMB73_777642 [Zea mays]
Length=462

 Score =   107 bits (266),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            +FME++RGG+ARFDP+R+V+TAGATAANELLTF+LA+PGDALL+PTPYYPGFDRDL
Sbjct  118  NFMEKVRGGKARFDPDRIVLTAGATAANELLTFVLANPGDALLIPTPYYPGFDRDL  173



>ref|XP_006837379.1| hypothetical protein AMTR_s00111p00124560 [Amborella trichopoda]
 gb|ERN00233.1| hypothetical protein AMTR_s00111p00124560 [Amborella trichopoda]
Length=466

 Score =   106 bits (265),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 43/55 (78%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+IRGGR +FDP+++V+TAGATAANE+LTF +A+PGDALL+PTPYYPGFDRDL
Sbjct  101  FMEEIRGGRVKFDPDKIVLTAGATAANEILTFCIANPGDALLIPTPYYPGFDRDL  155



>dbj|BAC66951.1| ACC synthase [Striga hermonthica]
Length=446

 Score =   106 bits (265),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRGGRA FDPER+VITAGATAA+ELLTFILADPGDA+ VPTPYYPGFDRDL
Sbjct  109  SFMERIRGGRANFDPERIVITAGATAASELLTFILADPGDAVPVPTPYYPGFDRDL  164



>gb|EEE54037.1| hypothetical protein OsJ_00716 [Oryza sativa Japonica Group]
Length=306

 Score =   104 bits (259),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFM +IRGG+ARFDP+ +V+TAGATAANELLTFILA+PGDALL+PTPYYPGFDRDL
Sbjct  113  SFMGKIRGGKARFDPDHIVLTAGATAANELLTFILANPGDALLIPTPYYPGFDRDL  168



>emb|CAA65776.1| 1-aminocyclopropane-1-carboxylic acid synthase [Oryza sativa 
Indica Group]
Length=461

 Score =   104 bits (260),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFM +IRGG+ARFDP+ +V+TAGATAANELLTFILA+PGDALL+PTPYYPGFDRDL
Sbjct  113  SFMGKIRGGKARFDPDHIVLTAGATAANELLTFILANPGDALLIPTPYYPGFDRDL  168



>ref|NP_001042279.1| Os01g0192900 [Oryza sativa Japonica Group]
 dbj|BAB12704.1| putative 1-aminocyclopropane-1-carboxylate synthase 5 [Oryza 
sativa Japonica Group]
 dbj|BAF04193.1| Os01g0192900 [Oryza sativa Japonica Group]
Length=461

 Score =   104 bits (260),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFM +IRGG+ARFDP+ +V+TAGATAANELLTFILA+PGDALL+PTPYYPGFDRDL
Sbjct  113  SFMGKIRGGKARFDPDHIVLTAGATAANELLTFILANPGDALLIPTPYYPGFDRDL  168



>ref|XP_006655071.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Oryza brachyantha]
Length=272

 Score =   103 bits (256),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME IRGG+ RFDP+R+V+TAGATAANELLT ILA+PGDALLVPTPYYPGFDRDL
Sbjct  103  SFMETIRGGKVRFDPDRIVLTAGATAANELLTCILANPGDALLVPTPYYPGFDRDL  158



>gb|EAY72868.1| hypothetical protein OsI_00740 [Oryza sativa Indica Group]
Length=461

 Score =   104 bits (259),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFM +IRGG+ARFDP+ +V+TAGATAANELLTFILA+PGDALL+PTPYYPGFDRDL
Sbjct  113  SFMGKIRGGKARFDPDHIVLTAGATAANELLTFILANPGDALLIPTPYYPGFDRDL  168



>emb|CDX92755.1| BnaC07g40130D [Brassica napus]
Length=416

 Score =   103 bits (258),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 44/52 (85%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGF  158
            SFME+IRGG+ARFDP+R+V+TAGATAANELLTFILA+P DALLVPTPYYPG+
Sbjct  113  SFMEKIRGGKARFDPDRIVLTAGATAANELLTFILANPNDALLVPTPYYPGY  164



>gb|AAR00507.1| 1-aminocyclopropane-1-carboxylate synthase [Phalaenopsis hybrid 
cultivar]
Length=445

 Score =   103 bits (258),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 46/56 (82%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRGGR++FD  R+V+TAGATAANE+LTFILAD GDALLVPTPYYPGF RDL
Sbjct  103  SFMEKIRGGRSKFDANRIVLTAGATAANEILTFILADRGDALLVPTPYYPGFLRDL  158



>gb|AAB05849.1| 1-aminocyclopropane-1-carboxylate synthase [x Doritaenopsis sp.]
Length=444

 Score =   103 bits (258),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 46/56 (82%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRGGR++FD  R+V+TAGATAANE+LTFILAD GDALLVPTPYYPGF RDL
Sbjct  103  SFMEKIRGGRSKFDANRIVLTAGATAANEILTFILADRGDALLVPTPYYPGFLRDL  158



>emb|CDP03198.1| unnamed protein product [Coffea canephora]
Length=294

 Score =   102 bits (254),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPG  155
            SFMEQIRGGRA+FDP+RVVITAGATAANEL+TFILA+PGDALLVPTPYYPG
Sbjct  105  SFMEQIRGGRAKFDPDRVVITAGATAANELVTFILANPGDALLVPTPYYPG  155



>ref|XP_010050459.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Eucalyptus grandis]
Length=455

 Score =   103 bits (257),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME+IRGGRA+FDP RVV+TAGATAANELLTF+LAD G A LVPTPYYPGFDRDL
Sbjct  105  SFMEEIRGGRAKFDPRRVVLTAGATAANELLTFVLADRGSAWLVPTPYYPGFDRDL  160



>gb|AAR11524.1| 1-aminocyclopropane-1-carboxylate synthase 2 [Pinus sylvestris]
Length=365

 Score =   102 bits (254),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 43/55 (78%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME +RGG+ RFDP+R+V+TAGATAANELL F LA+PG+A LVPTPYYPGFDRDL
Sbjct  56   FMELVRGGKVRFDPDRIVLTAGATAANELLMFCLANPGEAFLVPTPYYPGFDRDL  110



>emb|CAA11158.1| ACC syntase [Musa acuminata AAA Group]
Length=439

 Score =   102 bits (255),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 53/56 (95%), Gaps = 1/56 (2%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            +FMEQIR GRA+FDPER+V+TA ATAANELLTFILADPGD LL+PTPYYPGFDRDL
Sbjct  103  TFMEQIREGRAKFDPERIVLTA-ATAANELLTFILADPGDCLLIPTPYYPGFDRDL  157



>ref|XP_003564782.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7 [Brachypodium 
distachyon]
Length=468

 Score =   102 bits (255),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FM +IRGG+A FDP+R+V+TAGATAANELLTFILA+PGDALL+PTPYYPGFDRDL
Sbjct  114  FMGKIRGGKASFDPDRIVLTAGATAANELLTFILANPGDALLIPTPYYPGFDRDL  168



>gb|ABM60747.1| ACC synthase [Picea glauca]
Length=447

 Score =   102 bits (253),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 42/55 (76%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME++RGG+ RFDP+R+V+TAGATAA+ELL F LA+PG+A LVPTPYYPGFDRDL
Sbjct  114  FMEEVRGGKVRFDPDRIVLTAGATAASELLMFCLANPGEAFLVPTPYYPGFDRDL  168



>ref|XP_006655194.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7-like 
[Oryza brachyantha]
Length=491

 Score =   102 bits (253),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
             ME+I GG+A FDP+R+V+TAGATAANELLTFILADPGDALL+PTPYYPGFDRDL
Sbjct  113  LMEKITGGKATFDPDRIVLTAGATAANELLTFILADPGDALLIPTPYYPGFDRDL  167



>gb|AAL35386.1| ACC synthase [Annona cherimola]
Length=372

 Score =   100 bits (250),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            +FME++RGGRA+FDP+R+V++ GAT A+EL+ F LADPGDA LVPTPYYPGFDRDL
Sbjct  72   NFMEKVRGGRAKFDPDRIVMSGGATGAHELIAFCLADPGDAFLVPTPYYPGFDRDL  127



>gb|EEE63240.1| hypothetical protein OsJ_18050 [Oryza sativa Japonica Group]
Length=422

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+I GG+A FDP+R+V+TAGATAANELLTFILADP DALL+PTPYYPGFDRDL
Sbjct  116  FMEKIMGGKATFDPDRIVLTAGATAANELLTFILADPRDALLIPTPYYPGFDRDL  170



>gb|AAV44081.1| putative 1-aminocyclopropane-1-carboxylate synthase [Oryza sativa 
Japonica Group]
 gb|AAV44121.1| putative 1-aminocyclopropane-1-carboxylate synthase [Oryza sativa 
Japonica Group]
Length=496

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+I GG+A FDP+R+V+TAGATAANELLTFILADP DALL+PTPYYPGFDRDL
Sbjct  116  FMEKIMGGKATFDPDRIVLTAGATAANELLTFILADPRDALLIPTPYYPGFDRDL  170



>gb|EAY97524.1| hypothetical protein OsI_19452 [Oryza sativa Indica Group]
Length=472

 Score =   100 bits (248),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+I GG+A FDP+R+V+TAGATAANELLTFILADP DALL+PTPYYPGFDRDL
Sbjct  116  FMEKIMGGKATFDPDRIVLTAGATAANELLTFILADPRDALLIPTPYYPGFDRDL  170



>ref|XP_006829176.1| hypothetical protein AMTR_s00001p00270760 [Amborella trichopoda]
 gb|ERM96592.1| hypothetical protein AMTR_s00001p00270760 [Amborella trichopoda]
Length=480

 Score = 99.8 bits (247),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 41/55 (75%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FMEQIRGGRA+FDP R+V++ GAT ANEL+ F LADPG+A L+PTPYYPGFDRD+
Sbjct  101  FMEQIRGGRAKFDPNRIVMSGGATGANELIAFCLADPGEAFLLPTPYYPGFDRDV  155



>gb|ACZ54911.3| 1-aminocyclopropane-1-carboxylic acid synthase [Narcissus tazetta 
var. chinensis]
Length=490

 Score = 99.8 bits (247),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME++RGGR RFDP+R+V++ GAT A EL+ F LADPGDA L+PTPYYPGFDRD 
Sbjct  109  FMEKVRGGRVRFDPDRIVMSGGATGAQELIAFCLADPGDAFLIPTPYYPGFDRDF  163



>gb|AAM21682.1|AF500119_1 1-aminocyclopropane-1-carboxylate synthase 1 [Persea americana]
Length=489

 Score = 99.4 bits (246),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME++RGGRA+F+P+R+V++ GAT A+EL+ F LADPGDA LVPTPYYPGFDRDL
Sbjct  106  FMEKVRGGRAKFNPDRIVMSGGATGAHELVAFCLADPGDAFLVPTPYYPGFDRDL  160



>gb|AAM80889.1| 1-aminocyclopropane-1-carboxylate synthase [Betula pendula]
Length=367

 Score = 97.4 bits (241),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 38/56 (68%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            +FM ++RGGR RFDP+R+V++ GAT ANEL+TF LADPGD  LVP+PYYP FDRD+
Sbjct  56   NFMGRVRGGRVRFDPDRIVMSGGATGANELITFCLADPGDVFLVPSPYYPAFDRDM  111



>dbj|BAA34923.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=477

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 41/55 (75%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME++RG R RFDPER+V++ GAT A+E L F LADPGDA LVPTPYYPGFDRDL
Sbjct  98   FMEKVRGDRVRFDPERIVMSGGATGAHESLAFCLADPGDAFLVPTPYYPGFDRDL  152



>ref|NP_001234164.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
 gb|AAK72433.1|AF179249_1 1-aminocyclopropane-1-carboxylate synthase 6 [Solanum lycopersicum]
 gb|AAQ17610.1|AF167428_1 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=477

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 41/55 (75%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME++RG R RFDPER+V++ GAT A+E L F LADPGDA LVPTPYYPGFDRDL
Sbjct  98   FMEKVRGDRVRFDPERIVMSGGATGAHESLAFCLADPGDAFLVPTPYYPGFDRDL  152



>dbj|BAA25916.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=477

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 41/55 (75%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME++RG R RFDPER+V++ GAT A+E L F LADPGDA LVPTPYYPGFDRDL
Sbjct  98   FMEKVRGDRVRFDPERIVMSGGATGAHESLAFCLADPGDAFLVPTPYYPGFDRDL  152



>ref|XP_006853996.1| hypothetical protein AMTR_s00036p00235090 [Amborella trichopoda]
 gb|ERN15463.1| hypothetical protein AMTR_s00036p00235090 [Amborella trichopoda]
Length=386

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            SFME++RGG  +FD +R+V+TAGATAANELLTF L D G+ALLVPTPYYPGFDRDL
Sbjct  119  SFMEEVRGGAVKFDADRLVLTAGATAANELLTFCLVDSGEALLVPTPYYPGFDRDL  174



>gb|AAB67988.1| ACC synthase [Malus domestica]
Length=364

 Score = 96.7 bits (239),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME++RG R  FDPER+V++ GAT A+E L F LADPGDA LVPTPYYPGFDRDL
Sbjct  57   FMEKVRGDRVTFDPERIVMSGGATGAHESLAFCLADPGDAFLVPTPYYPGFDRDL  111



>gb|AAB96880.1| 1-aminocyclopropane-1-carboxylate synthase, partial [Solanum 
tuberosum]
Length=366

 Score = 96.7 bits (239),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME++RG R  FDPER+V++ GAT A+E L F LADPGDA LVPTPYYPGFDRDL
Sbjct  57   FMEKVRGDRVTFDPERIVMSGGATGAHESLAFCLADPGDAFLVPTPYYPGFDRDL  111



>gb|AAD33789.1|AF144746_1 1-aminocyclopropane-1-carboxylate synthase [Solanum melongena]
Length=374

 Score = 96.3 bits (238),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME++RG R  FDPER+V++ GAT A+E L F LADPGDA LVPTPYYPGFDRDL
Sbjct  64   FMEKVRGDRVTFDPERIVMSGGATGAHESLAFCLADPGDAFLVPTPYYPGFDRDL  118



>gb|AAB05848.1| 1-aminocyclopropane-1-carboxylate synthase [x Doritaenopsis sp.]
Length=425

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 42/51 (82%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPG  155
            SFME+IRGGR++FD  R+V+TAGATAANE+LTFILAD GDALLVPTPYYPG
Sbjct  103  SFMEKIRGGRSKFDANRIVLTAGATAANEILTFILADRGDALLVPTPYYPG  153



>pdb|1IAX|A Chain A, Crystal Structure Of Acc Synthase Complexed With Plp
 pdb|1IAX|B Chain B, Crystal Structure Of Acc Synthase Complexed With Plp
 pdb|1IAY|A Chain A, Crystal Structure Of Acc Synthase Complexed With Cofactor 
Plp And Inhibitor Avg
Length=428

 Score = 96.3 bits (238),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+ RGGR RFDPERVV+  GAT ANE + F LADPGDA LVP+PYYP F+RDL
Sbjct  95   FMEKTRGGRVRFDPERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDL  149



>gb|AAC41663.1| 1-aminocyclopropane-1-carboxylate synthase, partial [Solanum 
tuberosum]
Length=455

 Score = 96.7 bits (239),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+ RGGR RFDPERVV+  GAT ANE + F LADPGDA LVP+PYYP F+RDL
Sbjct  75   FMEKTRGGRVRFDPERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDL  129



>ref|XP_010503635.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 9-like 
[Camelina sativa]
Length=470

 Score = 96.7 bits (239),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+IRG R RFDP ++V+ AG+T+ANE L F LA+PGDA L+PTPYYPGFDRDL
Sbjct  98   FMEEIRGNRVRFDPSKIVLAAGSTSANETLMFCLAEPGDAFLLPTPYYPGFDRDL  152



>ref|XP_010053217.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Eucalyptus 
grandis]
 gb|KCW77478.1| hypothetical protein EUGRSUZ_D01817 [Eucalyptus grandis]
Length=486

 Score = 97.1 bits (240),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FM ++RG + RFDP+R+V++ GAT A+EL+TF LADPGDALLVPTPYYPGFDRDL
Sbjct  106  FMGRVRGDKVRFDPDRIVMSGGATGAHELITFCLADPGDALLVPTPYYPGFDRDL  160



>gb|AAR11523.1| 1-aminocyclopropane-1-carboxylate synthase 1 [Pinus sylvestris]
Length=365

 Score = 95.5 bits (236),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            +FME +RG + +FD E +V+TAGATAANELL F LADPGDA LVPTPYYPGF RDL
Sbjct  58   NFMESLRGNKVKFDAESIVLTAGATAANELLMFCLADPGDAFLVPTPYYPGFVRDL  113



>emb|CAD44993.1| putative 1-aminocyclopropane-1-carboxylate synthase [Solanum 
lycopersicum]
Length=275

 Score = 94.7 bits (234),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+ RGGR RFDPERVV+  GAT ANE + F LADPGDA LVP+PYYP F+RDL
Sbjct  17   FMEKTRGGRVRFDPERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPVFNRDL  71



>emb|CAA44397.1| 1-aminocyclopropane 1-carboxylate synthase [Solanum lycopersicum]
Length=477

 Score = 96.7 bits (239),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+ RGGR RFDPERVV+  GAT ANE + F LADPGDA LVP+PYYP F+RDL
Sbjct  97   FMEKTRGGRVRFDPERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDL  151



>gb|AAA81580.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=485

 Score = 96.7 bits (239),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+ RGGR RFDPERVV+  GAT ANE + F LADPGDA LVP+PYYP F+RDL
Sbjct  105  FMEKTRGGRVRFDPERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDL  159



>emb|CAA41856.1| 1-aminocyclopropane 1-carboxylate synthase [Solanum lycopersicum]
Length=485

 Score = 96.7 bits (239),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+ RGGR RFDPERVV+  GAT ANE + F LADPGDA LVP+PYYP F+RDL
Sbjct  105  FMEKTRGGRVRFDPERVVMVGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDL  159



>sp|P18485.2|1A12_SOLLC RecName: Full=1-aminocyclopropane-1-carboxylate synthase 2; Short=ACC 
synthase 2; AltName: Full=Le-ACS2; Short=ACS-2; AltName: 
Full=S-adenosyl-L-methionine methylthioadenosine-lyase 
2 [Solanum lycopersicum]
 emb|CAA41855.1| 1-aminocyclopropane 1-carboxylate synthase [Solanum lycopersicum]
Length=485

 Score = 96.7 bits (239),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+ RGGR RFDPERVV+  GAT ANE + F LADPGDA LVP+PYYP F+RDL
Sbjct  105  FMEKTRGGRVRFDPERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDL  159



>ref|NP_001234178.1| 1-aminocyclopropane-1-carboxylate synthase 2 [Solanum lycopersicum]
 gb|AAP96918.1| ripening-related ACC synthase 2 [Solanum lycopersicum]
Length=485

 Score = 96.7 bits (239),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+ RGGR RFDPERVV+  GAT ANE + F LADPGDA LVP+PYYP F+RDL
Sbjct  105  FMEKTRGGRVRFDPERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDL  159



>ref|XP_006343931.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Solanum 
tuberosum]
Length=484

 Score = 96.7 bits (239),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME++RG R  FDP+R+V++ GAT A+E+L F LADPGDA LVPTPYYPGFDRDL
Sbjct  109  FMEKVRGDRVTFDPDRIVMSGGATGAHEMLAFCLADPGDAFLVPTPYYPGFDRDL  163



>dbj|BAB89349.1| 1-aminocyclopropane-1-carboxylate synthase [Diospyros kaki]
Length=488

 Score = 96.7 bits (239),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FM ++RGGRA FDP+R+V+  GAT ANELL F LADPGDA LVP+PYYP FDRDL
Sbjct  109  FMGKVRGGRAEFDPKRIVMGGGATGANELLMFCLADPGDAFLVPSPYYPAFDRDL  163



>ref|XP_003622479.1| 1-aminocyclopropane-1-carboxylate synthase [Medicago truncatula]
 gb|KEH18801.1| 1-aminocyclopropane-1-carboxylate synthase [Medicago truncatula]
Length=480

 Score = 96.3 bits (238),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FM ++RGGR RFDP R++++ GAT ANEL+ F LADPGDA LVPTPYYPGF RDL
Sbjct  105  FMSKVRGGRVRFDPNRILMSGGATGANELIMFCLADPGDAFLVPTPYYPGFVRDL  159



>ref|NP_001275367.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum tuberosum]
 dbj|BAB16433.1| ACC synthase [Solanum tuberosum]
Length=486

 Score = 96.7 bits (239),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME++RG R  FDPER+V++ GAT A+E L F LADPGDA LVPTPYYPGFDRDL
Sbjct  107  FMEKVRGDRVTFDPERIVMSGGATGAHESLAFCLADPGDAFLVPTPYYPGFDRDL  161



>gb|AAT84611.1| ACC synthase ALSACS2-1 [Alstroemeria peruviana]
Length=161

 Score = 92.4 bits (228),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
             FM+++RGGRA FDP+R+V++ GAT A EL++F LADPGDA L+PTPYYPGFDRD 
Sbjct  53   KFMQKVRGGRAAFDPDRIVMSGGATGAQELISFCLADPGDAFLIPTPYYPGFDRDF  108



>dbj|BAG30910.1| ACC synthase [Capsicum chinense]
Length=486

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+ RGGR RFDPERVV+  GAT ANE + F LADPGDA LVP+PYYP F+RDL
Sbjct  106  FMEKTRGGRVRFDPERVVMAGGATGANESIIFCLADPGDAFLVPSPYYPAFNRDL  160



>emb|CAA57716.1| 1-aminocyclopropane-1-carboxylate synthase [Capsicum annuum]
Length=363

 Score = 94.7 bits (234),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME++RG R  FDP R+V++ GAT A+E+L F LADPGDA LVPTPYYPGFDRDL
Sbjct  56   FMEKVRGDRVTFDPNRIVMSGGATGAHEMLAFCLADPGDAFLVPTPYYPGFDRDL  110



>gb|AAF97615.1|U18057_1 1-amino-cyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=483

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME++RG R  FDP R+V++ GAT A+E+L F LADPGDA LVPTPYYPGFDRDL
Sbjct  108  FMEKVRGDRVTFDPNRIVMSGGATGAHEMLAFCLADPGDAFLVPTPYYPGFDRDL  162



>ref|XP_006339629.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 2 [Solanum 
tuberosum]
Length=486

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+ RGGR RFDPERVV+  GAT ANE + F LADPGDA LVP+PYYP F+RDL
Sbjct  106  FMEKTRGGRVRFDPERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDL  160



>gb|AAF97614.1|U18056_1 1-amino-cyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=485

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME++RG R  FDP R+V++ GAT A+E+L F LADPGDA LVPTPYYPGFDRDL
Sbjct  108  FMEKVRGDRVTFDPNRIVMSGGATGAHEMLAFCLADPGDAFLVPTPYYPGFDRDL  162



>ref|NP_001233922.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
 gb|AAB17278.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=485

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME++RG R  FDP R+V++ GAT A+E+L F LADPGDA LVPTPYYPGFDRDL
Sbjct  108  FMEKVRGDRVTFDPNRIVMSGGATGAHEMLAFCLADPGDAFLVPTPYYPGFDRDL  162



>ref|NP_001266271.1| 1-aminocyclopropane-1-carboxylate synthase-like [Solanum lycopersicum]
 gb|AAB17279.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=483

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME++RG R  FDP R+V++ GAT A+E+L F LADPGDA LVPTPYYPGFDRDL
Sbjct  108  FMEKVRGDRVTFDPNRIVMSGGATGAHEMLAFCLADPGDAFLVPTPYYPGFDRDL  162



>gb|AEI60174.1| 1-aminocyclopropane-1-carboxylate synthase [Pelargonium x hortorum]
Length=332

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FM QIRG +  FDP ++V+TAGAT+ANE L F LADPG+A L+PTPYYPGFDRDL
Sbjct  17   FMSQIRGNKVTFDPSKLVLTAGATSANEALMFCLADPGEAFLLPTPYYPGFDRDL  71



>emb|CDP08761.1| unnamed protein product [Coffea canephora]
Length=441

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FM ++RGGR  FDP R+V+  GAT A+EL+TF LADPGDA LVPTPYYP FDRDL
Sbjct  56   FMGKVRGGRVSFDPARIVLAGGATGASELITFCLADPGDAFLVPTPYYPAFDRDL  110



>ref|XP_006343930.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Solanum 
tuberosum]
Length=485

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME++RG +  FDP+R+V++ GAT A+E+L F LADPGDA LVPTPYYPGFDRDL
Sbjct  108  FMEKVRGDKVTFDPDRIVMSGGATGAHEMLAFCLADPGDAFLVPTPYYPGFDRDL  162



>gb|AEM65195.1| ACC synthase [Garcinia mangostana]
Length=404

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
             ME+IRGG+  FDPER+V++ GAT ANEL+ F LADPGDA LVP+PYYP F+RDL
Sbjct  97   LMEKIRGGKVTFDPERIVMSGGATGANELIIFCLADPGDAFLVPSPYYPAFNRDL  151



>ref|XP_009590053.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana 
tomentosiformis]
Length=485

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME++RG +  FDP RVV++ GAT A+E+L F LADPGDA LVPTPYYPGFDRDL
Sbjct  108  FMERVRGDKVTFDPNRVVMSGGATGAHEMLAFCLADPGDAFLVPTPYYPGFDRDL  162



>gb|ACI32113.1| 1-aminocyclopropane-1-carboxylate synthase, partial [Musa acuminata 
AAA Group]
Length=189

 Score = 91.7 bits (226),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
             FME++RGGRARFDP+R+V++ GAT A E + F LADPG+A L+PTPYYPGFDRD 
Sbjct  25   QFMEKVRGGRARFDPDRIVMSGGATGAQETIAFCLADPGEAFLIPTPYYPGFDRDF  80



>gb|AAC32840.1| 1-aminocyclopropane-1-carboxylate synthase 5, partial [Sinapis 
arvensis]
Length=251

 Score = 92.8 bits (229),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+IRG R  FDP+++V+ AG+T+ANE L F LA+PGDA L+PTPYYPGFDRDL
Sbjct  52   FMEEIRGNRVTFDPKKIVLAAGSTSANETLMFCLAEPGDAFLLPTPYYPGFDRDL  106



>emb|CDX81296.1| BnaC09g07070D [Brassica napus]
Length=439

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+IRG R  FDP+++V+ AG+T+ANE L F LA+PGDA L+PTPYYPGFDRDL
Sbjct  98   FMEEIRGNRVTFDPKKIVLAAGSTSANETLMFCLAEPGDAFLLPTPYYPGFDRDL  152



>emb|CDY18674.1| BnaA09g07210D [Brassica napus]
Length=439

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+IRG R  FDP+++V+ AG+T+ANE L F LA+PGDA L+PTPYYPGFDRDL
Sbjct  98   FMEEIRGNRVTFDPKKIVLAAGSTSANETLMFCLAEPGDAFLLPTPYYPGFDRDL  152



>gb|AAR99393.1| ACC synthase ACS3b [Nicotiana attenuata]
Length=485

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME++RG +  FDP R+V++ GAT A+E+L F LADPGDA LVPTPYYPGFDRDL
Sbjct  108  FMERVRGDKVXFDPNRIVMSGGATGAHEMLAFCLADPGDAFLVPTPYYPGFDRDL  162



>dbj|BAF33503.1| ACC synthase [Orobanche minor]
Length=497

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FM + RGG+ +FDPER+V+  GAT ANELL F LADP DA L+PTPYYPGFDRDL
Sbjct  109  FMGKSRGGKVKFDPERIVMAGGATGANELLMFCLADPKDAFLIPTPYYPGFDRDL  163



>ref|XP_009771943.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana 
sylvestris]
Length=484

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME++RG +  FDP R+V++ GAT A+E+L F LADPGDA LVPTPYYPGFDRDL
Sbjct  107  FMERVRGDKVTFDPNRIVMSGGATGAHEMLAFCLADPGDAFLVPTPYYPGFDRDL  161



>gb|AAC32839.1| 1-aminocyclopropane-1-carboxylate synthase 4 [Sinapis arvensis]
Length=251

 Score = 92.4 bits (228),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+IRG R  FDP+++V+ AG+T+ANE L F LA+PGDA L+PTPYYPGFDRDL
Sbjct  52   FMEEIRGNRVTFDPKKIVLAAGSTSANETLMFCLAEPGDAFLLPTPYYPGFDRDL  106



>ref|XP_006292599.1| hypothetical protein CARUB_v10018840mg, partial [Capsella rubella]
 gb|EOA25497.1| hypothetical protein CARUB_v10018840mg, partial [Capsella rubella]
Length=496

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            +FME+ RGGRARF+ ERVV++ GAT ANE L F LADPGDA LVPTPYY  FDRDL
Sbjct  111  AFMERARGGRARFEAERVVMSGGATGANETLMFCLADPGDAFLVPTPYYAAFDRDL  166



>ref|XP_010484425.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 5-like 
[Camelina sativa]
Length=470

 Score = 94.4 bits (233),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+IRG R  FDP+++V+ AG+T+ANE L F LA+PGDA L+PTPYYPGFDRDL
Sbjct  98   FMEEIRGNRVTFDPKKIVLAAGSTSANETLMFCLAEPGDAFLLPTPYYPGFDRDL  152



>ref|XP_010463583.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 5 [Camelina 
sativa]
Length=470

 Score = 94.4 bits (233),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+IRG R  FDP+++V+ AG+T+ANE L F LA+PGDA L+PTPYYPGFDRDL
Sbjct  98   FMEEIRGNRVTFDPKKIVLAAGSTSANETLMFCLAEPGDAFLLPTPYYPGFDRDL  152



>ref|XP_009112200.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 5-like 
[Brassica rapa]
Length=470

 Score = 94.4 bits (233),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+IRG R  FDP+++V+ AG+T+ANE L F LA+PGDA L+PTPYYPGFDRDL
Sbjct  98   FMEEIRGNRVTFDPKKIVLAAGSTSANETLMFCLAEPGDAFLLPTPYYPGFDRDL  152



>ref|XP_009130528.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 5 [Brassica 
rapa]
Length=470

 Score = 94.4 bits (233),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+IRG R  FDP+++V+ AG+T+ANE L F LA+PGDA L+PTPYYPGFDRDL
Sbjct  98   FMEEIRGNRVTFDPKKIVLAAGSTSANETLMFCLAEPGDAFLLPTPYYPGFDRDL  152



>gb|KFK28459.1| hypothetical protein AALP_AA8G517100 [Arabis alpina]
Length=470

 Score = 94.4 bits (233),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+IRG R  FDP+++V+ AG+T+ANE L F LA+PGDA L+PTPYYPGFDRDL
Sbjct  98   FMEEIRGNRVTFDPKKIVLAAGSTSANETLMFCLAEPGDAFLLPTPYYPGFDRDL  152



>ref|XP_006393985.1| hypothetical protein EUTSA_v10004145mg [Eutrema salsugineum]
 gb|ESQ31271.1| hypothetical protein EUTSA_v10004145mg [Eutrema salsugineum]
Length=470

 Score = 94.4 bits (233),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+IRG R  FDP+++V+ AG+T+ANE L F LA+PGDA L+PTPYYPGFDRDL
Sbjct  98   FMEEIRGNRVTFDPKKIVLAAGSTSANETLMFCLAEPGDAFLLPTPYYPGFDRDL  152



>ref|XP_006280412.1| hypothetical protein CARUB_v10026345mg [Capsella rubella]
 gb|EOA13310.1| hypothetical protein CARUB_v10026345mg [Capsella rubella]
Length=470

 Score = 94.4 bits (233),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+IRG R  FDP+++V+ AG+T+ANE L F LA+PGDA L+PTPYYPGFDRDL
Sbjct  98   FMEEIRGNRVTFDPKKIVLAAGSTSANETLMFCLAEPGDAFLLPTPYYPGFDRDL  152



>ref|NP_201381.1| 1-aminocyclopropane-1-carboxylate synthase 5 [Arabidopsis thaliana]
 sp|Q37001.1|1A15_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate synthase 5; Short=ACC 
synthase 5; AltName: Full=Ethylene-overproduction protein 
2; AltName: Full=S-adenosyl-L-methionine methylthioadenosine-lyase 
5 [Arabidopsis thaliana]
 gb|AAG50098.1|AF334720_1 1-aminocyclopropane-1-carboxylate synthase ACS5 [Arabidopsis 
thaliana]
 gb|AAA87291.1| 1-amino-1-cyclopropanecarboxylate synthase [Arabidopsis thaliana]
 gb|AAA87292.1| 1-amino-1-cyclopropanecarboxylate synthase [Arabidopsis thaliana]
 emb|CAA16680.1| 1-aminocyclopropane-1-carboxylate synthase; ACS5 [Arabidopsis 
thaliana]
 dbj|BAB10687.1| 1-aminocyclopropane-1-carboxylate synthase ACS5 [Arabidopsis 
thaliana]
 dbj|BAF00967.1| 1-aminocyclopropane-1-carboxylate synthase ACS5 [Arabidopsis 
thaliana]
 gb|AED98109.1| 1-aminocyclopropane-1-carboxylate synthase 5 [Arabidopsis thaliana]
Length=470

 Score = 94.4 bits (233),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+IRG R  FDP+++V+ AG+T+ANE L F LA+PGDA L+PTPYYPGFDRDL
Sbjct  98   FMEEIRGNRVTFDPKKIVLAAGSTSANETLMFCLAEPGDAFLLPTPYYPGFDRDL  152



>ref|XP_010444599.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 5-like 
[Camelina sativa]
Length=470

 Score = 94.4 bits (233),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+IRG R  FDP+++V+ AG+T+ANE L F LA+PGDA L+PTPYYPGFDRDL
Sbjct  98   FMEEIRGNRVTFDPKKIVLAAGSTSANETLIFCLAEPGDAFLLPTPYYPGFDRDL  152



>gb|AAC70351.2| ACC synthase 1 [Antirrhinum majus]
Length=348

 Score = 92.8 bits (229),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME++RG R RFDP+++V++ GAT A E L F LADPGDALLVPTPYYPG DRD+
Sbjct  49   FMEKVRGNRVRFDPDKIVMSGGATGAQETLAFCLADPGDALLVPTPYYPGNDRDI  103



>gb|AAL50560.1| 1-aminocyclopropane-1-carboxylate synthase 9 [Nicotiana tabacum]
Length=109

 Score = 89.0 bits (219),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME++RG +  FDP RVV++ GAT A+E+L F LADPGDA LVPTPYYPGFDRDL
Sbjct  9    FMERVRGDKVTFDPSRVVMSGGATGAHEMLAFCLADPGDAFLVPTPYYPGFDRDL  63



>gb|AAC32838.1| 1-aminocyclopropane-1-carboxylate synthase 3, partial [Sinapis 
arvensis]
Length=251

 Score = 92.0 bits (227),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+IRG R  FDP ++V+ AG+T+ANE L F LA+PGDA L+PTPYYPGFDRDL
Sbjct  52   FMEEIRGNRVSFDPSKIVLAAGSTSANETLMFCLAEPGDAFLLPTPYYPGFDRDL  106



>emb|CDY23035.1| BnaC07g31520D [Brassica napus]
Length=466

 Score = 94.0 bits (232),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+IRG R  FDP ++V+ AG+T+ANE L F LA+PGDA L+PTPYYPGFDRDL
Sbjct  98   FMEEIRGNRVTFDPSKIVLAAGSTSANETLMFCLAEPGDAFLLPTPYYPGFDRDL  152



>ref|XP_010515330.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 9-like 
[Camelina sativa]
Length=470

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+IRG R  FDP ++V+ AG+T+ANE L F LA+PGDA L+PTPYYPGFDRDL
Sbjct  98   FMEEIRGNRVTFDPRKIVLAAGSTSANETLMFCLAEPGDAFLLPTPYYPGFDRDL  152



>emb|CDY05953.1| BnaC08g21300D [Brassica napus]
Length=470

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+IRG R  FDP ++V+ AG+T+ANE L F LA+PGDA L+PTPYYPGFDRDL
Sbjct  98   FMEEIRGNRVTFDPRKIVLAAGSTSANETLMFCLAEPGDAFLLPTPYYPGFDRDL  152



>emb|CDY08163.1| BnaA06g15630D [Brassica napus]
Length=470

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+IRG R  FDP ++V+ AG+T+ANE L F LA+PGDA L+PTPYYPGFDRDL
Sbjct  98   FMEEIRGNRVTFDPRKIVLAAGSTSANETLMFCLAEPGDAFLLPTPYYPGFDRDL  152



>ref|XP_010426493.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 9 isoform 
X1 [Camelina sativa]
 ref|XP_010426494.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 9 isoform 
X2 [Camelina sativa]
Length=470

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+IRG R  FDP ++V+ AG+T+ANE L F LA+PGDA L+PTPYYPGFDRDL
Sbjct  98   FMEEIRGNRVTFDPSKIVLAAGSTSANETLMFCLAEPGDAFLLPTPYYPGFDRDL  152



>ref|XP_009136516.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 9 [Brassica 
rapa]
 emb|CDY02111.1| BnaA03g40560D [Brassica napus]
Length=470

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+IRG R  FDP ++V+ AG+T+ANE L F LA+PGDA L+PTPYYPGFDRDL
Sbjct  98   FMEEIRGNRVTFDPSKIVLAAGSTSANETLMFCLAEPGDAFLLPTPYYPGFDRDL  152



>ref|NP_190539.1| 1-aminocyclopropane-1-carboxylate synthase 9 [Arabidopsis thaliana]
 sp|Q9M2Y8.1|1A19_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate synthase 9; Short=ACC 
synthase 9; AltName: Full=Ethylene-overproduction protein 
3; AltName: Full=S-adenosyl-L-methionine methylthioadenosine-lyase 
9 [Arabidopsis thaliana]
 gb|AAG48755.1|AF332391_1 1-aminocyclopropane-1-carboxylate synthase ACS9 [Arabidopsis 
thaliana]
 emb|CAB66908.1| 1-aminocyclopropane-1-carboxylate synthase-like protein [Arabidopsis 
thaliana]
 gb|AEE78578.1| 1-aminocyclopropane-1-carboxylate synthase 9 [Arabidopsis thaliana]
Length=470

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+IRG R  FDP ++V+ AG+T+ANE L F LA+PGDA L+PTPYYPGFDRDL
Sbjct  98   FMEEIRGNRVTFDPSKIVLAAGSTSANETLMFCLAEPGDAFLLPTPYYPGFDRDL  152



>ref|XP_006293030.1| hypothetical protein CARUB_v10019310mg [Capsella rubella]
 gb|EOA25928.1| hypothetical protein CARUB_v10019310mg [Capsella rubella]
Length=470

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+IRG R  FDP ++V+ AG+T+ANE L F LA+PGDA L+PTPYYPGFDRDL
Sbjct  98   FMEEIRGNRVTFDPSKIVLAAGSTSANETLMFCLAEPGDAFLLPTPYYPGFDRDL  152



>ref|XP_002877694.1| hypothetical protein ARALYDRAFT_348080 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53953.1| hypothetical protein ARALYDRAFT_348080 [Arabidopsis lyrata subsp. 
lyrata]
Length=470

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+IRG R  FDP ++V+ AG+T+ANE L F LA+PGDA L+PTPYYPGFDRDL
Sbjct  98   FMEEIRGNRVTFDPSKIVLAAGSTSANETLMFCLAEPGDAFLLPTPYYPGFDRDL  152



>ref|XP_011023276.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Populus euphratica]
Length=486

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME++RGGR  FDP+R+V++ GAT ANEL+ F LADPGDA LVP+PYYP F RDL
Sbjct  102  FMERVRGGRVTFDPDRIVMSGGATGANELIMFCLADPGDAFLVPSPYYPAFYRDL  156



>emb|CAD44267.2| putative aminocyclopropane carboxylic acid synthase [Musa AAB 
Group]
Length=485

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 37/55 (67%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+++GGRARFDP+R+V++ GAT A E + F LADPG+A L+PTPYYPGFDRD 
Sbjct  108  FMEKVKGGRARFDPDRIVMSGGATGAQETIAFCLADPGEAFLIPTPYYPGFDRDF  162



>gb|KHG22476.1| 1-aminocyclopropane-1-carboxylate synthase [Gossypium arboreum]
Length=475

 Score = 94.0 bits (232),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 37/55 (67%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FM ++RGGR +FDP+R+V++ GAT A+E++ F LADPG+A LVPTPYYPGFDRDL
Sbjct  98   FMGKVRGGRVKFDPDRIVMSGGATGAHEMVAFCLADPGEAFLVPTPYYPGFDRDL  152



>gb|AAC70353.2| ACC synthase 3 [Antirrhinum majus]
Length=434

 Score = 93.2 bits (230),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            +FM +IRG +  FDP ++V+TAGAT+ANE L F LA+PGDA L+PTPYYPGFDRDL
Sbjct  96   NFMSEIRGNKVNFDPNKLVLTAGATSANETLMFCLAEPGDAFLLPTPYYPGFDRDL  151



>ref|XP_004492797.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Cicer arietinum]
Length=483

 Score = 94.0 bits (232),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            +FM ++RGGR RFDP+R++++ GAT ANEL+ F LADPGDA LVP+PYYP F RDL
Sbjct  104  NFMSKVRGGRVRFDPDRILMSGGATGANELIMFCLADPGDAFLVPSPYYPAFVRDL  159



>gb|AES80302.2| 1-aminocyclopropane-1-carboxylate synthase [Medicago truncatula]
Length=484

 Score = 94.0 bits (232),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            +FM ++RGGR RFDP+R++++ GAT ANEL+ F LADPGDA LVP+PYYP F RDL
Sbjct  104  NFMSKVRGGRVRFDPDRILMSGGATGANELIMFCLADPGDAFLVPSPYYPAFVRDL  159



>ref|XP_002271055.2| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 7 [Vitis 
vinifera]
 emb|CBI25768.3| unnamed protein product [Vitis vinifera]
Length=506

 Score = 94.0 bits (232),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 39/56 (70%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            +FM ++RG R + DP+ +V+TAGATA NE+LTF +ADPG+ALLVPTPYYPGFDRDL
Sbjct  128  NFMAEVRGRRVKIDPDMIVLTAGATAGNEILTFCIADPGEALLVPTPYYPGFDRDL  183



>dbj|BAG30909.1| ACC synthase [Capsicum chinense]
Length=485

 Score = 94.0 bits (232),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME++RG +  FDP R+V++ GAT A+E+L F LADPGDA LVPTPYYPGFDRDL
Sbjct  108  FMEKVRGDKVTFDPNRIVMSGGATGAHEMLAFCLADPGDAFLVPTPYYPGFDRDL  162



>ref|XP_010279043.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nelumbo 
nucifera]
Length=482

 Score = 94.0 bits (232),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    SFMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            +FM ++RGGR  FDPER+V++ GAT A E+L F LADPGDA LVP+PYYP FDRDL
Sbjct  103  NFMGRVRGGRITFDPERIVMSGGATGAQEMLAFCLADPGDAFLVPSPYYPAFDRDL  158



>ref|XP_006404112.1| hypothetical protein EUTSA_v10011085mg [Eutrema salsugineum]
 gb|ESQ45565.1| hypothetical protein EUTSA_v10011085mg [Eutrema salsugineum]
Length=470

 Score = 93.6 bits (231),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+IRG R  FDP ++V+ AG+T+ANE L F LA+PGDA L+PTPYYPGFDRDL
Sbjct  98   FMEEIRGNRVTFDPTKIVLAAGSTSANETLMFCLAEPGDAFLLPTPYYPGFDRDL  152



>gb|ADF31934.1| 1-aminocyclopropane-1-carboxylate synthase 5 [Brassica oleracea 
var. alboglabra]
Length=143

 Score = 89.4 bits (220),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+IRG R  FDP+++V+ AG+T+ANE L F LA+PGDA L+PTPYYPGFDRDL
Sbjct  25   FMEEIRGNRVTFDPKKIVLAAGSTSANETLMFCLAEPGDAFLLPTPYYPGFDRDL  79



>gb|ABJ99502.1| 1-aminocyclopropane-1-carboxylate synthase [Gossypium hirsutum]
Length=475

 Score = 93.6 bits (231),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 37/55 (67%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FM ++RGGR +FDP+R+V++ GAT A+E++ F LADPG+A LVPTPYYPGFDRDL
Sbjct  98   FMGKVRGGRVKFDPDRIVMSGGATGAHEMVAFCLADPGEAFLVPTPYYPGFDRDL  152



>emb|CAN77934.1| hypothetical protein VITISV_021265 [Vitis vinifera]
Length=456

 Score = 93.6 bits (231),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FM ++RG R  FDP+R+V++ GAT A+EL+TF LADPGDA LVPTPYYPGFDRDL
Sbjct  92   FMGKVRGDRVVFDPDRIVMSGGATGAHELVTFCLADPGDAFLVPTPYYPGFDRDL  146



>ref|XP_009109390.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 8 [Brassica 
rapa]
Length=469

 Score = 93.6 bits (231),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FM + RG R  FDP+++V+TAGAT+ANE L F LADPGDA L+PTPYYPGFDRDL
Sbjct  98   FMSENRGNRVSFDPKKLVLTAGATSANETLMFCLADPGDAFLLPTPYYPGFDRDL  152



>emb|CDX69326.1| BnaC01g01270D [Brassica napus]
Length=469

 Score = 93.6 bits (231),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FM + RG R  FDP+++V+TAGAT+ANE L F LADPGDA L+PTPYYPGFDRDL
Sbjct  98   FMSENRGNRVSFDPKKLVLTAGATSANETLMFCLADPGDAFLLPTPYYPGFDRDL  152



>emb|CDY69462.1| BnaAnng30490D [Brassica napus]
Length=469

 Score = 93.6 bits (231),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FM + RG R  FDP+++V+TAGAT+ANE L F LADPGDA L+PTPYYPGFDRDL
Sbjct  98   FMSENRGNRVSFDPKKLVLTAGATSANETLMFCLADPGDAFLLPTPYYPGFDRDL  152



>gb|ABC75833.1| 1-aminocyclopropane-1-carboxylate synthase [Gossypium hirsutum]
Length=475

 Score = 93.6 bits (231),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 37/55 (67%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FM ++RGGR +FDP+R+V++ GAT A+E++ F LADPG+A LVPTPYYPGFDRDL
Sbjct  98   FMGKVRGGRVKFDPDRIVMSGGATGAHEMVAFCLADPGEAFLVPTPYYPGFDRDL  152



>ref|XP_010026543.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 3-like 
[Eucalyptus grandis]
Length=469

 Score = 93.6 bits (231),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    FMEQIRGGRARFDPERVVITAGATAANELLTFILADPGDALLVPTPYYPGFDRDL  170
            FME+IRG +  FDP ++V+TAGAT+ANE L F LA+ GDA+L+PTPYYPGFDRDL
Sbjct  99   FMEEIRGNKVSFDPNKIVLTAGATSANETLIFCLAEKGDAILIPTPYYPGFDRDL  153



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 513120851568