BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c11955_g1_i1 len=1769 path=[85:0-394 65:395-413 84:414-1768]

Length=1769
                                                                      Score     E

ref|XP_009628579.1|  PREDICTED: prolyl endopeptidase-like               746   0.0      
ref|XP_009761497.1|  PREDICTED: prolyl endopeptidase-like               740   0.0      
ref|XP_009775532.1|  PREDICTED: prolyl endopeptidase isoform X3         723   0.0      
ref|XP_009775531.1|  PREDICTED: prolyl endopeptidase isoform X2         724   0.0      
ref|XP_011099789.1|  PREDICTED: prolyl endopeptidase-like               729   0.0      
ref|XP_006355174.1|  PREDICTED: prolyl endopeptidase-like               728   0.0      
ref|XP_009775530.1|  PREDICTED: prolyl endopeptidase isoform X1         723   0.0      
ref|XP_010324785.1|  PREDICTED: prolyl endopeptidase isoform X4         718   0.0      
ref|XP_010324784.1|  PREDICTED: prolyl endopeptidase isoform X3         718   0.0      
ref|XP_004244855.1|  PREDICTED: prolyl endopeptidase isoform X2         719   0.0      
ref|XP_010101294.1|  Prolyl endopeptidase                               719   0.0      
ref|XP_010324783.1|  PREDICTED: prolyl endopeptidase isoform X1         719   0.0      
ref|XP_011074726.1|  PREDICTED: prolyl endopeptidase-like               718   0.0      
ref|XP_003523219.1|  PREDICTED: prolyl endopeptidase-like               716   0.0      
ref|XP_007136135.1|  hypothetical protein PHAVU_009G020800g             714   0.0      
gb|KDP36852.1|  hypothetical protein JCGZ_08143                         714   0.0      
ref|XP_010266944.1|  PREDICTED: prolyl endopeptidase-like               716   0.0      
ref|XP_004291316.1|  PREDICTED: prolyl endopeptidase-like               713   0.0      
ref|XP_007160609.1|  hypothetical protein PHAVU_001G001700g             713   0.0      
gb|KCW70284.1|  hypothetical protein EUGRSUZ_F03531                     713   0.0      
ref|XP_011034924.1|  PREDICTED: prolyl endopeptidase-like               711   0.0      
gb|EYU17544.1|  hypothetical protein MIMGU_mgv1a001978mg                711   0.0      
gb|KCW70285.1|  hypothetical protein EUGRSUZ_F03531                     711   0.0      
ref|XP_010063100.1|  PREDICTED: LOW QUALITY PROTEIN: prolyl endop...    713   0.0      
ref|XP_003545007.2|  PREDICTED: prolyl endopeptidase-like               711   0.0      
gb|KHN12595.1|  Prolyl endopeptidase                                    710   0.0      
ref|XP_002300671.1|  prolyl oligopeptidase family protein               709   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011041281.1|  PREDICTED: prolyl endopeptidase-like               711   0.0      
ref|XP_010266084.1|  PREDICTED: prolyl endopeptidase-like               709   0.0      
ref|XP_009334405.1|  PREDICTED: prolyl endopeptidase-like isoform X1    707   0.0      
ref|XP_009334412.1|  PREDICTED: prolyl endopeptidase-like isoform X2    707   0.0      
gb|AEX58649.1|  prolyl oligopeptidase                                   706   0.0      
emb|CDP07325.1|  unnamed protein product                                706   0.0      
gb|AEX58648.1|  prolyl oligopeptidase                                   705   0.0      
ref|XP_004238404.1|  PREDICTED: prolyl endopeptidase-like               705   0.0      
ref|XP_004145530.1|  PREDICTED: prolyl endopeptidase-like               704   0.0      
ref|XP_009333758.1|  PREDICTED: prolyl endopeptidase-like               704   0.0      
ref|XP_002307762.1|  prolyl oligopeptidase family protein               704   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008221184.1|  PREDICTED: prolyl endopeptidase-like isoform X3    700   0.0      
gb|KGN55478.1|  hypothetical protein Csa_4G652900                       704   0.0      
gb|ADN34133.1|  serine-type endopeptidase                               702   0.0      
ref|XP_008350482.1|  PREDICTED: prolyl endopeptidase-like               703   0.0      
ref|XP_008221183.1|  PREDICTED: prolyl endopeptidase-like isoform X2    700   0.0      
ref|XP_007225583.1|  hypothetical protein PRUPE_ppa001887m1g            694   0.0      
ref|XP_008452924.1|  PREDICTED: prolyl endopeptidase-like               702   0.0      
ref|XP_009595595.1|  PREDICTED: prolyl endopeptidase                    700   0.0      
ref|XP_007017945.1|  Prolyl oligopeptidase family protein               702   0.0      
ref|XP_008221182.1|  PREDICTED: prolyl endopeptidase-like isoform X1    700   0.0      
ref|XP_010664095.1|  PREDICTED: prolyl endopeptidase isoform X2         698   0.0      
emb|CBI18894.3|  unnamed protein product                                698   0.0      
emb|CAN70125.1|  hypothetical protein VITISV_001107                     697   0.0      Vitis vinifera
ref|XP_008377101.1|  PREDICTED: prolyl endopeptidase                    697   0.0      
ref|XP_006342100.1|  PREDICTED: prolyl endopeptidase-like isoform X2    694   0.0      
ref|XP_006342099.1|  PREDICTED: prolyl endopeptidase-like isoform X1    696   0.0      
ref|XP_008221181.1|  PREDICTED: prolyl endopeptidase-like               696   0.0      
ref|XP_002285910.2|  PREDICTED: prolyl endopeptidase isoform X1         698   0.0      Vitis vinifera
ref|XP_011041280.1|  PREDICTED: prolyl endopeptidase-like               695   0.0      
ref|XP_002890385.1|  hypothetical protein ARALYDRAFT_472267             695   0.0      
ref|XP_007227012.1|  hypothetical protein PRUPE_ppa001441mg             698   0.0      
gb|KHF99507.1|  Prolyl endopeptidase                                    695   0.0      
ref|XP_002306966.1|  prolyl oligopeptidase family protein               694   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009384008.1|  PREDICTED: prolyl endopeptidase-like               696   0.0      
ref|XP_002301932.2|  hypothetical protein POPTR_0002s01530g             691   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004500899.1|  PREDICTED: prolyl endopeptidase-like               689   0.0      
ref|XP_010498470.1|  PREDICTED: prolyl endopeptidase-like               688   0.0      
ref|XP_006473741.1|  PREDICTED: prolyl endopeptidase-like               687   0.0      
ref|XP_010477279.1|  PREDICTED: prolyl endopeptidase-like isoform X2    687   0.0      
ref|XP_006435285.1|  hypothetical protein CICLE_v10000298mg             688   0.0      
ref|XP_010477278.1|  PREDICTED: prolyl endopeptidase-like isoform X1    686   0.0      
ref|XP_010459719.1|  PREDICTED: prolyl endopeptidase-like               685   0.0      
ref|XP_006435284.1|  hypothetical protein CICLE_v10000298mg             687   0.0      
ref|XP_004499318.1|  PREDICTED: prolyl endopeptidase-like               684   0.0      
emb|CDY69652.1|  BnaCnng64630D                                          682   0.0      
ref|XP_009128156.1|  PREDICTED: prolyl endopeptidase-like               684   0.0      
ref|XP_006416406.1|  hypothetical protein EUTSA_v10006924mg             681   0.0      
ref|XP_010667346.1|  PREDICTED: prolyl endopeptidase-like               684   0.0      
gb|KEH40256.1|  prolyl oligopeptidase-like protein                      683   0.0      
ref|XP_010918173.1|  PREDICTED: prolyl endopeptidase                    683   0.0      
emb|CDY55199.1|  BnaCnng28400D                                          681   0.0      
gb|KFK44154.1|  hypothetical protein AALP_AA1G222100                    679   0.0      
ref|XP_008791969.1|  PREDICTED: LOW QUALITY PROTEIN: prolyl endop...    679   0.0      
emb|CDY29532.1|  BnaA06g14380D                                          676   0.0      
ref|XP_009149522.1|  PREDICTED: prolyl endopeptidase                    675   0.0      
ref|NP_177741.3|  prolyl oligopeptidase                                 676   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KEH36278.1|  prolyl oligopeptidase-like protein                      674   0.0      
gb|AAL86330.1|  putative prolyl endopeptidase                           674   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_001117606.1|  prolyl oligopeptidase                              676   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006301553.1|  hypothetical protein CARUB_v10021987mg             676   0.0      
ref|NP_173463.1|  Prolyl oligopeptidase family protein                  672   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006828887.1|  hypothetical protein AMTR_s00001p00185410          671   0.0      
gb|AAF88151.1|AC026234_2  Contains similarity to a rPOP protein f...    671   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006390231.1|  hypothetical protein EUTSA_v10018135mg             669   0.0      
ref|XP_007017944.1|  Prolyl oligopeptidase family protein               670   0.0      
ref|XP_010428665.1|  PREDICTED: prolyl endopeptidase-like               672   0.0      
emb|CDX87635.1|  BnaA07g32380D                                          669   0.0      
ref|XP_010416526.1|  PREDICTED: prolyl endopeptidase-like               671   0.0      
ref|XP_011034925.1|  PREDICTED: prolyl endopeptidase-like               667   0.0      
ref|XP_006303918.1|  hypothetical protein CARUB_v10008428mg             667   0.0      
ref|XP_010471763.1|  PREDICTED: prolyl endopeptidase-like               670   0.0      
ref|XP_010536444.1|  PREDICTED: prolyl endopeptidase-like               667   0.0      
ref|XP_006493142.1|  PREDICTED: prolyl endopeptidase-like               661   0.0      
ref|XP_009106269.1|  PREDICTED: prolyl endopeptidase                    670   0.0      
emb|CDY31465.1|  BnaC05g15740D                                          666   0.0      
ref|XP_006390232.1|  hypothetical protein EUTSA_v10018135mg             668   0.0      
ref|XP_006478474.1|  PREDICTED: prolyl endopeptidase-like isoform X1    665   0.0      
ref|XP_006478476.1|  PREDICTED: prolyl endopeptidase-like isoform X3    665   0.0      
ref|XP_006478479.1|  PREDICTED: prolyl endopeptidase-like isoform X1    665   0.0      
ref|XP_010539814.1|  PREDICTED: prolyl endopeptidase-like isoform X2    667   0.0      
ref|XP_010539813.1|  PREDICTED: prolyl endopeptidase-like isoform X1    667   0.0      
ref|XP_006478475.1|  PREDICTED: prolyl endopeptidase-like isoform X2    665   0.0      
ref|XP_006441995.1|  hypothetical protein CICLE_v10019028mg             664   0.0      
dbj|BAJ96495.1|  predicted protein                                      665   0.0      
ref|XP_003570892.1|  PREDICTED: prolyl endopeptidase-like               662   0.0      
ref|XP_002887627.1|  prolyl oligopeptidase                              662   0.0      
ref|XP_009401895.1|  PREDICTED: prolyl endopeptidase-like isoform X2    660   0.0      
ref|XP_009401894.1|  PREDICTED: prolyl endopeptidase-like isoform X1    660   0.0      
ref|NP_001130392.1|  uncharacterized protein LOC100191488               659   0.0      Zea mays [maize]
ref|XP_009397972.1|  PREDICTED: prolyl endopeptidase-like               658   0.0      
ref|XP_006478480.1|  PREDICTED: prolyl endopeptidase-like isoform X2    656   0.0      
gb|AFW56408.1|  prolyl endopeptidase                                    657   0.0      
ref|XP_004172990.1|  PREDICTED: prolyl endopeptidase-like               644   0.0      
gb|ACN31271.1|  unknown                                                 653   0.0      Zea mays [maize]
gb|EEC69790.1|  hypothetical protein OsI_00077                          648   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001041787.1|  Os01g0108200                                       648   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_001053552.1|  Os04g0561500                                       648   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002961763.1|  hypothetical protein SELMODRAFT_77679              647   0.0      
ref|XP_004956126.1|  PREDICTED: prolyl endopeptidase-like               647   0.0      
ref|XP_006661048.1|  PREDICTED: prolyl endopeptidase-like               645   0.0      
gb|EEC77797.1|  hypothetical protein OsI_16976                          645   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_004976493.1|  PREDICTED: prolyl endopeptidase-like isoform X1    642   0.0      
ref|XP_004976494.1|  PREDICTED: prolyl endopeptidase-like isoform X2    641   0.0      
ref|XP_006652640.1|  PREDICTED: prolyl endopeptidase-like               639   0.0      
gb|EPS68647.1|  hypothetical protein M569_06121                         632   0.0      
ref|XP_003580320.1|  PREDICTED: prolyl endopeptidase                    633   0.0      
dbj|BAK03252.1|  predicted protein                                      630   0.0      
ref|XP_002510623.1|  prolyl endopeptidase, putative                     627   0.0      Ricinus communis
ref|XP_010667345.1|  PREDICTED: prolyl endopeptidase-like               627   0.0      
ref|XP_002446934.1|  hypothetical protein SORBIDRAFT_06g025250          625   0.0      Sorghum bicolor [broomcorn]
ref|XP_002964833.1|  hypothetical protein SELMODRAFT_230523             618   0.0      
gb|AGL51088.1|  peptide cyclase 1                                       616   0.0      
tpg|DAA36457.1|  TPA: hypothetical protein ZEAMMB73_895418              612   0.0      
tpg|DAA36459.1|  TPA: hypothetical protein ZEAMMB73_895418              611   0.0      
ref|XP_008669027.1|  PREDICTED: prolyl endopeptidase isoform X1         611   0.0      
ref|XP_008669028.1|  PREDICTED: prolyl endopeptidase isoform X2         610   0.0      
gb|EMT12618.1|  Prolyl endopeptidase                                    604   0.0      
ref|XP_001757912.1|  predicted protein                                  604   0.0      
ref|XP_001754097.1|  predicted protein                                  588   0.0      
gb|KEH40255.1|  prolyl oligopeptidase-like protein                      573   0.0      
gb|EPS72019.1|  hypothetical protein M569_02738                         574   0.0      
ref|XP_001763118.1|  predicted protein                                  567   0.0      
ref|XP_001780642.1|  predicted protein                                  564   0.0      
emb|CDX73235.1|  BnaC06g36830D                                          557   0.0      
ref|XP_001783134.1|  predicted protein                                  553   0.0      
gb|EEE53725.1|  hypothetical protein OsJ_00069                          550   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008388141.1|  PREDICTED: prolyl endopeptidase-like               543   0.0      
gb|EMT09978.1|  Prolyl endopeptidase                                    527   3e-178   
dbj|BAE41885.1|  unnamed protein product                                530   8e-177   Mus musculus [mouse]
ref|NP_035286.1|  prolyl endopeptidase                                  530   9e-177   Mus musculus [mouse]
dbj|BAC36278.1|  unnamed protein product                                530   9e-177   Mus musculus [mouse]
ref|XP_004660718.1|  PREDICTED: prolyl endopeptidase                    528   1e-175   
ref|XP_008848520.1|  PREDICTED: prolyl endopeptidase isoform X3         523   4e-175   
gb|EGW09640.1|  Prolyl endopeptidase                                    520   4e-175   
gb|KFP09027.1|  Prolyl endopeptidase                                    523   9e-175   
ref|XP_003781615.1|  PREDICTED: prolyl endopeptidase                    524   1e-174   
ref|XP_005509542.1|  PREDICTED: prolyl endopeptidase                    524   2e-174   
gb|EMC83075.1|  Prolyl endopeptidase                                    523   2e-174   
gb|KFO62279.1|  Prolyl endopeptidase                                    523   2e-174   
ref|XP_009091499.1|  PREDICTED: prolyl endopeptidase                    521   2e-174   
ref|XP_006983806.1|  PREDICTED: prolyl endopeptidase                    523   3e-174   
ref|XP_008065250.1|  PREDICTED: prolyl endopeptidase                    521   3e-174   
ref|XP_009647537.1|  PREDICTED: prolyl endopeptidase                    523   3e-174   
gb|KFO96556.1|  Prolyl endopeptidase                                    522   4e-174   
gb|KDO85002.1|  hypothetical protein CISIN_1g0038782mg                  518   4e-174   
ref|XP_003466076.1|  PREDICTED: prolyl endopeptidase                    523   4e-174   
ref|XP_007260527.1|  PREDICTED: prolyl endopeptidase-like               523   5e-174   
ref|XP_005368679.1|  PREDICTED: prolyl endopeptidase                    523   5e-174   
ref|XP_008848518.1|  PREDICTED: prolyl endopeptidase isoform X1         523   5e-174   
gb|KFQ71820.1|  Prolyl endopeptidase                                    521   6e-174   
ref|XP_010405605.1|  PREDICTED: prolyl endopeptidase                    522   7e-174   
ref|XP_005974615.1|  PREDICTED: prolyl endopeptidase                    522   8e-174   
ref|XP_004011542.1|  PREDICTED: prolyl endopeptidase                    522   9e-174   
gb|ELR52168.1|  Prolyl endopeptidase                                    521   1e-173   
ref|XP_008636142.1|  PREDICTED: prolyl endopeptidase                    522   1e-173   
ref|XP_009204023.1|  PREDICTED: prolyl endopeptidase isoform X2         520   1e-173   
ref|XP_008005660.1|  PREDICTED: prolyl endopeptidase isoform X2         520   1e-173   
ref|XP_005552311.1|  PREDICTED: prolyl endopeptidase isoform X2         519   2e-173   
gb|KGM00304.1|  Prolyl endopeptidase                                    520   2e-173   
ref|XP_005154718.1|  PREDICTED: prolyl endopeptidase                    523   2e-173   
gb|KFV82344.1|  Prolyl endopeptidase                                    520   2e-173   
gb|EDL99674.1|  prolyl endopeptidase                                    521   2e-173   
ref|XP_010281515.1|  PREDICTED: prolyl endopeptidase                    521   2e-173   
ref|XP_008261549.1|  PREDICTED: LOW QUALITY PROTEIN: prolyl endop...    521   2e-173   
ref|XP_003509718.1|  PREDICTED: prolyl endopeptidase isoform X1         521   2e-173   
gb|KFQ95616.1|  Prolyl endopeptidase                                    520   2e-173   
gb|AAI40508.1|  PREP protein                                            521   2e-173   Bos taurus [bovine]
ref|XP_005377881.1|  PREDICTED: prolyl endopeptidase                    521   2e-173   
ref|NP_112614.1|  prolyl endopeptidase                                  521   2e-173   Rattus norvegicus [brown rat]
ref|XP_004875134.1|  PREDICTED: prolyl endopeptidase                    521   3e-173   
ref|XP_005426660.1|  PREDICTED: prolyl endopeptidase                    522   3e-173   
dbj|BAA86936.1|  prolyl endopeptidase                                   521   3e-173   Homo sapiens [man]
ref|XP_008502431.1|  PREDICTED: prolyl endopeptidase                    521   3e-173   
gb|AFK11407.1|  prolyl endopeptidase-like protein                       521   3e-173   
gb|KFU94339.1|  Prolyl endopeptidase                                    520   4e-173   
ref|XP_009563199.1|  PREDICTED: prolyl endopeptidase                    520   4e-173   
ref|XP_005684669.1|  PREDICTED: prolyl endopeptidase                    521   4e-173   
gb|KFO79123.1|  Prolyl endopeptidase                                    520   5e-173   
gb|KDO85001.1|  hypothetical protein CISIN_1g0038782mg                  518   5e-173   
gb|KGL76780.1|  Prolyl endopeptidase                                    520   6e-173   
ref|XP_010571747.1|  PREDICTED: prolyl endopeptidase                    520   6e-173   
ref|XP_005493071.1|  PREDICTED: prolyl endopeptidase                    520   7e-173   
ref|XP_009894751.1|  PREDICTED: prolyl endopeptidase                    520   8e-173   
ref|XP_010002170.1|  PREDICTED: prolyl endopeptidase                    520   8e-173   
gb|EHH53266.1|  hypothetical protein EGM_13872                          519   9e-173   
ref|XP_003898012.2|  PREDICTED: prolyl endopeptidase isoform X1         520   9e-173   
ref|XP_005901668.1|  PREDICTED: prolyl endopeptidase                    521   9e-173   
ref|XP_009892160.1|  PREDICTED: prolyl endopeptidase                    520   1e-172   
gb|KFV64238.1|  Prolyl endopeptidase                                    519   1e-172   
ref|NP_001279126.1|  prolyl endopeptidase-like                          519   1e-172   
tpg|DAA26234.1|  TPA: prolyl endopeptidase                              519   1e-172   
ref|XP_006061999.1|  PREDICTED: prolyl endopeptidase-like               520   1e-172   
gb|ADK26642.1|  prolyl endopeptidase                                    520   1e-172   
ref|XP_005445825.1|  PREDICTED: prolyl endopeptidase                    521   1e-172   
ref|XP_005244132.1|  PREDICTED: prolyl endopeptidase                    521   1e-172   
ref|XP_005330186.1|  PREDICTED: prolyl endopeptidase                    519   1e-172   
ref|XP_008005659.1|  PREDICTED: prolyl endopeptidase isoform X1         519   1e-172   
ref|XP_009675264.1|  PREDICTED: prolyl endopeptidase                    520   2e-172   
dbj|BAG36874.1|  unnamed protein product                                519   2e-172   Homo sapiens [man]
gb|KFM01437.1|  Prolyl endopeptidase                                    518   2e-172   
ref|XP_010350811.1|  PREDICTED: prolyl endopeptidase                    519   2e-172   
ref|XP_009450003.1|  PREDICTED: prolyl endopeptidase isoform X2         518   2e-172   
ref|NP_001244843.1|  prolyl endopeptidase                               519   2e-172   
ref|XP_006215840.1|  PREDICTED: prolyl endopeptidase                    519   2e-172   
ref|XP_007190702.1|  PREDICTED: prolyl endopeptidase                    519   2e-172   
ref|NP_777197.1|  prolyl endopeptidase                                  519   2e-172   Bos taurus [bovine]
ref|XP_003458281.1|  PREDICTED: prolyl endopeptidase-like               520   2e-172   
ref|NP_002717.3|  prolyl endopeptidase                                  518   2e-172   Homo sapiens [man]
ref|XP_006626084.1|  PREDICTED: prolyl endopeptidase-like               518   3e-172   
ref|XP_004568833.1|  PREDICTED: prolyl endopeptidase-like               519   3e-172   
ref|XP_007939038.1|  PREDICTED: prolyl endopeptidase                    518   4e-172   
ref|XP_004673792.1|  PREDICTED: prolyl endopeptidase                    518   4e-172   
ref|XP_008152832.1|  PREDICTED: prolyl endopeptidase                    518   4e-172   
ref|XP_010855005.1|  PREDICTED: prolyl endopeptidase                    520   4e-172   
ref|XP_002193605.1|  PREDICTED: prolyl endopeptidase                    519   4e-172   Taeniopygia guttata
ref|XP_005518296.1|  PREDICTED: prolyl endopeptidase                    520   5e-172   
gb|KFO22328.1|  Prolyl endopeptidase                                    518   5e-172   
ref|XP_004605818.1|  PREDICTED: prolyl endopeptidase                    519   5e-172   
ref|XP_004044512.1|  PREDICTED: prolyl endopeptidase                    518   5e-172   
ref|XP_010605500.1|  PREDICTED: prolyl endopeptidase                    517   5e-172   
ref|XP_004264819.1|  PREDICTED: prolyl endopeptidase                    518   5e-172   
ref|XP_001501827.1|  PREDICTED: prolyl endopeptidase                    519   6e-172   Equus caballus [domestic horse]
ref|XP_518657.2|  PREDICTED: prolyl endopeptidase isoform X1            518   6e-172   Pan troglodytes
ref|XP_004753488.1|  PREDICTED: prolyl endopeptidase isoform X2         515   6e-172   
gb|KFW69859.1|  Prolyl endopeptidase                                    517   6e-172   
ref|XP_009326213.1|  PREDICTED: prolyl endopeptidase                    517   7e-172   
dbj|BAA04661.1|  prolyl endopeptidase                                   517   8e-172   Homo sapiens [man]
ref|XP_010705858.1|  PREDICTED: prolyl endopeptidase isoform X2         516   9e-172   
ref|XP_009461626.1|  PREDICTED: prolyl endopeptidase                    520   9e-172   
ref|XP_008515073.1|  PREDICTED: prolyl endopeptidase                    516   1e-171   
ref|XP_010212266.1|  PREDICTED: prolyl endopeptidase                    520   1e-171   
emb|CAA52605.1|  prolyl oligopeptidase                                  516   1e-171   Homo sapiens [man]
ref|XP_010344793.1|  PREDICTED: prolyl endopeptidase                    517   2e-171   
ref|XP_007465841.1|  PREDICTED: prolyl endopeptidase                    517   2e-171   
pdb|4AX4|A  Chain A, Prolyl Oligopeptidase From Porcine Brain, H6...    516   2e-171   
ref|XP_005921665.1|  PREDICTED: prolyl endopeptidase-like               517   2e-171   
ref|NP_001004050.1|  prolyl endopeptidase                               516   2e-171   Sus scrofa [pigs]
ref|XP_004637514.1|  PREDICTED: prolyl endopeptidase                    516   3e-171   
ref|XP_005627728.1|  PREDICTED: prolyl endopeptidase                    515   3e-171   
ref|XP_004422222.1|  PREDICTED: prolyl endopeptidase                    516   3e-171   
ref|XP_010739332.1|  PREDICTED: prolyl endopeptidase-like               516   3e-171   
ref|XP_004753487.1|  PREDICTED: prolyl endopeptidase isoform X1         515   3e-171   
ref|XP_004784233.1|  PREDICTED: prolyl endopeptidase isoform X1         515   4e-171   
ref|XP_004397944.1|  PREDICTED: prolyl endopeptidase                    515   4e-171   
ref|XP_003769373.1|  PREDICTED: prolyl endopeptidase                    515   4e-171   
ref|NP_001006410.1|  prolyl endopeptidase                               515   4e-171   Gallus gallus [bantam]
ref|XP_010705857.1|  PREDICTED: prolyl endopeptidase isoform X1         516   4e-171   
ref|XP_008703213.1|  PREDICTED: prolyl endopeptidase                    515   4e-171   
ref|XP_006270313.1|  PREDICTED: prolyl endopeptidase isoform X1         515   5e-171   
ref|XP_004372486.1|  PREDICTED: prolyl endopeptidase                    515   5e-171   
ref|XP_007067073.1|  PREDICTED: prolyl endopeptidase                    515   5e-171   
ref|XP_009283462.1|  PREDICTED: prolyl endopeptidase                    517   5e-171   
ref|XP_004784234.1|  PREDICTED: prolyl endopeptidase isoform X2         514   5e-171   
gb|EFB28369.1|  hypothetical protein PANDA_005258                       513   6e-171   
pdb|3DDU|A  Chain A, Prolyl Oligopeptidase With Gsk552                  515   6e-171   
ref|XP_007120588.1|  PREDICTED: prolyl endopeptidase-like               517   7e-171   
pdb|1E8M|A  Chain A, Prolyl Oligopeptidase From Porcine Brain, Mu...    514   7e-171   
ref|XP_008163126.1|  PREDICTED: prolyl endopeptidase                    514   7e-171   
ref|XP_008301683.1|  PREDICTED: prolyl endopeptidase                    516   7e-171   
ref|XP_008976351.1|  PREDICTED: prolyl endopeptidase                    517   9e-171   
pdb|1H2X|A  Chain A, Prolyl Oligopeptidase From Porcine Brain, Y4...    514   9e-171   
ref|XP_002806765.1|  PREDICTED: LOW QUALITY PROTEIN: prolyl endop...    514   9e-171   
ref|XP_010987939.1|  PREDICTED: prolyl endopeptidase                    515   1e-170   
pdb|1O6G|A  Chain A, Prolyl Oligopeptidase From Porcine Brain, D6...    514   1e-170   
pdb|1VZ3|A  Chain A, Prolyl Oligopeptidase From Porcine Brain, T5...    514   1e-170   
ref|XP_007546639.1|  PREDICTED: prolyl endopeptidase                    514   1e-170   
ref|XP_007085562.1|  PREDICTED: prolyl endopeptidase                    515   1e-170   
ref|XP_006118521.1|  PREDICTED: prolyl endopeptidase                    514   1e-170   
ref|XP_002917093.1|  PREDICTED: prolyl endopeptidase-like               514   1e-170   
ref|XP_005044015.1|  PREDICTED: prolyl endopeptidase                    518   2e-170   
ref|XP_006631358.1|  PREDICTED: prolyl endopeptidase-like               513   2e-170   
ref|XP_006881244.1|  PREDICTED: prolyl endopeptidase-like               513   3e-170   
ref|XP_007624562.1|  PREDICTED: prolyl endopeptidase isoform X2         519   3e-170   
pdb|1O6F|A  Chain A, Prolyl Oligopeptidase From Porcine Brain, D6...    513   3e-170   
ref|XP_006019889.1|  PREDICTED: prolyl endopeptidase                    513   3e-170   
ref|XP_003986476.1|  PREDICTED: prolyl endopeptidase                    515   3e-170   
ref|XP_005991058.1|  PREDICTED: prolyl endopeptidase-like               512   5e-170   
pdb|1E5T|A  Chain A, Prolyl Oligopeptidase From Porcine Brain, Mu...    512   8e-170   
ref|XP_001368079.1|  PREDICTED: prolyl endopeptidase                    512   8e-170   
ref|XP_004478791.1|  PREDICTED: prolyl endopeptidase                    512   9e-170   
ref|NP_001018589.1|  prolyl endopeptidase                               512   1e-169   
ref|XP_003258213.1|  PREDICTED: prolyl endopeptidase                    517   1e-169   
ref|XP_006840028.1|  PREDICTED: prolyl endopeptidase                    512   1e-169   
ref|XP_004083507.1|  PREDICTED: prolyl endopeptidase-like               513   1e-169   
ref|XP_004580574.1|  PREDICTED: prolyl endopeptidase                    515   1e-169   
ref|XP_010963664.1|  PREDICTED: prolyl endopeptidase                    511   1e-169   
ref|XP_008395823.1|  PREDICTED: prolyl endopeptidase                    512   2e-169   
ref|XP_003971930.1|  PREDICTED: prolyl endopeptidase-like               511   3e-169   
pdb|1QFM|A  Chain A, Prolyl Oligopeptidase From Porcine Muscle          510   4e-169   
pdb|1VZ2|A  Chain A, Prolyl Oligopeptidase From Porcine Brain, Y7...    510   4e-169   
ref|XP_007425623.1|  PREDICTED: prolyl endopeptidase                    510   5e-169   
ref|XP_006777313.1|  PREDICTED: prolyl endopeptidase                    510   7e-169   
ref|XP_004696570.1|  PREDICTED: prolyl endopeptidase                    509   9e-169   
ref|XP_006157084.1|  PREDICTED: LOW QUALITY PROTEIN: prolyl endop...    512   1e-168   
ref|XP_010887799.1|  PREDICTED: prolyl endopeptidase isoform X2         506   1e-168   
ref|XP_006792578.1|  PREDICTED: prolyl endopeptidase-like               510   1e-168   
ref|XP_002733861.1|  PREDICTED: prolyl endopeptidase-like               509   2e-168   
ref|XP_010766681.1|  PREDICTED: prolyl endopeptidase                    509   2e-168   
ref|XP_005802687.1|  PREDICTED: prolyl endopeptidase-like               509   3e-168   
gb|EHB01344.1|  Prolyl endopeptidase                                    506   6e-168   
ref|XP_008311319.1|  PREDICTED: prolyl endopeptidase                    508   1e-167   
ref|XP_010887798.1|  PREDICTED: prolyl endopeptidase isoform X1         506   1e-167   
gb|ELK00599.1|  Prolyl endopeptidase                                    506   2e-167   
gb|ERE86258.1|  prolyl endopeptidase                                    506   4e-167   
ref|XP_010586900.1|  PREDICTED: prolyl endopeptidase                    510   4e-167   
gb|AAF17627.1|AC009978_3  T23E18.7                                      500   4e-166   
ref|NP_989189.1|  prolyl endopeptidase                                  502   6e-166   
ref|XP_007670039.1|  PREDICTED: prolyl endopeptidase                    502   6e-166   
ref|XP_004882094.1|  PREDICTED: prolyl endopeptidase                    506   7e-166   
ref|NP_001084314.1|  prolyl endopeptidase                               502   7e-166   
ref|XP_003226988.2|  PREDICTED: prolyl endopeptidase                    504   1e-165   
gb|AAH71008.1|  PREP protein                                            502   2e-165   
gb|AAH47161.1|  PREP protein                                            502   2e-165   
ref|XP_010741037.1|  PREDICTED: prolyl endopeptidase-like               498   2e-164   
gb|EMS49943.1|  Prolyl endopeptidase                                    493   2e-164   
ref|XP_010124176.1|  PREDICTED: prolyl endopeptidase                    489   4e-164   
gb|KFP38415.1|  Prolyl endopeptidase                                    489   5e-164   
ref|XP_006101145.1|  PREDICTED: prolyl endopeptidase-like               487   3e-163   
emb|CDQ68383.1|  unnamed protein product                                494   4e-163   
ref|XP_009046664.1|  hypothetical protein LOTGIDRAFT_199566             494   7e-163   
ref|XP_005813430.1|  PREDICTED: prolyl endopeptidase-like               493   8e-163   
ref|XP_007897315.1|  PREDICTED: prolyl endopeptidase                    494   8e-163   
ref|XP_010863497.1|  PREDICTED: prolyl endopeptidase-like isoform X1    494   1e-162   
ref|XP_010863498.1|  PREDICTED: prolyl endopeptidase-like isoform X2    493   1e-162   
ref|NP_001167336.1|  Prolyl endopeptidase                               493   3e-162   
ref|XP_005070497.1|  PREDICTED: prolyl endopeptidase                    495   3e-162   
ref|XP_006794406.1|  PREDICTED: prolyl endopeptidase-like               492   5e-162   
ref|XP_003447221.1|  PREDICTED: prolyl endopeptidase-like               492   6e-162   
ref|XP_004548989.1|  PREDICTED: prolyl endopeptidase-like               491   8e-162   
ref|XP_004074199.1|  PREDICTED: prolyl endopeptidase-like               491   9e-162   
ref|XP_005023940.1|  PREDICTED: LOW QUALITY PROTEIN: prolyl endop...    490   1e-161   
ref|XP_005754782.1|  PREDICTED: prolyl endopeptidase-like               490   2e-161   
ref|XP_006926243.1|  PREDICTED: prolyl endopeptidase                    491   7e-161   
ref|XP_003969229.1|  PREDICTED: prolyl endopeptidase-like               486   8e-160   
emb|CAG11079.1|  unnamed protein product                                487   1e-159   
ref|XP_004994381.1|  prolyl endopeptidase                               484   4e-159   
ref|XP_007576562.1|  PREDICTED: prolyl endopeptidase-like               484   5e-159   
ref|XP_005095067.1|  PREDICTED: prolyl endopeptidase-like               481   5e-158   
ref|XP_008918757.1|  PREDICTED: prolyl endopeptidase                    482   5e-158   
ref|XP_001622222.1|  predicted protein                                  479   1e-157   
gb|ERE86257.1|  prolyl endopeptidase                                    473   3e-157   
ref|XP_010784892.1|  PREDICTED: prolyl endopeptidase-like               479   7e-157   
ref|XP_004365255.1|  prolyl endopeptidase                               478   2e-156   
ref|XP_002607366.1|  hypothetical protein BRAFLDRAFT_204923             478   2e-156   
ref|XP_008298527.1|  PREDICTED: LOW QUALITY PROTEIN: prolyl endop...    478   2e-156   
ref|XP_002130949.1|  PREDICTED: prolyl endopeptidase                    472   3e-154   
gb|EKC37709.1|  Prolyl endopeptidase                                    472   3e-154   
gb|KFQ44435.1|  Prolyl endopeptidase                                    462   4e-154   
ref|XP_010014327.1|  PREDICTED: prolyl endopeptidase                    462   6e-154   
ref|XP_009935420.1|  PREDICTED: prolyl endopeptidase-like               462   8e-153   
ref|XP_003387450.1|  PREDICTED: prolyl endopeptidase isoform 1          468   2e-152   
ref|XP_009913104.1|  PREDICTED: prolyl endopeptidase                    458   2e-152   
gb|KFP99332.1|  Prolyl endopeptidase                                    456   1e-151   
ref|XP_009951408.1|  PREDICTED: prolyl endopeptidase                    456   2e-151   
ref|XP_002155242.1|  PREDICTED: prolyl endopeptidase-like               465   2e-151   
gb|KFZ63469.1|  Prolyl endopeptidase                                    454   3e-151   
ref|XP_007523996.1|  PREDICTED: prolyl endopeptidase                    464   6e-151   
gb|KFR12758.1|  Prolyl endopeptidase                                    454   7e-151   
ref|XP_005938849.1|  PREDICTED: prolyl endopeptidase-like               461   2e-150   
ref|XP_002114510.1|  hypothetical protein TRIADDRAFT_37989              459   2e-149   
ref|XP_009020673.1|  hypothetical protein HELRODRAFT_187164             457   2e-148   
ref|XP_009240389.1|  PREDICTED: LOW QUALITY PROTEIN: prolyl endop...    457   3e-148   
ref|XP_005997949.1|  PREDICTED: prolyl endopeptidase                    452   4e-147   
ref|XP_003387451.1|  PREDICTED: prolyl endopeptidase isoform 2          452   1e-146   
gb|EFX79244.1|  hypothetical protein DAPPUDRAFT_304946                  451   2e-146   
ref|XP_001603578.2|  PREDICTED: prolyl endopeptidase                    445   5e-143   
ref|XP_002410789.1|  prolyl endopeptidase, putative                     442   9e-143   
gb|ELW50062.1|  Prolyl endopeptidase                                    444   6e-142   
ref|XP_008556849.1|  PREDICTED: prolyl endopeptidase                    439   4e-141   
gb|KDR21572.1|  Prolyl endopeptidase                                    440   5e-141   
ref|XP_005883892.1|  PREDICTED: prolyl endopeptidase                    437   1e-140   
gb|EPQ18663.1|  Prolyl endopeptidase                                    434   4e-140   
gb|EXX75500.1|  hypothetical protein RirG_041300                        435   5e-140   
gb|ETE68797.1|  Prolyl endopeptidase                                    433   5e-140   
gb|ESA22682.1|  hypothetical protein GLOINDRAFT_73788                   435   5e-140   
gb|EFN66352.1|  Prolyl endopeptidase                                    432   9e-139   
ref|XP_789457.3|  PREDICTED: LOW QUALITY PROTEIN: prolyl endopept...    431   2e-138   
ref|XP_006566861.1|  PREDICTED: prolyl endopeptidase-like isoform X3    426   3e-138   
gb|EZA56288.1|  Prolyl endopeptidase                                    431   7e-138   
ref|XP_008421277.1|  PREDICTED: prolyl endopeptidase-like               417   9e-137   
ref|XP_004344010.1|  prolyl oligopeptidase                              427   3e-136   
ref|XP_395364.2|  PREDICTED: prolyl endopeptidase-like isoformX1        427   3e-136   
ref|XP_006566860.1|  PREDICTED: prolyl endopeptidase-like isoform X2    426   3e-136   
ref|XP_009173321.1|  hypothetical protein T265_09078                    425   4e-136   
ref|XP_006608499.1|  PREDICTED: prolyl endopeptidase-like isoform X3    424   5e-136   
ref|XP_003691037.1|  PREDICTED: prolyl endopeptidase-like               426   6e-136   
ref|XP_006608498.1|  PREDICTED: prolyl endopeptidase-like isoform X2    424   7e-136   
ref|XP_006608497.1|  PREDICTED: prolyl endopeptidase-like isoform X1    425   2e-135   
gb|EFN76622.1|  Prolyl endopeptidase                                    424   6e-135   
ref|XP_008587351.1|  PREDICTED: prolyl endopeptidase                    421   8e-135   
ref|XP_003394688.1|  PREDICTED: prolyl endopeptidase-like               421   4e-134   
gb|EHJ78277.1|  putative prolyl endopeptidase isoform 1                 418   1e-133   
ref|XP_003704000.1|  PREDICTED: prolyl endopeptidase-like               420   1e-133   
ref|XP_003491520.1|  PREDICTED: prolyl endopeptidase-like               420   2e-133   
dbj|BAE37487.1|  unnamed protein product                                405   8e-133   
gb|KFP67931.1|  Prolyl endopeptidase                                    404   2e-132   
ref|XP_009704361.1|  PREDICTED: prolyl endopeptidase                    404   2e-132   
gb|KFV02594.1|  Prolyl endopeptidase                                    404   2e-132   
ref|XP_008193478.1|  PREDICTED: prolyl endopeptidase isoform X2         414   5e-132   
ref|XP_008193477.1|  PREDICTED: prolyl endopeptidase isoform X1         415   8e-132   
gb|EFA11595.1|  Prolyl oligopeptidase                                   414   9e-132   
ref|XP_002430998.1|  Prolyl endopeptidase, putative                     414   1e-131   
ref|XP_010148292.1|  PREDICTED: prolyl endopeptidase                    402   1e-131   
gb|KFW03704.1|  Prolyl endopeptidase                                    402   1e-131   
gb|KFH68270.1|  prolyl oligopeptidase                                   413   2e-131   
ref|XP_001693915.1|  predicted protein                                  415   3e-131   
gb|ACF78590.1|  unknown                                                 397   6e-131   
ref|XP_004932449.1|  PREDICTED: prolyl endopeptidase-like               409   3e-130   
ref|XP_003881672.1|  Prolyl oligopeptidase (Precursor),related          409   1e-129   
ref|XP_008884135.1|  prolyl endopeptidase                               412   1e-129   
ref|XP_008848519.1|  PREDICTED: prolyl endopeptidase isoform X2         405   5e-129   
ref|XP_001748524.1|  hypothetical protein                               405   1e-128   
ref|XP_005846541.1|  hypothetical protein CHLNCDRAFT_31842              408   2e-128   
gb|KHN88004.1|  Prolyl endopeptidase                                    407   2e-128   
gb|KFH08714.1|  prolyl endopeptidase                                    408   3e-128   
gb|KFH08369.1|  prolyl endopeptidase                                    408   3e-128   
gb|ESS30635.1|  prolyl endopeptidase                                    408   3e-128   
gb|EPR59408.1|  prolyl endopeptidase                                    408   3e-128   
gb|AHK24800.1|  prolyl oligopeptidase                                   405   3e-128   
ref|XP_002955735.1|  hypothetical protein VOLCADRAFT_119179             405   5e-128   
gb|KFG63278.1|  prolyl endopeptidase                                    407   7e-128   
ref|XP_002369249.1|  prolyl endopeptidase, putative                     406   1e-127   
ref|XP_005650183.1|  hypothetical protein COCSUDRAFT_22018              405   1e-127   
gb|ETN62890.1|  prolyl endopeptidase (prolyl oligopeptidase)            403   5e-127   
ref|WP_015228923.1|  serine protease, S9A family peptidase              400   7e-127   
ref|WP_015227506.1|  prolyl oligopeptidase                              400   8e-127   
gb|AJC98850.1|  AGAP009172                                              401   1e-126   
gb|EYB99552.1|  hypothetical protein Y032_0121g1009                     401   1e-126   
ref|XP_003333036.2|  hypothetical protein PGTG_14822                    401   2e-126   
gb|AJC98847.1|  AGAP009172                                              401   2e-126   
gb|AJC98863.1|  AGAP009172                                              400   2e-126   
gb|AJC98845.1|  AGAP009172                                              400   2e-126   
gb|AJC98846.1|  AGAP009172                                              400   3e-126   
gb|AJC98849.1|  AGAP009172                                              400   3e-126   
gb|AJC98861.1|  AGAP009172                                              400   3e-126   
gb|AJC98855.1|  AGAP009172                                              400   3e-126   
gb|AJC98860.1|  AGAP009172                                              400   3e-126   
ref|XP_001659779.1|  prolyl endopeptidase (prolyl oligopeptidase)       401   5e-126   
ref|XP_001992919.1|  GH13380                                            399   5e-126   
gb|ETN69064.1|  putative prolyl endopeptidase                           399   5e-126   
ref|XP_002535103.1|  prolyl endopeptidase, putative                     399   6e-126   
gb|KFB39311.1|  AGAP009172-PA-like protein                              399   6e-126   
gb|AJC98864.1|  AGAP009172                                              399   9e-126   
ref|XP_319935.4|  AGAP009172-PA                                         399   9e-126   
gb|AJC98862.1|  AGAP009172                                              399   1e-125   
ref|XP_004519372.1|  PREDICTED: prolyl endopeptidase-like               398   1e-125   
ref|XP_001894227.1|  prolyl oligopeptidase family protein               396   2e-125   
ref|WP_012831463.1|  prolyl endopeptidase                               397   1e-124   
gb|EJW86070.1|  prolyl oligopeptidase                                   394   3e-124   
emb|CCA22744.1|  unnamed protein product putative                       395   6e-124   
emb|CDP92499.1|  Protein Bm9037                                         395   7e-124   
gb|ERG83141.1|  prolyl endopeptidase                                    396   7e-124   
ref|WP_015078097.1|  prolyl oligopeptidase                              392   1e-123   
gb|EPZ32533.1|  Peptidase S9A/B/C, oligopeptidasebeta-propeller d...    392   1e-123   
gb|KHJ99899.1|  peptidase, S9A/B/C family, catalytic domain protein     388   2e-123   
gb|ENN74169.1|  hypothetical protein YQE_09142                          392   2e-123   
ref|XP_002052413.1|  GJ21822                                            392   2e-123   
emb|CCI10032.1|  unnamed protein product                                406   3e-123   
emb|CDS18842.1|  prolyl endopeptidase                                   392   3e-123   
ref|WP_011317345.1|  prolyl endopeptidase                               390   4e-123   
ref|WP_026637121.1|  prolyl endopeptidase                               391   4e-123   
ref|XP_006683027.1|  hypothetical protein BATDEDRAFT_92713              391   5e-123   
ref|WP_033366544.1|  prolyl endopeptidase                               389   1e-122   
emb|CBY21252.1|  unnamed protein product                                390   1e-122   
ref|XP_008477891.1|  PREDICTED: prolyl endopeptidase-like               388   2e-122   
ref|XP_001843671.1|  prolyl endopeptidase                               390   2e-122   
ref|XP_002002881.1|  GI17622                                            389   3e-122   
gb|ERL94303.1|  hypothetical protein D910_11584                         389   4e-122   
ref|WP_015128436.1|  prolyl oligopeptidase                              390   4e-122   
ref|XP_001694070.1|  predicted protein                                  389   7e-122   
emb|CDS27107.1|  prolyl endopeptidase                                   388   7e-122   
ref|XP_001963120.1|  GF14099                                            389   8e-122   



>ref|XP_009628579.1| PREDICTED: prolyl endopeptidase-like [Nicotiana tomentosiformis]
Length=804

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/455 (79%), Positives = 406/455 (89%), Gaps = 2/455 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQS+DILCWKD++NP+   SASVTEDGKY L+Y +ENCDPVNKVY CDLSALP+
Sbjct  295   YHRLGTDQSDDILCWKDAENPKCTRSASVTEDGKYVLLYTYENCDPVNKVYYCDLSALPD  354

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             G++GY+G +ELLPF K+VD+F+ASY  VAND   FTFRTNK+APKYKLVRVD+KEP  W 
Sbjct  355   GIEGYKGRNELLPFIKLVDNFDASYDNVANDGTRFTFRTNKDAPKYKLVRVDLKEPDSWS  414

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             D+IQEDEKDVLESAVAVN NQLVV+YLSDVK+VLQLRD++ G +L+H LPIDIGTV+GIS
Sbjct  415   DIIQEDEKDVLESAVAVNENQLVVSYLSDVKNVLQLRDLKAGALLHH-LPIDIGTVSGIS  473

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKDS +FIGFTNFLIP IIY+C+L+++VP LK+FRE  VPGFD   F V QVFV SKD
Sbjct  474   ARRKDSTIFIGFTNFLIPGIIYECDLKAEVPNLKVFRETVVPGFDHTDFQVNQVFVPSKD  533

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             GVKIPMFIV+GKDI LDGS+PCLL+GYGGF+ S+TPYFS  R+VIAKHLGV+FC+ANIRG
Sbjct  534   GVKIPMFIVAGKDISLDGSHPCLLYGYGGFNISITPYFSVGRVVIAKHLGVVFCIANIRG  593

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGE+WHKAG+L+KKQNCFDDFI A EYL+AAG+TQP KLCIEGGSNGGLL+GACINQ
Sbjct  594   GGEYGEDWHKAGSLSKKQNCFDDFISAGEYLVAAGYTQPEKLCIEGGSNGGLLVGACINQ  653

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCSD EEEF WLIKYSPLHNVRRPWEQ
Sbjct  654   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSDKEEEFQWLIKYSPLHNVRRPWEQ  713

Query  508   T-HQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM  407
             +  Q  QYPSTMLLTADHDDRVVPLH+ K LA M 
Sbjct  714   SPEQESQYPSTMLLTADHDDRVVPLHSLKLLATMQ  748


 Score =   108 bits (270),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS   +PQTNPI+GRI+R AGHG GRPTQK+IDEAAD+YAFMAKVLGA W
Sbjct  743  LLATMQYVLCTSLEKSPQTNPIIGRIDRKAGHGAGRPTQKVIDEAADKYAFMAKVLGASW  802

Query  225  IE  220
            +E
Sbjct  803  ME  804



>ref|XP_009761497.1| PREDICTED: prolyl endopeptidase-like [Nicotiana sylvestris]
Length=798

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/455 (78%), Positives = 406/455 (89%), Gaps = 2/455 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQS+DILCWKD +NP+   SASVTEDGKY L+Y +ENCDPVNKVY CDLSALP+
Sbjct  289   YHRLGTDQSDDILCWKDPENPKCTRSASVTEDGKYVLLYTYENCDPVNKVYYCDLSALPD  348

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             G++GY+G +ELLPF K+VD+F+ASY  VAND   FTFRTNK+APKYKLVRVD+KEP  W 
Sbjct  349   GIEGYKGRNELLPFIKLVDNFDASYDCVANDGTAFTFRTNKDAPKYKLVRVDLKEPDSWS  408

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             D+++EDEKDVLESAVAVN+NQLVV+YLSDVK+VLQLRD++  G+L H+LPIDIGTV+GIS
Sbjct  409   DIVREDEKDVLESAVAVNDNQLVVSYLSDVKNVLQLRDLK-AGVLLHHLPIDIGTVSGIS  467

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKDS +FIGFTNFLIP IIY+C+L+++VP LK+FRE  VPGFD   F V QVFV SKD
Sbjct  468   ARRKDSTIFIGFTNFLIPGIIYECDLKAEVPNLKVFRETVVPGFDHTEFQVNQVFVPSKD  527

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             GVKIPMFIV+GKDI LDGS+PCLL+GYGGF+ S+TPYFS  R+VIAKHLGV+FC+ANIRG
Sbjct  528   GVKIPMFIVAGKDISLDGSHPCLLYGYGGFNISITPYFSVGRVVIAKHLGVVFCIANIRG  587

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGE+WHKAG+L+KKQNCFDDFI AAEYL+ AG+TQP KLCIEGGSNGGLL+GACINQ
Sbjct  588   GGEYGEDWHKAGSLSKKQNCFDDFISAAEYLVTAGYTQPEKLCIEGGSNGGLLVGACINQ  647

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCSD EEEF WLIKYSPLHNVRRPWEQ
Sbjct  648   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSDKEEEFQWLIKYSPLHNVRRPWEQ  707

Query  508   T-HQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM  407
             +  Q  QYPSTMLLTADHDDRVVPLH+ K LA M 
Sbjct  708   SPDQESQYPSTMLLTADHDDRVVPLHSLKLLATMQ  742


 Score =   108 bits (270),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS   +PQTNPI+GRI+R AGHG GRPTQK+IDEAAD+YAFMAKVLGA W
Sbjct  737  LLATMQYVLCTSLEKSPQTNPIIGRIDRKAGHGAGRPTQKVIDEAADKYAFMAKVLGASW  796

Query  225  IE  220
            +E
Sbjct  797  VE  798



>ref|XP_009775532.1| PREDICTED: prolyl endopeptidase isoform X3 [Nicotiana sylvestris]
Length=622

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/486 (72%), Positives = 412/486 (85%), Gaps = 12/486 (2%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS DILCWKD++NP+H   ASVTEDGKY L+Y F NCD VNK++ CDLS LPN
Sbjct  113   YHFLGTDQSNDILCWKDTENPKHRHMASVTEDGKYVLLYTFRNCDTVNKLHYCDLSTLPN  172

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             G++GY+G  ++LPFNK+VDHF+ASY +VA++ ++FTF TNKNAPKYKLVRVDV++P  W 
Sbjct  173   GIEGYKGRSDVLPFNKLVDHFDASYDYVAHNNSIFTFLTNKNAPKYKLVRVDVQKPDFWF  232

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             D+I EDEKDVL+SAVAVN NQL+V+YL DVK+VLQLRD+ TG +L H+LPIDIG V+G+S
Sbjct  233   DIIDEDEKDVLQSAVAVNGNQLIVSYLRDVKNVLQLRDLETG-VLLHHLPIDIGRVSGVS  291

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+ VFIGF NFLIP +IY+CNL+ +VP+LK+FREI VPGFDR  F V QVFV SKD
Sbjct  292   ARRKDNSVFIGFMNFLIPGLIYECNLKGEVPDLKVFREIVVPGFDRTEFQVNQVFVPSKD  351

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             GVKIPMFIVS K+I LDGSNPCLLFGYGGF+ S+TP FS AR+V+AKHLGV+FC+ANIRG
Sbjct  352   GVKIPMFIVSRKNISLDGSNPCLLFGYGGFNVSLTPSFSAARVVLAKHLGVVFCIANIRG  411

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEW+KAGAL++KQNCFDDFI AAEYL+ +G+TQP KLCIEGGSNGGLL+GAC+NQ
Sbjct  412   GGEYGEEWYKAGALSRKQNCFDDFISAAEYLVTSGYTQPHKLCIEGGSNGGLLVGACVNQ  471

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSD EEEF WLIKYSPLHNVRRPWEQ
Sbjct  472   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDKEEEFQWLIKYSPLHNVRRPWEQ  531

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM--MPCPDHAACP--------VYKRSQ  362
                +A QYPS MLLTADHDDRVVPLH+ K LA M  + C   A  P        + +++ 
Sbjct  532   FAIKAYQYPSIMLLTADHDDRVVPLHSLKLLATMQYVLCTSVAKSPQTNPIIGRIERKAG  591

Query  361   HSANQP  344
             H   +P
Sbjct  592   HGCGRP  597


 Score =   112 bits (279),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS   +PQTNPI+GRIER AGHGCGRPTQKLIDEAADRYAFMAK LGA W
Sbjct  561  LLATMQYVLCTSVAKSPQTNPIIGRIERKAGHGCGRPTQKLIDEAADRYAFMAKELGASW  620

Query  225  IE  220
             E
Sbjct  621  FE  622



>ref|XP_009775531.1| PREDICTED: prolyl endopeptidase isoform X2 [Nicotiana sylvestris]
Length=672

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/486 (72%), Positives = 412/486 (85%), Gaps = 12/486 (2%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS DILCWKD++NP+H   ASVTEDGKY L+Y F NCD VNK++ CDLS LPN
Sbjct  163   YHFLGTDQSNDILCWKDTENPKHRHMASVTEDGKYVLLYTFRNCDTVNKLHYCDLSTLPN  222

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             G++GY+G  ++LPFNK+VDHF+ASY +VA++ ++FTF TNKNAPKYKLVRVDV++P  W 
Sbjct  223   GIEGYKGRSDVLPFNKLVDHFDASYDYVAHNNSIFTFLTNKNAPKYKLVRVDVQKPDFWF  282

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             D+I EDEKDVL+SAVAVN NQL+V+YL DVK+VLQLRD+ TG +L H+LPIDIG V+G+S
Sbjct  283   DIIDEDEKDVLQSAVAVNGNQLIVSYLRDVKNVLQLRDLETG-VLLHHLPIDIGRVSGVS  341

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+ VFIGF NFLIP +IY+CNL+ +VP+LK+FREI VPGFDR  F V QVFV SKD
Sbjct  342   ARRKDNSVFIGFMNFLIPGLIYECNLKGEVPDLKVFREIVVPGFDRTEFQVNQVFVPSKD  401

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             GVKIPMFIVS K+I LDGSNPCLLFGYGGF+ S+TP FS AR+V+AKHLGV+FC+ANIRG
Sbjct  402   GVKIPMFIVSRKNISLDGSNPCLLFGYGGFNVSLTPSFSAARVVLAKHLGVVFCIANIRG  461

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEW+KAGAL++KQNCFDDFI AAEYL+ +G+TQP KLCIEGGSNGGLL+GAC+NQ
Sbjct  462   GGEYGEEWYKAGALSRKQNCFDDFISAAEYLVTSGYTQPHKLCIEGGSNGGLLVGACVNQ  521

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSD EEEF WLIKYSPLHNVRRPWEQ
Sbjct  522   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDKEEEFQWLIKYSPLHNVRRPWEQ  581

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM--MPCPDHAACP--------VYKRSQ  362
                +A QYPS MLLTADHDDRVVPLH+ K LA M  + C   A  P        + +++ 
Sbjct  582   FAIKAYQYPSIMLLTADHDDRVVPLHSLKLLATMQYVLCTSVAKSPQTNPIIGRIERKAG  641

Query  361   HSANQP  344
             H   +P
Sbjct  642   HGCGRP  647


 Score =   112 bits (280),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS   +PQTNPI+GRIER AGHGCGRPTQKLIDEAADRYAFMAK LGA W
Sbjct  611  LLATMQYVLCTSVAKSPQTNPIIGRIERKAGHGCGRPTQKLIDEAADRYAFMAKELGASW  670

Query  225  IE  220
             E
Sbjct  671  FE  672



>ref|XP_011099789.1| PREDICTED: prolyl endopeptidase-like [Sesamum indicum]
Length=790

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/472 (73%), Positives = 409/472 (87%), Gaps = 6/472 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQSEDILCW D +NP+H +SASVTEDGKY L+YI ENCDPVNKVY CDL +LP 
Sbjct  281   YHFLGTDQSEDILCWSDPENPKHTLSASVTEDGKYVLLYIGENCDPVNKVYYCDLLSLPK  340

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+GY+G  ELLPF K+VD F+ASY +VAND+ +FTF TNK+AP+ KLVRVD+KEP  W 
Sbjct  341   GLEGYKGKKELLPFVKLVDKFDASYEYVANDDTIFTFLTNKDAPRNKLVRVDLKEPSSWT  400

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             +V+QED+KDVLESA AVN NQ++VNYLSDVK+VLQ+RD++TG +L+H LP++IG+V+ IS
Sbjct  401   EVLQEDKKDVLESATAVNGNQIIVNYLSDVKNVLQIRDLKTGSLLHH-LPLEIGSVSEIS  459

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             +RRKDSI+F+GFT+FLIP IIY CNLQ + P+L+IFREI VPGFDR+ F  +QVFV SKD
Sbjct  460   SRRKDSIIFVGFTSFLIPGIIYTCNLQGEAPDLRIFREIVVPGFDRSEFEASQVFVPSKD  519

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ K + LDGS+PCLL+GYGGF+ S+TPYF+ +R++IAKHL  +FC+ANIRG
Sbjct  520   GTKIPMFIVARKGLSLDGSHPCLLYGYGGFNISITPYFTASRILIAKHLDGVFCIANIRG  579

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAGALAKKQNCFDDFI AAEYL++ G+TQP KLCIEGGSNGGLL+GACINQ
Sbjct  580   GGEYGEEWHKAGALAKKQNCFDDFISAAEYLVSVGYTQPKKLCIEGGSNGGLLVGACINQ  639

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCSD EEEF+WLIKYSPLHNVRRPW++
Sbjct  640   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSDKEEEFNWLIKYSPLHNVRRPWDK  699

Query  508   TH-QACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHS  356
             T  +A QYPSTMLLTADHDDRVVPLH+ K LA M     H  C   ++S  +
Sbjct  700   TSDKATQYPSTMLLTADHDDRVVPLHSLKLLATMQ----HVLCTSVEKSPQT  747


 Score =   105 bits (262),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQHVLCTS   +PQTNPI+GRIE+ AGHG G PTQK+IDEAADRYAFMAKV+ A W
Sbjct  729  LLATMQHVLCTSVEKSPQTNPIIGRIEQKAGHGAGMPTQKIIDEAADRYAFMAKVVDASW  788

Query  225  IE  220
            I+
Sbjct  789  ID  790



>ref|XP_006355174.1| PREDICTED: prolyl endopeptidase-like [Solanum tuberosum]
Length=800

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/454 (78%), Positives = 402/454 (89%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQS+DILCWKD +NP+   SASVTEDGKY L+Y +ENCDPVN+VY CDLSALP+
Sbjct  291   YHRLGTDQSDDILCWKDPENPKCTRSASVTEDGKYVLLYTYENCDPVNQVYYCDLSALPD  350

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             G++G +G  ELLPF K+VD+F ASY +VAND   FTFRTNK+APKYKLVRVD+KEP  W 
Sbjct  351   GVEGCKGRSELLPFIKLVDNFVASYEYVANDGTAFTFRTNKDAPKYKLVRVDLKEPYSWS  410

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             D+IQE+EKDVLESAVAVNNNQLVV+YLSDVK+VLQLRD++ G +L+H LPIDIG+V+GIS
Sbjct  411   DIIQENEKDVLESAVAVNNNQLVVSYLSDVKNVLQLRDLKAGALLHH-LPIDIGSVSGIS  469

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD  +FIGFTNFLIP IIY+CNL+ +VP LK+FRE  VPGFD   F V QVFV SKD
Sbjct  470   ARRKDDTIFIGFTNFLIPGIIYECNLKEEVPNLKVFRETVVPGFDHTDFQVNQVFVPSKD  529

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             GVKIPMFIV+GKDI LDGS+PCLL+GYGGF+ S+TPYFS  R+VIAKHLGV+FC+ANIRG
Sbjct  530   GVKIPMFIVAGKDISLDGSHPCLLYGYGGFNISITPYFSVGRVVIAKHLGVVFCIANIRG  589

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGE+WHKAG+L+KKQNCFDDFI AAEYL+ AG+T+P KLCIEGGSNGGLL+GACINQ
Sbjct  590   GGEYGEDWHKAGSLSKKQNCFDDFISAAEYLVEAGYTRPKKLCIEGGSNGGLLVGACINQ  649

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCS+ EEEF WLIKYSPLHNVRRPWEQ
Sbjct  650   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSEKEEEFQWLIKYSPLHNVRRPWEQ  709

Query  508   T-HQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             + +Q  QYP TMLLTADHDDRVVPLH+ K LA M
Sbjct  710   SPNQESQYPPTMLLTADHDDRVVPLHSLKLLATM  743


 Score =   105 bits (261),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS   +PQTNPI+GRIE  AGHG GRPTQK+IDEAADRYAFMAKV+GA W
Sbjct  739  LLATMQYVLCTSLEKSPQTNPIIGRIECKAGHGAGRPTQKVIDEAADRYAFMAKVMGASW  798

Query  225  IE  220
            ++
Sbjct  799  VQ  800



>ref|XP_009775530.1| PREDICTED: prolyl endopeptidase isoform X1 [Nicotiana sylvestris]
Length=732

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/454 (76%), Positives = 401/454 (88%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS DILCWKD++NP+H   ASVTEDGKY L+Y F NCD VNK++ CDLS LPN
Sbjct  223   YHFLGTDQSNDILCWKDTENPKHRHMASVTEDGKYVLLYTFRNCDTVNKLHYCDLSTLPN  282

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             G++GY+G  ++LPFNK+VDHF+ASY +VA++ ++FTF TNKNAPKYKLVRVDV++P  W 
Sbjct  283   GIEGYKGRSDVLPFNKLVDHFDASYDYVAHNNSIFTFLTNKNAPKYKLVRVDVQKPDFWF  342

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             D+I EDEKDVL+SAVAVN NQL+V+YL DVK+VLQLRD+ TG +L H+LPIDIG V+G+S
Sbjct  343   DIIDEDEKDVLQSAVAVNGNQLIVSYLRDVKNVLQLRDLETG-VLLHHLPIDIGRVSGVS  401

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+ VFIGF NFLIP +IY+CNL+ +VP+LK+FREI VPGFDR  F V QVFV SKD
Sbjct  402   ARRKDNSVFIGFMNFLIPGLIYECNLKGEVPDLKVFREIVVPGFDRTEFQVNQVFVPSKD  461

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             GVKIPMFIVS K+I LDGSNPCLLFGYGGF+ S+TP FS AR+V+AKHLGV+FC+ANIRG
Sbjct  462   GVKIPMFIVSRKNISLDGSNPCLLFGYGGFNVSLTPSFSAARVVLAKHLGVVFCIANIRG  521

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEW+KAGAL++KQNCFDDFI AAEYL+ +G+TQP KLCIEGGSNGGLL+GAC+NQ
Sbjct  522   GGEYGEEWYKAGALSRKQNCFDDFISAAEYLVTSGYTQPHKLCIEGGSNGGLLVGACVNQ  581

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSD EEEF WLIKYSPLHNVRRPWEQ
Sbjct  582   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDKEEEFQWLIKYSPLHNVRRPWEQ  641

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                +A QYPS MLLTADHDDRVVPLH+ K LA M
Sbjct  642   FAIKAYQYPSIMLLTADHDDRVVPLHSLKLLATM  675


 Score =   112 bits (280),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS   +PQTNPI+GRIER AGHGCGRPTQKLIDEAADRYAFMAK LGA W
Sbjct  671  LLATMQYVLCTSVAKSPQTNPIIGRIERKAGHGCGRPTQKLIDEAADRYAFMAKELGASW  730

Query  225  IE  220
             E
Sbjct  731  FE  732



>ref|XP_010324785.1| PREDICTED: prolyl endopeptidase isoform X4 [Solanum lycopersicum]
Length=622

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/472 (74%), Positives = 404/472 (86%), Gaps = 6/472 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQS+DILCWKD +NP+   SASVT+DGKY L+Y +ENCDPVN+VY CDLSALP+
Sbjct  113   YHRLGTDQSDDILCWKDPENPKCTRSASVTQDGKYVLLYTYENCDPVNQVYYCDLSALPD  172

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
              ++G +G +ELLPF K+VD+F ASY +VAND +  TFRTNK+APKYKLVRVD+KEP  W 
Sbjct  173   WVEGCKGRNELLPFIKLVDNFVASYEYVANDGSALTFRTNKDAPKYKLVRVDLKEPDSWS  232

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             D+IQE+EKDVLESAV VNNNQLVVNYLSDVK+VLQLRD++ G +L+H LPIDIG+V+GIS
Sbjct  233   DIIQENEKDVLESAVVVNNNQLVVNYLSDVKNVLQLRDLKAGALLHH-LPIDIGSVSGIS  291

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD   FIGFTNFLIP IIY+CNL  +VP LK+FRE  VPGFD   F V QVFV SKD
Sbjct  292   ARRKDDTFFIGFTNFLIPGIIYECNLNEEVPNLKVFRETVVPGFDHTDFQVNQVFVPSKD  351

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             GVKIPMFIV+GKDI  DGS+PCLL+GYGGF+ S+TPYFS  R+VIAKHLGV+FC+ANIRG
Sbjct  352   GVKIPMFIVAGKDISFDGSHPCLLYGYGGFNISITPYFSVGRVVIAKHLGVVFCIANIRG  411

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGE+WHKAG+L+KKQNCFDDFI AAEYL+ AG+T+P KLCIEGGSNGGLL+GACINQ
Sbjct  412   GGEYGEDWHKAGSLSKKQNCFDDFISAAEYLVEAGYTRPKKLCIEGGSNGGLLVGACINQ  471

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCS+ EEEF WLIKYSPLHNVRRPWEQ
Sbjct  472   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSEKEEEFQWLIKYSPLHNVRRPWEQ  531

Query  508   T-HQACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHS  356
             + +Q  QYP TMLLTADHDDRVVPLH+ K LA M     +  C   ++S  S
Sbjct  532   SPNQESQYPPTMLLTADHDDRVVPLHSLKLLATMQ----YVLCTSLEKSPQS  579


 Score =   101 bits (252),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS   +PQ+NPI+ RIE  AGHG GRPTQK+IDEAADRYAFMAKV+GA W
Sbjct  561  LLATMQYVLCTSLEKSPQSNPIISRIECKAGHGAGRPTQKVIDEAADRYAFMAKVMGASW  620

Query  225  IE  220
            ++
Sbjct  621  VQ  622



>ref|XP_010324784.1| PREDICTED: prolyl endopeptidase isoform X3 [Solanum lycopersicum]
Length=630

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/472 (74%), Positives = 404/472 (86%), Gaps = 6/472 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQS+DILCWKD +NP+   SASVT+DGKY L+Y +ENCDPVN+VY CDLSALP+
Sbjct  121   YHRLGTDQSDDILCWKDPENPKCTRSASVTQDGKYVLLYTYENCDPVNQVYYCDLSALPD  180

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
              ++G +G +ELLPF K+VD+F ASY +VAND +  TFRTNK+APKYKLVRVD+KEP  W 
Sbjct  181   WVEGCKGRNELLPFIKLVDNFVASYEYVANDGSALTFRTNKDAPKYKLVRVDLKEPDSWS  240

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             D+IQE+EKDVLESAV VNNNQLVVNYLSDVK+VLQLRD++ G +L+H LPIDIG+V+GIS
Sbjct  241   DIIQENEKDVLESAVVVNNNQLVVNYLSDVKNVLQLRDLKAGALLHH-LPIDIGSVSGIS  299

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD   FIGFTNFLIP IIY+CNL  +VP LK+FRE  VPGFD   F V QVFV SKD
Sbjct  300   ARRKDDTFFIGFTNFLIPGIIYECNLNEEVPNLKVFRETVVPGFDHTDFQVNQVFVPSKD  359

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             GVKIPMFIV+GKDI  DGS+PCLL+GYGGF+ S+TPYFS  R+VIAKHLGV+FC+ANIRG
Sbjct  360   GVKIPMFIVAGKDISFDGSHPCLLYGYGGFNISITPYFSVGRVVIAKHLGVVFCIANIRG  419

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGE+WHKAG+L+KKQNCFDDFI AAEYL+ AG+T+P KLCIEGGSNGGLL+GACINQ
Sbjct  420   GGEYGEDWHKAGSLSKKQNCFDDFISAAEYLVEAGYTRPKKLCIEGGSNGGLLVGACINQ  479

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCS+ EEEF WLIKYSPLHNVRRPWEQ
Sbjct  480   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSEKEEEFQWLIKYSPLHNVRRPWEQ  539

Query  508   T-HQACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHS  356
             + +Q  QYP TMLLTADHDDRVVPLH+ K LA M     +  C   ++S  S
Sbjct  540   SPNQESQYPPTMLLTADHDDRVVPLHSLKLLATMQ----YVLCTSLEKSPQS  587


 Score =   101 bits (252),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS   +PQ+NPI+ RIE  AGHG GRPTQK+IDEAADRYAFMAKV+GA W
Sbjct  569  LLATMQYVLCTSLEKSPQSNPIISRIECKAGHGAGRPTQKVIDEAADRYAFMAKVMGASW  628

Query  225  IE  220
            ++
Sbjct  629  VQ  630



>ref|XP_004244855.1| PREDICTED: prolyl endopeptidase isoform X2 [Solanum lycopersicum]
Length=731

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/472 (74%), Positives = 404/472 (86%), Gaps = 6/472 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQS+DILCWKD +NP+   SASVT+DGKY L+Y +ENCDPVN+VY CDLSALP+
Sbjct  222   YHRLGTDQSDDILCWKDPENPKCTRSASVTQDGKYVLLYTYENCDPVNQVYYCDLSALPD  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
              ++G +G +ELLPF K+VD+F ASY +VAND +  TFRTNK+APKYKLVRVD+KEP  W 
Sbjct  282   WVEGCKGRNELLPFIKLVDNFVASYEYVANDGSALTFRTNKDAPKYKLVRVDLKEPDSWS  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             D+IQE+EKDVLESAV VNNNQLVVNYLSDVK+VLQLRD++ G +L+H LPIDIG+V+GIS
Sbjct  342   DIIQENEKDVLESAVVVNNNQLVVNYLSDVKNVLQLRDLKAGALLHH-LPIDIGSVSGIS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD   FIGFTNFLIP IIY+CNL  +VP LK+FRE  VPGFD   F V QVFV SKD
Sbjct  401   ARRKDDTFFIGFTNFLIPGIIYECNLNEEVPNLKVFRETVVPGFDHTDFQVNQVFVPSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             GVKIPMFIV+GKDI  DGS+PCLL+GYGGF+ S+TPYFS  R+VIAKHLGV+FC+ANIRG
Sbjct  461   GVKIPMFIVAGKDISFDGSHPCLLYGYGGFNISITPYFSVGRVVIAKHLGVVFCIANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGE+WHKAG+L+KKQNCFDDFI AAEYL+ AG+T+P KLCIEGGSNGGLL+GACINQ
Sbjct  521   GGEYGEDWHKAGSLSKKQNCFDDFISAAEYLVEAGYTRPKKLCIEGGSNGGLLVGACINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCS+ EEEF WLIKYSPLHNVRRPWEQ
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSEKEEEFQWLIKYSPLHNVRRPWEQ  640

Query  508   T-HQACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHS  356
             + +Q  QYP TMLLTADHDDRVVPLH+ K LA M     +  C   ++S  S
Sbjct  641   SPNQESQYPPTMLLTADHDDRVVPLHSLKLLATMQ----YVLCTSLEKSPQS  688


 Score =   101 bits (252),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS   +PQ+NPI+ RIE  AGHG GRPTQK+IDEAADRYAFMAKV+GA W
Sbjct  670  LLATMQYVLCTSLEKSPQSNPIISRIECKAGHGAGRPTQKVIDEAADRYAFMAKVMGASW  729

Query  225  IE  220
            ++
Sbjct  730  VQ  731



>ref|XP_010101294.1| Prolyl endopeptidase [Morus notabilis]
 gb|EXB88229.1| Prolyl endopeptidase [Morus notabilis]
Length=729

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/453 (74%), Positives = 399/453 (88%), Gaps = 1/453 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQSEDILCWKDSDNP+++  ASVT+DGKY L+YI E CDPVNK Y CD+S LPN
Sbjct  221   YHFLGTDQSEDILCWKDSDNPKYLFGASVTDDGKYVLLYIDEGCDPVNKFYYCDMSELPN  280

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+RG ++LLPF +++D+F+A Y  +AND+ VFTF TNK+APKYKLVR D+K+P  W 
Sbjct  281   GLEGFRGKNDLLPFVRVIDNFDAQYLTIANDDTVFTFLTNKDAPKYKLVRADLKQPTLWT  340

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+QEDEKDVLESA AVN NQLVV+YLSDVK V+Q+RD+++G ++ H LPIDIG+V GIS
Sbjct  341   DVLQEDEKDVLESAFAVNGNQLVVSYLSDVKYVVQIRDLKSGSLI-HQLPIDIGSVYGIS  399

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+D+IVF GFT+FL P IIYQCNL S++PE+KIFREI VPGFDR++FNV QVF  SKD
Sbjct  400   ARREDNIVFYGFTSFLTPGIIYQCNLDSELPEIKIFREIAVPGFDRSAFNVHQVFFPSKD  459

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMF+V+ K+I LDGS+PCLL+GYGGF+ ++TP FS +R+V+++HLG +FC+ NIRG
Sbjct  460   GTKIPMFVVARKNIVLDGSHPCLLYGYGGFNINLTPSFSVSRIVLSRHLGAVFCIVNIRG  519

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGE+WHKAG+LAKKQNCFDDFI AAEYLI+ G+TQP KLCIEGGSNGGLL+GACINQ
Sbjct  520   GGEYGEKWHKAGSLAKKQNCFDDFISAAEYLISTGYTQPKKLCIEGGSNGGLLVGACINQ  579

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GC+D EEEF WLIKYSPLHNVRRPWE 
Sbjct  580   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCADKEEEFQWLIKYSPLHNVRRPWEN  639

Query  508   THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
               +A QYPSTMLLTADHDDRVVPLH+ K LA M
Sbjct  640   PDKASQYPSTMLLTADHDDRVVPLHSLKLLATM  672


 Score =   100 bits (249),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VL TS   +PQTNPI+GRIE  AGHG GRPT+K+IDEAADRY+FMAK+LGA W
Sbjct  668  LLATMQYVLSTSLEKSPQTNPIIGRIECKAGHGAGRPTKKMIDEAADRYSFMAKMLGASW  727

Query  225  IE  220
            +E
Sbjct  728  LE  729



>ref|XP_010324783.1| PREDICTED: prolyl endopeptidase isoform X1 [Solanum lycopersicum]
Length=739

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/472 (74%), Positives = 404/472 (86%), Gaps = 6/472 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQS+DILCWKD +NP+   SASVT+DGKY L+Y +ENCDPVN+VY CDLSALP+
Sbjct  230   YHRLGTDQSDDILCWKDPENPKCTRSASVTQDGKYVLLYTYENCDPVNQVYYCDLSALPD  289

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
              ++G +G +ELLPF K+VD+F ASY +VAND +  TFRTNK+APKYKLVRVD+KEP  W 
Sbjct  290   WVEGCKGRNELLPFIKLVDNFVASYEYVANDGSALTFRTNKDAPKYKLVRVDLKEPDSWS  349

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             D+IQE+EKDVLESAV VNNNQLVVNYLSDVK+VLQLRD++ G +L+H LPIDIG+V+GIS
Sbjct  350   DIIQENEKDVLESAVVVNNNQLVVNYLSDVKNVLQLRDLKAGALLHH-LPIDIGSVSGIS  408

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD   FIGFTNFLIP IIY+CNL  +VP LK+FRE  VPGFD   F V QVFV SKD
Sbjct  409   ARRKDDTFFIGFTNFLIPGIIYECNLNEEVPNLKVFRETVVPGFDHTDFQVNQVFVPSKD  468

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             GVKIPMFIV+GKDI  DGS+PCLL+GYGGF+ S+TPYFS  R+VIAKHLGV+FC+ANIRG
Sbjct  469   GVKIPMFIVAGKDISFDGSHPCLLYGYGGFNISITPYFSVGRVVIAKHLGVVFCIANIRG  528

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGE+WHKAG+L+KKQNCFDDFI AAEYL+ AG+T+P KLCIEGGSNGGLL+GACINQ
Sbjct  529   GGEYGEDWHKAGSLSKKQNCFDDFISAAEYLVEAGYTRPKKLCIEGGSNGGLLVGACINQ  588

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCS+ EEEF WLIKYSPLHNVRRPWEQ
Sbjct  589   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSEKEEEFQWLIKYSPLHNVRRPWEQ  648

Query  508   T-HQACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHS  356
             + +Q  QYP TMLLTADHDDRVVPLH+ K LA M     +  C   ++S  S
Sbjct  649   SPNQESQYPPTMLLTADHDDRVVPLHSLKLLATMQ----YVLCTSLEKSPQS  696


 Score =   101 bits (252),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS   +PQ+NPI+ RIE  AGHG GRPTQK+IDEAADRYAFMAKV+GA W
Sbjct  678  LLATMQYVLCTSLEKSPQSNPIISRIECKAGHGAGRPTQKVIDEAADRYAFMAKVMGASW  737

Query  225  IE  220
            ++
Sbjct  738  VQ  739



>ref|XP_011074726.1| PREDICTED: prolyl endopeptidase-like [Sesamum indicum]
Length=731

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/487 (71%), Positives = 408/487 (84%), Gaps = 12/487 (2%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGT QSEDILCW D DNP+H  SA VT+DGKY L+Y +ENCDPVNK+Y CD+S LP 
Sbjct  222   YHFLGTAQSEDILCWSDPDNPKHTRSAKVTDDGKYVLLYTYENCDPVNKIYHCDISVLPR  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+GY+GT ELLPF K+VD F+A Y ++AND+A+FTF TNK+AP+ KLVRVD+KEP  W 
Sbjct  282   GLEGYKGTKELLPFVKLVDTFDALYQYIANDDAIFTFLTNKDAPRNKLVRVDLKEPTFWN  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             +V++ED+KDVLESAVA N NQ+VVNYLSDVK+VLQLRD+ TG +++H LP+DIGTV  IS
Sbjct  342   EVLREDKKDVLESAVAANGNQIVVNYLSDVKNVLQLRDLETGALVHH-LPLDIGTVTEIS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             +RRK+S++FIGFT+FLIP IIY+CNL+++ P+++IFREI VPGFDR  FNV Q FV SKD
Sbjct  401   SRRKESMIFIGFTSFLIPGIIYKCNLEAETPDMRIFREIDVPGFDRTEFNVNQAFVPSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ K I LDGS+PCLL+GYGGF+ S+TPYFS +R++IAKHL VIFC+ANIRG
Sbjct  461   GTKIPMFIVARKGISLDGSHPCLLYGYGGFNVSITPYFSVSRILIAKHLDVIFCIANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHK GAL++KQNCFDDFI AAEYL++AG+TQ  KLCIEGGSNGGLLIGACINQ
Sbjct  521   GGEYGEEWHKGGALSRKQNCFDDFISAAEYLVSAGYTQARKLCIEGGSNGGLLIGACINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSD EE+FHWLIKYSPLHNVRRPW++
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDKEEQFHWLIKYSPLHNVRRPWDK  640

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM----------PCPDHAACPVYKRSQ  362
              +H   QYPSTMLLTADHDDRVVPLH+ K LA M           P  +     + +++ 
Sbjct  641   PSHMFIQYPSTMLLTADHDDRVVPLHSLKLLATMQYVLCSSLEKSPQTNPIIVRIERKAG  700

Query  361   HSANQPN  341
             H A  P 
Sbjct  701   HGAGMPT  707


 Score = 99.4 bits (246),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLC+S   +PQTNPI+ RIER AGHG G PTQK+IDEAADRY+FMAK+L A W
Sbjct  670  LLATMQYVLCSSLEKSPQTNPIIVRIERKAGHGAGMPTQKMIDEAADRYSFMAKMLDAFW  729

Query  225  IE  220
            I+
Sbjct  730  ID  731



>ref|XP_003523219.1| PREDICTED: prolyl endopeptidase-like [Glycine max]
 gb|KHN33822.1| Prolyl endopeptidase [Glycine soja]
Length=727

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/454 (74%), Positives = 398/454 (88%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQSEDILCW+D +NP++    SVT+DGKY L++I E CDPVNK+Y CDLS LPN
Sbjct  218   YHFLGTDQSEDILCWRDPENPKYTFGGSVTDDGKYILLHIAEGCDPVNKLYYCDLSKLPN  277

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
              L+G+R  + LLPF K++D+F+A Y  +AND+ VFTF TNK+APKYK+VRVD+KEP  W 
Sbjct  278   ALEGFRNGNSLLPFAKLIDNFDAQYEAIANDDTVFTFLTNKDAPKYKIVRVDLKEPTAWA  337

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+QE EKDVLESA AVN NQL+V+YLSDVK +LQ+RD++TG +L H LPI+IG+V+ IS
Sbjct  338   DVLQESEKDVLESACAVNGNQLIVSYLSDVKYLLQVRDLKTGSLL-HQLPIEIGSVSEIS  396

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+DS+VFIGFT+FL P IIYQCNL +++P++KIFREI VPGFDR+ F+V Q FV SKD
Sbjct  397   ARREDSVVFIGFTSFLTPGIIYQCNLGTEIPDMKIFREIVVPGFDRSEFHVKQDFVTSKD  456

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ KDI LDGS+PCLL+GYGGF+ ++TPYFS +R+V+ +HLGV+F +ANIRG
Sbjct  457   GTKIPMFIVAKKDITLDGSHPCLLYGYGGFNINITPYFSVSRIVLTRHLGVVFSIANIRG  516

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LA+KQNCFDDFI AAEYL++ G+TQP KLCIEGGSNGGLL+GACINQ
Sbjct  517   GGEYGEEWHKAGSLARKQNCFDDFISAAEYLVSTGYTQPKKLCIEGGSNGGLLVGACINQ  576

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCSD EEEFHWLIKYSPLHNVRRPWEQ
Sbjct  577   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSDKEEEFHWLIKYSPLHNVRRPWEQ  636

Query  508   TH-QACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
              H Q+ QYPSTMLLTADHDDRVVPLHT K LA M
Sbjct  637   HHDQSFQYPSTMLLTADHDDRVVPLHTLKLLATM  670


 Score = 99.8 bits (247),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS   +PQTN I+GRI+  +GHG GRPTQK+IDEAADRY FMAKVL  HW
Sbjct  666  LLATMQYVLCTSLEKSPQTNAIIGRIDCKSGHGAGRPTQKMIDEAADRYGFMAKVLEVHW  725

Query  225  IE  220
            IE
Sbjct  726  IE  727



>ref|XP_007136135.1| hypothetical protein PHAVU_009G020800g [Phaseolus vulgaris]
 gb|ESW08129.1| hypothetical protein PHAVU_009G020800g [Phaseolus vulgaris]
Length=730

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/471 (72%), Positives = 397/471 (84%), Gaps = 5/471 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQSEDILCW+D +NP++    SVT+DG+Y L+ I E CDPVNK+Y CDLS +PN
Sbjct  222   YHFLGTDQSEDILCWRDPENPKYTFGGSVTDDGQYILLNIAEGCDPVNKLYYCDLSKIPN  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
              L+G+R  + LLPF K+VD+F+A Y  +AND+ VFTF TNK+APKYKLVRVD+KEP  W 
Sbjct  282   ALEGFRNGNSLLPFVKLVDNFDAQYEAIANDDTVFTFLTNKDAPKYKLVRVDLKEPTVWA  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+QE EKDVLESA AVN NQL+V+YLSDVK +LQ+RD+RTG +L H LPIDIG+V+ +S
Sbjct  342   DVLQESEKDVLESACAVNGNQLIVSYLSDVKYLLQVRDLRTGSLL-HQLPIDIGSVSEVS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR+DS+VFIGFT+FL P IIYQCNL +++P++KIFREI VPGFDR+ F V Q FV  KD
Sbjct  401   GRREDSVVFIGFTSFLTPGIIYQCNLGTEIPDMKIFREIVVPGFDRSEFQVKQDFVSGKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
               KIP+FIV+ +DI LDGS+PCLL+GYGGF+ S+TPYFS +R+V+ +HLGV+FC+ANIRG
Sbjct  461   ATKIPVFIVAKRDIVLDGSHPCLLYGYGGFNISITPYFSVSRVVMTRHLGVVFCIANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LAKKQNCFDDFI AAEYL++ G+TQP KLCIEGGSNGGLL+GACINQ
Sbjct  521   GGEYGEEWHKAGSLAKKQNCFDDFISAAEYLVSTGYTQPKKLCIEGGSNGGLLVGACINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCAL HVGVMDMLRFHKFTIGHAWTSD+GCSD EEEFHWLIKYSPLHNVRRPWE 
Sbjct  581   RPDLFGCALGHVGVMDMLRFHKFTIGHAWTSDYGCSDKEEEFHWLIKYSPLHNVRRPWEH  640

Query  508   THQACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHS  356
             T Q+ QYPSTMLLTADHDDRVVPLHT K LA M     H  C   + S  +
Sbjct  641   TDQSIQYPSTMLLTADHDDRVVPLHTLKLLATMQ----HVLCTSLEESPQT  687


 Score =   104 bits (259),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQHVLCTS   +PQTNPI+GRI+  +GHG GRPTQK+IDEAADRY+FMAK+L  HW
Sbjct  669  LLATMQHVLCTSLEESPQTNPIIGRIDCKSGHGAGRPTQKMIDEAADRYSFMAKMLEVHW  728

Query  225  IE  220
            IE
Sbjct  729  IE  730



>gb|KDP36852.1| hypothetical protein JCGZ_08143 [Jatropha curcas]
Length=730

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/454 (76%), Positives = 395/454 (87%), Gaps = 3/454 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQSEDILCWKD +NP++M SA VTEDGKY L+YI E+CDPVNK+Y CD+S  P 
Sbjct  222   YHFLGTDQSEDILCWKDPENPKYMFSAGVTEDGKYLLLYIEESCDPVNKIYYCDMSIFPE  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL G+ G + LLPF K+VD+F+A Y  +AND+  FTF TNK+APKYKLVRVD+KEP  W 
Sbjct  282   GLGGFSG-NGLLPFLKLVDNFDAQYHAIANDDTSFTFLTNKDAPKYKLVRVDLKEPSIWT  340

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ E EKDVLESA AVN NQ++++YLSDVK VLQ+RD++TG +L H LPIDIGTV+GIS
Sbjct  341   DVVSEAEKDVLESARAVNGNQMILSYLSDVKYVLQVRDLKTGSLL-HQLPIDIGTVSGIS  399

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKDS VFIGFT+FL P IIYQCNL + VPE+KIFREI+V GFDR  F+V QVFV SKD
Sbjct  400   ARRKDSTVFIGFTSFLTPGIIYQCNLDTPVPEMKIFREISVAGFDRTEFHVDQVFVPSKD  459

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             GVKIPMFIV+ K+I LDGS+PCLL+GYGGF+ S+TP FS +R+ + +HLG ++C+ANIRG
Sbjct  460   GVKIPMFIVAKKNIKLDGSHPCLLYGYGGFNISLTPSFSVSRITLTRHLGAVYCIANIRG  519

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LAKKQNCFDDFI AAEYLI+ G+TQPSKLCIEGGSNGGLL+GA INQ
Sbjct  520   GGEYGEEWHKAGSLAKKQNCFDDFISAAEYLISTGYTQPSKLCIEGGSNGGLLVGASINQ  579

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCSDN+EEFHWLIKYSPLHNVRRPWEQ
Sbjct  580   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSDNKEEFHWLIKYSPLHNVRRPWEQ  639

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                Q CQYP+TMLLTADHDDRVVPLH+ K LA M
Sbjct  640   HPDQPCQYPATMLLTADHDDRVVPLHSLKLLATM  673


 Score =   105 bits (262),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLC+S  N+PQTNPI+GRI+  AGHG GRPTQKLIDEAADRY FMAKVLGA W
Sbjct  669  LLATMQYVLCSSLENSPQTNPIIGRIDCKAGHGAGRPTQKLIDEAADRYGFMAKVLGAAW  728

Query  225  IE  220
             E
Sbjct  729  TE  730



>ref|XP_010266944.1| PREDICTED: prolyl endopeptidase-like [Nelumbo nucifera]
Length=804

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/487 (71%), Positives = 407/487 (84%), Gaps = 12/487 (2%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQSEDILCWKDSDNP+++ SA V +DGKY L+YI E CDPVNK+Y CD+SALP+
Sbjct  295   YHFLGTDQSEDILCWKDSDNPKYLFSAQVMDDGKYVLLYIEEGCDPVNKLYYCDISALPD  354

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             G++G++G +E LPF K+VD+F+ASY  +AND  +FTF+TNK APKYKLVRVD+ EP  W 
Sbjct  355   GVEGFKGRNERLPFIKLVDNFDASYHAIANDGTLFTFQTNKEAPKYKLVRVDLNEPSVWT  414

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             +V++E EKDVL SA AVN+NQ++V YLSDVK VLQ+RD++TG +L+H LPIDIGTV G S
Sbjct  415   NVLEESEKDVLVSANAVNSNQILVRYLSDVKYVLQIRDLKTGSLLHH-LPIDIGTVYGSS  473

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RRKD+ +FIGFT+FL P IIYQCNL+++VPE+KIFREI VPGFDR  F V QVFVGSKD
Sbjct  474   GRRKDNEIFIGFTSFLTPGIIYQCNLETEVPEMKIFREIVVPGFDRMEFQVNQVFVGSKD  533

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIVS K+I LDGS+PCLL+GYGGF+ S+TP FS +R ++ +HLG +FC+ANIRG
Sbjct  534   GTKIPMFIVSRKNIILDGSHPCLLYGYGGFNISITPSFSVSRTILMRHLGAVFCIANIRG  593

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGE WHKAG+LAKKQNCFDDFI AAE+L++AG+TQP KLCIEGGSNGGLL+ ACI+Q
Sbjct  594   GGEYGEAWHKAGSLAKKQNCFDDFISAAEFLVSAGYTQPKKLCIEGGSNGGLLVAACISQ  653

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSD EEEF WLIKYSPLHNVRRPWEQ
Sbjct  654   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDKEEEFQWLIKYSPLHNVRRPWEQ  713

Query  508   TH-QACQYPSTMLLTADHDDRVVPLHTFKYLAMM--MPCPDHAACP--------VYKRSQ  362
              H + CQYPSTMLLTADHDDRVVPLH+ K LA M  + C      P        + ++S 
Sbjct  714   LHDKTCQYPSTMLLTADHDDRVVPLHSLKLLATMQYILCNSLEKSPQTNPIIGWIDRKSG  773

Query  361   HSANQPN  341
             H A +P 
Sbjct  774   HGAGRPT  780


 Score =   101 bits (252),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ++LC S   +PQTNPI+G I+R +GHG GRPTQKLIDEAADRY+FMAK+LGA W
Sbjct  743  LLATMQYILCNSLEKSPQTNPIIGWIDRKSGHGAGRPTQKLIDEAADRYSFMAKMLGASW  802

Query  225  IE  220
            I+
Sbjct  803  IK  804



>ref|XP_004291316.1| PREDICTED: prolyl endopeptidase-like [Fragaria vesca subsp. vesca]
Length=730

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/454 (74%), Positives = 397/454 (87%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS DILCWKDS+NP+++  ASVT+DGKYAL+ + E CDPVNK Y CD+S LPN
Sbjct  223   YHFLGTDQSNDILCWKDSENPKYLFGASVTDDGKYALMNVDEGCDPVNKFYYCDMSTLPN  282

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G R  +ELLP  K+VD FEA Y  +AND+ VFTF TNK+APKYKLVRVD+KEP  W 
Sbjct  283   GLEGLRANNELLPVVKLVDTFEACYHAIANDDTVFTFLTNKDAPKYKLVRVDLKEPTVWT  342

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVI+E EKDVLESA AVN NQ++V+YLSDVK VLQ+RD+++G ++ H LPIDIGTV GIS
Sbjct  343   DVIKESEKDVLESASAVNGNQMIVSYLSDVKYVLQIRDLKSGSLV-HQLPIDIGTVTGIS  401

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+DS +F GFT+F+ P +IYQCNL S+VP+L++FREITVPGFDR+ F+V QVF+ SKD
Sbjct  402   ARREDSTIFFGFTSFVTPGVIYQCNLDSEVPDLRVFREITVPGFDRSDFHVDQVFIPSKD  461

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G +IP+FIV+ K+I LDGS+PCLL+GYGGF+ S+TP FS +R+V+A+HLGV++CLANIRG
Sbjct  462   GTQIPIFIVARKNIVLDGSHPCLLYGYGGFNISLTPSFSVSRIVLARHLGVVYCLANIRG  521

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+L+KKQNCFDDFI A EYL++AG+TQPSKLCIEGGSNGGLL+GACINQ
Sbjct  522   GGEYGEEWHKAGSLSKKQNCFDDFISAGEYLVSAGYTQPSKLCIEGGSNGGLLVGACINQ  581

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCSD EEEFHWLIKYSPLHNV RPWEQ
Sbjct  582   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSDKEEEFHWLIKYSPLHNVNRPWEQ  641

Query  508   THQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM  407
              H   QYP TMLLTADHDDRVVPLH+ K+LA + 
Sbjct  642   -HPNQQYPPTMLLTADHDDRVVPLHSLKFLATLQ  674


 Score = 97.4 bits (241),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+QHVL TS   +PQTNPI+GRIE  AGHG GRPTQK+IDEAADR++FM K LGA W
Sbjct  669  FLATLQHVLITSLEKSPQTNPIIGRIECKAGHGAGRPTQKMIDEAADRFSFMVKTLGASW  728

Query  225  IE  220
            I+
Sbjct  729  ID  730



>ref|XP_007160609.1| hypothetical protein PHAVU_001G001700g [Phaseolus vulgaris]
 gb|ESW32603.1| hypothetical protein PHAVU_001G001700g [Phaseolus vulgaris]
Length=780

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/454 (74%), Positives = 394/454 (87%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQSEDILCW+D +NP+HM   SVTEDGKY L+YI E CDPVNK+Y  DLS LPN
Sbjct  271   YHFLGTDQSEDILCWRDPENPKHMFGGSVTEDGKYLLLYIEEGCDPVNKLYYYDLSELPN  330

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+ +R  + LLPF K+VD F+  Y  +AND+ +FTF TNK+APKYK+VRVD+KEP  W 
Sbjct  331   GLESFRNENSLLPFVKLVDKFDGQYHAIANDDTLFTFLTNKDAPKYKIVRVDLKEPNAWT  390

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVIQE EKDVLESA AVN N+L+V+YLSDVK VLQ+RD+ TG  L H LPIDIGTV+ IS
Sbjct  391   DVIQESEKDVLESARAVNGNKLIVSYLSDVKYVLQVRDLETGS-LQHQLPIDIGTVSEIS  449

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR+DS VFIGFT+FL P IIYQC+L++++P++KIFREI VPGFDR+ F V QVFV SKD
Sbjct  450   GRREDSEVFIGFTSFLTPGIIYQCDLRTQIPDMKIFREIVVPGFDRSEFQVNQVFVPSKD  509

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ KDI LDGS+PCLL+GYGGF+ S+TPYF+ +R V+A+HLGV+FC+ANIRG
Sbjct  510   GTKIPMFIVAKKDIVLDGSHPCLLYGYGGFNISLTPYFNISRTVLARHLGVVFCIANIRG  569

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGE+WHKAG+LA KQNCFDDFI AAEYL++AG+T+P KLCIEGGSNGGLL+GACINQ
Sbjct  570   GGEYGEDWHKAGSLANKQNCFDDFISAAEYLVSAGYTKPKKLCIEGGSNGGLLVGACINQ  629

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWT+D+GCSD EEEFHWLIKYSPLHNV+RPWE+
Sbjct  630   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTTDYGCSDKEEEFHWLIKYSPLHNVQRPWEK  689

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
               +Q+ QYPSTMLLTADHDDRVVPLH+ K LA +
Sbjct  690   HPNQSIQYPSTMLLTADHDDRVVPLHSLKLLATL  723


 Score = 98.6 bits (244),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+Q+VL  S   +PQTNPI+GRIE  AGHG GRPT+K+IDEAADRY+FMAK+L AHW
Sbjct  719  LLATLQYVLVNSLDESPQTNPIIGRIECKAGHGAGRPTKKMIDEAADRYSFMAKMLDAHW  778

Query  225  IE  220
            IE
Sbjct  779  IE  780



>gb|KCW70284.1| hypothetical protein EUGRSUZ_F03531 [Eucalyptus grandis]
Length=774

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/454 (74%), Positives = 396/454 (87%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHF+GTDQ+EDILCW+DSDNP++M  ASVTEDGKY L+ I E+CDPVNKVY CD+S+LP+
Sbjct  265   YHFVGTDQTEDILCWRDSDNPKYMFGASVTEDGKYVLLDIVEDCDPVNKVYYCDMSSLPD  324

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             G++G +  +ELLPF K+VD+ +A Y  VANDE VFTF TNK+AP+YKLVRVD++EP  W 
Sbjct  325   GIEGLKKRNELLPFIKLVDNLDAKYEAVANDETVFTFLTNKDAPRYKLVRVDLREPNVWT  384

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVI+E EKDVLESA AVN+NQL+V+YLSDVK V+Q+RD++TG +L H LPIDIGTV+GIS
Sbjct  385   DVIKEAEKDVLESASAVNHNQLIVSYLSDVKYVVQIRDLKTGSLL-HQLPIDIGTVSGIS  443

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+DS +F  FT+FL P IIYQC+LQ++VP++KIFREI V GFDR+ F V QVFV SKD
Sbjct  444   ARREDSTIFFSFTSFLSPGIIYQCDLQNEVPDMKIFREIVVSGFDRSEFQVNQVFVSSKD  503

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ K I LDGS+PCLL+GYGGF+ S+TP FS +R ++ +HLG ++C+ANIRG
Sbjct  504   GTKIPMFIVARKGISLDGSHPCLLYGYGGFNISITPSFSVSRTILIRHLGAVYCIANIRG  563

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAGALAKKQNCFDDFI AA+YL++AG+TQP KLCIEGGSNGGLLIGACINQ
Sbjct  564   GGEYGEEWHKAGALAKKQNCFDDFISAAQYLVSAGYTQPKKLCIEGGSNGGLLIGACINQ  623

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGC+D EEEFHWLIKYSPLHNVRRPWEQ
Sbjct  624   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCADKEEEFHWLIKYSPLHNVRRPWEQ  683

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                Q  QYP TMLLTADHDDRVVPLH+ K LA M
Sbjct  684   GPDQLVQYPPTMLLTADHDDRVVPLHSLKLLATM  717


 Score =   100 bits (248),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS   +PQTNPI+GRIE  AGHG GRPT+K+IDEAADRY FMAK+L A W
Sbjct  713  LLATMQYVLCTSLEKSPQTNPILGRIECKAGHGAGRPTKKMIDEAADRYGFMAKMLDASW  772

Query  225  IE  220
            I+
Sbjct  773  ID  774



>ref|XP_011034924.1| PREDICTED: prolyl endopeptidase-like [Populus euphratica]
Length=731

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/472 (72%), Positives = 396/472 (84%), Gaps = 6/472 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             +HF+GTDQSEDILCW+DS+NP++M  ASVT+DGKY L+YI ENCDPVNKVY CD+SA  +
Sbjct  222   HHFVGTDQSEDILCWRDSENPKYMFGASVTDDGKYLLLYITENCDPVNKVYYCDMSAFSD  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G++G   LLPF K++D+F+A Y  +AND+ VFTF TNK+APKYK+VRVD+KEPG W 
Sbjct  282   GLEGFKGGKSLLPFIKLIDNFDAQYQHIANDDTVFTFLTNKDAPKYKVVRVDLKEPGSWI  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ E  KDVLESA AVN ++++V+YL DVK VLQ+RD+ TG +L H LPIDIG+V GIS
Sbjct  342   DVVPESGKDVLESACAVNGDKMIVSYLRDVKYVLQIRDLNTGSLL-HQLPIDIGSVTGIS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKDS VFIGFT+FL P IIYQCNL + VP++KIFREITVPGFDR  F V QVFV SKD
Sbjct  401   ARRKDSTVFIGFTSFLTPGIIYQCNLDTGVPDMKIFREITVPGFDRTEFQVNQVFVPSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ K+I LDGS+PCLL+ YGGF+ S+TP FS +R V+ +HLG +FC+ANIRG
Sbjct  461   GTKIPMFIVAKKNIKLDGSHPCLLYAYGGFNISLTPSFSVSRTVLTRHLGAVFCIANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LA+KQNCFDDFI A+EYL+ AG+TQP KLCIEGGSNGGLLIGACINQ
Sbjct  521   GGEYGEEWHKAGSLARKQNCFDDFISASEYLVTAGYTQPKKLCIEGGSNGGLLIGACINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSD +EEF WLIKYSPLHNVRRPWEQ
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDKKEEFGWLIKYSPLHNVRRPWEQ  640

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHS  356
                Q  QYPSTMLLTADHDDRVVPLH+ K LA M     H  C   K S  +
Sbjct  641   HPEQPSQYPSTMLLTADHDDRVVPLHSLKLLATMQ----HILCTSLKNSPQT  688


 Score =   103 bits (257),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQH+LCTS  N+PQTNPI+GRI+  AGHG GRPTQKLID+AADRY+FMAK++GA W
Sbjct  670  LLATMQHILCTSLKNSPQTNPIIGRIDCKAGHGAGRPTQKLIDQAADRYSFMAKMVGASW  729

Query  225  IE  220
             E
Sbjct  730  NE  731



>gb|EYU17544.1| hypothetical protein MIMGU_mgv1a001978mg [Erythranthe guttata]
Length=731

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/472 (72%), Positives = 401/472 (85%), Gaps = 6/472 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQSEDILCW D +NP+H  SASVT+DGKY L+YI ENCDPVNK+Y CD+S LP 
Sbjct  222   YHFLGTDQSEDILCWSDPENPKHTRSASVTDDGKYVLLYIGENCDPVNKIYYCDISLLPK  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+GY+G+ ELLPF K+VD+F+ASY +VAND+ +FTF TNK+AP+ KLVRVD++EP  W 
Sbjct  282   GLEGYKGSKELLPFVKLVDNFDASYHYVANDDTIFTFLTNKDAPRNKLVRVDLREPSSWT  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             +V+QED+KDVLESA AVN+NQLVVNYLSDVK+VLQ+RD++TG  L H LP+DIG V+ IS
Sbjct  342   EVLQEDKKDVLESASAVNHNQLVVNYLSDVKNVLQIRDLKTGDFL-HRLPLDIGAVSEIS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RRKDSI+F+GFT+FL+P IIY CNL+   P++KIFREI VPGFDR  F  +QVFV SKD
Sbjct  401   CRRKDSIMFVGFTSFLVPGIIYMCNLEGDAPDMKIFREIVVPGFDRTEFESSQVFVTSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIP FIV+ K + LDGS+PCLL+GYGGF+ S+TPYF+ AR++IAKHL V+FC+ANIRG
Sbjct  461   GTKIPTFIVARKGLSLDGSHPCLLYGYGGFNISITPYFTAARILIAKHLDVVFCIANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LA KQN FDDFI AAEYL++AG+TQP KLCIEGGSNGGLL+GACINQ
Sbjct  521   GGEYGEEWHKAGSLANKQNVFDDFISAAEYLVSAGYTQPKKLCIEGGSNGGLLVGACINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFH FTIGHAWTSD+GCS  EEEFHWLIKYSPLHNVRRPW++
Sbjct  581   RPDLFGCALAHVGVMDMLRFHMFTIGHAWTSDYGCSSKEEEFHWLIKYSPLHNVRRPWDK  640

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHS  356
              + +  QYPSTMLLTADHDDRVVPLH+ K LA +     H  C   ++S  +
Sbjct  641   PSEEGSQYPSTMLLTADHDDRVVPLHSLKLLATLQ----HVLCTSVEKSPQT  688


 Score =   100 bits (249),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+QHVLCTS   +PQTNPI+GRIE  AGHG G PTQK+IDEAADRYAFMAKV+ A W
Sbjct  670  LLATLQHVLCTSVEKSPQTNPIIGRIEHKAGHGAGMPTQKIIDEAADRYAFMAKVVDATW  729

Query  225  IE  220
             +
Sbjct  730  TD  731



>gb|KCW70285.1| hypothetical protein EUGRSUZ_F03531 [Eucalyptus grandis]
Length=726

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/467 (73%), Positives = 403/467 (86%), Gaps = 7/467 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHF+GTDQ+EDILCW+DSDNP++M  ASVTEDGKY L+ I E+CDPVNKVY CD+S+LP+
Sbjct  265   YHFVGTDQTEDILCWRDSDNPKYMFGASVTEDGKYVLLDIVEDCDPVNKVYYCDMSSLPD  324

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             G++G +  +ELLPF K+VD+ +A Y  VANDE VFTF TNK+AP+YKLVRVD++EP  W 
Sbjct  325   GIEGLKKRNELLPFIKLVDNLDAKYEAVANDETVFTFLTNKDAPRYKLVRVDLREPNVWT  384

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVI+E EKDVLESA AVN+NQL+V+YLSDVK V+Q+RD++TG +L H LPIDIGTV+GIS
Sbjct  385   DVIKEAEKDVLESASAVNHNQLIVSYLSDVKYVVQIRDLKTGSLL-HQLPIDIGTVSGIS  443

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+DS +F  FT+FL P IIYQC+LQ++VP++KIFREI V GFDR+ F V QVFV SKD
Sbjct  444   ARREDSTIFFSFTSFLSPGIIYQCDLQNEVPDMKIFREIVVSGFDRSEFQVNQVFVSSKD  503

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ K I LDGS+PCLL+GYGGF+ S+TP FS +R ++ +HLG ++C+ANIRG
Sbjct  504   GTKIPMFIVARKGISLDGSHPCLLYGYGGFNISITPSFSVSRTILIRHLGAVYCIANIRG  563

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAGALAKKQNCFDDFI AA+YL++AG+TQP KLCIEGGSNGGLLIGACINQ
Sbjct  564   GGEYGEEWHKAGALAKKQNCFDDFISAAQYLVSAGYTQPKKLCIEGGSNGGLLIGACINQ  623

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGC+D EEEFHWLIKYSPLHNVRRPWEQ
Sbjct  624   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCADKEEEFHWLIKYSPLHNVRRPWEQ  683

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYK  371
                Q  QYP TMLLTADHDDRVVPLH+ K LA+     ++A  P++K
Sbjct  684   GPDQLVQYPPTMLLTADHDDRVVPLHSLKLLAV-----NNAIRPMHK  725



>ref|XP_010063100.1| PREDICTED: LOW QUALITY PROTEIN: prolyl endopeptidase [Eucalyptus 
grandis]
Length=807

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/454 (74%), Positives = 396/454 (87%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHF+GTDQ+EDILCW+DSDNP++M  ASVTEDGKY L+ I E+CDPVNKVY CD+S+LP+
Sbjct  298   YHFVGTDQTEDILCWRDSDNPKYMFGASVTEDGKYVLLDIVEDCDPVNKVYYCDMSSLPD  357

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             G++G +  +ELLPF K+VD+ +A Y  VANDE VFTF TNK+AP+YKLVRVD++EP  W 
Sbjct  358   GIEGLKKRNELLPFIKLVDNLDAKYEAVANDETVFTFLTNKDAPRYKLVRVDLREPNVWT  417

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVI+E EKDVLESA AVN+NQL+V+YLSDVK V+Q+RD++TG +L H LPIDIGTV+GIS
Sbjct  418   DVIKEAEKDVLESASAVNHNQLIVSYLSDVKYVVQIRDLKTGSLL-HQLPIDIGTVSGIS  476

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+DS +F  FT+FL P IIYQC+LQ++VP++KIFREI V GFDR+ F V QVFV SKD
Sbjct  477   ARREDSTIFFSFTSFLSPGIIYQCDLQNEVPDMKIFREIVVSGFDRSEFQVNQVFVSSKD  536

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ K I LDGS+PCLL+GYGGF+ S+TP FS +R ++ +HLG ++C+ANIRG
Sbjct  537   GTKIPMFIVARKGISLDGSHPCLLYGYGGFNISITPSFSVSRTILIRHLGAVYCIANIRG  596

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAGALAKKQNCFDDFI AA+YL++AG+TQP KLCIEGGSNGGLLIGACINQ
Sbjct  597   GGEYGEEWHKAGALAKKQNCFDDFISAAQYLVSAGYTQPKKLCIEGGSNGGLLIGACINQ  656

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGC+D EEEFHWLIKYSPLHNVRRPWEQ
Sbjct  657   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCADKEEEFHWLIKYSPLHNVRRPWEQ  716

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                Q  QYP TMLLTADHDDRVVPLH+ K LA M
Sbjct  717   GPDQLVQYPPTMLLTADHDDRVVPLHSLKLLATM  750


 Score =   100 bits (248),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS   +PQTNPI+GRIE  AGHG GRPT+K+IDEAADRY FMAK+L A W
Sbjct  746  LLATMQYVLCTSLEKSPQTNPILGRIECKAGHGAGRPTKKMIDEAADRYGFMAKMLDASW  805

Query  225  IE  220
            I+
Sbjct  806  ID  807



>ref|XP_003545007.2| PREDICTED: prolyl endopeptidase-like [Glycine max]
Length=762

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/454 (74%), Positives = 392/454 (86%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS+DILCW+D +NP++M   +VTEDGKY L+YI E CDPVNK+Y CDLS LPN
Sbjct  253   YHFLGTDQSQDILCWRDPENPKYMFGGTVTEDGKYVLLYIEEGCDPVNKLYYCDLSELPN  312

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+R    LLPF K+VD F+  Y  +AND+ +FTF TNK+APKYKLVRVD+KEP  W 
Sbjct  313   GLEGFRNESSLLPFVKLVDKFDGQYQAIANDDTLFTFLTNKDAPKYKLVRVDLKEPNAWT  372

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVI E EKDVLESA AVN NQL+V+YLSDVK VLQ+RD+ TG  L H LPIDIGTV+ IS
Sbjct  373   DVIPESEKDVLESARAVNGNQLIVSYLSDVKYVLQVRDLETGS-LQHKLPIDIGTVSEIS  431

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+D+++FIGFT+FL P IIYQC+L ++ P++KIFREI +PGFDR+ F+V QVFV SKD
Sbjct  432   ARREDTVLFIGFTSFLTPGIIYQCDLGTQTPDMKIFREIDIPGFDRSEFHVNQVFVPSKD  491

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ KDI LDGS+PCLL+GYGGF+ S+TPYF+ +R V+A+HLG +FC+ANIRG
Sbjct  492   GTKIPMFIVARKDIVLDGSHPCLLYGYGGFNVSLTPYFNISRTVLARHLGAVFCIANIRG  551

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHK+G+LA KQNCFDDFI AAEYL++AG+TQP KLCIEGGSNGGLL+GACINQ
Sbjct  552   GGEYGEEWHKSGSLANKQNCFDDFISAAEYLVSAGYTQPRKLCIEGGSNGGLLVGACINQ  611

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAW +D+GCS+ EEEFHWLIKYSPLHNVRRPWEQ
Sbjct  612   RPDLFGCALAHVGVMDMLRFHKFTIGHAWATDYGCSEKEEEFHWLIKYSPLHNVRRPWEQ  671

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                Q+ QYPSTMLLTADHDDRVVPLH+ K LA +
Sbjct  672   HPDQSIQYPSTMLLTADHDDRVVPLHSLKLLATL  705


 Score =   101 bits (252),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+Q+VL TS   +PQTNPI+GRIE  AGHG GRPTQK+IDEAADRY+FMAK+L AHW
Sbjct  701  LLATLQYVLVTSLDKSPQTNPIIGRIECKAGHGAGRPTQKMIDEAADRYSFMAKMLDAHW  760

Query  225  IE  220
            IE
Sbjct  761  IE  762



>gb|KHN12595.1| Prolyl endopeptidase [Glycine soja]
Length=732

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/454 (74%), Positives = 392/454 (86%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS+DILCW+D +NP++M   +VTEDGKY L+YI E CDPVNK+Y CDLS LPN
Sbjct  223   YHFLGTDQSQDILCWRDPENPKYMFGGTVTEDGKYVLLYIEEGCDPVNKLYYCDLSELPN  282

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+R    LLPF K+VD F+  Y  +AND+ +FTF TNK+APKYKLVRVD+KEP  W 
Sbjct  283   GLEGFRNESSLLPFVKLVDKFDGQYQAIANDDTLFTFLTNKDAPKYKLVRVDLKEPNAWT  342

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVI E EKDVLESA AVN NQL+V+YLSDVK VLQ+RD+ TG  L H LPIDIGTV+ IS
Sbjct  343   DVIPESEKDVLESARAVNGNQLIVSYLSDVKYVLQVRDLETGS-LQHKLPIDIGTVSEIS  401

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+D+++FIGFT+FL P IIYQC+L ++ P++KIFREI +PGFDR+ F+V QVFV SKD
Sbjct  402   ARREDTVLFIGFTSFLTPGIIYQCDLGTQTPDMKIFREIDIPGFDRSEFHVNQVFVPSKD  461

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ KDI LDGS+PCLL+GYGGF+ S+TPYF+ +R V+A+HLG +FC+ANIRG
Sbjct  462   GTKIPMFIVARKDIVLDGSHPCLLYGYGGFNVSLTPYFNISRTVLARHLGAVFCIANIRG  521

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHK+G+LA KQNCFDDFI AAEYL++AG+TQP KLCIEGGSNGGLL+GACINQ
Sbjct  522   GGEYGEEWHKSGSLANKQNCFDDFISAAEYLVSAGYTQPRKLCIEGGSNGGLLVGACINQ  581

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAW +D+GCS+ EEEFHWLIKYSPLHNVRRPWEQ
Sbjct  582   RPDLFGCALAHVGVMDMLRFHKFTIGHAWATDYGCSEKEEEFHWLIKYSPLHNVRRPWEQ  641

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                Q+ QYPSTMLLTADHDDRVVPLH+ K LA +
Sbjct  642   HPDQSIQYPSTMLLTADHDDRVVPLHSLKLLATL  675


 Score =   101 bits (252),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+Q+VL TS   +PQTNPI+GRIE  AGHG GRPTQK+IDEAADRY+FMAK+L AHW
Sbjct  671  LLATLQYVLVTSLDKSPQTNPIIGRIECKAGHGAGRPTQKMIDEAADRYSFMAKMLDAHW  730

Query  225  IE  220
            IE
Sbjct  731  IE  732



>ref|XP_002300671.1| prolyl oligopeptidase family protein [Populus trichocarpa]
 gb|EEE79944.1| prolyl oligopeptidase family protein [Populus trichocarpa]
Length=731

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/472 (72%), Positives = 396/472 (84%), Gaps = 6/472 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             +HF+GTDQSEDILCW+DS+NP++M  A VT+DGKY L+YI ENCDPVNKVY CD+SA  +
Sbjct  222   HHFVGTDQSEDILCWRDSENPKYMFGAGVTDDGKYLLLYITENCDPVNKVYYCDMSAFSD  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G++G   LLPF K++D+F+A Y  +AND+ VFTF TNK+APKYK+VRVD+KEPG W 
Sbjct  282   GLEGFKGGKSLLPFIKLIDNFDAQYQHIANDDTVFTFLTNKDAPKYKVVRVDLKEPGSWI  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ E  KDVLESA AVN ++++V+YL DVK VLQ+RD+ TG +L H LPIDIG+V GIS
Sbjct  342   DVVPEYGKDVLESACAVNGDKMIVSYLRDVKYVLQIRDLNTGSLL-HQLPIDIGSVTGIS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKDS VFIGFT+FL P IIYQCNL + VP++KIFREITVPGFDR  F V QVFV SKD
Sbjct  401   ARRKDSTVFIGFTSFLTPGIIYQCNLDTGVPDMKIFREITVPGFDRTEFQVNQVFVPSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ K+I LDGS+PCLL+ YGGF+ S+TP FS +R V+ +HLG +FC+ANIRG
Sbjct  461   GTKIPMFIVAKKNIKLDGSHPCLLYAYGGFNISLTPSFSISRTVLTRHLGAVFCIANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LA+KQNCFDDFI A+EYL+ AG+TQP KLCIEGGSNGGLLIGACINQ
Sbjct  521   GGEYGEEWHKAGSLARKQNCFDDFISASEYLVTAGYTQPKKLCIEGGSNGGLLIGACINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSD +EEF WLIKYSPLHNVRRPWEQ
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDKKEEFGWLIKYSPLHNVRRPWEQ  640

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHS  356
                Q  QYPSTMLLTADHDDRVVPLH+ K LA M     H  C   K+S  +
Sbjct  641   HPEQPSQYPSTMLLTADHDDRVVPLHSLKLLATMQ----HILCTSLKKSPQT  688


 Score =   100 bits (248),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQH+LCTS   +PQTNPI+GRI+  AGHG GRPTQKLID+AADRY+FMAK++GA W
Sbjct  670  LLATMQHILCTSLKKSPQTNPIIGRIDCKAGHGAGRPTQKLIDQAADRYSFMAKMVGASW  729



>ref|XP_011041281.1| PREDICTED: prolyl endopeptidase-like [Populus euphratica]
Length=786

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/454 (74%), Positives = 393/454 (87%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHF+GTDQSEDI CW+DS+NP++M  A VT+DGKY L+YI ENCDPVNKVY CD+SA  +
Sbjct  277   YHFVGTDQSEDIQCWRDSENPKYMFGAGVTDDGKYLLLYISENCDPVNKVYYCDMSAFHD  336

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G++G + LLPF K++D F+A Y  +AND+ VFTF TNK+AP+YK+VRVD+KEP  W 
Sbjct  337   GLEGFKGGNALLPFIKLIDDFDAQYQEIANDDTVFTFLTNKDAPRYKVVRVDLKEPSSWI  396

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ E EKDVLESA AVN +Q++V YLSDVK VLQ+RD++TG +L H LP DIG+V GIS
Sbjct  397   DVVPESEKDVLESAFAVNGDQMIVCYLSDVKYVLQIRDLKTGSLL-HQLPTDIGSVTGIS  455

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+DS VFIGFT+FL P IIYQCNL SKVP++KIFREI+VPGF+R+ F V+QVFV SKD
Sbjct  456   ARRRDSTVFIGFTSFLTPGIIYQCNLDSKVPDMKIFREISVPGFNRSEFQVSQVFVPSKD  515

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G +IPMFIV+ K+I LDGS+PCLL+ YGGF+ S+TP FS +R+V+ +HLG +FC+ANIRG
Sbjct  516   GTRIPMFIVAKKNIALDGSHPCLLYAYGGFNISITPSFSVSRIVLTRHLGSVFCIANIRG  575

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LA+KQNCFDDFI AAEYL++AG+TQP KLCIEGGSNGGLL+GACINQ
Sbjct  576   GGEYGEEWHKAGSLARKQNCFDDFISAAEYLVSAGYTQPKKLCIEGGSNGGLLVGACINQ  635

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSD EEEF WL KYSPLHNVRRPWEQ
Sbjct  636   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDKEEEFGWLFKYSPLHNVRRPWEQ  695

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                Q  QYPSTMLLTADHDDRVVPLH+ K LA M
Sbjct  696   HPEQPSQYPSTMLLTADHDDRVVPLHSLKLLATM  729


 Score =   103 bits (256),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ++LCTS  N+PQTNPI+GRI+  AGHG GRPTQKLIDEAADRY+FMAK+L A W
Sbjct  725  LLATMQYILCTSLKNSPQTNPIIGRIDCKAGHGAGRPTQKLIDEAADRYSFMAKMLDASW  784

Query  225  IE  220
             E
Sbjct  785  TE  786



>ref|XP_010266084.1| PREDICTED: prolyl endopeptidase-like [Nelumbo nucifera]
Length=732

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/501 (69%), Positives = 408/501 (81%), Gaps = 14/501 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQSED+LCWKD DNP+++ +A V +DGKY L+YI E CDPVNK+Y CD+S LP 
Sbjct  223   YHFLGTDQSEDVLCWKDPDNPKYLFAAEVMDDGKYVLLYIEEGCDPVNKLYYCDISTLPG  282

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G++G DE LPF K++D+FEASY  +AND   FTF+TNK+APKYKLV V++ EP  W 
Sbjct  283   GLEGFKGRDEKLPFIKLIDNFEASYHAIANDGTEFTFQTNKDAPKYKLVWVNLNEPSVWT  342

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV++E EKDVLESAVAVN NQ++V+YLSDVK VLQ+RD++TG +L+H LP+DIGTV G S
Sbjct  343   DVLEESEKDVLESAVAVNENQILVSYLSDVKYVLQIRDLKTGSLLHH-LPLDIGTVYGSS  401

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RRKDS VFIGFT+FL P IIY+CNL+S+VPELKIFREI VPGFDR  F V QVF  SKD
Sbjct  402   GRRKDSEVFIGFTSFLTPGIIYKCNLESEVPELKIFREIVVPGFDRTDFQVNQVFPASKD  461

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIP+FIVS K+I LDGS+PCLL+GYGGF+ S+TP FS  R+V+ +HLG +FC+ANIRG
Sbjct  462   GTKIPIFIVSKKNILLDGSHPCLLYGYGGFNISITPSFSVKRIVLMRHLGAVFCIANIRG  521

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LAKKQNCFDDFI AAE+LI+AG+TQP KLCIEGGSNGGLL+ ACINQ
Sbjct  522   GGEYGEEWHKAGSLAKKQNCFDDFISAAEFLISAGYTQPKKLCIEGGSNGGLLVAACINQ  581

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPD+FGCALAHVGVMDMLRFHKFTIGHAWTSD+GCSD EEEF WLIKYSPLHNVRRPWEQ
Sbjct  582   RPDIFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSDKEEEFRWLIKYSPLHNVRRPWEQ  641

Query  508   THQ-ACQYPSTMLLTADHDDRVVPLHTFKYLAMM--MPCPDHAACP--------VYKRSQ  362
              +   CQYPSTMLLTADHDDRVVPLH+ K LA M  + C      P        + +++ 
Sbjct  642   HNDLTCQYPSTMLLTADHDDRVVPLHSLKLLATMQYVLCTSLEKSPQTNPIIGRIDRKAG  701

Query  361   HSANQPNCG--SHRAQCWPWM  305
             H A +P        A C+ +M
Sbjct  702   HGAGRPTQKLIDEAADCYSFM  722


 Score =   100 bits (250),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS   +PQTNPI+GRI+R AGHG GRPTQKLIDEAAD Y+FM K+LG  W
Sbjct  671  LLATMQYVLCTSLEKSPQTNPIIGRIDRKAGHGAGRPTQKLIDEAADCYSFMTKMLGVSW  730

Query  225  I  223
            I
Sbjct  731  I  731



>ref|XP_009334405.1| PREDICTED: prolyl endopeptidase-like isoform X1 [Pyrus x bretschneideri]
Length=733

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/455 (73%), Positives = 392/455 (86%), Gaps = 2/455 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHF+GTDQSEDILCW+DS+NP+++  A VT DGKY L+Y+ E CDPVNK Y CD+SALPN
Sbjct  224   YHFVGTDQSEDILCWRDSENPKYLFDADVTYDGKYILLYVEEGCDPVNKFYYCDMSALPN  283

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G RG ++LLP  K++D F+A Y  +ANDE VFT  TNK+APKYKLVRVD+KEP  W 
Sbjct  284   GLEGLRGKNDLLPVIKVIDKFDAQYHVIANDETVFTLLTNKDAPKYKLVRVDLKEPTVWT  343

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ E EKDVLESA AVN  Q++V+YLSDVK V+Q+RD+++G +L H LPIDIG+VN IS
Sbjct  344   DVVPESEKDVLESASAVNGTQMIVSYLSDVKYVVQIRDLKSGNLL-HQLPIDIGSVNEIS  402

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+DS VF GFT+FL P IIYQCNL +++P+LK+ REITVPGF+R+ F+V QVFV SKD
Sbjct  403   ARREDSTVFFGFTSFLTPGIIYQCNLDNEIPDLKVLREITVPGFERSEFHVDQVFVLSKD  462

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIP F+V+ K+I LDGS+PCLL+GYGGF+ S+TP FS +R V+ +HLGV++C+ANIRG
Sbjct  463   GTKIPTFVVARKNISLDGSHPCLLYGYGGFNISITPSFSVSRSVLTRHLGVVYCIANIRG  522

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+L+KKQNCFDDFI AAEYL++AG+TQPSKLCIEGGSNGGLL+GACINQ
Sbjct  523   GGEYGEEWHKAGSLSKKQNCFDDFISAAEYLVSAGYTQPSKLCIEGGSNGGLLVGACINQ  582

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCSD EEEF WLIKYSPLHNVRRPWEQ
Sbjct  583   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSDKEEEFRWLIKYSPLHNVRRPWEQ  642

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM  407
                Q  QYPSTMLLTADHDDRVVPLH+ K LA + 
Sbjct  643   HASQPHQYPSTMLLTADHDDRVVPLHSLKLLATLQ  677


 Score =   105 bits (261),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+Q+VL TS  N+PQTNPI+GRIE  AGHG GRPTQK+IDEAADRY+FMAKVLGA W
Sbjct  672  LLATLQYVLITSLENSPQTNPIIGRIECKAGHGAGRPTQKMIDEAADRYSFMAKVLGASW  731

Query  225  IE  220
            IE
Sbjct  732  IE  733



>ref|XP_009334412.1| PREDICTED: prolyl endopeptidase-like isoform X2 [Pyrus x bretschneideri]
Length=731

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/455 (73%), Positives = 392/455 (86%), Gaps = 2/455 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHF+GTDQSEDILCW+DS+NP+++  A VT DGKY L+Y+ E CDPVNK Y CD+SALPN
Sbjct  222   YHFVGTDQSEDILCWRDSENPKYLFDADVTYDGKYILLYVEEGCDPVNKFYYCDMSALPN  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G RG ++LLP  K++D F+A Y  +ANDE VFT  TNK+APKYKLVRVD+KEP  W 
Sbjct  282   GLEGLRGKNDLLPVIKVIDKFDAQYHVIANDETVFTLLTNKDAPKYKLVRVDLKEPTVWT  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ E EKDVLESA AVN  Q++V+YLSDVK V+Q+RD+++G +L H LPIDIG+VN IS
Sbjct  342   DVVPESEKDVLESASAVNGTQMIVSYLSDVKYVVQIRDLKSGNLL-HQLPIDIGSVNEIS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+DS VF GFT+FL P IIYQCNL +++P+LK+ REITVPGF+R+ F+V QVFV SKD
Sbjct  401   ARREDSTVFFGFTSFLTPGIIYQCNLDNEIPDLKVLREITVPGFERSEFHVDQVFVLSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIP F+V+ K+I LDGS+PCLL+GYGGF+ S+TP FS +R V+ +HLGV++C+ANIRG
Sbjct  461   GTKIPTFVVARKNISLDGSHPCLLYGYGGFNISITPSFSVSRSVLTRHLGVVYCIANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+L+KKQNCFDDFI AAEYL++AG+TQPSKLCIEGGSNGGLL+GACINQ
Sbjct  521   GGEYGEEWHKAGSLSKKQNCFDDFISAAEYLVSAGYTQPSKLCIEGGSNGGLLVGACINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCSD EEEF WLIKYSPLHNVRRPWEQ
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSDKEEEFRWLIKYSPLHNVRRPWEQ  640

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM  407
                Q  QYPSTMLLTADHDDRVVPLH+ K LA + 
Sbjct  641   HASQPHQYPSTMLLTADHDDRVVPLHSLKLLATLQ  675


 Score =   105 bits (261),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+Q+VL TS  N+PQTNPI+GRIE  AGHG GRPTQK+IDEAADRY+FMAKVLGA W
Sbjct  670  LLATLQYVLITSLENSPQTNPIIGRIECKAGHGAGRPTQKMIDEAADRYSFMAKVLGASW  729

Query  225  IE  220
            IE
Sbjct  730  IE  731



>gb|AEX58649.1| prolyl oligopeptidase [Coffea arabica]
 gb|AEX58650.1| prolyl oligopeptidase [Coffea arabica]
Length=731

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/487 (70%), Positives = 400/487 (82%), Gaps = 12/487 (2%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFL TDQSEDILCWKD DNP+H  SASVTEDG+Y L+Y FE CDPVNKVY CDLSALP+
Sbjct  222   YHFLSTDQSEDILCWKDPDNPKHTRSASVTEDGQYVLLYTFETCDPVNKVYYCDLSALPD  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+ Y+ T+ LLPF K+VD F+ASY  VAND +VFTFRTNK+AP+YKLVRVD+K P  W 
Sbjct  282   GLENYKETNNLLPFVKLVDSFDASYLDVANDGSVFTFRTNKDAPRYKLVRVDLKVPTSWT  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             +V+QE EKDVLES VAVN +Q+VV+YLSDVK+VLQ+RD++TG +L+H LP+DIGTV  IS
Sbjct  342   EVLQESEKDVLESVVAVNGDQIVVSYLSDVKNVLQIRDLKTGSLLHH-LPVDIGTVCQIS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+IVFI FT+FL+P IIY+CNL    PE+ IFREI VPGFDR+ F V QVFV SKD
Sbjct  401   ARRKDNIVFIHFTSFLVPGIIYKCNLGGGAPEISIFREIIVPGFDRSQFVVNQVFVPSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G  IPMF+VS KDI LDGSNPCLL+ YGGF  S+TP FS +R+VIA+HL  IFC+ANIRG
Sbjct  461   GTLIPMFVVSKKDISLDGSNPCLLYAYGGFDISITPSFSVSRIVIARHLDAIFCIANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LAKKQNCFDDF   A+YLI+ G+TQP KLCIEGGSNGGLL+GA INQ
Sbjct  521   GGEYGEEWHKAGSLAKKQNCFDDFASCAKYLISTGYTQPRKLCIEGGSNGGLLVGASINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCS+ E+EFHWL KYSPLHNVRRPWEQ
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSEKEKEFHWLFKYSPLHNVRRPWEQ  640

Query  508   T-HQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM----------PCPDHAACPVYKRSQ  362
             +  Q  QYP+TMLLTADHDDRVVPLH+ K+LA +           P  +     + +++ 
Sbjct  641   SPDQVSQYPATMLLTADHDDRVVPLHSLKFLATLQYELCTGLESSPQTNPIISRIERKAG  700

Query  361   HSANQPN  341
             H A +P 
Sbjct  701   HGAGRPT  707


 Score =   101 bits (252),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+ LCT   ++PQTNPI+ RIER AGHG GRPTQK+IDEAADRYAFMAKVLGA W
Sbjct  670  FLATLQYELCTGLESSPQTNPIISRIERKAGHGAGRPTQKMIDEAADRYAFMAKVLGATW  729

Query  225  IE  220
            ++
Sbjct  730  VD  731



>emb|CDP07325.1| unnamed protein product [Coffea canephora]
Length=731

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/487 (70%), Positives = 400/487 (82%), Gaps = 12/487 (2%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFL TDQSEDILCWKD DNP+H  SASVTEDG+Y L+Y FE CDPVNKVY CDLSALP+
Sbjct  222   YHFLATDQSEDILCWKDPDNPKHTRSASVTEDGQYVLLYTFETCDPVNKVYYCDLSALPD  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+ Y+ T+ LLPF K+VD F+ASY  VAND +VFTFRTNK+AP+YKLVRVD+K P  W 
Sbjct  282   GLEIYKETNNLLPFVKLVDSFDASYLDVANDGSVFTFRTNKDAPRYKLVRVDLKVPTSWT  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             +V+QE EKDVLES VAVN +Q+VV+YLSDVK+VLQ+RD++TG +L+H LP+DIGTV  IS
Sbjct  342   EVLQESEKDVLESVVAVNGDQIVVSYLSDVKNVLQIRDLKTGSLLHH-LPVDIGTVCQIS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+IVFI FT+FL+P IIY+CNL    PE+ IFREI VPGFDR+ F V QVFV SKD
Sbjct  401   ARRKDNIVFIHFTSFLVPGIIYKCNLGGGAPEISIFREIIVPGFDRSQFVVNQVFVPSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G  IPMF+VS KDI LDGSNPCLL+ YGGF  S+TP FS +R+VIA+HL  IFC+ANIRG
Sbjct  461   GTLIPMFVVSKKDISLDGSNPCLLYAYGGFDISITPSFSVSRIVIARHLDAIFCIANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LAKKQNCFDDF   A+YLI+ G+TQP KLCIEGGSNGGLL+GA INQ
Sbjct  521   GGEYGEEWHKAGSLAKKQNCFDDFASCAKYLISTGYTQPRKLCIEGGSNGGLLVGASINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCS+ E+EFHWL KYSPLHNVRRPWEQ
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSEKEKEFHWLFKYSPLHNVRRPWEQ  640

Query  508   T-HQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM----------PCPDHAACPVYKRSQ  362
             +  Q  QYP+TMLLTADHDDRVVPLH+ K+LA +           P  +     + +++ 
Sbjct  641   SPDQVSQYPATMLLTADHDDRVVPLHSLKFLATLQYELCTGLESSPQTNPIISRIERKAG  700

Query  361   HSANQPN  341
             H A +P 
Sbjct  701   HGAGRPT  707


 Score = 98.2 bits (243),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+ LCT   ++PQTNPI+ RIER AGHG GRPTQK+I EAADRYAFMAKVLGA W
Sbjct  670  FLATLQYELCTGLESSPQTNPIISRIERKAGHGAGRPTQKMIAEAADRYAFMAKVLGATW  729

Query  225  IE  220
            ++
Sbjct  730  VD  731



>gb|AEX58648.1| prolyl oligopeptidase [Coffea arabica]
Length=731

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/487 (70%), Positives = 400/487 (82%), Gaps = 12/487 (2%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFL TDQSEDILCWKD DNP+H  SASVTEDG+Y L+Y FE CDPVNKVY CDLSALP+
Sbjct  222   YHFLATDQSEDILCWKDPDNPKHTRSASVTEDGQYVLLYTFETCDPVNKVYYCDLSALPD  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+ Y+ T+ LLPF K+VD F+ASY  VAND +VFTFRTNK+AP+YKLVRVD+K P  W 
Sbjct  282   GLEIYKETNNLLPFVKLVDSFDASYLDVANDGSVFTFRTNKDAPRYKLVRVDLKVPTSWT  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             +V+QE EKDVLES VAVN +Q+VV+YLSDVK+VLQ+RD++TG +L+H LP+DIGTV  IS
Sbjct  342   EVLQESEKDVLESVVAVNGDQIVVSYLSDVKNVLQIRDLKTGSLLHH-LPVDIGTVCQIS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+IVFI FT+FL+P IIY+CNL    PE+ IFREI VPGFDR+ F V QVFV SKD
Sbjct  401   ARRKDNIVFIHFTSFLVPGIIYKCNLGGGAPEISIFREIIVPGFDRSQFVVNQVFVPSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G  IPMF+VS KDI LDGSNPCLL+ YGGF  S+TP FS +R+VIA+HL  IFC+ANIRG
Sbjct  461   GTLIPMFVVSKKDISLDGSNPCLLYAYGGFDISITPSFSVSRIVIARHLDAIFCIANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LAKKQNCFDDF   A+YLI+ G+TQP KLCIEGGSNGGLL+GA INQ
Sbjct  521   GGEYGEEWHKAGSLAKKQNCFDDFASCAKYLISTGYTQPRKLCIEGGSNGGLLVGASINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCS+ E+EFHWL KYSPLHNVRRPWEQ
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSEKEKEFHWLFKYSPLHNVRRPWEQ  640

Query  508   T-HQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM----------PCPDHAACPVYKRSQ  362
             +  Q  QYP+TMLLTADHDDRVVPLH+ K+LA +           P  +     + +++ 
Sbjct  641   SPDQVSQYPATMLLTADHDDRVVPLHSLKFLATLQYELCTGLESSPQTNPIISRIERKAG  700

Query  361   HSANQPN  341
             H A +P 
Sbjct  701   HGAGRPT  707


 Score =   101 bits (252),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+ LCT   ++PQTNPI+ RIER AGHG GRPTQK+IDEAADRYAFMAKVLGA W
Sbjct  670  FLATLQYELCTGLESSPQTNPIISRIERKAGHGAGRPTQKMIDEAADRYAFMAKVLGATW  729

Query  225  IE  220
            ++
Sbjct  730  VD  731



>ref|XP_004238404.1| PREDICTED: prolyl endopeptidase-like [Solanum lycopersicum]
Length=733

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/455 (75%), Positives = 390/455 (86%), Gaps = 3/455 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQS+DILCWKD +NP H    SVTEDGKY L+YIF NCD VNK+Y CDLS LPN
Sbjct  223   YHRLGTDQSDDILCWKDPENPMHRHIVSVTEDGKYVLLYIFRNCDTVNKLYYCDLSTLPN  282

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             G++GY+G  + LPFNK+VD F+ASY +VA++  +FTF+TNK+APKYKL+RVDV+ P  W 
Sbjct  283   GIEGYKGKRDALPFNKLVDTFDASYDYVAHNGTIFTFQTNKDAPKYKLIRVDVENPDFWS  342

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             D+I+EDEKDVL+SAVAVN NQLVV+YL DVK+VLQLRD+ TG +L H LPIDIG V+GIS
Sbjct  343   DIIEEDEKDVLQSAVAVNENQLVVSYLRDVKNVLQLRDLETGELL-HCLPIDIGRVSGIS  401

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD  +FIGF NFLIP +IYQCNL+ +VP+LK+FREI VPGFDR  F V QVFV SKD
Sbjct  402   ARRKDDSIFIGFMNFLIPGLIYQCNLKGEVPDLKVFREIVVPGFDRTEFQVNQVFVPSKD  461

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             GVKIPMFIVS K I LDG NPCLL+GYGGF+ S+TP+FS AR+V+AKHLGV+FC+ANIRG
Sbjct  462   GVKIPMFIVSRKGISLDGCNPCLLYGYGGFNVSITPHFSAARVVLAKHLGVVFCIANIRG  521

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEW+K GAL KKQNCFDDFI AAEYL+ AG+TQP KLCIEGGSNGGLL+GAC+NQ
Sbjct  522   GGEYGEEWYKGGALNKKQNCFDDFISAAEYLVCAGYTQPHKLCIEGGSNGGLLVGACVNQ  581

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSD EEEF WLIKYSPLHNV RPWE+
Sbjct  582   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDKEEEFQWLIKYSPLHNVSRPWEK  641

Query  508   THQAC--QYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             +      QYPS MLLTADHDDRVVPLH+ K LA M
Sbjct  642   SVNLAFVQYPSIMLLTADHDDRVVPLHSLKLLATM  676


 Score =   113 bits (282),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS   +PQTNPIVGRIER AGHGCGRPTQKLIDEAADRYAFMAK LGA W
Sbjct  672  LLATMQYVLCTSQEGSPQTNPIVGRIERKAGHGCGRPTQKLIDEAADRYAFMAKELGAAW  731

Query  225  IE  220
            +E
Sbjct  732  VE  733



>ref|XP_004145530.1| PREDICTED: prolyl endopeptidase-like [Cucumis sativus]
Length=731

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/454 (73%), Positives = 397/454 (87%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS+D+LCW+D D+P+++ SASVT+DGKY L+ I E CDPVNK Y C++SALPN
Sbjct  222   YHFLGTDQSDDVLCWRDQDHPKYLFSASVTDDGKYVLMPIEEGCDPVNKFYYCNISALPN  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G++G ++LLPF K++D F+A Y  +AND+ +FTF TNKNAPKYKLVRVD+ +P  W 
Sbjct  282   GLEGFKGKNDLLPFTKLIDDFDAQYYAIANDDTLFTFITNKNAPKYKLVRVDLNDPTVWT  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             +++ E +KDVLESA AVN +Q++V+YLSDVK VLQ+RD+++G +L H LPIDIGTVNGIS
Sbjct  342   ELLPESDKDVLESACAVNGDQMIVSYLSDVKYVLQIRDLKSGSLL-HQLPIDIGTVNGIS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+DS++FIGFT+FL P IIYQCNL+S  P+LKIFRE  VPGF+R++FNV QVFV SKD
Sbjct  401   ARREDSLIFIGFTSFLTPGIIYQCNLESGTPDLKIFRETVVPGFERSAFNVDQVFVRSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G  IPMF+V+ K+I  DGS+PCLL+GYGGF+ S+TP FS +R V+ +HLG +FC+ANIRG
Sbjct  461   GTNIPMFVVARKNIVFDGSHPCLLYGYGGFNISLTPSFSVSRTVLMRHLGAVFCVANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LAKKQNCFDDFI +AEYLI+AG+TQPSKLCIEGGSNGGLL+GACINQ
Sbjct  521   GGEYGEEWHKAGSLAKKQNCFDDFISSAEYLISAGYTQPSKLCIEGGSNGGLLVGACINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCSDNEEEF WLIKYSPLHNV+RPWEQ
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSDNEEEFKWLIKYSPLHNVKRPWEQ  640

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                +  QYPSTMLLTADHDDRVVPLH+ K LA M
Sbjct  641   HPDRLLQYPSTMLLTADHDDRVVPLHSLKLLATM  674


 Score =   100 bits (249),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS   +PQTNPI+GRIE  AGHG GRPTQK+IDEA+DRYAFMA +L A W
Sbjct  670  LLATMQYVLCTSLEKSPQTNPIIGRIECKAGHGAGRPTQKMIDEASDRYAFMAMMLAATW  729

Query  225  IE  220
            I+
Sbjct  730  ID  731



>ref|XP_009333758.1| PREDICTED: prolyl endopeptidase-like [Pyrus x bretschneideri]
Length=731

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/455 (73%), Positives = 392/455 (86%), Gaps = 2/455 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHF+GTDQSEDILCW+DS+NP++   A+VT+DGKY L+Y+ E CDPVNK Y CD+SALPN
Sbjct  222   YHFVGTDQSEDILCWRDSENPKYSFGANVTDDGKYILLYVHEGCDPVNKFYYCDMSALPN  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G RG ++LLP  K++D F+A Y  +ANDE VFT  TNK+APKYKLVRVD+KEP  W 
Sbjct  282   GLEGLRGKNDLLPVIKVIDKFDAQYDVIANDETVFTLLTNKDAPKYKLVRVDLKEPTVWT  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ E EKDVLESA AVN  Q++V+YLSDVK V+Q+RD+++G +L H LPIDIG+VNGIS
Sbjct  342   DVVPESEKDVLESAFAVNGTQMIVSYLSDVKYVVQIRDLKSGNLL-HQLPIDIGSVNGIS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+DS VF  FT+FL P IIYQCNL +++P+LK+FREITVPGF+R+ F+V QVFV SKD
Sbjct  401   ARREDSTVFFKFTSFLTPGIIYQCNLDNEIPDLKVFREITVPGFERSKFHVDQVFVPSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIP F+V+ K+I LDGS+PCLL+GYGGF+ S+TP F  +R V+ +HLGV++C+ANIRG
Sbjct  461   GTKIPTFVVARKNISLDGSHPCLLYGYGGFNISITPSFIVSRSVLTRHLGVVYCIANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+L+KKQNCFDDFI AAEYL++AG+TQPSKLCIEG SNGGLL+GACINQ
Sbjct  521   GGEYGEEWHKAGSLSKKQNCFDDFISAAEYLVSAGYTQPSKLCIEGRSNGGLLVGACINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCSD EEEF WLIKYSPLHNVRRPWEQ
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSDKEEEFRWLIKYSPLHNVRRPWEQ  640

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM  407
                Q  QYPSTMLLTADHDDRVVPLH+ K LA + 
Sbjct  641   HASQPHQYPSTMLLTADHDDRVVPLHSLKLLATLQ  675


 Score = 99.0 bits (245),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+Q+VL TS  N+PQTNPI+GRIE  AGHG G PTQK+IDEAAD+Y+FMAK+LGA W
Sbjct  670  LLATLQYVLITSLENSPQTNPIIGRIECKAGHGAGLPTQKMIDEAADQYSFMAKMLGASW  729

Query  225  IE  220
            IE
Sbjct  730  IE  731



>ref|XP_002307762.1| prolyl oligopeptidase family protein [Populus trichocarpa]
 gb|EEE94758.1| prolyl oligopeptidase family protein [Populus trichocarpa]
Length=731

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/454 (73%), Positives = 390/454 (86%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHF+GTDQSEDI CW+DS+NP++M  A VT+DGKY L+YI ENCDPVNKVY CD+SA  +
Sbjct  222   YHFVGTDQSEDIQCWRDSENPKYMFGAGVTDDGKYLLLYISENCDPVNKVYYCDMSAFHD  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G++G + LLPF K++D F+A Y  +AND+ VFTF TNK+AP+YK+VRVD+KEP  W 
Sbjct  282   GLEGFKGGNALLPFIKLIDDFDAQYQEIANDDTVFTFLTNKDAPRYKVVRVDLKEPSSWI  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ E EKDVLESA AVN ++++V YLSDVK V+Q+RD++TG +L H LP DIG+V GIS
Sbjct  342   DVVPESEKDVLESAFAVNGDKMIVCYLSDVKYVIQIRDLKTGSLL-HQLPTDIGSVTGIS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+DS VFIGF +FL P IIYQCNL S+VP++KIFREI+VPGF+R+ F V QVFV SKD
Sbjct  401   ARRRDSTVFIGFASFLTPGIIYQCNLDSEVPDMKIFREISVPGFNRSEFQVNQVFVRSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ K+I LDGS+PCLL+ YGGF+ S+TP FS +R+V+ +HLG +FC+ANIRG
Sbjct  461   GTKIPMFIVAKKNITLDGSHPCLLYAYGGFNISITPSFSVSRIVLTRHLGSVFCIANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHK G+LA+KQNCFDDFI AAEYL++AG+TQP KLCIEGGSNGGLL+GACINQ
Sbjct  521   GGEYGEEWHKEGSLARKQNCFDDFISAAEYLVSAGYTQPKKLCIEGGSNGGLLVGACINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSD EEEF WL KYSPLHNVRRPWEQ
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDKEEEFGWLFKYSPLHNVRRPWEQ  640

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                Q  QYPSTMLLTADHDDRVVPLH+ K LA M
Sbjct  641   HPEQPSQYPSTMLLTADHDDRVVPLHSLKLLATM  674


 Score =   102 bits (255),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ++LCTS  N+PQTNPI+GRI+  AGHG GRPTQKLIDEAADRY+FMAK+L A W
Sbjct  670  LLATMQYILCTSLKNSPQTNPIIGRIDCKAGHGAGRPTQKLIDEAADRYSFMAKMLEASW  729

Query  225  IE  220
             E
Sbjct  730  TE  731



>ref|XP_008221184.1| PREDICTED: prolyl endopeptidase-like isoform X3 [Prunus mume]
Length=647

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/454 (72%), Positives = 389/454 (86%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHF+GTDQS+DILCWKD +NP+++  A+VT DGKY ++ I E CDPVNK Y CD+SALPN
Sbjct  138   YHFVGTDQSKDILCWKDPENPKYLFGATVTADGKYIILSIDEGCDPVNKFYYCDMSALPN  197

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G R  ++LLPF K++D F+A Y  +ANDE VFTF TNK+APKYKLVRVD+KEP  W 
Sbjct  198   GLEGLREKNDLLPFLKLIDTFDAMYDLIANDETVFTFLTNKDAPKYKLVRVDLKEPTVWT  257

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+QE EKDVLES  AVN +Q++V+YLSDVKSVLQ+RD+ +G +L H LPIDIG+V+ IS
Sbjct  258   DVLQEAEKDVLESVCAVNGSQMIVSYLSDVKSVLQIRDLNSGNLL-HQLPIDIGSVSEIS  316

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR+DS  F  FT+FL P I+YQCNL +K+P++K+FREITVPGFDR+ F V QVF+ SKD
Sbjct  317   GRREDSTAFFWFTSFLTPGIVYQCNLANKIPDMKVFREITVPGFDRSEFQVDQVFIPSKD  376

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G +IPMF+V+ K+I LDGS+PCLL GYGGF+ S+TPYFS +R+V+ +HLG +FC+ANIRG
Sbjct  377   GTEIPMFVVASKNIPLDGSHPCLLCGYGGFNISITPYFSVSRIVLTRHLGAVFCIANIRG  436

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHK+G+LAKKQNCFDDFI AAEYL++A +TQPSKLCIEGGSNGGLL+GACINQ
Sbjct  437   GGEYGEEWHKSGSLAKKQNCFDDFISAAEYLVSADYTQPSKLCIEGGSNGGLLVGACINQ  496

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE-  512
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCSD EEEF WLIKYSPLHNVRRPWE 
Sbjct  497   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSDKEEEFQWLIKYSPLHNVRRPWEL  556

Query  511   QTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                Q  QYPSTMLLTADHDDRVVPLHT K LA +
Sbjct  557   HASQPHQYPSTMLLTADHDDRVVPLHTLKLLATL  590


 Score =   100 bits (250),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+Q+VL TS   +PQTNPI+GRIE  AGHG GRPTQK+IDEAADRY+FMAK+LGA W
Sbjct  586  LLATLQYVLSTSLEKSPQTNPIIGRIECKAGHGGGRPTQKMIDEAADRYSFMAKMLGASW  645

Query  225  IE  220
            IE
Sbjct  646  IE  647



>gb|KGN55478.1| hypothetical protein Csa_4G652900 [Cucumis sativus]
Length=783

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/454 (73%), Positives = 397/454 (87%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS+D+LCW+D D+P+++ SASVT+DGKY L+ I E CDPVNK Y C++SALPN
Sbjct  274   YHFLGTDQSDDVLCWRDQDHPKYLFSASVTDDGKYVLMPIEEGCDPVNKFYYCNISALPN  333

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G++G ++LLPF K++D F+A Y  +AND+ +FTF TNKNAPKYKLVRVD+ +P  W 
Sbjct  334   GLEGFKGKNDLLPFTKLIDDFDAQYYAIANDDTLFTFITNKNAPKYKLVRVDLNDPTVWT  393

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             +++ E +KDVLESA AVN +Q++V+YLSDVK VLQ+RD+++G +L H LPIDIGTVNGIS
Sbjct  394   ELLPESDKDVLESACAVNGDQMIVSYLSDVKYVLQIRDLKSGSLL-HQLPIDIGTVNGIS  452

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+DS++FIGFT+FL P IIYQCNL+S  P+LKIFRE  VPGF+R++FNV QVFV SKD
Sbjct  453   ARREDSLIFIGFTSFLTPGIIYQCNLESGTPDLKIFRETVVPGFERSAFNVDQVFVRSKD  512

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G  IPMF+V+ K+I  DGS+PCLL+GYGGF+ S+TP FS +R V+ +HLG +FC+ANIRG
Sbjct  513   GTNIPMFVVARKNIVFDGSHPCLLYGYGGFNISLTPSFSVSRTVLMRHLGAVFCVANIRG  572

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LAKKQNCFDDFI +AEYLI+AG+TQPSKLCIEGGSNGGLL+GACINQ
Sbjct  573   GGEYGEEWHKAGSLAKKQNCFDDFISSAEYLISAGYTQPSKLCIEGGSNGGLLVGACINQ  632

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCSDNEEEF WLIKYSPLHNV+RPWEQ
Sbjct  633   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSDNEEEFKWLIKYSPLHNVKRPWEQ  692

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                +  QYPSTMLLTADHDDRVVPLH+ K LA M
Sbjct  693   HPDRLLQYPSTMLLTADHDDRVVPLHSLKLLATM  726


 Score =   100 bits (249),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS   +PQTNPI+GRIE  AGHG GRPTQK+IDEA+DRYAFMA +L A W
Sbjct  722  LLATMQYVLCTSLEKSPQTNPIIGRIECKAGHGAGRPTQKMIDEASDRYAFMAMMLAATW  781

Query  225  IE  220
            I+
Sbjct  782  ID  783



>gb|ADN34133.1| serine-type endopeptidase [Cucumis melo subsp. melo]
Length=731

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/454 (73%), Positives = 395/454 (87%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS+D+LCW+D D+P+++ SASVT+DGKY ++ I E CDPVNK Y C +SALPN
Sbjct  222   YHFLGTDQSDDVLCWRDQDHPKYLFSASVTDDGKYVVMEIEEGCDPVNKFYYCKISALPN  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G++G ++LLPF K++D F+A Y  +AND+ +FTF TNKNAPKYKLVRVD+ +P  W 
Sbjct  282   GLEGFKGKNDLLPFTKLIDDFDAQYHDIANDDTLFTFITNKNAPKYKLVRVDLNDPTVWT  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             +++ E EKDVLESA AVN +Q++V+YLSDVK VLQ+RD+++G +L H LPIDIGTV GIS
Sbjct  342   ELLPESEKDVLESACAVNGDQMIVSYLSDVKYVLQIRDLKSGSLL-HQLPIDIGTVYGIS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+DS++FIGF++FL P IIYQCNL+S  P+LKIFREI VPGF+R+ FNV QVFV S D
Sbjct  401   ARREDSLIFIGFSSFLTPGIIYQCNLESGTPDLKIFREIAVPGFERSEFNVDQVFVRSND  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G  IPMFIV+ K+I  DGS+PCLL+GYGGF+ ++TPYFS +R V+A+HLG +FC+ANIRG
Sbjct  461   GTNIPMFIVARKNIVFDGSHPCLLYGYGGFNINLTPYFSVSRTVLARHLGAVFCIANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LAKKQNCFDDFI  AEYLI+AG+TQPSKLCIEGGSNGGLL+GACINQ
Sbjct  521   GGEYGEEWHKAGSLAKKQNCFDDFISCAEYLISAGYTQPSKLCIEGGSNGGLLVGACINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCSDNEEEF WLIKYSPLHNV+RPWEQ
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSDNEEEFKWLIKYSPLHNVKRPWEQ  640

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                +  QYPSTMLLTADHDDRVVPLH+ K LA M
Sbjct  641   HPDRLLQYPSTMLLTADHDDRVVPLHSLKLLATM  674


 Score =   102 bits (255),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ++LCTS   +PQTNPIVGRIE  AGHG GRPTQK+IDEA+DRYAFMAK+L A W
Sbjct  670  LLATMQYILCTSLEKSPQTNPIVGRIECKAGHGAGRPTQKMIDEASDRYAFMAKMLAATW  729

Query  225  IE  220
            I+
Sbjct  730  ID  731



>ref|XP_008350482.1| PREDICTED: prolyl endopeptidase-like [Malus domestica]
Length=783

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/454 (73%), Positives = 392/454 (86%), Gaps = 6/454 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHF+GTDQSEDILCW+DS+NP++   A VT DGKY L+Y+ E CDPVNK Y CD+SALPN
Sbjct  278   YHFVGTDQSEDILCWRDSENPKYTFGADVTVDGKYILLYVAEGCDPVNKFYYCDMSALPN  337

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G RG ++LLP  K++D F+A     ANDE VFT  TNK+APKYKLVRVD+KEP  W 
Sbjct  338   GLEGLRGKNDLLPVIKVIDKFDAR----ANDETVFTLLTNKDAPKYKLVRVDLKEPTVWT  393

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ E EKDVLESA AVN  Q++V+YLSDVK V+Q+RD+++G +L H LPIDIG+VNGIS
Sbjct  394   DVLPESEKDVLESASAVNGTQMIVSYLSDVKYVVQVRDLKSGNLL-HQLPIDIGSVNGIS  452

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+DS VF GFT+FL P IIYQCNL +++P+LK+FREITVPGF+R+ F+V QVFV SKD
Sbjct  453   ARREDSTVFFGFTSFLTPGIIYQCNLDNEIPDLKVFREITVPGFERSEFHVDQVFVPSKD  512

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIP F+V+ K+I LDGS+PCLL+GYGGF+ S+TP FS +R+V+ +HLGV++C+ANIRG
Sbjct  513   GTKIPTFVVARKNISLDGSHPCLLYGYGGFNISITPSFSVSRIVLTRHLGVVYCIANIRG  572

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+L+KKQNCFDDFI AAEYL++AG+TQPSKLCIEGGSNGGLL+GACINQ
Sbjct  573   GGEYGEEWHKAGSLSKKQNCFDDFISAAEYLVSAGYTQPSKLCIEGGSNGGLLVGACINQ  632

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCSD EEEF WLIKYSP+HNVRRPWEQ
Sbjct  633   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSDKEEEFRWLIKYSPIHNVRRPWEQ  692

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                Q  QYPSTMLLTADHDDRVVPLH+ K LA +
Sbjct  693   HASQPHQYPSTMLLTADHDDRVVPLHSLKLLATL  726


 Score =   102 bits (254),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+Q+VL TS  N+PQTNPI+GRIE  AGHG GRPTQK+IDEAADRY+FMAK+LGA W
Sbjct  722  LLATLQYVLITSLENSPQTNPIIGRIECKAGHGAGRPTQKMIDEAADRYSFMAKMLGASW  781

Query  225  IE  220
            +E
Sbjct  782  ME  783



>ref|XP_008221183.1| PREDICTED: prolyl endopeptidase-like isoform X2 [Prunus mume]
Length=700

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/454 (72%), Positives = 389/454 (86%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHF+GTDQS+DILCWKD +NP+++  A+VT DGKY ++ I E CDPVNK Y CD+SALPN
Sbjct  191   YHFVGTDQSKDILCWKDPENPKYLFGATVTADGKYIILSIDEGCDPVNKFYYCDMSALPN  250

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G R  ++LLPF K++D F+A Y  +ANDE VFTF TNK+APKYKLVRVD+KEP  W 
Sbjct  251   GLEGLREKNDLLPFLKLIDTFDAMYDLIANDETVFTFLTNKDAPKYKLVRVDLKEPTVWT  310

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+QE EKDVLES  AVN +Q++V+YLSDVKSVLQ+RD+ +G +L H LPIDIG+V+ IS
Sbjct  311   DVLQEAEKDVLESVCAVNGSQMIVSYLSDVKSVLQIRDLNSGNLL-HQLPIDIGSVSEIS  369

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR+DS  F  FT+FL P I+YQCNL +K+P++K+FREITVPGFDR+ F V QVF+ SKD
Sbjct  370   GRREDSTAFFWFTSFLTPGIVYQCNLANKIPDMKVFREITVPGFDRSEFQVDQVFIPSKD  429

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G +IPMF+V+ K+I LDGS+PCLL GYGGF+ S+TPYFS +R+V+ +HLG +FC+ANIRG
Sbjct  430   GTEIPMFVVASKNIPLDGSHPCLLCGYGGFNISITPYFSVSRIVLTRHLGAVFCIANIRG  489

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHK+G+LAKKQNCFDDFI AAEYL++A +TQPSKLCIEGGSNGGLL+GACINQ
Sbjct  490   GGEYGEEWHKSGSLAKKQNCFDDFISAAEYLVSADYTQPSKLCIEGGSNGGLLVGACINQ  549

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE-  512
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCSD EEEF WLIKYSPLHNVRRPWE 
Sbjct  550   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSDKEEEFQWLIKYSPLHNVRRPWEL  609

Query  511   QTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                Q  QYPSTMLLTADHDDRVVPLHT K LA +
Sbjct  610   HASQPHQYPSTMLLTADHDDRVVPLHTLKLLATL  643


 Score =   100 bits (250),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+Q+VL TS   +PQTNPI+GRIE  AGHG GRPTQK+IDEAADRY+FMAK+LGA W
Sbjct  639  LLATLQYVLSTSLEKSPQTNPIIGRIECKAGHGGGRPTQKMIDEAADRYSFMAKMLGASW  698

Query  225  IE  220
            IE
Sbjct  699  IE  700



>ref|XP_007225583.1| hypothetical protein PRUPE_ppa001887m1g, partial [Prunus persica]
 gb|EMJ26782.1| hypothetical protein PRUPE_ppa001887m1g, partial [Prunus persica]
Length=569

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/454 (72%), Positives = 388/454 (85%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHF+GTDQS+DILCWKD +NP+++  A VT DGKY ++ I E CDPVNK Y CD+SALPN
Sbjct  60    YHFVGTDQSKDILCWKDPENPKYLFGAYVTVDGKYIILSINEGCDPVNKFYYCDMSALPN  119

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G R  ++LLP  K++D F+A Y  +AND+ VFTF TNK+APKYKLVRVD+KEP  W 
Sbjct  120   GLEGLREKNDLLPVLKLIDTFDAMYDLIANDDTVFTFLTNKDAPKYKLVRVDIKEPTVWT  179

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+QE EKDVLES  AVN +Q++V+YLSDVK VLQ+RD+ +G +L H LPIDIG+V+GIS
Sbjct  180   DVLQEAEKDVLESVCAVNGSQMIVSYLSDVKCVLQIRDLNSGNLL-HQLPIDIGSVSGIS  238

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR+DS  F  FT+FL P IIYQCNL +++P++K+FREITVPGFDR+ F V QVF+ SKD
Sbjct  239   GRREDSTAFFEFTSFLTPGIIYQCNLANEIPDMKVFREITVPGFDRSEFQVDQVFIPSKD  298

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G +IPMF+V+ K+I LDGS+PCLL+GYGGF  S+TPYFS +R+V+ +HLG +FC+ANIRG
Sbjct  299   GNEIPMFVVARKNIPLDGSHPCLLYGYGGFEISITPYFSVSRIVLTRHLGAVFCIANIRG  358

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHK+G+LAKKQNCFDDFI AAEYL++AG+TQPSKLCIEGGSNGGLL+GACINQ
Sbjct  359   GGEYGEEWHKSGSLAKKQNCFDDFISAAEYLVSAGYTQPSKLCIEGGSNGGLLVGACINQ  418

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE-  512
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCSD EEEF WLIKYSPLHNVRRPWE 
Sbjct  419   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSDKEEEFQWLIKYSPLHNVRRPWEL  478

Query  511   QTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                Q  QYPSTMLLTADHDDRVVPLHT K LA +
Sbjct  479   HASQPHQYPSTMLLTADHDDRVVPLHTLKLLATL  512


 Score = 95.1 bits (235),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+Q+VL TS   +PQTNPI+ RIE  AGHG G PTQK+IDEAADRY+FMAK+LGA W
Sbjct  508  LLATLQYVLSTSLEKSPQTNPIICRIECKAGHGSGLPTQKMIDEAADRYSFMAKMLGASW  567

Query  225  IE  220
            IE
Sbjct  568  IE  569



>ref|XP_008452924.1| PREDICTED: prolyl endopeptidase-like [Cucumis melo]
 ref|XP_008452925.1| PREDICTED: prolyl endopeptidase-like [Cucumis melo]
Length=783

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/454 (73%), Positives = 395/454 (87%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS+D+LCW+D D+P+++ SASVT+DGKY ++ I E CDPVNK Y C +SALPN
Sbjct  274   YHFLGTDQSDDVLCWRDQDHPKYLFSASVTDDGKYVVMEIEEGCDPVNKFYYCKISALPN  333

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G++G ++LLPF K++D F+A Y  +AND+ +FTF TNKNAPKYKLVRVD+ +P  W 
Sbjct  334   GLEGFKGKNDLLPFTKLIDDFDAQYHDIANDDTLFTFITNKNAPKYKLVRVDLNDPTVWT  393

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             +++ E EKDVLESA AVN +Q++V+YLSDVK VLQ+RD+++G +L H LPIDIGTV GIS
Sbjct  394   ELLPESEKDVLESACAVNGDQMIVSYLSDVKYVLQIRDLKSGSLL-HQLPIDIGTVYGIS  452

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+DS++FIGF++FL P IIYQCNL+S  P+LKIFREI VPGF+R+ FNV QVFV S D
Sbjct  453   ARREDSLIFIGFSSFLTPGIIYQCNLESGTPDLKIFREIAVPGFERSEFNVDQVFVRSND  512

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G  IPMFIV+ K+I  DGS+PCLL+GYGGF+ ++TPYFS +R V+A+HLG +FC+ANIRG
Sbjct  513   GTNIPMFIVARKNIVFDGSHPCLLYGYGGFNINLTPYFSVSRTVLARHLGAVFCIANIRG  572

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LAKKQNCFDDFI  AEYLI+AG+TQPSKLCIEGGSNGGLL+GACINQ
Sbjct  573   GGEYGEEWHKAGSLAKKQNCFDDFISCAEYLISAGYTQPSKLCIEGGSNGGLLVGACINQ  632

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCSDNEEEF WLIKYSPLHNV+RPWEQ
Sbjct  633   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSDNEEEFKWLIKYSPLHNVKRPWEQ  692

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                +  QYPSTMLLTADHDDRVVPLH+ K LA M
Sbjct  693   HPDRLLQYPSTMLLTADHDDRVVPLHSLKLLATM  726


 Score =   102 bits (255),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ++LCTS   +PQTNPIVGRIE  AGHG GRPTQK+IDEA+DRYAFMAK+L A W
Sbjct  722  LLATMQYILCTSLEKSPQTNPIVGRIECKAGHGAGRPTQKMIDEASDRYAFMAKMLAATW  781

Query  225  IE  220
            I+
Sbjct  782  ID  783



>ref|XP_009595595.1| PREDICTED: prolyl endopeptidase [Nicotiana tomentosiformis]
Length=732

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/472 (73%), Positives = 401/472 (85%), Gaps = 6/472 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT+QS+DILCWKD++NP+H   ASVTEDGKY L+Y F NCD VNK++ CDLS LPN
Sbjct  223   YHSLGTNQSDDILCWKDTENPKHRHMASVTEDGKYVLLYTFRNCDTVNKLHYCDLSTLPN  282

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             G+  Y+G    LPFNK+VD+F+ASY +VA+++++FTF TNKNAPKYKLVRVD+++   W 
Sbjct  283   GIGDYKGRSGALPFNKLVDNFDASYDYVAHNDSIFTFLTNKNAPKYKLVRVDLEKSDFWF  342

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             D+I E+EKDVL+SAVAVN NQLVV+YL DVK+VLQLRD+ TG +L H+LPIDIG V+GIS
Sbjct  343   DIIDEEEKDVLQSAVAVNGNQLVVSYLRDVKNVLQLRDLETG-VLLHHLPIDIGRVSGIS  401

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+ VFIGF NFLIP +IY CNL+ +VP+LK+FREI VPGF+R  F V QVFV SKD
Sbjct  402   ARRKDNSVFIGFMNFLIPGLIYDCNLKGEVPDLKVFREIVVPGFNRTEFQVNQVFVPSKD  461

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             GVKIP+FIVS K+I LDGSNPCLLFGYGGF+ S+TP FS AR+V++KHLGV+FC+ANIRG
Sbjct  462   GVKIPIFIVSRKNISLDGSNPCLLFGYGGFNVSLTPSFSAARVVLSKHLGVVFCIANIRG  521

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEW+KAGAL+KKQNCFDDFI AAEYL+ AG+TQP KLCIEGGSNGGLL+GAC+NQ
Sbjct  522   GGEYGEEWYKAGALSKKQNCFDDFISAAEYLVTAGYTQPHKLCIEGGSNGGLLVGACVNQ  581

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAW SDFGCSD EEEF WLIKYSPLHNVRRPWEQ
Sbjct  582   RPDLFGCALAHVGVMDMLRFHKFTIGHAWISDFGCSDKEEEFQWLIKYSPLHNVRRPWEQ  641

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHS  356
                +A QYPS MLLTADHDDRVVPLH+ K LA M     +  C   +RS  +
Sbjct  642   FAIKAYQYPSIMLLTADHDDRVVPLHSLKLLATMQ----YVLCTSVERSPQT  689


 Score =   112 bits (279),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS   +PQTNPI+GRIER AGHGCGRPTQKLIDEAADRYAFMAK +GA W
Sbjct  671  LLATMQYVLCTSVERSPQTNPIIGRIERKAGHGCGRPTQKLIDEAADRYAFMAKEIGASW  730

Query  225  IE  220
             E
Sbjct  731  FE  732



>ref|XP_007017945.1| Prolyl oligopeptidase family protein [Theobroma cacao]
 gb|EOY15170.1| Prolyl oligopeptidase family protein [Theobroma cacao]
Length=789

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/454 (74%), Positives = 390/454 (86%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLG DQSEDILCW+D +NP+H+I  SVT+DGKY L+ I E+CDPVNK+Y CD+S+LP 
Sbjct  280   YHFLGADQSEDILCWRDPENPKHLIDGSVTDDGKYLLLSIGESCDPVNKLYYCDMSSLPE  339

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+R  +  LPF K++D F+A Y  +AND+ VFTF TNK+APKYKLVRVD+KEP  W 
Sbjct  340   GLEGFRKKNGPLPFVKLIDQFDAQYQAIANDDTVFTFLTNKDAPKYKLVRVDLKEPSNWI  399

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVI E EKDVLESA AVN NQ++V+YLSDVK VLQ+RD++TG +L H LPIDIG+V GIS
Sbjct  400   DVIPEAEKDVLESAYAVNVNQMIVSYLSDVKYVLQIRDLKTG-LLLHQLPIDIGSVYGIS  458

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKDS+ FIGFT+FL P I+YQCN+ ++VP++KIFREITVPGFDR+ + VTQVFV SKD
Sbjct  459   ARRKDSVAFIGFTSFLTPGIVYQCNIGTEVPDMKIFREITVPGFDRSEYEVTQVFVQSKD  518

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV  K+  LDGS+PCLL+GYGGF+ S+TP FS + +V+A+HLG  FC+ANIRG
Sbjct  519   GTKIPMFIVGKKNANLDGSHPCLLYGYGGFNISLTPTFSVSSIVLARHLGAFFCIANIRG  578

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAGAL+ KQNCFDDFI AAEYLI+AG+TQ  KLCIEGGSNGGLLIGACINQ
Sbjct  579   GGEYGEEWHKAGALSNKQNCFDDFISAAEYLISAGYTQSKKLCIEGGSNGGLLIGACINQ  638

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCSD EEEF+WLIKYSPLHNVRRPWEQ
Sbjct  639   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSDKEEEFNWLIKYSPLHNVRRPWEQ  698

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                Q  QYP TMLLTADHDDRVVPLH+ K LA M
Sbjct  699   HPGQPLQYPPTMLLTADHDDRVVPLHSLKLLATM  732


 Score =   102 bits (253),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS   +PQTNPI+GRIE  AGHG GRPTQK+IDEAA+R+ FMAK+LGA W
Sbjct  728  LLATMQYVLCTSLEKSPQTNPIIGRIECKAGHGAGRPTQKMIDEAAERFGFMAKMLGASW  787

Query  225  IE  220
            +E
Sbjct  788  VE  789



>ref|XP_008221182.1| PREDICTED: prolyl endopeptidase-like isoform X1 [Prunus mume]
Length=731

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/454 (72%), Positives = 389/454 (86%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHF+GTDQS+DILCWKD +NP+++  A+VT DGKY ++ I E CDPVNK Y CD+SALPN
Sbjct  222   YHFVGTDQSKDILCWKDPENPKYLFGATVTADGKYIILSIDEGCDPVNKFYYCDMSALPN  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G R  ++LLPF K++D F+A Y  +ANDE VFTF TNK+APKYKLVRVD+KEP  W 
Sbjct  282   GLEGLREKNDLLPFLKLIDTFDAMYDLIANDETVFTFLTNKDAPKYKLVRVDLKEPTVWT  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+QE EKDVLES  AVN +Q++V+YLSDVKSVLQ+RD+ +G +L H LPIDIG+V+ IS
Sbjct  342   DVLQEAEKDVLESVCAVNGSQMIVSYLSDVKSVLQIRDLNSGNLL-HQLPIDIGSVSEIS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR+DS  F  FT+FL P I+YQCNL +K+P++K+FREITVPGFDR+ F V QVF+ SKD
Sbjct  401   GRREDSTAFFWFTSFLTPGIVYQCNLANKIPDMKVFREITVPGFDRSEFQVDQVFIPSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G +IPMF+V+ K+I LDGS+PCLL GYGGF+ S+TPYFS +R+V+ +HLG +FC+ANIRG
Sbjct  461   GTEIPMFVVASKNIPLDGSHPCLLCGYGGFNISITPYFSVSRIVLTRHLGAVFCIANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHK+G+LAKKQNCFDDFI AAEYL++A +TQPSKLCIEGGSNGGLL+GACINQ
Sbjct  521   GGEYGEEWHKSGSLAKKQNCFDDFISAAEYLVSADYTQPSKLCIEGGSNGGLLVGACINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE-  512
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCSD EEEF WLIKYSPLHNVRRPWE 
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSDKEEEFQWLIKYSPLHNVRRPWEL  640

Query  511   QTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                Q  QYPSTMLLTADHDDRVVPLHT K LA +
Sbjct  641   HASQPHQYPSTMLLTADHDDRVVPLHTLKLLATL  674


 Score =   100 bits (250),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+Q+VL TS   +PQTNPI+GRIE  AGHG GRPTQK+IDEAADRY+FMAK+LGA W
Sbjct  670  LLATLQYVLSTSLEKSPQTNPIIGRIECKAGHGGGRPTQKMIDEAADRYSFMAKMLGASW  729

Query  225  IE  220
            IE
Sbjct  730  IE  731



>ref|XP_010664095.1| PREDICTED: prolyl endopeptidase isoform X2 [Vitis vinifera]
Length=698

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/454 (73%), Positives = 395/454 (87%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS+DILCWKD DNP+HM  A VT+DGKY L+YI E+C+ VNKVY CD+++LP 
Sbjct  189   YHFLGTDQSQDILCWKDPDNPKHMFGADVTDDGKYVLLYISESCEEVNKVYHCDITSLPE  248

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+R   +LLPF K++D+F+A Y  +AND+ +FTF TNK+APKYKLV+VD+KEP  W 
Sbjct  249   GLEGFRERKDLLPFIKLIDNFDARYHAIANDDTLFTFMTNKDAPKYKLVQVDLKEPSIWN  308

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
              V++E EKDVLESA AVN NQ++V YLSDVK VLQ+RD++TG +L H+LPIDIG+V  IS
Sbjct  309   VVLEEAEKDVLESAYAVNGNQILVCYLSDVKYVLQIRDLKTGSLL-HDLPIDIGSVFDIS  367

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+DS VFIGFT+FL P IIY CNL++ VP++KIFREI VPGFDR  F V QVFV SKD
Sbjct  368   ARRRDSTVFIGFTSFLTPGIIYHCNLEAGVPDMKIFREIVVPGFDRTEFCVDQVFVPSKD  427

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ K+I +DGS+PCLL+GYGGF+ S+TP FS +R+V+++HLG +FC+ANIRG
Sbjct  428   GTKIPMFIVARKNIPMDGSHPCLLYGYGGFNISITPSFSVSRIVLSRHLGAVFCIANIRG  487

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYG+EWHK+G+LAKKQNCFDDFI AAEYL++AG+TQP KLCIEGGSNGGLL+GACINQ
Sbjct  488   GGEYGQEWHKSGSLAKKQNCFDDFISAAEYLVSAGYTQPRKLCIEGGSNGGLLVGACINQ  547

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCS+ EEEFHWLIKYSPLHNVRRPWEQ
Sbjct  548   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSEKEEEFHWLIKYSPLHNVRRPWEQ  607

Query  508   T-HQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             +  Q  QYP+TM+LTADHDDRVVPLH+ K LA M
Sbjct  608   SPDQPSQYPATMILTADHDDRVVPLHSLKLLATM  641


 Score =   102 bits (253),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ++LCTS   +PQTNPI+GRIE  AGHG GRPTQK+IDEAADRY+F+AK+L A W
Sbjct  637  LLATMQYILCTSVEKSPQTNPIIGRIECKAGHGAGRPTQKMIDEAADRYSFLAKMLEASW  696

Query  225  IE  220
            IE
Sbjct  697  IE  698



>emb|CBI18894.3| unnamed protein product [Vitis vinifera]
Length=731

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/454 (73%), Positives = 395/454 (87%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS+DILCWKD DNP+HM  A VT+DGKY L+YI E+C+ VNKVY CD+++LP 
Sbjct  222   YHFLGTDQSQDILCWKDPDNPKHMFGADVTDDGKYVLLYISESCEEVNKVYHCDITSLPE  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+R   +LLPF K++D+F+A Y  +AND+ +FTF TNK+APKYKLV+VD+KEP  W 
Sbjct  282   GLEGFRERKDLLPFIKLIDNFDARYHAIANDDTLFTFMTNKDAPKYKLVQVDLKEPSIWN  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
              V++E EKDVLESA AVN NQ++V YLSDVK VLQ+RD++TG +L H+LPIDIG+V  IS
Sbjct  342   VVLEEAEKDVLESAYAVNGNQILVCYLSDVKYVLQIRDLKTGSLL-HDLPIDIGSVFDIS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+DS VFIGFT+FL P IIY CNL++ VP++KIFREI VPGFDR  F V QVFV SKD
Sbjct  401   ARRRDSTVFIGFTSFLTPGIIYHCNLEAGVPDMKIFREIVVPGFDRTEFCVDQVFVPSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ K+I +DGS+PCLL+GYGGF+ S+TP FS +R+V+++HLG +FC+ANIRG
Sbjct  461   GTKIPMFIVARKNIPMDGSHPCLLYGYGGFNISITPSFSVSRIVLSRHLGAVFCIANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYG+EWHK+G+LAKKQNCFDDFI AAEYL++AG+TQP KLCIEGGSNGGLL+GACINQ
Sbjct  521   GGEYGQEWHKSGSLAKKQNCFDDFISAAEYLVSAGYTQPRKLCIEGGSNGGLLVGACINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCS+ EEEFHWLIKYSPLHNVRRPWEQ
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSEKEEEFHWLIKYSPLHNVRRPWEQ  640

Query  508   T-HQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             +  Q  QYP+TM+LTADHDDRVVPLH+ K LA M
Sbjct  641   SPDQPSQYPATMILTADHDDRVVPLHSLKLLATM  674


 Score =   102 bits (253),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ++LCTS   +PQTNPI+GRIE  AGHG GRPTQK+IDEAADRY+F+AK+L A W
Sbjct  670  LLATMQYILCTSVEKSPQTNPIIGRIECKAGHGAGRPTQKMIDEAADRYSFLAKMLEASW  729

Query  225  IE  220
            IE
Sbjct  730  IE  731



>emb|CAN70125.1| hypothetical protein VITISV_001107 [Vitis vinifera]
Length=731

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/454 (73%), Positives = 394/454 (87%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS+DILCWKD DNP+HM  A VT+DGKY L+YI E+C+ VNKVY CD+++LP 
Sbjct  222   YHFLGTDQSQDILCWKDPDNPKHMFGADVTDDGKYVLLYISESCEEVNKVYHCDITSLPE  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+R   +LLPF K++D+F+A Y  +AND+ +FTF TNK+APKYKLV+VD+KEP  W 
Sbjct  282   GLEGFRERKDLLPFIKLIDNFDARYHAIANDDTLFTFMTNKDAPKYKLVQVDLKEPSIWN  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
              V++E EKDVLESA AVN NQ++V YLSDVK VLQ+RD++TG +L H+LPIDIG+V  IS
Sbjct  342   VVLEEAEKDVLESAYAVNGNQILVCYLSDVKYVLQIRDLKTGSLL-HDLPIDIGSVFDIS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+DS VFIGFT+FL P IIY CNL++ VP +KIFREI VPGFDR  F V QVFV SKD
Sbjct  401   ARRRDSTVFIGFTSFLTPGIIYHCNLEAGVPXMKIFREIVVPGFDRTEFCVDQVFVPSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ K+I +DGS+PCLL+GYGGF+ S+TP FS +R+V+++HLG +FC+ANIRG
Sbjct  461   GTKIPMFIVARKNIPMDGSHPCLLYGYGGFNISITPSFSVSRIVLSRHLGAVFCIANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYG+EWHK+G+LAKKQNCFDDFI AAEYL++AG+TQP KLCIEGGSNGGLL+GACINQ
Sbjct  521   GGEYGQEWHKSGSLAKKQNCFDDFISAAEYLVSAGYTQPRKLCIEGGSNGGLLVGACINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCS+ EEEFHWLIKYSPLHNVRRPWEQ
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSEKEEEFHWLIKYSPLHNVRRPWEQ  640

Query  508   T-HQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             +  Q  QYP+TM+LTADHDDRVVPLH+ K LA M
Sbjct  641   SPDQPSQYPATMILTADHDDRVVPLHSLKLLATM  674


 Score =   102 bits (253),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ++LCTS   +PQTNPI+GRIE  AGHG GRPTQK+IDEAADRY+F+AK+L A W
Sbjct  670  LLATMQYILCTSVEKSPQTNPIIGRIECKAGHGAGRPTQKMIDEAADRYSFLAKMLEASW  729

Query  225  IE  220
            IE
Sbjct  730  IE  731



>ref|XP_008377101.1| PREDICTED: prolyl endopeptidase [Malus domestica]
Length=731

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/454 (71%), Positives = 392/454 (86%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHF+GTDQSEDILCWKDS+NP+ +  A VTEDGKY L+Y+ E CDPVNK Y CD+SAL N
Sbjct  222   YHFVGTDQSEDILCWKDSENPKSLFEADVTEDGKYILLYVEEGCDPVNKFYYCDMSALLN  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G RG ++LLP  K++D F+A Y  +AND+ VFT  TNK+APKYKL RVD+KEP  W 
Sbjct  282   GLEGLRGKNDLLPVIKVIDKFDAQYRVIANDDTVFTLLTNKDAPKYKLARVDLKEPTVWT  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ E  KDVLESA AVN  Q++V+YLSDVK ++Q+RD+++G +L H LPIDIG+V+  S
Sbjct  342   DVLPESGKDVLESASAVNGTQMIVSYLSDVKYIVQIRDLKSGNLL-HQLPIDIGSVHRFS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+DS VF GFT+FL P IIYQCNL +++P+LK+FREITVPGF+R+ F+V QVF+ SKD
Sbjct  401   ARREDSTVFFGFTSFLTPGIIYQCNLDNEIPDLKVFREITVPGFERSEFHVDQVFIPSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMF+++ ++I L+GS+PCLL+GYGGF+ S+TP FS +R V+ +HLGV++C+ANIRG
Sbjct  461   GTKIPMFVMARQNIPLNGSHPCLLYGYGGFNVSITPSFSVSRSVLTRHLGVVYCIANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+L+KKQNCFDDFI AAEYL++AG+TQPSKLCIEGGSNGGLL+GACIN+
Sbjct  521   GGEYGEEWHKAGSLSKKQNCFDDFISAAEYLVSAGYTQPSKLCIEGGSNGGLLVGACINK  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSD EEEFHWLI+YSPLHNVRRPWEQ
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDKEEEFHWLIEYSPLHNVRRPWEQ  640

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                Q  QYPSTMLLTADHDDRVVPLH+ K+LA +
Sbjct  641   HATQPHQYPSTMLLTADHDDRVVPLHSLKFLATL  674


 Score =   100 bits (250),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+ L TS  N+PQTNPI+GRIE  AGHG GRPTQK+IDEAADRY+FMAK+LGA W
Sbjct  670  FLATLQYALSTSLENSPQTNPIIGRIECKAGHGAGRPTQKMIDEAADRYSFMAKMLGASW  729

Query  225  IE  220
            IE
Sbjct  730  IE  731



>ref|XP_006342100.1| PREDICTED: prolyl endopeptidase-like isoform X2 [Solanum tuberosum]
Length=678

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/455 (75%), Positives = 392/455 (86%), Gaps = 4/455 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQS+DILCWKDS+NP H    SVTEDGKY L+YIF NCD VNK+Y CDLS LPN
Sbjct  223   YHRLGTDQSDDILCWKDSENPMHRHIVSVTEDGKYVLLYIFRNCDTVNKLYYCDLSTLPN  282

Query  1588  GLQGYRGT-DELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCW  1412
             G++G +G  D+ LPFNK+VD F+ASY +VA++  +FTF+TNK+APKYKL+RVDV+ P  W
Sbjct  283   GIEGCKGKRDDALPFNKLVDTFDASYDYVAHNGTIFTFQTNKDAPKYKLIRVDVENPDFW  342

Query  1411  CDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGI  1232
              D+I+EDEKDVL+SAVAVN NQLVV+YL DVK+VLQLRD+ TG +L+H LPIDIG V+GI
Sbjct  343   YDIIEEDEKDVLQSAVAVNENQLVVSYLRDVKNVLQLRDLDTGELLHH-LPIDIGRVSGI  401

Query  1231  SARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSK  1052
             SARRKD  VFIGF NFLIP +IY+CNL+ +VP+LK+FREI VPGFDR  F V QVFV SK
Sbjct  402   SARRKDDSVFIGFMNFLIPGLIYECNLKGEVPDLKVFREIVVPGFDRTEFQVNQVFVPSK  461

Query  1051  DGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIR  872
             DGVKIPMFIVS K I LDG NPCLLFGYGGF+ S+TP+FS AR+V+AKHLGV+FC+ANIR
Sbjct  462   DGVKIPMFIVSRKGISLDGCNPCLLFGYGGFNVSITPHFSAARVVLAKHLGVVFCIANIR  521

Query  871   GGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACIN  692
             GGGEYGEEW+K GAL KKQNCFDDFI AAEYL++AG+TQP KLCIEGGSNGGLL+GAC+N
Sbjct  522   GGGEYGEEWYKGGALNKKQNCFDDFISAAEYLVSAGYTQPHKLCIEGGSNGGLLVGACVN  581

Query  691   QRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE  512
             QRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSD EEEF  LI+YSPLHNV RPWE
Sbjct  582   QRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDKEEEFQCLIEYSPLHNVSRPWE  641

Query  511   QTHQAC--QYPSTMLLTADHDDRVVPLHTFKYLAM  413
             ++      QYPS MLLTADHDDRVVPLH+ K LA+
Sbjct  642   KSANVAFVQYPSIMLLTADHDDRVVPLHSLKLLAV  676



>ref|XP_006342099.1| PREDICTED: prolyl endopeptidase-like isoform X1 [Solanum tuberosum]
Length=734

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/457 (75%), Positives = 392/457 (86%), Gaps = 4/457 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQS+DILCWKDS+NP H    SVTEDGKY L+YIF NCD VNK+Y CDLS LPN
Sbjct  223   YHRLGTDQSDDILCWKDSENPMHRHIVSVTEDGKYVLLYIFRNCDTVNKLYYCDLSTLPN  282

Query  1588  GLQGYRGT-DELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCW  1412
             G++G +G  D+ LPFNK+VD F+ASY +VA++  +FTF+TNK+APKYKL+RVDV+ P  W
Sbjct  283   GIEGCKGKRDDALPFNKLVDTFDASYDYVAHNGTIFTFQTNKDAPKYKLIRVDVENPDFW  342

Query  1411  CDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGI  1232
              D+I+EDEKDVL+SAVAVN NQLVV+YL DVK+VLQLRD+ TG +L+H LPIDIG V+GI
Sbjct  343   YDIIEEDEKDVLQSAVAVNENQLVVSYLRDVKNVLQLRDLDTGELLHH-LPIDIGRVSGI  401

Query  1231  SARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSK  1052
             SARRKD  VFIGF NFLIP +IY+CNL+ +VP+LK+FREI VPGFDR  F V QVFV SK
Sbjct  402   SARRKDDSVFIGFMNFLIPGLIYECNLKGEVPDLKVFREIVVPGFDRTEFQVNQVFVPSK  461

Query  1051  DGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIR  872
             DGVKIPMFIVS K I LDG NPCLLFGYGGF+ S+TP+FS AR+V+AKHLGV+FC+ANIR
Sbjct  462   DGVKIPMFIVSRKGISLDGCNPCLLFGYGGFNVSITPHFSAARVVLAKHLGVVFCIANIR  521

Query  871   GGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACIN  692
             GGGEYGEEW+K GAL KKQNCFDDFI AAEYL++AG+TQP KLCIEGGSNGGLL+GAC+N
Sbjct  522   GGGEYGEEWYKGGALNKKQNCFDDFISAAEYLVSAGYTQPHKLCIEGGSNGGLLVGACVN  581

Query  691   QRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE  512
             QRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSD EEEF  LI+YSPLHNV RPWE
Sbjct  582   QRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDKEEEFQCLIEYSPLHNVSRPWE  641

Query  511   QTHQAC--QYPSTMLLTADHDDRVVPLHTFKYLAMMM  407
             ++      QYPS MLLTADHDDRVVPLH+ K LA M 
Sbjct  642   KSANVAFVQYPSIMLLTADHDDRVVPLHSLKLLATMQ  678


 Score =   108 bits (271),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ++LCTS   + QTNPIVGRIER AGHGCGRPTQKLIDEAADRYAFMAK LGA W
Sbjct  673  LLATMQYILCTSQEGSRQTNPIVGRIERKAGHGCGRPTQKLIDEAADRYAFMAKELGAAW  732

Query  225  IE  220
            +E
Sbjct  733  VE  734



>ref|XP_008221181.1| PREDICTED: prolyl endopeptidase-like [Prunus mume]
Length=731

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/454 (71%), Positives = 389/454 (86%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHF+GTDQS+DILCWKD +NP+++  A+VT DGKY ++ I E CDPVNK Y CD+SALPN
Sbjct  222   YHFVGTDQSKDILCWKDPENPKYLFGANVTADGKYIILSITEGCDPVNKFYYCDMSALPN  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G R  ++LLP  K++D F+A Y  +AND+ +FTF TNK+APKYKLVRVD+KEP  W 
Sbjct  282   GLEGLREKNDLLPVLKLIDTFDAMYDLIANDDTLFTFLTNKDAPKYKLVRVDLKEPTVWT  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+QE EKDVLES  AVN  Q++V+YLSDVK VLQ+RD+ +G +L H LP+DIG+V+GIS
Sbjct  342   DVLQEAEKDVLESVCAVNGGQMIVSYLSDVKYVLQIRDLNSGNLL-HQLPVDIGSVSGIS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR+DS  F GFT+FL P IIYQCNL +++P++K+FREITVPGFDR+ F V QVF+ SKD
Sbjct  401   GRREDSTAFFGFTSFLTPGIIYQCNLANEIPDMKVFREITVPGFDRSEFQVDQVFIPSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G +IP+F+V+ K+I LDGS+PCLL+GYGGF+ S+TPYFS +R+V+ +HL  +FC+ANIRG
Sbjct  461   GTEIPIFVVARKNIPLDGSHPCLLYGYGGFNISITPYFSVSRIVLTRHLDAVFCIANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHK+G+LAKKQNCFDDFI AAEYL++AG+TQPSKLCIEGGSNGGLL+GACINQ
Sbjct  521   GGEYGEEWHKSGSLAKKQNCFDDFISAAEYLVSAGYTQPSKLCIEGGSNGGLLVGACINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE-  512
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCSD EEEF WLIKYSPLHNVRRPWE 
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSDKEEEFQWLIKYSPLHNVRRPWEL  640

Query  511   QTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                Q  QYPSTMLLTADHDDRVVPLHT K LA +
Sbjct  641   HASQPHQYPSTMLLTADHDDRVVPLHTLKLLATL  674


 Score =   100 bits (250),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+Q+VL TS   +PQTNPI+GRIE  AGHG GRPTQK+IDEAADRY+FMAK+LGA W
Sbjct  670  LLATLQYVLSTSLEKSPQTNPIIGRIECKAGHGGGRPTQKMIDEAADRYSFMAKMLGASW  729

Query  225  IE  220
            IE
Sbjct  730  IE  731



>ref|XP_002285910.2| PREDICTED: prolyl endopeptidase isoform X1 [Vitis vinifera]
Length=791

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/454 (73%), Positives = 395/454 (87%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS+DILCWKD DNP+HM  A VT+DGKY L+YI E+C+ VNKVY CD+++LP 
Sbjct  282   YHFLGTDQSQDILCWKDPDNPKHMFGADVTDDGKYVLLYISESCEEVNKVYHCDITSLPE  341

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+R   +LLPF K++D+F+A Y  +AND+ +FTF TNK+APKYKLV+VD+KEP  W 
Sbjct  342   GLEGFRERKDLLPFIKLIDNFDARYHAIANDDTLFTFMTNKDAPKYKLVQVDLKEPSIWN  401

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
              V++E EKDVLESA AVN NQ++V YLSDVK VLQ+RD++TG +L H+LPIDIG+V  IS
Sbjct  402   VVLEEAEKDVLESAYAVNGNQILVCYLSDVKYVLQIRDLKTGSLL-HDLPIDIGSVFDIS  460

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+DS VFIGFT+FL P IIY CNL++ VP++KIFREI VPGFDR  F V QVFV SKD
Sbjct  461   ARRRDSTVFIGFTSFLTPGIIYHCNLEAGVPDMKIFREIVVPGFDRTEFCVDQVFVPSKD  520

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ K+I +DGS+PCLL+GYGGF+ S+TP FS +R+V+++HLG +FC+ANIRG
Sbjct  521   GTKIPMFIVARKNIPMDGSHPCLLYGYGGFNISITPSFSVSRIVLSRHLGAVFCIANIRG  580

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYG+EWHK+G+LAKKQNCFDDFI AAEYL++AG+TQP KLCIEGGSNGGLL+GACINQ
Sbjct  581   GGEYGQEWHKSGSLAKKQNCFDDFISAAEYLVSAGYTQPRKLCIEGGSNGGLLVGACINQ  640

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCS+ EEEFHWLIKYSPLHNVRRPWEQ
Sbjct  641   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSEKEEEFHWLIKYSPLHNVRRPWEQ  700

Query  508   T-HQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             +  Q  QYP+TM+LTADHDDRVVPLH+ K LA M
Sbjct  701   SPDQPSQYPATMILTADHDDRVVPLHSLKLLATM  734


 Score =   102 bits (253),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ++LCTS   +PQTNPI+GRIE  AGHG GRPTQK+IDEAADRY+F+AK+L A W
Sbjct  730  LLATMQYILCTSVEKSPQTNPIIGRIECKAGHGAGRPTQKMIDEAADRYSFLAKMLEASW  789

Query  225  IE  220
            IE
Sbjct  790  IE  791



>ref|XP_011041280.1| PREDICTED: prolyl endopeptidase-like [Populus euphratica]
Length=733

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/472 (69%), Positives = 396/472 (84%), Gaps = 6/472 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQSEDILCW+D +NP++M  A+VT+DGKY L+YI E+CDPVNKVY CD+SA  +
Sbjct  224   YHFLGTDQSEDILCWRDLENPKYMFEAAVTDDGKYLLLYIEESCDPVNKVYYCDMSAFSD  283

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G++G + LLPF K+VD+F+A Y  +AND  +FTF TNK+APKYK+VRVD+KEP  W 
Sbjct  284   GLEGFKGGNSLLPFIKLVDNFDAKYHEIANDGTLFTFLTNKDAPKYKIVRVDLKEPSSWI  343

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ E EKDVLESA AV+ ++++V+YL+DVK VLQ+RD++TG +L H LPIDIG+V GIS
Sbjct  344   DVVPESEKDVLESAYAVHGDKMIVSYLNDVKHVLQIRDLKTGSLL-HRLPIDIGSVTGIS  402

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+DS VFI FT+FL   IIYQCNL ++VP++KIFREI+VPGF+R  F V QVFV SKD
Sbjct  403   ARREDSTVFIEFTSFLTSRIIYQCNLDTEVPDVKIFREISVPGFNRTEFQVNQVFVPSKD  462

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G +IPMFIV+ K+I LDGS+PCLL+ YGGF+ S+TP FS  R+V+ +HLG + C+ANIRG
Sbjct  463   GTRIPMFIVAKKNITLDGSHPCLLYAYGGFNISITPSFSVNRIVLTRHLGSVVCIANIRG  522

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+L++KQNCFDDFI AAEYL++AG+TQP KLCIEGGSNGGLL+GACINQ
Sbjct  523   GGEYGEEWHKAGSLSRKQNCFDDFISAAEYLVSAGYTQPKKLCIEGGSNGGLLVGACINQ  582

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCSD +EEF WLIKYSPLHNVRRPWEQ
Sbjct  583   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSDKKEEFEWLIKYSPLHNVRRPWEQ  642

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHS  356
                Q  QYP+TMLLTADHDDRVVPLH+ K LA M     H  C   + S  +
Sbjct  643   HPEQPSQYPATMLLTADHDDRVVPLHSLKLLATMQ----HILCTSLENSPQT  690


 Score = 99.4 bits (246),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQH+LCTS  N+PQTNPI+GRIE  AGHG GRPT+K+IDEAAD Y+FMA++L A W
Sbjct  672  LLATMQHILCTSLENSPQTNPIIGRIECKAGHGAGRPTKKMIDEAADTYSFMARMLDASW  731

Query  225  IE  220
             E
Sbjct  732  NE  733



>ref|XP_002890385.1| hypothetical protein ARALYDRAFT_472267 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66644.1| hypothetical protein ARALYDRAFT_472267 [Arabidopsis lyrata subsp. 
lyrata]
Length=731

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/454 (71%), Positives = 386/454 (85%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLG DQSED+LCW+D DNP+HM  + VT+DGKY ++ I E CDPVNKVY CDLS+LP 
Sbjct  222   YHFLGMDQSEDVLCWRDQDNPKHMFGSKVTDDGKYLIMSIEEGCDPVNKVYHCDLSSLPK  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+RG++ LLPF K++D F+A Y  +AND  +FTF TNK+APKYKLVRVD+KEP  W 
Sbjct  282   GLEGFRGSNALLPFVKLIDTFDAQYIAIANDATLFTFLTNKDAPKYKLVRVDLKEPSSWT  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVI E EKDVL +A AVN +QLVV+Y+SDVK +LQ+RD+++G +L H LP+DIG+V G+ 
Sbjct  342   DVIAEHEKDVLSTASAVNGDQLVVSYMSDVKHILQIRDLKSGSLL-HRLPVDIGSVCGVF  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+I F  FT+FL P +IY+C+L  + PE+ +FREI VPGFDR +F VTQVF  SKD
Sbjct  401   ARRKDTIFFFRFTSFLTPGVIYKCDLSHEAPEVTVFREIGVPGFDRTAFQVTQVFYPSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G +IPMFIV+ KDI LDGS+PCLL+ YGGFS S+TP+FS  R+V+++HLG +FC ANIRG
Sbjct  461   GTEIPMFIVARKDIKLDGSHPCLLYAYGGFSVSMTPFFSATRIVLSRHLGTVFCFANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHK+GALA KQNCFDDFI  AEYL++AG+TQP KLCIEGGSNGG+L+GACINQ
Sbjct  521   GGEYGEEWHKSGALANKQNCFDDFISGAEYLVSAGYTQPRKLCIEGGSNGGILVGACINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTS+FGCSD EEEFHWLIKYSPLHNV+RPWEQ
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSEFGCSDKEEEFHWLIKYSPLHNVKRPWEQ  640

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
              T +  QYPSTMLLTADHDDRVVPLHT+K LA M
Sbjct  641   KTDRFVQYPSTMLLTADHDDRVVPLHTYKLLATM  674


 Score = 93.2 bits (230),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+ L  S  N+PQTNPI+ RIE  AGHG GRPTQK+IDEAADRY+FMAK++ A W
Sbjct  670  LLATMQYELGLSLENSPQTNPIIARIEVKAGHGAGRPTQKMIDEAADRYSFMAKMVDASW  729

Query  225  IE  220
            I+
Sbjct  730  ID  731



>ref|XP_007227012.1| hypothetical protein PRUPE_ppa001441mg [Prunus persica]
 gb|EMJ28211.1| hypothetical protein PRUPE_ppa001441mg [Prunus persica]
Length=828

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/454 (72%), Positives = 389/454 (86%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHF+GTDQS+DILCWKD +NP+++  A+VT DGKY ++ I E CDPVNK Y CD+SALPN
Sbjct  319   YHFVGTDQSKDILCWKDPENPKYLFGATVTADGKYIILSIDEGCDPVNKFYYCDMSALPN  378

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G R  ++LLP  K++D F+A Y  +AND+ VFTF TNK+APKYKLVRVD+KEP  W 
Sbjct  379   GLEGLREKNDLLPVLKLIDTFDAMYNLIANDDTVFTFLTNKDAPKYKLVRVDLKEPTVWT  438

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+QE EKDVL S  AVN +Q++V+YLSDVK VLQ+RD+ +G +L H LP+DIG+V+GIS
Sbjct  439   DVLQEAEKDVLGSVCAVNGSQMIVSYLSDVKCVLQIRDLNSGNLL-HQLPLDIGSVSGIS  497

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR+DS  F GFT+FL P IIYQCNL +++P++K+FREITVPGFDR+ F V QVF+ SKD
Sbjct  498   GRREDSTAFFGFTSFLTPGIIYQCNLVNEIPDVKVFREITVPGFDRSEFQVDQVFIPSKD  557

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G +IPMF+V+ K+I LDGS+PCLL+GYGGF  S+TPYFS +R+V+ +HLG +FC+ANIRG
Sbjct  558   GTEIPMFVVARKNIPLDGSHPCLLYGYGGFDISITPYFSVSRIVLTRHLGAVFCIANIRG  617

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHK+G+LAKKQNCFDDFI AAEYL++AG+TQPSKLCIEGGSNGGLL+GACINQ
Sbjct  618   GGEYGEEWHKSGSLAKKQNCFDDFISAAEYLVSAGYTQPSKLCIEGGSNGGLLVGACINQ  677

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE-  512
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCSD EEEF WLIKYSPLHNVRRPWE 
Sbjct  678   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSDKEEEFQWLIKYSPLHNVRRPWEL  737

Query  511   QTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                Q  QYPSTMLLTADHDDRVVPLHT K LA +
Sbjct  738   HASQPHQYPSTMLLTADHDDRVVPLHTLKLLATL  771


 Score =   100 bits (249),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+Q+VL TS   +PQTNPI+GRIE  AGHG GRPTQK+IDEAADRY+FMAK+LGA W
Sbjct  767  LLATLQYVLSTSLEKSPQTNPIIGRIECKAGHGSGRPTQKMIDEAADRYSFMAKMLGAIW  826

Query  225  IE  220
            IE
Sbjct  827  IE  828



>gb|KHF99507.1| Prolyl endopeptidase [Gossypium arboreum]
Length=734

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/485 (70%), Positives = 398/485 (82%), Gaps = 10/485 (2%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGT+QSEDILCW+D +NP+HM S  VT+DGKY ++YI E C PVNK+Y+CD+S LP 
Sbjct  225   YHFLGTNQSEDILCWRDPENPKHMFSGKVTDDGKYLVLYIDEGCGPVNKLYLCDMSTLPG  284

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GLQG+R  +  LPF K++D F+A Y  VAND++ FTF TNK+APKYKLVRVD+KEPG W 
Sbjct  285   GLQGFRERNGPLPFVKLIDKFDAQYINVANDDSWFTFMTNKDAPKYKLVRVDLKEPGKWI  344

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVI E+EKDVLESA  VN  Q++ +YLSDVK V+Q+RD+ TG +L HNLPIDIGTV GIS
Sbjct  345   DVIPENEKDVLESACVVNGYQIITSYLSDVKYVIQVRDLETGSML-HNLPIDIGTVYGIS  403

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+DSIVFIGFT+FL P IIYQCNL +K PE+KIFREI+V GFDR+ F V QVFV SKD
Sbjct  404   ARREDSIVFIGFTSFLTPGIIYQCNLGTKFPEMKIFREISVLGFDRSEFKVNQVFVPSKD  463

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFI+  KD+ LDGS+PCLL+GYGGF+ S+TP FS +R+V+A+HLG  FC+ANIRG
Sbjct  464   GTKIPMFIIGRKDLNLDGSHPCLLYGYGGFNVSLTPSFSVSRIVLARHLGAFFCIANIRG  523

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAGAL+KKQ CFDDFI AAEYLI++G+T P KLCIEGGSNGGLL+GACINQ
Sbjct  524   GGEYGEEWHKAGALSKKQTCFDDFISAAEYLISSGYTMPEKLCIEGGSNGGLLVGACINQ  583

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RP+LFGCALAHVGVMDMLRFHKFTIGHAWT DFGCSD EE+F+WLIKYSPLHNVRRPWE+
Sbjct  584   RPELFGCALAHVGVMDMLRFHKFTIGHAWTCDFGCSDKEEDFNWLIKYSPLHNVRRPWEK  643

Query  508   T-HQACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHSANQPNCGS  332
                +  QYPSTMLLTADHDDRVVPLH+ K LA M     H  C     S  ++ Q N   
Sbjct  644   LPGRMLQYPSTMLLTADHDDRVVPLHSLKMLATMQ----HVLC----TSLENSPQTNPIV  695

Query  331   HRAQC  317
              R +C
Sbjct  696   GRIEC  700


 Score =   113 bits (282),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            ++ TMQHVLCTS  N+PQTNPIVGRIE  AGHGCGRPT KLIDEAADRY+FMAKVLGA W
Sbjct  673  MLATMQHVLCTSLENSPQTNPIVGRIECKAGHGCGRPTHKLIDEAADRYSFMAKVLGASW  732

Query  225  IE  220
            IE
Sbjct  733  IE  734



>ref|XP_002306966.1| prolyl oligopeptidase family protein [Populus trichocarpa]
 gb|EEE93962.1| prolyl oligopeptidase family protein [Populus trichocarpa]
Length=733

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/454 (72%), Positives = 390/454 (86%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQSEDILCW+D +NP++M  A VT+DGKY L+YI E+CDPVNKVY CD+SA  +
Sbjct  224   YHFLGTDQSEDILCWRDLENPKYMFEAGVTDDGKYLLLYIEESCDPVNKVYYCDMSAFSD  283

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G++G + LLPF K+VD+F+A Y  +AND  +FTF TNK+APKYK+VRVD+KEP  W 
Sbjct  284   GLEGFKGGNSLLPFIKLVDNFDAKYHEIANDGTLFTFLTNKDAPKYKIVRVDLKEPSSWI  343

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ E EKDVLESA AV+ ++++V+YL+DVK VLQ+RD++TG +L H LPIDIG+V GIS
Sbjct  344   DVVPESEKDVLESAYAVHGDKMIVSYLNDVKHVLQIRDLKTGSLL-HRLPIDIGSVTGIS  402

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+DS VFI FT+FL   IIYQCNL ++VP++KIFREI+VPGF+R  F V QVFV SKD
Sbjct  403   ARREDSTVFIEFTSFLTSRIIYQCNLDTEVPDVKIFREISVPGFNRTEFQVNQVFVPSKD  462

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G +IPMFIV+ K+I LDGS+PCLL+ YGGF+ S+TP FS +R+V+ +HLG + C+ANIRG
Sbjct  463   GTRIPMFIVAKKNITLDGSHPCLLYAYGGFNISITPSFSVSRIVLTRHLGSVVCIANIRG  522

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LA+KQNCFDDFI AAEYL++AG+TQP KLCIEGGSNGGLL+GACINQ
Sbjct  523   GGEYGEEWHKAGSLARKQNCFDDFISAAEYLVSAGYTQPKKLCIEGGSNGGLLVGACINQ  582

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCSD +EEF WLIKYSPLHNVRRPWEQ
Sbjct  583   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSDKKEEFDWLIKYSPLHNVRRPWEQ  642

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                Q  QYP TMLLTADHDDRVVPLH+ K LA M
Sbjct  643   HPEQPSQYPPTMLLTADHDDRVVPLHSLKLLATM  676


 Score = 95.9 bits (237),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ++LCTS  N+PQTNPI+GRIE  AGHG GRPT+K IDEAAD Y+FMA++L A W
Sbjct  672  LLATMQYILCTSLENSPQTNPIIGRIECKAGHGAGRPTKKKIDEAADTYSFMARMLDASW  731

Query  225  IE  220
             E
Sbjct  732  NE  733



>ref|XP_009384008.1| PREDICTED: prolyl endopeptidase-like [Musa acuminata subsp. malaccensis]
Length=803

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/454 (72%), Positives = 394/454 (87%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQSEDILCW+D ++P+++  + VT DGKY L+YI E CDPVNK+Y CDLS+L N
Sbjct  294   YHFLGTDQSEDILCWRDPEHPKYIFDSYVTNDGKYVLLYIEEGCDPVNKLYYCDLSSLSN  353

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G++G++E+LPF K+VD FEA Y  VAND+  FT  TNK APKYKLVR+D+K+P  W 
Sbjct  354   GLEGFKGSNEMLPFVKLVDTFEACYSLVANDDGEFTLLTNKEAPKYKLVRIDLKKPALWS  413

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             D++ EDEKDVLESA AVN+NQ++V YLSDVK VLQ+RD++TG +L H LP+D+G+V+GIS
Sbjct  414   DILPEDEKDVLESAYAVNSNQILVCYLSDVKHVLQIRDLKTGNLL-HPLPLDVGSVSGIS  472

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR+DS +FI FT+FL P IIY+CNL S+VPE+KIFREI+VPGFDR  F V QVFV S+D
Sbjct  473   GRREDSEIFISFTSFLTPGIIYRCNLASEVPEMKIFREISVPGFDRTDFEVKQVFVSSED  532

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIVS K+I L+GSNP LL+GYGGF+ S+ P FS ARLV+A++LG IFC+ANIRG
Sbjct  533   GTKIPMFIVSKKNIELNGSNPVLLYGYGGFNISLPPSFSVARLVLARNLGCIFCIANIRG  592

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGE+WHKAG+L+KKQNCFDDFI AAE+L++ G+T+P +LCIEGGSNGGLL+ AC+NQ
Sbjct  593   GGEYGEDWHKAGSLSKKQNCFDDFISAAEFLVSNGYTKPERLCIEGGSNGGLLVAACMNQ  652

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGC LAHVGVMDMLRFHKFTIGHAWTSD+GCSDNEEEFHWLIKYSPLHNV+RPWE+
Sbjct  653   RPDLFGCVLAHVGVMDMLRFHKFTIGHAWTSDYGCSDNEEEFHWLIKYSPLHNVKRPWEK  712

Query  508   TH-QACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             +  Q+CQYPSTMLLTADHDDRVVPLH+ K LA M
Sbjct  713   SSDQSCQYPSTMLLTADHDDRVVPLHSLKLLATM  746


 Score =   104 bits (260),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLC+S  N+PQTNPI+ RI+R AGHG GRPTQK+IDEAADRY+FMAKVLGA W
Sbjct  742  LLATMQYVLCSSVVNSPQTNPIIARIDRKAGHGAGRPTQKMIDEAADRYSFMAKVLGATW  801

Query  225  IE  220
             +
Sbjct  802  TD  803



>ref|XP_002301932.2| hypothetical protein POPTR_0002s01530g [Populus trichocarpa]
 gb|EEE81205.2| hypothetical protein POPTR_0002s01530g [Populus trichocarpa]
Length=733

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/454 (71%), Positives = 386/454 (85%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHF+G +QSEDILCW+D +NP+++  A VT+DGKY L+YI E CDPVNKVY CD+SA  +
Sbjct  224   YHFMGKNQSEDILCWRDPENPKYVFGADVTDDGKYLLLYIGEGCDPVNKVYYCDMSAFSD  283

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G++G   LLPF K++D+F+A Y  +AND   FTF TNK+APKYK+VRVD+KEP  W 
Sbjct  284   GLEGFKGGKSLLPFTKLIDNFDARYHEIANDGTSFTFLTNKDAPKYKIVRVDLKEPSSWI  343

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVI E EKDVLESA AV+ ++++V+YLSDVK VLQ+RD++TG +L H LPIDIG+V GIS
Sbjct  344   DVIPESEKDVLESAYAVDGDKMIVSYLSDVKHVLQIRDLKTGSLL-HQLPIDIGSVTGIS  402

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             A+RKDS VFI FT+FL P IIYQCNL + VP+LKIFREI+VPGFDR  F+V Q+FV SKD
Sbjct  403   AQRKDSTVFIEFTSFLTPRIIYQCNLDTGVPDLKIFREISVPGFDRTEFHVDQLFVTSKD  462

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
               KIP FIV+ K+I LDGS+PCLL+GYGGF+ S+TP FS +R+V+ +HLG +FC+ANIRG
Sbjct  463   DTKIPTFIVAKKNIKLDGSHPCLLYGYGGFNVSITPSFSVSRMVLTRHLGAVFCIANIRG  522

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LA+KQNCFDDFI  +EYL++AG+TQP KLCIEGGSNGGLL+GACINQ
Sbjct  523   GGEYGEEWHKAGSLARKQNCFDDFISVSEYLVSAGYTQPKKLCIEGGSNGGLLVGACINQ  582

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCSD +EEF WLIKYSPLHNVRRPWEQ
Sbjct  583   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSDKKEEFGWLIKYSPLHNVRRPWEQ  642

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                Q  QYP TM+LTADHDDRVVPLH+ K LA M
Sbjct  643   HPEQPSQYPPTMILTADHDDRVVPLHSLKLLATM  676


 Score =   102 bits (255),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ++LCTS   +PQTNPI+GRIE  AGHG GRPTQKLIDEAADRY+FMA++LGA W
Sbjct  672  LLATMQYILCTSLEKSPQTNPIIGRIECKAGHGAGRPTQKLIDEAADRYSFMARMLGASW  731

Query  225  IE  220
             E
Sbjct  732  NE  733



>ref|XP_004500899.1| PREDICTED: prolyl endopeptidase-like [Cicer arietinum]
Length=728

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/454 (72%), Positives = 388/454 (85%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQSEDILCWKD  NP++ +   VT+DGKY L+YI E CDPVNK+Y  D+   P+
Sbjct  219   YHFLGTDQSEDILCWKDLANPKYTVGGVVTDDGKYLLLYIGEGCDPVNKLYYYDMYDQPS  278

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
              L+ +R  +  LPF K++D+F+A Y ++AND+ VFTF TNK+APKYKLVRVD+K+P  W 
Sbjct  279   VLENFRSENSPLPFVKLIDNFDAKYDYIANDDTVFTFLTNKDAPKYKLVRVDLKKPNAWA  338

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV++E EKDVLESA AVN NQL+V+YLSDVK +LQ+RD++TG +L H LPIDIGTV  IS
Sbjct  339   DVLRESEKDVLESACAVNGNQLIVSYLSDVKHLLQVRDLKTGSLL-HQLPIDIGTVYEIS  397

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+D++VFI FT+FL P I+YQCNL + VP+LKI REI VPGFDR+ F+V QVFV SKD
Sbjct  398   ARREDNVVFISFTSFLTPGIVYQCNLGTGVPDLKILREIAVPGFDRSEFHVNQVFVPSKD  457

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ +DI LDGS+PCLL+GYGGF+ S+TP FS +R+V+ KHLGV++C+ANIRG
Sbjct  458   GTKIPMFIVAKRDIVLDGSHPCLLYGYGGFNISITPSFSVSRIVLTKHLGVVYCIANIRG  517

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWH AG+LA+KQNCFDDFI AAEYLI+ G+TQP KLCIEGGSNGGLL+GACINQ
Sbjct  518   GGEYGEEWHNAGSLARKQNCFDDFISAAEYLISTGYTQPRKLCIEGGSNGGLLVGACINQ  577

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GC+D E+EFHWLIKYSPLHNVRRPWEQ
Sbjct  578   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCADKEKEFHWLIKYSPLHNVRRPWEQ  637

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                Q+ QYPSTMLLTADHDDRVVPLH+ K LA M
Sbjct  638   HPDQSIQYPSTMLLTADHDDRVVPLHSLKLLATM  671


 Score =   101 bits (252),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLC S   +PQTNPI+GRI+  AGHG GRPTQK+IDEAADRY+FMAK+L  HW
Sbjct  667  LLATMQYVLCNSLEKSPQTNPIIGRIDCKAGHGAGRPTQKMIDEAADRYSFMAKMLEVHW  726

Query  225  IE  220
            IE
Sbjct  727  IE  728



>ref|XP_010498470.1| PREDICTED: prolyl endopeptidase-like [Camelina sativa]
Length=731

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/454 (70%), Positives = 386/454 (85%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS+D+LCW+D DNP+HM  + VT+DGKY ++ I E CDPVNKVY CDLS+LP 
Sbjct  222   YHFLGTDQSQDVLCWRDQDNPKHMFGSKVTDDGKYLIMSIEEGCDPVNKVYHCDLSSLPK  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+RG++ LLPF K++D F+A Y  +ANDE +FTF TNK+APKYK+VRVD+KEP  W 
Sbjct  282   GLEGFRGSNALLPFVKLIDTFDAQYIAIANDETLFTFFTNKDAPKYKVVRVDLKEPSNWT  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVI E EKDVL +A AVN +QLVV+Y+SDVK +LQ+RD+++G +L H LP+DIG+V G+ 
Sbjct  342   DVIAEHEKDVLSTASAVNGDQLVVSYMSDVKHILQIRDLKSGSLL-HRLPVDIGSVYGVF  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+     FT+FL P +IY+C+L  K P++ +FREI+VPGFDR +F V+QVF  SKD
Sbjct  401   ARRKDTTFLFMFTSFLTPGVIYKCDLSHKAPKVTVFREISVPGFDRTAFEVSQVFYPSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ K+I LDGS+PCLL+GYGGFS S TP+FS  R+V+++HLGV+FC ANIRG
Sbjct  461   GTKIPMFIVARKNIKLDGSHPCLLYGYGGFSDSTTPFFSATRIVLSRHLGVVFCFANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHK+GALA KQNCFDDFI  AEYL++AG+TQP KLCIEG SNGG+L+GACINQ
Sbjct  521   GGEYGEEWHKSGALASKQNCFDDFISGAEYLVSAGYTQPRKLCIEGSSNGGILVGACINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAW S+FGCSD E+EFHWLIKYSPLHNV+RPWEQ
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWVSEFGCSDKEDEFHWLIKYSPLHNVKRPWEQ  640

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
              T +  QYPSTMLLTADHDDRVVPLHT+K LA M
Sbjct  641   KTDRFVQYPSTMLLTADHDDRVVPLHTYKLLATM  674


 Score = 92.0 bits (227),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+ L  S  N+PQTNP++ RIE  AGHG GRPTQK+IDEAADRY+FMAK++ A W
Sbjct  670  LLATMQYELSLSLENSPQTNPLIARIEVKAGHGAGRPTQKMIDEAADRYSFMAKMVDASW  729

Query  225  IE  220
            ++
Sbjct  730  MD  731



>ref|XP_006473741.1| PREDICTED: prolyl endopeptidase-like [Citrus sinensis]
Length=732

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/455 (72%), Positives = 390/455 (86%), Gaps = 3/455 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGT QSEDILCWKD ++P+++ S  VTEDG+Y ++ I ENCDPVNKVY CDLSALP 
Sbjct  222   YHFLGTKQSEDILCWKDPEHPKYIFSGHVTEDGQYLVMCIEENCDPVNKVYYCDLSALPE  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G++  D LLPF K++D F+A Y  +AND+ VFTF TNK+APKYK++RVD+KEP  W 
Sbjct  282   GLEGFKKRDGLLPFVKLIDGFDAQYEVIANDDTVFTFLTNKDAPKYKIIRVDLKEPNDWF  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             +VI E E+DVLESA AVN NQ++V+YLSDVK VLQ+RD++ G +L H LPI+IG+VN IS
Sbjct  342   EVIPEAERDVLESATAVNLNQMIVSYLSDVKYVLQIRDLKNGSLL-HQLPIEIGSVNAIS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+DS+VFI FT+FLIP I+YQCNL+++ PE+KIFRE  +PGFDR+ F+V QVFV SKD
Sbjct  401   ARREDSVVFISFTSFLIPGIVYQCNLKTETPEMKIFRETIIPGFDRSEFHVHQVFVPSKD  460

Query  1048  G-VKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIR  872
             G  KIPMFIVS K+I LDGS+PCLL+GYGGF+ SVTP FS +R ++ +HLG +FC+ANIR
Sbjct  461   GSTKIPMFIVSKKNIKLDGSHPCLLYGYGGFNISVTPSFSVSRTILMRHLGAVFCIANIR  520

Query  871   GGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACIN  692
             GGGEYGEEWHK GALAKKQNCFDDFI A+EYLI+AG+TQ  KLCIEGGSNGGLL+GACIN
Sbjct  521   GGGEYGEEWHKGGALAKKQNCFDDFISASEYLISAGYTQSRKLCIEGGSNGGLLVGACIN  580

Query  691   QRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE  512
             QRPDLFGCALAHVGVMDMLR+HKFTIGHAW SDFGCS+ EEEF+WLIKYSPLHNVRRPWE
Sbjct  581   QRPDLFGCALAHVGVMDMLRYHKFTIGHAWVSDFGCSEEEEEFYWLIKYSPLHNVRRPWE  640

Query  511   QT-HQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             Q   +  QYPST+LLTADHDDRVVPLH+ K LA M
Sbjct  641   QNPDKPFQYPSTLLLTADHDDRVVPLHSLKLLATM  675


 Score =   108 bits (271),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS  N+PQTNPI+GRIER AGHG G PTQK+IDEAADRY FMAK+LGA W
Sbjct  671  LLATMQYVLCTSLENSPQTNPIIGRIERKAGHGVGLPTQKMIDEAADRYGFMAKMLGASW  730

Query  225  IE  220
            +E
Sbjct  731  VE  732



>ref|XP_010477279.1| PREDICTED: prolyl endopeptidase-like isoform X2 [Camelina sativa]
Length=731

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/454 (70%), Positives = 383/454 (84%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS+D+LCW+D DNP+HM  + VT+DGKY ++ I E CDPVNKVY CDLS+LP 
Sbjct  222   YHFLGTDQSQDVLCWRDQDNPKHMFGSKVTDDGKYLIMSIEEGCDPVNKVYHCDLSSLPK  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+RG++ LLPF K++D FEA Y  +ANDE +FTF TNK APKYK+VRVD+KEP  W 
Sbjct  282   GLEGFRGSNALLPFVKLIDTFEAQYIAIANDETLFTFFTNKEAPKYKVVRVDLKEPSNWT  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVI E EKDVL +A AVN +QLVV+Y+SDVK +LQ+RD+++G +L H LP+DIG+V G+ 
Sbjct  342   DVIAEHEKDVLSTASAVNGDQLVVSYMSDVKHILQIRDLKSGSLL-HRLPVDIGSVYGVF  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+     FT+FL P +IY+C+L  + P++ +FREI+VPGFDR  F V+QVF  SKD
Sbjct  401   ARRKDTTFLFMFTSFLTPGVIYKCDLSHEAPKVTVFREISVPGFDRTGFEVSQVFYPSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ KDI LDGS+PCLL+GYGGFS S TP+FS  R+V+++HLG +FC ANIRG
Sbjct  461   GTKIPMFIVARKDIKLDGSHPCLLYGYGGFSDSTTPFFSATRIVLSRHLGAVFCFANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHK+GALA KQNCFDDFI  AEYL++AG+TQP KLCIEG SNGG+L+GACINQ
Sbjct  521   GGEYGEEWHKSGALASKQNCFDDFISGAEYLVSAGYTQPRKLCIEGSSNGGILVGACINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAW S+FGCSD E+EFHWLIKYSPLHNV+RPWEQ
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWVSEFGCSDKEDEFHWLIKYSPLHNVKRPWEQ  640

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
              T +  QYPSTMLLTADHDDRVVPLHT+K LA M
Sbjct  641   KTDRFVQYPSTMLLTADHDDRVVPLHTYKLLATM  674


 Score = 93.2 bits (230),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+ L  S  N+PQTNP++ RIE  AGHG GRPTQK+IDEAADRY+FMAK++ A W
Sbjct  670  LLATMQYELSLSLENSPQTNPLIARIEVKAGHGAGRPTQKMIDEAADRYSFMAKMVDASW  729

Query  225  IE  220
            I+
Sbjct  730  ID  731



>ref|XP_006435285.1| hypothetical protein CICLE_v10000298mg [Citrus clementina]
 gb|ESR48525.1| hypothetical protein CICLE_v10000298mg [Citrus clementina]
Length=762

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/455 (72%), Positives = 390/455 (86%), Gaps = 3/455 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGT QSEDILCWKD ++P+++ S  VTEDG+Y ++ I ENCDPVNKVY CDLSALP 
Sbjct  252   YHFLGTKQSEDILCWKDPEHPKYIFSGHVTEDGQYLVMCIEENCDPVNKVYYCDLSALPE  311

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G++  D LLPF K++D F+A Y  +AND+ VFTF TNK+APKYK++RVD+KEP  W 
Sbjct  312   GLEGFKKRDGLLPFVKLIDGFDAQYEVIANDDTVFTFLTNKDAPKYKIIRVDLKEPNDWF  371

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             +VI E E+DVLESA AVN NQ++V+YLSDVK VLQ+RD++ G +L H LPI+IG+VN IS
Sbjct  372   EVIPEAERDVLESATAVNLNQMIVSYLSDVKYVLQIRDLKNGSLL-HQLPIEIGSVNAIS  430

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+DS+VFI FT+FLIP I+YQCNL+++ PE+KIFRE  +PGFDR+ F+V QVFV SKD
Sbjct  431   ARREDSVVFISFTSFLIPGIVYQCNLKTETPEMKIFRETIIPGFDRSEFHVHQVFVPSKD  490

Query  1048  G-VKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIR  872
             G  KIPMFIVS K+I LDGS+PCLL+GYGGF+ SVTP FS +R ++ +HLG +FC+ANIR
Sbjct  491   GSTKIPMFIVSKKNIKLDGSHPCLLYGYGGFNISVTPSFSVSRTILMRHLGAVFCIANIR  550

Query  871   GGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACIN  692
             GGGEYGEEWHK GALAKKQNCFDDFI A+EYLI+AG+TQ  KLCIEGGSNGGLL+GACIN
Sbjct  551   GGGEYGEEWHKGGALAKKQNCFDDFISASEYLISAGYTQSRKLCIEGGSNGGLLVGACIN  610

Query  691   QRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE  512
             QRPDLFGCALAHVGVMDMLR+HKFTIGHAW SDFGCS+ EEEF+WLIKYSPLHNVRRPWE
Sbjct  611   QRPDLFGCALAHVGVMDMLRYHKFTIGHAWVSDFGCSEEEEEFYWLIKYSPLHNVRRPWE  670

Query  511   QT-HQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             Q   +  QYPST+LLTADHDDRVVPLH+ K LA M
Sbjct  671   QNPDKPFQYPSTLLLTADHDDRVVPLHSLKLLATM  705


 Score =   108 bits (271),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS  N+PQTNPI+GRIER AGHG G PTQK+IDEAADRY FMAK+LGA W
Sbjct  701  LLATMQYVLCTSLENSPQTNPIIGRIERKAGHGVGLPTQKMIDEAADRYGFMAKMLGASW  760

Query  225  IE  220
            +E
Sbjct  761  VE  762



>ref|XP_010477278.1| PREDICTED: prolyl endopeptidase-like isoform X1 [Camelina sativa]
Length=733

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/454 (70%), Positives = 383/454 (84%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS+D+LCW+D DNP+HM  + VT+DGKY ++ I E CDPVNKVY CDLS+LP 
Sbjct  222   YHFLGTDQSQDVLCWRDQDNPKHMFGSKVTDDGKYLIMSIEEGCDPVNKVYHCDLSSLPK  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+RG++ LLPF K++D FEA Y  +ANDE +FTF TNK APKYK+VRVD+KEP  W 
Sbjct  282   GLEGFRGSNALLPFVKLIDTFEAQYIAIANDETLFTFFTNKEAPKYKVVRVDLKEPSNWT  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVI E EKDVL +A AVN +QLVV+Y+SDVK +LQ+RD+++G +L H LP+DIG+V G+ 
Sbjct  342   DVIAEHEKDVLSTASAVNGDQLVVSYMSDVKHILQIRDLKSGSLL-HRLPVDIGSVYGVF  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+     FT+FL P +IY+C+L  + P++ +FREI+VPGFDR  F V+QVF  SKD
Sbjct  401   ARRKDTTFLFMFTSFLTPGVIYKCDLSHEAPKVTVFREISVPGFDRTGFEVSQVFYPSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ KDI LDGS+PCLL+GYGGFS S TP+FS  R+V+++HLG +FC ANIRG
Sbjct  461   GTKIPMFIVARKDIKLDGSHPCLLYGYGGFSDSTTPFFSATRIVLSRHLGAVFCFANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHK+GALA KQNCFDDFI  AEYL++AG+TQP KLCIEG SNGG+L+GACINQ
Sbjct  521   GGEYGEEWHKSGALASKQNCFDDFISGAEYLVSAGYTQPRKLCIEGSSNGGILVGACINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAW S+FGCSD E+EFHWLIKYSPLHNV+RPWEQ
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWVSEFGCSDKEDEFHWLIKYSPLHNVKRPWEQ  640

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
              T +  QYPSTMLLTADHDDRVVPLHT+K LA M
Sbjct  641   KTDRFVQYPSTMLLTADHDDRVVPLHTYKLLATM  674


 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQK-LIDEAADRYAFM  250
            L+ TMQ+ L  S  N+PQTNP++ RIE  AGHG GRPTQK LID  + R  +M
Sbjct  670  LLATMQYELSLSLENSPQTNPLIARIEVKAGHGAGRPTQKMLIDIRSWRRWWM  722



>ref|XP_010459719.1| PREDICTED: prolyl endopeptidase-like [Camelina sativa]
Length=731

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/454 (70%), Positives = 384/454 (85%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS+D+LCW+D DNP+HM  + VT+DGKY ++ I E CDPVNKVY CDLS+LP 
Sbjct  222   YHFLGTDQSQDVLCWRDQDNPKHMFGSKVTDDGKYLIMSIEEGCDPVNKVYHCDLSSLPK  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+RG++ LLPF K++D FEA Y  +ANDE +FTF TNK+APKYK+VRVD+KEP  W 
Sbjct  282   GLEGFRGSNALLPFVKLIDTFEAQYIAIANDETLFTFFTNKDAPKYKVVRVDLKEPSNWT  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVI E EKDVL +A AVN +QLVV+Y+SDVK +LQ+RD+++G +L H LP+DIG+V G+ 
Sbjct  342   DVIAEHEKDVLSTASAVNGDQLVVSYMSDVKHILQIRDLKSGSLL-HRLPVDIGSVYGVI  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+     FT+FL P +IY+C+L  + P++ +FREI+VPGFDR +F V+QVF  SKD
Sbjct  401   ARRKDTTFLFMFTSFLTPGVIYKCDLSHEAPKVTVFREISVPGFDRTAFEVSQVFYPSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
               KIPMFIV+ KDI LDGS+PCLL+GYGGFS S TP+FS  R+V+++HLGV+FC ANIRG
Sbjct  461   RTKIPMFIVARKDIKLDGSHPCLLYGYGGFSDSTTPFFSATRIVLSRHLGVVFCFANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYG EWHK+GALA KQNCFDDFI  AEYL++AG+TQP KLCIEG SNGG+LIGACINQ
Sbjct  521   GGEYGVEWHKSGALASKQNCFDDFISGAEYLVSAGYTQPRKLCIEGSSNGGILIGACINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAW S+FGCSD E+EFHWLIKYSPLHNV+RPWEQ
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWVSEFGCSDKEDEFHWLIKYSPLHNVKRPWEQ  640

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
              T +  QYPSTMLLTADHDDRVVPLHT+K LA M
Sbjct  641   KTDRFVQYPSTMLLTADHDDRVVPLHTYKLLATM  674


 Score = 93.2 bits (230),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+ L  S  N+PQTNP++ RIE  AGHG GRPTQK+IDEAADRY+FMAK++ A W
Sbjct  670  LLATMQYELSLSLENSPQTNPLIARIEVKAGHGAGRPTQKMIDEAADRYSFMAKMVDASW  729

Query  225  IE  220
            I+
Sbjct  730  ID  731



>ref|XP_006435284.1| hypothetical protein CICLE_v10000298mg [Citrus clementina]
 gb|ESR48524.1| hypothetical protein CICLE_v10000298mg [Citrus clementina]
Length=819

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/455 (72%), Positives = 390/455 (86%), Gaps = 3/455 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGT QSEDILCWKD ++P+++ S  VTEDG+Y ++ I ENCDPVNKVY CDLSALP 
Sbjct  309   YHFLGTKQSEDILCWKDPEHPKYIFSGHVTEDGQYLVMCIEENCDPVNKVYYCDLSALPE  368

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G++  D LLPF K++D F+A Y  +AND+ VFTF TNK+APKYK++RVD+KEP  W 
Sbjct  369   GLEGFKKRDGLLPFVKLIDGFDAQYEVIANDDTVFTFLTNKDAPKYKIIRVDLKEPNDWF  428

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             +VI E E+DVLESA AVN NQ++V+YLSDVK VLQ+RD++ G +L H LPI+IG+VN IS
Sbjct  429   EVIPEAERDVLESATAVNLNQMIVSYLSDVKYVLQIRDLKNGSLL-HQLPIEIGSVNAIS  487

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+DS+VFI FT+FLIP I+YQCNL+++ PE+KIFRE  +PGFDR+ F+V QVFV SKD
Sbjct  488   ARREDSVVFISFTSFLIPGIVYQCNLKTETPEMKIFRETIIPGFDRSEFHVHQVFVPSKD  547

Query  1048  G-VKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIR  872
             G  KIPMFIVS K+I LDGS+PCLL+GYGGF+ SVTP FS +R ++ +HLG +FC+ANIR
Sbjct  548   GSTKIPMFIVSKKNIKLDGSHPCLLYGYGGFNISVTPSFSVSRTILMRHLGAVFCIANIR  607

Query  871   GGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACIN  692
             GGGEYGEEWHK GALAKKQNCFDDFI A+EYLI+AG+TQ  KLCIEGGSNGGLL+GACIN
Sbjct  608   GGGEYGEEWHKGGALAKKQNCFDDFISASEYLISAGYTQSRKLCIEGGSNGGLLVGACIN  667

Query  691   QRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE  512
             QRPDLFGCALAHVGVMDMLR+HKFTIGHAW SDFGCS+ EEEF+WLIKYSPLHNVRRPWE
Sbjct  668   QRPDLFGCALAHVGVMDMLRYHKFTIGHAWVSDFGCSEEEEEFYWLIKYSPLHNVRRPWE  727

Query  511   QT-HQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             Q   +  QYPST+LLTADHDDRVVPLH+ K LA M
Sbjct  728   QNPDKPFQYPSTLLLTADHDDRVVPLHSLKLLATM  762


 Score =   108 bits (271),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS  N+PQTNPI+GRIER AGHG G PTQK+IDEAADRY FMAK+LGA W
Sbjct  758  LLATMQYVLCTSLENSPQTNPIIGRIERKAGHGVGLPTQKMIDEAADRYGFMAKMLGASW  817

Query  225  IE  220
            +E
Sbjct  818  VE  819



>ref|XP_004499318.1| PREDICTED: prolyl endopeptidase-like [Cicer arietinum]
Length=729

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/455 (73%), Positives = 384/455 (84%), Gaps = 3/455 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS+DILCW+D  +P++   A+VT+DG Y L+ I E CD VNK+Y  DLS L N
Sbjct  219   YHFLGTDQSQDILCWRDPHSPKYRFEATVTDDGNYVLLNIQEGCDSVNKIYYFDLSQLSN  278

Query  1588  GLQGYRGTDE-LLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCW  1412
             GLQG+R  +   LPF K++D+F+A Y  +AND+ VFTF TNK+APKYKLVRVD+KEP  W
Sbjct  279   GLQGFRNENSSFLPFVKLIDNFDAKYQAIANDDTVFTFLTNKDAPKYKLVRVDLKEPNTW  338

Query  1411  CDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGI  1232
              DVIQE EKDVLESA  VN NQL+V YLSDVK VLQ+RD+ TG  L H LPIDIGTV  I
Sbjct  339   TDVIQESEKDVLESAYVVNGNQLIVCYLSDVKCVLQVRDLETGS-LQHQLPIDIGTVYQI  397

Query  1231  SARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSK  1052
             SA+R+D+++FIGFT+FL   IIYQC+L + +P++KIFREI VPGFDR+ F V QVF  SK
Sbjct  398   SAQREDNVIFIGFTSFLTLGIIYQCDLGTHIPDIKIFREIVVPGFDRSEFRVNQVFAPSK  457

Query  1051  DGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIR  872
             DG KIPMFIV+ KDI LDGS+PCLL+GYGGF+ S+TPYFS +R+V+AKHLG +FC+ANIR
Sbjct  458   DGTKIPMFIVAKKDIILDGSHPCLLYGYGGFNISLTPYFSVSRIVLAKHLGSVFCIANIR  517

Query  871   GGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACIN  692
             GGGEYGEEWHKAG+LA KQNCFDDFI AAEYL++AG+TQP KLCIEGGSNGGLL+GACIN
Sbjct  518   GGGEYGEEWHKAGSLANKQNCFDDFISAAEYLVSAGYTQPKKLCIEGGSNGGLLVGACIN  577

Query  691   QRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE  512
             QRPDLFGCALAHVGVMDMLRFHKFTIGHAWTS+FGCSD EEEFHWLIKYSPLHNVRR WE
Sbjct  578   QRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSEFGCSDKEEEFHWLIKYSPLHNVRRAWE  637

Query  511   Q-THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             +   ++ QYPSTMLLTADHDDRVVPLH+ K LA M
Sbjct  638   EHPDKSIQYPSTMLLTADHDDRVVPLHSLKLLATM  672


 Score = 96.3 bits (238),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VL  S   +PQTNPI+ RIE  AGHG GRPTQK IDEAADRY FMAK+L AHW
Sbjct  668  LLATMQYVLVNSLDKSPQTNPIIARIECKAGHGAGRPTQKTIDEAADRYGFMAKMLEAHW  727

Query  225  IE  220
            IE
Sbjct  728  IE  729



>emb|CDY69652.1| BnaCnng64630D [Brassica napus]
Length=728

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/472 (68%), Positives = 388/472 (82%), Gaps = 6/472 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS+DILCW+D +NP++M  A VT+DGKY ++ I E CDPVNK+Y CDLS+L  
Sbjct  219   YHFLGTDQSQDILCWRDHENPKYMFGAEVTDDGKYLIMSIGEGCDPVNKLYYCDLSSLSG  278

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+ +RG+   LPF K++D F+A Y  ++NDE +FTF TNK+APKYKLVRVD+KEP  W 
Sbjct  279   GLESFRGSSTFLPFTKLIDSFDAQYIVISNDETLFTFLTNKDAPKYKLVRVDLKEPTSWT  338

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVI+E EKDVLESA  VN N+LVV Y+SDVK +LQ+RD+ +G +L H L +DIG+V+ +S
Sbjct  339   DVIEEHEKDVLESACVVNGNRLVVCYMSDVKHILQIRDLESGSLL-HQLDVDIGSVSDVS  397

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+  F  FT++L P +IY+C+L +  PE+K+FRE+ VPGFDR +F  TQVF  SKD
Sbjct  398   ARRKDNAFFFSFTSYLTPGVIYKCDLANGSPEVKVFREVDVPGFDREAFQATQVFYPSKD  457

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ K I LDGS+PCLL+ YGGF+ S+TP FS +R+V++KHLGV+FC ANIRG
Sbjct  458   GTKIPMFIVAKKGIKLDGSHPCLLYAYGGFNISITPSFSASRIVLSKHLGVVFCFANIRG  517

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LAKKQNCFDDFI  AEYL++AG+TQPSKLCIEGGSNGGLLIGACINQ
Sbjct  518   GGEYGEEWHKAGSLAKKQNCFDDFIAGAEYLVSAGYTQPSKLCIEGGSNGGLLIGACINQ  577

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE-  512
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCS+NE+EFHWLIKYSPLHNV+RPWE 
Sbjct  578   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSENEKEFHWLIKYSPLHNVKRPWEQ  637

Query  511   QTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHS  356
             QT    QYPSTMLLTADHDDRVVPLH+ K LA M     H  C   + S  +
Sbjct  638   QTGSLVQYPSTMLLTADHDDRVVPLHSLKLLATMQ----HVLCTSLENSPQT  685


 Score =   105 bits (261),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQHVLCTS  N+PQTNPI+GRIE  AGHG GRPTQK+IDEAADRY+FMAK++ A W
Sbjct  667  LLATMQHVLCTSLENSPQTNPIIGRIEVKAGHGAGRPTQKIIDEAADRYSFMAKMVNASW  726

Query  225  IE  220
             E
Sbjct  727  TE  728



>ref|XP_009128156.1| PREDICTED: prolyl endopeptidase-like [Brassica rapa]
Length=792

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/472 (68%), Positives = 388/472 (82%), Gaps = 6/472 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS+DILCW+D +NP++M  A VT+DGKY ++ I E CDPVNK+Y CDLS+L  
Sbjct  283   YHFLGTDQSQDILCWRDHENPKYMFGAEVTDDGKYLIMSIGEGCDPVNKLYYCDLSSLSG  342

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+ +RG+   LPF K++D F+A Y  ++NDE +FTF TNK+APKYKLVRVD+KEP  W 
Sbjct  343   GLESFRGSSTFLPFTKLIDSFDAQYIVISNDETLFTFLTNKDAPKYKLVRVDLKEPTSWT  402

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVI+E EKDVLESA  VN NQLVV Y+SDVK +L +RD+ +G +L H L +DIG+V+ +S
Sbjct  403   DVIEEHEKDVLESACVVNGNQLVVCYMSDVKHILHIRDLESGSLL-HQLDVDIGSVSDVS  461

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+  F  FT++L P +IY+C+L +  PE+K+FRE+ VPGFDR +F  TQVF  SKD
Sbjct  462   ARRKDNAFFFSFTSYLTPGVIYKCDLANGSPEVKVFREVAVPGFDREAFQATQVFYPSKD  521

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ K I LDGS+PCLL+ YGGF+ S+TP FS +R+V++KHLGV+FC ANIRG
Sbjct  522   GTKIPMFIVAKKGIKLDGSHPCLLYAYGGFNISITPSFSASRIVLSKHLGVVFCFANIRG  581

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LAKKQNCFDDFI  AEYL++AG+TQPSKLCIEGGSNGGLLIGACINQ
Sbjct  582   GGEYGEEWHKAGSLAKKQNCFDDFISGAEYLVSAGYTQPSKLCIEGGSNGGLLIGACINQ  641

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCS+NEEEFHWLIKYSPLHNV+RPW+Q
Sbjct  642   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSENEEEFHWLIKYSPLHNVKRPWDQ  701

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHS  356
              T  + QYPSTMLLTADHDDRVVPLH+ K LA M     H  C   + S  +
Sbjct  702   KTDSSVQYPSTMLLTADHDDRVVPLHSLKLLATMQ----HVLCTSLENSPQT  749


 Score =   105 bits (262),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQHVLCTS  N+PQTNPI+GRIE  AGHG GRPTQK+IDEAADRY+FMAK++ A W
Sbjct  731  LLATMQHVLCTSLENSPQTNPIIGRIEVKAGHGAGRPTQKIIDEAADRYSFMAKMVNASW  790

Query  225  IE  220
             E
Sbjct  791  TE  792



>ref|XP_006416406.1| hypothetical protein EUTSA_v10006924mg [Eutrema salsugineum]
 gb|ESQ34759.1| hypothetical protein EUTSA_v10006924mg [Eutrema salsugineum]
Length=731

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/454 (72%), Positives = 387/454 (85%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQSED+LCW+D +NP+HM  + VT+DGKY ++ I E CDPVNKVY CDLS+LP+
Sbjct  222   YHFLGTDQSEDVLCWRDQENPKHMFGSKVTDDGKYLIMTIEEGCDPVNKVYHCDLSSLPH  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+RG++ LLPF K++D F+A Y  +ANDE +FTF TNK+APKYKLVRVD+KEP  W 
Sbjct  282   GLEGFRGSNALLPFVKLIDTFDAQYIAIANDETLFTFFTNKDAPKYKLVRVDLKEPSNWT  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVI E EKDVL +A  VN NQLVV+Y+SDVK +LQ+RD+++G +L H LP+DIG+V G+ 
Sbjct  342   DVIAEHEKDVLSTACVVNGNQLVVSYMSDVKHILQIRDLKSGSLL-HRLPVDIGSVGGVF  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+  F  FT+FL P +IY+C+L ++ PE+ +FREI VPGFDR +F VTQVF  SKD
Sbjct  401   ARRKDTTFFFRFTSFLTPGVIYKCDLSNEAPEVTVFREIAVPGFDRTAFQVTQVFYPSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ KDI LDGS+PCLL+ YGGFSAS+TP+FS  R+V+++HLG +FC ANIRG
Sbjct  461   GTKIPMFIVARKDIELDGSHPCLLYAYGGFSASMTPFFSATRIVLSRHLGAVFCFANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHK+GALA KQ CFDDFI  AEYL++AG+TQP KLCIEG SNGG+LIGACINQ
Sbjct  521   GGEYGEEWHKSGALANKQKCFDDFISGAEYLVSAGYTQPRKLCIEGSSNGGILIGACINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTS+FGCSD EEEFHWLIKYSPLHNV+RPWEQ
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSEFGCSDKEEEFHWLIKYSPLHNVKRPWEQ  640

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
              T +  QYPSTMLLTADHDDRVVPLHTFK LA M
Sbjct  641   KTDRFVQYPSTMLLTADHDDRVVPLHTFKLLATM  674


 Score = 94.7 bits (234),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+ L  S  N+PQTNPIV RIE  AGHG GRPTQK+IDEAADRYAFMAK++ A W
Sbjct  670  LLATMQYELGLSLENSPQTNPIVARIEVKAGHGAGRPTQKMIDEAADRYAFMAKMVDASW  729

Query  225  IE  220
            I+
Sbjct  730  ID  731



>ref|XP_010667346.1| PREDICTED: prolyl endopeptidase-like [Beta vulgaris subsp. vulgaris]
Length=820

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/454 (71%), Positives = 381/454 (84%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS DILCWKD +NP+H   A VT+DGKY L+Y  E+C+ VNKVY  DL+ LPN
Sbjct  311   YHFLGTDQSADILCWKDPENPKHSFGAEVTDDGKYLLLYTSESCEVVNKVYYLDLTTLPN  370

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             G++G R   +LLPF K+VD F+A+Y  VAND+ VFTFRTNK+AP+YKLVRVD+K P  W 
Sbjct  371   GIEGSRAEKDLLPFIKLVDTFDAAYDAVANDDTVFTFRTNKDAPRYKLVRVDLKTPEIWT  430

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ + EKDVLESA AVN+N L+V YL+DVK VL++RD+ +G +L HNLP++IG+V+ IS
Sbjct  431   DVVPQSEKDVLESAYAVNSNHLLVCYLNDVKHVLEVRDLESGSLL-HNLPLEIGSVDDIS  489

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKDS++F  F +FL P IIY+C+L S  PE+ IFREI VP FDR  F V QVFV SKD
Sbjct  490   ARRKDSVIFFRFASFLSPGIIYKCDLNSNAPEMAIFREIVVPKFDRDEFQVDQVFVSSKD  549

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ K I LDGS+PCLL+GYGGF+ S+TP F  +R+V+ KHLG +FC+ANIRG
Sbjct  550   GTKIPMFIVARKGIVLDGSHPCLLYGYGGFNISITPSFGVSRIVLLKHLGAVFCIANIRG  609

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAGALAKKQNCFDDFI AAE+L++ G+TQP KLCIEGGSNGGLL+GACINQ
Sbjct  610   GGEYGEEWHKAGALAKKQNCFDDFISAAEFLVSNGYTQPKKLCIEGGSNGGLLVGACINQ  669

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPD+FGCALAHVGVMDMLRFHKFTIGHAWTSD+GCSD EEEFHWLIKYSPLHNVRRPWE+
Sbjct  670   RPDIFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSDKEEEFHWLIKYSPLHNVRRPWEE  729

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
              T  + QYP+TMLLTADHDDRVVPLH+ K LA M
Sbjct  730   STDHSAQYPATMLLTADHDDRVVPLHSLKLLATM  763


 Score =   102 bits (255),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQHVLCTS  ++PQ NPI+GRIE  AGHG GRPTQK+IDEAADRY+FMAK++ A W
Sbjct  759  LLATMQHVLCTSLEDSPQKNPIIGRIECKAGHGAGRPTQKMIDEAADRYSFMAKMVNASW  818

Query  225  IE  220
            I+
Sbjct  819  ID  820



>gb|KEH40256.1| prolyl oligopeptidase-like protein [Medicago truncatula]
Length=788

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/454 (73%), Positives = 389/454 (86%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS+DILCW+D  NP++M  ASVT+DGKY L+ I E CDPVNK+Y  DLS LPN
Sbjct  279   YHFLGTDQSQDILCWRDPHNPKYMFGASVTDDGKYVLLSIEEGCDPVNKIYYFDLSELPN  338

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+R     L F K++D F+A Y  +AND+AVFTF TNK+APKYKLVRVD++EP  W 
Sbjct  339   GLEGFRNKHSFLTFVKLIDDFDAKYQPIANDDAVFTFLTNKDAPKYKLVRVDLREPNTWT  398

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVIQE EKDVL SA  VN+NQL+V+YLSDVK VLQ+R+++TG  L H LPIDIGTV  IS
Sbjct  399   DVIQESEKDVLGSAYVVNSNQLIVSYLSDVKYVLQVRNLQTGS-LQHQLPIDIGTVGEIS  457

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             A+R+DS+ F  FT+FL P IIYQCNL +++P++KIFREI VPGFDR+ F+V QVF  SKD
Sbjct  458   AQREDSVFFFSFTSFLTPGIIYQCNLGTRIPDVKIFREIVVPGFDRSDFHVNQVFAPSKD  517

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIVS KDI L+GS+PCLL+GYGGF+ S+TP+FS +R+V+A+HLG + C+ANIRG
Sbjct  518   GTKIPMFIVSRKDIILNGSHPCLLYGYGGFNVSLTPFFSVSRIVLARHLGSVICIANIRG  577

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+L+KKQNCFDDFI AAEYL++AG+TQP KLCIEGGSNGGLL+GACINQ
Sbjct  578   GGEYGEEWHKAGSLSKKQNCFDDFISAAEYLVSAGYTQPKKLCIEGGSNGGLLVGACINQ  637

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSD EEEFHWLIKYSPLHNVRRPWEQ
Sbjct  638   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDKEEEFHWLIKYSPLHNVRRPWEQ  697

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                ++ QYPSTMLLTADHDDRVVPLH+ K LA +
Sbjct  698   HPDKSIQYPSTMLLTADHDDRVVPLHSLKLLATL  731


 Score = 94.4 bits (233),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+Q+VL TS   +PQTNPI+ RIE  AGHG GRPTQK IDEAADRY FMAK+L A W
Sbjct  727  LLATLQYVLVTSLDKSPQTNPIIARIECKAGHGAGRPTQKTIDEAADRYGFMAKMLEARW  786

Query  225  IE  220
            IE
Sbjct  787  IE  788



>ref|XP_010918173.1| PREDICTED: prolyl endopeptidase [Elaeis guineensis]
Length=804

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/454 (72%), Positives = 391/454 (86%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQSEDILCWKD ++P++   A VTEDGKY L+YI E CDPVNK+Y C LS+LP 
Sbjct  295   YHFLGTDQSEDILCWKDPEHPKYTFGAGVTEDGKYVLLYIDEGCDPVNKLYYCALSSLPC  354

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G +G+ E+LPF K+VD+FEA Y  VAND++ FTF TNK AP+ KLVRVD++EP  W 
Sbjct  355   GLEGLKGSTEMLPFIKLVDNFEARYEAVANDDSEFTFLTNKGAPRNKLVRVDLREPNSWT  414

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             D++ ED+KDVLESA AVN NQL+V+YLSDVK VLQ+RD++TG +L+H LPIDIGTV GIS
Sbjct  415   DILPEDQKDVLESANAVNGNQLLVSYLSDVKYVLQIRDLKTGTLLHH-LPIDIGTVFGIS  473

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR+DS VFI FT+FL P IIY+CNL ++VPE+KIFREI+VPGFDR  F V QVFV SKD
Sbjct  474   GRREDSEVFIAFTSFLTPGIIYKCNLTTEVPEMKIFREISVPGFDRTVFEVNQVFVSSKD  533

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIVS K+I LDGS+P LL+GYGGF+ ++TP FS +R++++++LG +FC+ANIRG
Sbjct  534   GTKIPMFIVSKKNIELDGSHPALLYGYGGFNINLTPSFSVSRIILSRNLGFVFCIANIRG  593

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+L+KKQNCFDDFI  AE+LI+ G+T+  +LCIEGGSNGGLL+ ACINQ
Sbjct  594   GGEYGEEWHKAGSLSKKQNCFDDFIACAEFLISTGYTKSKRLCIEGGSNGGLLVAACINQ  653

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWT+D+G SD EEEF WLIKYSPLHNV+RPWE+
Sbjct  654   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTTDYGSSDKEEEFQWLIKYSPLHNVKRPWEK  713

Query  508   T-HQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             + +QACQYPSTMLLTADHDDRVVPLH+ K LA M
Sbjct  714   SANQACQYPSTMLLTADHDDRVVPLHSLKLLATM  747


 Score =   102 bits (253),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS  N+PQTNPI+ RIE  AGHG GRPTQK+IDEAADRY+F+AKV+G  W
Sbjct  743  LLATMQYVLCTSVENSPQTNPIIARIECKAGHGAGRPTQKMIDEAADRYSFVAKVMGLTW  802

Query  225  IE  220
            I+
Sbjct  803  ID  804



>emb|CDY55199.1| BnaCnng28400D [Brassica napus]
Length=727

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/472 (68%), Positives = 388/472 (82%), Gaps = 6/472 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS+DILCW+D +NP++M  A VT+DGKY  + I E CDPVNK+Y CDLS+L  
Sbjct  219   YHFLGTDQSQDILCWRDHENPKYMFGAEVTDDGKYLFMSIGEGCDPVNKLYYCDLSSLSG  278

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+ +RG+   LPF K++D F+A Y  ++ND+++FTF TNK+APKYKLVRVD+KEP  W 
Sbjct  279   GLESFRGSSTFLPFVKLIDTFDAQYIVISNDDSLFTFLTNKDAPKYKLVRVDLKEPTSWT  338

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVI+E EKDVLESA  VN NQLVV Y+SDVK +LQ+RD+ +G +L H L +DIG+V+ +S
Sbjct  339   DVIEEHEKDVLESACVVNRNQLVVCYMSDVKHILQIRDLESGSLL-HQLDVDIGSVSDVS  397

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+  F  FT++L P +IY+C+L +  PE+K+FRE+ VPGFDR +F  TQVF  SKD
Sbjct  398   ARRKDNAFFFSFTSYLTPGVIYKCDLANGSPEVKVFREVAVPGFDREAFQATQVFFPSKD  457

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ K I LDGS+PCLL+ YGGF+ S+TP FS +R+V++KHLGV+FC ANIRG
Sbjct  458   GTKIPMFIVAKKGIKLDGSHPCLLYAYGGFNISITPSFSASRIVLSKHLGVVFCFANIRG  517

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LAKKQNCFDDFI  AEYL++AG+TQPSKLCIEGGSNGGLLIGACINQ
Sbjct  518   GGEYGEEWHKAGSLAKKQNCFDDFISGAEYLVSAGYTQPSKLCIEGGSNGGLLIGACINQ  577

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE-  512
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCS+NE+EFHWLIKYSPLHNV+RPWE 
Sbjct  578   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSENEKEFHWLIKYSPLHNVKRPWEQ  637

Query  511   QTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHS  356
             QT    QYPSTMLLTADHDDRVVPLH+ K LA M     H  C   + S  +
Sbjct  638   QTDSLVQYPSTMLLTADHDDRVVPLHSLKLLATMQ----HVLCTSLENSPQT  685


 Score =   103 bits (256),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQHVLCTS  N+PQTNPI+GRIE  AGHG GRPTQK+IDEAADRY+FMAK++ A W
Sbjct  667  LLATMQHVLCTSLENSPQTNPIIGRIEVKAGHGAGRPTQKIIDEAADRYSFMAKMVNATW  726



>gb|KFK44154.1| hypothetical protein AALP_AA1G222100 [Arabis alpina]
Length=731

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/454 (71%), Positives = 390/454 (86%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQSED+LCW+D +NP++M  + VT+DGKY ++ I E+CDPVNKVY CDLS+LPN
Sbjct  222   YHFLGTDQSEDVLCWRDQENPKYMFGSKVTDDGKYLIMTIDESCDPVNKVYHCDLSSLPN  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+RG++ LLPF K++D F+A Y  +ANDE VFTF TNK+APKYKLVRVD+KEP  W 
Sbjct  282   GLEGFRGSNALLPFVKLIDTFDAQYIAIANDETVFTFFTNKDAPKYKLVRVDLKEPNKWT  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ E EKDVL +A AVN +QLVV+Y+SDVK +LQ+RD+++G +L H+LP+DIG+V G+ 
Sbjct  342   DVVAEHEKDVLSTACAVNGHQLVVSYMSDVKHILQIRDLKSGSLL-HSLPVDIGSVCGVF  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+  F  FT+FL P +IY+C+L ++ PE+ +FREI VPGFDR +F VTQVF  SKD
Sbjct  401   ARRKDTTFFFRFTSFLTPGVIYKCDLSNEAPEVTVFREIAVPGFDRTAFQVTQVFYPSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ K+I LDGS+PCLL+ YGGFS+S+TP+FS  R+V++ HLG +FC ANIRG
Sbjct  461   GTKIPMFIVARKEIKLDGSHPCLLYAYGGFSSSMTPFFSATRIVLSSHLGAVFCFANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHK+GALA KQNCFDDFI  AEYL++AG+TQP KLCIEG SNGG+L+GACINQ
Sbjct  521   GGEYGEEWHKSGALANKQNCFDDFISGAEYLVSAGYTQPRKLCIEGASNGGILVGACINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTS+FGCSD EEEFHWL+KYSPLHNV+RPWEQ
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSEFGCSDKEEEFHWLMKYSPLHNVKRPWEQ  640

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
              T +  QYPSTMLLTADHDDRVVPLHTFK LA M
Sbjct  641   KTDRFVQYPSTMLLTADHDDRVVPLHTFKMLATM  674


 Score = 95.9 bits (237),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            ++ TMQH L  S  N+PQTNPI+ RIE  AGHG GRPTQK+IDEAADRYAFMAK++ A W
Sbjct  670  MLATMQHELSLSLENSPQTNPIIARIEVKAGHGAGRPTQKMIDEAADRYAFMAKMVDASW  729

Query  225  IE  220
            I+
Sbjct  730  ID  731



>ref|XP_008791969.1| PREDICTED: LOW QUALITY PROTEIN: prolyl endopeptidase [Phoenix 
dactylifera]
Length=801

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/454 (71%), Positives = 389/454 (86%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQSEDILCWKD ++P++   A VTEDGKY L+YI E CDPVNK+Y CDLS+L  
Sbjct  292   YHFLGTDQSEDILCWKDPEHPKYTFGAQVTEDGKYVLLYIDEGCDPVNKLYYCDLSSLSC  351

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G +G+ E+LPF ++VD+FEA Y  VAND++ FTF TNK AP+ KLVRVD+K+P  W 
Sbjct  352   GLEGLKGSSEMLPFIQLVDNFEARYEAVANDDSEFTFLTNKGAPRNKLVRVDLKQPNSWT  411

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             D++ ED+KDVLESA AVN NQ++V+YLSDVK VLQ+RD++ G +L+H LPIDIGTV GIS
Sbjct  412   DILPEDQKDVLESAYAVNGNQILVSYLSDVKYVLQIRDLKXGTLLHH-LPIDIGTVFGIS  470

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR+DS VFIGFT+FL P IIY+CNL ++VPELKIFREI+VPGFDR  F V QVFV   D
Sbjct  471   GRREDSEVFIGFTSFLTPGIIYKCNLATEVPELKIFREISVPGFDRTVFEVKQVFVSGTD  530

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G K+PMFIVS K+I LDGS+P LL+GYGGF+ ++TP FS +R++++++LG +FC+ANIRG
Sbjct  531   GTKVPMFIVSKKNIELDGSHPALLYGYGGFNINLTPSFSVSRIILSRNLGFVFCIANIRG  590

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+L+KKQNCFDDFI  AE+LI+ G+T   +LCIEGGSNGGLL+ ACINQ
Sbjct  591   GGEYGEEWHKAGSLSKKQNCFDDFIACAEFLISNGYTNSKRLCIEGGSNGGLLVAACINQ  650

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWT+D+GCSD EEEFHWLIKYSPLHNV+RPWE+
Sbjct  651   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTTDYGCSDKEEEFHWLIKYSPLHNVKRPWEK  710

Query  508   T-HQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             + + +CQYPSTMLLTADHDDRVVPLH+ K LA M
Sbjct  711   SANPSCQYPSTMLLTADHDDRVVPLHSLKLLATM  744


 Score =   101 bits (252),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS  N+PQTNPI+GRIE  AGHG GRPTQK+IDEAADR++F+AKV+G  W
Sbjct  740  LLATMQYVLCTSVENSPQTNPIIGRIECKAGHGAGRPTQKMIDEAADRFSFVAKVMGLTW  799

Query  225  IE  220
            ++
Sbjct  800  MD  801



>emb|CDY29532.1| BnaA06g14380D [Brassica napus]
Length=731

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/454 (72%), Positives = 380/454 (84%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQSED+LCW+D DNP+HM  + VT+DGKY ++ I E CDPVNKVY CDLS+LP 
Sbjct  222   YHFLGTDQSEDVLCWRDQDNPKHMFGSKVTDDGKYLIMTIEEGCDPVNKVYHCDLSSLPK  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+GYRG+  LLPF K++D FEA Y  + NDE +FTF TNK+APKYKLVRVD+KEP  W 
Sbjct  282   GLEGYRGSKSLLPFIKLIDTFEAQYIAIGNDETLFTFFTNKDAPKYKLVRVDLKEPSTWT  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVI E EKDVL +A  VN NQLVV+Y+SDVK +LQ+RD++ G +L H LP+DIG+V G+ 
Sbjct  342   DVIPEHEKDVLSTACVVNGNQLVVSYMSDVKHILQIRDLKYGSLL-HTLPVDIGSVGGVF  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+  F  FT+FL P +IY+C+L ++ P + +FREI VPGFDR +F VTQVF  SKD
Sbjct  401   ARRKDTTFFFRFTSFLTPGVIYKCDLSNESPLVTVFREIDVPGFDRTAFQVTQVFYPSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ K+I LDGS+PCLL+ YGGFSAS+TP+FS  R+V+++HLG +FC ANIRG
Sbjct  461   GTKIPMFIVARKEIELDGSHPCLLYAYGGFSASMTPFFSATRIVLSRHLGAVFCFANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAGAL  KQNCFDDFI  AEYL++AG+TQP KLCIEG SNGG+LIGACINQ
Sbjct  521   GGEYGEEWHKAGALGNKQNCFDDFIAGAEYLVSAGYTQPRKLCIEGSSNGGILIGACINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTS+FGCSD EEEFHWLIKYSPLHNV+RPWEQ
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSEFGCSDKEEEFHWLIKYSPLHNVKRPWEQ  640

Query  508   THQA-CQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                   QYPSTMLLTADHDDRVVPLHTFK LA M
Sbjct  641   KRDGVVQYPSTMLLTADHDDRVVPLHTFKLLATM  674


 Score = 89.0 bits (219),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+ L  S  N+PQTNPI+ RIE  AGHG GRPTQK+I+EAADRY FMAK++ A W
Sbjct  670  LLATMQYELGLSLENSPQTNPIIARIEVKAGHGAGRPTQKIIEEAADRYGFMAKMVDATW  729

Query  225  IE  220
            ++
Sbjct  730  LD  731



>ref|XP_009149522.1| PREDICTED: prolyl endopeptidase [Brassica rapa]
Length=731

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/454 (72%), Positives = 380/454 (84%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQSED+LCW+D DNP+HM  + VT+DGKY ++ I E CDPVNKVY CDLS+LP 
Sbjct  222   YHFLGTDQSEDVLCWRDQDNPKHMFGSKVTDDGKYLIMTIEEGCDPVNKVYHCDLSSLPK  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+GYRG+  LLPF K++D FEA Y  + NDE +FTF TNK+APKYKLVRVD+KEP  W 
Sbjct  282   GLEGYRGSKSLLPFIKLIDTFEAQYIAIGNDETLFTFFTNKDAPKYKLVRVDLKEPSTWT  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVI E EKDVL +A  VN NQLVV+Y+SDVK +LQ+RD++ G +L H LP+DIG+V G+ 
Sbjct  342   DVIPEHEKDVLSTACVVNGNQLVVSYMSDVKHILQIRDLKYGSLL-HTLPVDIGSVGGVF  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+  F  FT+FL P +IY+C+L ++ P + +FREI VPGFDR +F VTQVF  SKD
Sbjct  401   ARRKDTTFFFRFTSFLTPGVIYKCDLSNESPLVTVFREIDVPGFDRTAFQVTQVFYPSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ K+I LDGS+PCLL+ YGGFSAS+TP+FS  R+V+++HLG +FC ANIRG
Sbjct  461   GTKIPMFIVARKEIELDGSHPCLLYAYGGFSASMTPFFSATRIVLSRHLGAVFCFANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAGAL  KQNCFDDFI  AEYL++AG+TQP KLCIEG SNGG+LIGACINQ
Sbjct  521   GGEYGEEWHKAGALGNKQNCFDDFIAGAEYLVSAGYTQPRKLCIEGSSNGGILIGACINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTS+FGCSD EEEFHWLIKYSPLHNV+RPWEQ
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSEFGCSDKEEEFHWLIKYSPLHNVKRPWEQ  640

Query  508   THQA-CQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                   QYPSTMLLTADHDDRVVPLHTFK LA M
Sbjct  641   KRDGFFQYPSTMLLTADHDDRVVPLHTFKLLATM  674


 Score = 90.9 bits (224),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+ L  S  N+PQTNPI+ RIE  AGHG GRPTQK+IDEAADRY FMAK++ A W
Sbjct  670  LLATMQYELGLSLENSPQTNPIIARIEVKAGHGAGRPTQKIIDEAADRYGFMAKMVDATW  729

Query  225  IE  220
            ++
Sbjct  730  LD  731



>ref|NP_177741.3| prolyl oligopeptidase [Arabidopsis thaliana]
 gb|AEE35801.1| prolyl oligopeptidase [Arabidopsis thaliana]
Length=795

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/454 (70%), Positives = 387/454 (85%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHF+GTDQS+DILCW+D++NP++M  A VT+DGKY ++ I E+CDPVNK+Y CD+++L  
Sbjct  286   YHFIGTDQSQDILCWRDNENPKYMFGAEVTDDGKYLIMSIGESCDPVNKLYYCDMTSLSG  345

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+ +RG+   LPF K+VD F+A Y  ++NDE +FTF TNK+APKYKLVRVD+KEP  W 
Sbjct  346   GLESFRGSSSFLPFIKLVDTFDAQYSVISNDETLFTFLTNKDAPKYKLVRVDLKEPNSWT  405

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV++E EKDVL SA AVN N LV  Y+SDVK +LQ+RD+++G +L H LP+DIG+V+ +S
Sbjct  406   DVVEEHEKDVLASACAVNGNHLVACYMSDVKHILQIRDLKSGSLL-HQLPLDIGSVSDVS  464

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+  F  FT+FL P +IY+C+L ++ PE+K+FRE+TVPGFDR +F   QVF  SKD
Sbjct  465   ARRKDNTFFFSFTSFLTPGVIYKCDLANESPEVKVFREVTVPGFDREAFQAIQVFYPSKD  524

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ KDI LDGS+PCLL+ YGGF+ S+TP FS +R+V++KHLGV+FC ANIRG
Sbjct  525   GTKIPMFIVAKKDIKLDGSHPCLLYAYGGFNISITPSFSASRIVLSKHLGVVFCFANIRG  584

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LAKKQNCFDDFI  AEYL++AG+TQPSKLCIEGGSNGGLL+GACINQ
Sbjct  585   GGEYGEEWHKAGSLAKKQNCFDDFISGAEYLVSAGYTQPSKLCIEGGSNGGLLVGACINQ  644

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE-  512
             RPDL+GCALAHVGVMDMLRFHKFTIGHAWTSD+GCS+NEEEFHWLIKYSPLHNV+RPWE 
Sbjct  645   RPDLYGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSENEEEFHWLIKYSPLHNVKRPWEQ  704

Query  511   QTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             QT    QYPSTMLLTADHDDRVVPLH+ K LA +
Sbjct  705   QTDHLVQYPSTMLLTADHDDRVVPLHSLKLLATL  738


 Score =   102 bits (253),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+QHVLCTS  N+PQ NPI+GRIE  AGHG GRPTQK+IDEAADRY+FMAK++ A W
Sbjct  734  LLATLQHVLCTSLDNSPQMNPIIGRIEVKAGHGAGRPTQKMIDEAADRYSFMAKMVNASW  793

Query  225  IE  220
             E
Sbjct  794  TE  795



>gb|KEH36278.1| prolyl oligopeptidase-like protein [Medicago truncatula]
Length=728

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/454 (70%), Positives = 382/454 (84%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS DILCWKD +NP++     VT+DGKY L+YI E CDPVNK+Y CD+S  P+
Sbjct  219   YHFLGTDQSGDILCWKDHENPKYSFGGIVTDDGKYLLLYISEGCDPVNKLYYCDMSDFPS  278

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
               + +   +  LPF K++D+F+A Y ++AND++VFTF TNK+APKYKLVRVD+++P  W 
Sbjct  279   IFESFFSANSPLPFVKLIDNFDAKYDYIANDDSVFTFLTNKDAPKYKLVRVDLEKPNTWA  338

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ E +KDVLESA AVN NQL+V+YLSDVK ++Q+RD+++G +L H LPIDIGTV  IS
Sbjct  339   DVLPESDKDVLESACAVNGNQLIVSYLSDVKHLIQVRDLKSGSLL-HELPIDIGTVYDIS  397

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+D++VFI FT+FL P I+YQCNL +  P+LKI REI VPGFDR+ F V QVF  SKD
Sbjct  398   ARREDNVVFISFTSFLSPGIVYQCNLGTGTPDLKILREIAVPGFDRSEFQVNQVFFPSKD  457

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ KDI  DGS+PCLL+GYGGF+ S+TP FS +R+V+ KHLG ++C+ANIRG
Sbjct  458   GTKIPMFIVAKKDIVFDGSHPCLLYGYGGFNISITPSFSVSRIVLTKHLGFVYCIANIRG  517

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LAKKQNCFDDFI A EYL++ G+TQP KLCIEGGSNGGLL+GAC+NQ
Sbjct  518   GGEYGEEWHKAGSLAKKQNCFDDFISAGEYLVSTGYTQPRKLCIEGGSNGGLLVGACVNQ  577

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RP+LFGCALAHVGVMDMLRFHKFTIGHAWTSD+GC+D EEEFHWLIKYSPLHNVRRPWEQ
Sbjct  578   RPELFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCADKEEEFHWLIKYSPLHNVRRPWEQ  637

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                ++ QYPSTMLLTADHDDRVVPLH+ K LA M
Sbjct  638   HPDKSIQYPSTMLLTADHDDRVVPLHSLKLLATM  671


 Score =   102 bits (255),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLC+S   +PQTNPI+GRI+  AGHG GRPT+K+IDEAADRY+FMAK+L AHW
Sbjct  667  LLATMQYVLCSSLEKSPQTNPIIGRIDCKAGHGAGRPTKKMIDEAADRYSFMAKMLEAHW  726

Query  225  IE  220
            IE
Sbjct  727  IE  728



>gb|AAL86330.1| putative prolyl endopeptidase [Arabidopsis thaliana]
Length=757

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/454 (70%), Positives = 387/454 (85%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHF+GTDQS+DILCW+D++NP++M  A VT+DGKY ++ I E+CDPVNK+Y CD+++L  
Sbjct  248   YHFIGTDQSQDILCWRDNENPKYMFGAEVTDDGKYLIMSIGESCDPVNKLYYCDMTSLSG  307

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+ +RG+   LPF K+VD F+A Y  ++NDE +FTF TNK+APKYKLVRVD+KEP  W 
Sbjct  308   GLESFRGSSSFLPFIKLVDTFDAQYSVISNDETLFTFLTNKDAPKYKLVRVDLKEPNSWT  367

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV++E EKDVL SA AVN N LV  Y+SDVK +LQ+RD+++G +L H LP+DIG+V+ +S
Sbjct  368   DVVEEHEKDVLASACAVNGNHLVACYMSDVKHILQIRDLKSGSLL-HQLPLDIGSVSDVS  426

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+  F  FT+FL P +IY+C+L ++ PE+K+FRE+TVPGFDR +F   QVF  SKD
Sbjct  427   ARRKDNTFFFSFTSFLTPGVIYKCDLANESPEVKVFREVTVPGFDREAFQAIQVFYPSKD  486

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ KDI LDGS+PCLL+ YGGF+ S+TP FS +R+V++KHLGV+FC ANIRG
Sbjct  487   GTKIPMFIVAKKDIKLDGSHPCLLYAYGGFNISITPSFSASRIVLSKHLGVVFCFANIRG  546

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LAKKQNCFDDFI  AEYL++AG+TQPSKLCIEGGSNGGLL+GACINQ
Sbjct  547   GGEYGEEWHKAGSLAKKQNCFDDFISGAEYLVSAGYTQPSKLCIEGGSNGGLLVGACINQ  606

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE-  512
             RPDL+GCALAHVGVMDMLRFHKFTIGHAWTSD+GCS+NEEEFHWLIKYSPLHNV+RPWE 
Sbjct  607   RPDLYGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSENEEEFHWLIKYSPLHNVKRPWEQ  666

Query  511   QTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             QT    QYPSTMLLTADHDDRVVPLH+ K LA +
Sbjct  667   QTDHLVQYPSTMLLTADHDDRVVPLHSLKLLATL  700


 Score =   102 bits (253),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+QHVLCTS  N+PQ NPI+GRIE  AGHG GRPTQK+IDEAADRY+FMAK++ A W
Sbjct  696  LLATLQHVLCTSLDNSPQMNPIIGRIEVKAGHGAGRPTQKMIDEAADRYSFMAKMVNASW  755

Query  225  IE  220
             E
Sbjct  756  TE  757



>ref|NP_001117606.1| prolyl oligopeptidase [Arabidopsis thaliana]
 gb|AEE35802.1| prolyl oligopeptidase [Arabidopsis thaliana]
Length=792

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/455 (70%), Positives = 388/455 (85%), Gaps = 2/455 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHF+GTDQS+DILCW+D++NP++M  A VT+DGKY ++ I E+CDPVNK+Y CD+++L  
Sbjct  286   YHFIGTDQSQDILCWRDNENPKYMFGAEVTDDGKYLIMSIGESCDPVNKLYYCDMTSLSG  345

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+ +RG+   LPF K+VD F+A Y  ++NDE +FTF TNK+APKYKLVRVD+KEP  W 
Sbjct  346   GLESFRGSSSFLPFIKLVDTFDAQYSVISNDETLFTFLTNKDAPKYKLVRVDLKEPNSWT  405

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV++E EKDVL SA AVN N LV  Y+SDVK +LQ+RD+++G +L H LP+DIG+V+ +S
Sbjct  406   DVVEEHEKDVLASACAVNGNHLVACYMSDVKHILQIRDLKSGSLL-HQLPLDIGSVSDVS  464

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+  F  FT+FL P +IY+C+L ++ PE+K+FRE+TVPGFDR +F   QVF  SKD
Sbjct  465   ARRKDNTFFFSFTSFLTPGVIYKCDLANESPEVKVFREVTVPGFDREAFQAIQVFYPSKD  524

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ KDI LDGS+PCLL+ YGGF+ S+TP FS +R+V++KHLGV+FC ANIRG
Sbjct  525   GTKIPMFIVAKKDIKLDGSHPCLLYAYGGFNISITPSFSASRIVLSKHLGVVFCFANIRG  584

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LAKKQNCFDDFI  AEYL++AG+TQPSKLCIEGGSNGGLL+GACINQ
Sbjct  585   GGEYGEEWHKAGSLAKKQNCFDDFISGAEYLVSAGYTQPSKLCIEGGSNGGLLVGACINQ  644

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE-  512
             RPDL+GCALAHVGVMDMLRFHKFTIGHAWTSD+GCS+NEEEFHWLIKYSPLHNV+RPWE 
Sbjct  645   RPDLYGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSENEEEFHWLIKYSPLHNVKRPWEQ  704

Query  511   QTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM  407
             QT    QYPSTMLLTADHDDRVVPLH+ K LA ++
Sbjct  705   QTDHLVQYPSTMLLTADHDDRVVPLHSLKLLAHVL  739


 Score = 96.7 bits (239),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -3

Query  402  VQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHWI  223
            ++ + HVLCTS  N+PQ NPI+GRIE  AGHG GRPTQK+IDEAADRY+FMAK++ A W 
Sbjct  732  LKLLAHVLCTSLDNSPQMNPIIGRIEVKAGHGAGRPTQKMIDEAADRYSFMAKMVNASWT  791

Query  222  E  220
            E
Sbjct  792  E  792



>ref|XP_006301553.1| hypothetical protein CARUB_v10021987mg [Capsella rubella]
 gb|EOA34451.1| hypothetical protein CARUB_v10021987mg [Capsella rubella]
Length=796

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/472 (68%), Positives = 390/472 (83%), Gaps = 6/472 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHF+GTDQS+DILCW+D +NP++M  A VT+DGKY ++ I E CDPVNK+Y CD+++   
Sbjct  287   YHFIGTDQSQDILCWRDHENPKYMFGAEVTDDGKYLVMSIGEGCDPVNKLYYCDMTSFSG  346

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+RG+   LPF K+VD F+A Y  ++NDE +FTF TNK+APKYKLVRVD+KEP  W 
Sbjct  347   GLEGFRGSSSFLPFIKLVDTFDAQYSVISNDETLFTFLTNKDAPKYKLVRVDLKEPNSWT  406

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV++E EKDVL SA AVN NQLV  Y+SDVK +LQ+RD+++G +L H LP+DIG+V+ +S
Sbjct  407   DVVEEHEKDVLASACAVNGNQLVACYMSDVKHILQIRDLKSGSLL-HQLPVDIGSVSDVS  465

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+  F  FT+FL P +IY+C+L ++ PE+K+FRE+TVPGFDR +F  TQVF  SKD
Sbjct  466   ARRKDNSFFFSFTSFLTPGVIYKCDLANESPEVKVFREVTVPGFDREAFQATQVFYPSKD  525

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ KDI LDGS+PCLL+ YGGF+ S+TP FS +R+V++KHLGV+FC ANIRG
Sbjct  526   GTKIPMFIVAKKDIKLDGSHPCLLYAYGGFNISITPSFSASRIVLSKHLGVVFCFANIRG  585

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LAKKQNCFDDFI   EYLI+AG+TQPSKLCIEGGSNGGLLIGACINQ
Sbjct  586   GGEYGEEWHKAGSLAKKQNCFDDFISGGEYLISAGYTQPSKLCIEGGSNGGLLIGACINQ  645

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE-  512
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCS+ EEEFHWLIKYSPLHNV+RPWE 
Sbjct  646   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSEVEEEFHWLIKYSPLHNVKRPWEQ  705

Query  511   QTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHS  356
             QT    QYPSTMLLTADHDDRVVPLH+ K LA +     H  C   + S  +
Sbjct  706   QTDNLVQYPSTMLLTADHDDRVVPLHSLKLLATLQ----HVLCTSLENSPQT  753


 Score =   105 bits (261),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+QHVLCTS  N+PQTNPI+GRIE  AGHG GRPTQK+IDEAADRYAFMAK++ A W
Sbjct  735  LLATLQHVLCTSLENSPQTNPIIGRIEVKAGHGAGRPTQKMIDEAADRYAFMAKMVNASW  794

Query  225  IE  220
             E
Sbjct  795  TE  796



>ref|NP_173463.1| Prolyl oligopeptidase family protein [Arabidopsis thaliana]
 gb|AEE29967.1| Prolyl oligopeptidase family protein [Arabidopsis thaliana]
Length=731

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/454 (71%), Positives = 382/454 (84%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQSED+LCW+D DNP+HM  + VT+DGKY ++ I E CDPVNKVY CDLS LP 
Sbjct  222   YHFLGTDQSEDVLCWRDQDNPKHMFGSKVTDDGKYLIMSIEEGCDPVNKVYHCDLSLLPK  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+RG++ LLPF K++D F+A Y  +ANDE +FTF TNK+APKYK+VRVD+KEP  W 
Sbjct  282   GLEGFRGSNTLLPFVKLIDTFDAQYIAIANDETLFTFLTNKDAPKYKVVRVDLKEPSSWT  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVI E EKDVL +A AVN +QLVV+Y+SDVK +LQ+RD+++G +L H LP+DIG+V G+ 
Sbjct  342   DVIAEHEKDVLSTASAVNGDQLVVSYMSDVKHILQIRDLKSGSLL-HGLPVDIGSVCGVF  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+  F  FT+FL P +IY C+L  + PE+ +FREI VPGFDR +F VTQVF  SKD
Sbjct  401   ARRKDTTFFFRFTSFLTPGVIYICDLSHEAPEVTVFREIGVPGFDRTAFQVTQVFYPSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G  IPMFIV+ KDI LDGS+PCLL+ YGGFS S+TP+FS  R+V+ +HLG +FC ANIRG
Sbjct  461   GTDIPMFIVARKDIKLDGSHPCLLYAYGGFSISMTPFFSATRIVLGRHLGTVFCFANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHK+GALA KQNCFDDFI  AEYL++AG+TQP KLCIEGGSNGG+L+GACINQ
Sbjct  521   GGEYGEEWHKSGALANKQNCFDDFISGAEYLVSAGYTQPRKLCIEGGSNGGILVGACINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTS+FGCSD EEEFHWLIKYSPLHNV+RPWEQ
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSEFGCSDKEEEFHWLIKYSPLHNVKRPWEQ  640

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
              T    QYPSTMLLTADHDDRVVPLH++K LA M
Sbjct  641   KTDLFFQYPSTMLLTADHDDRVVPLHSYKLLATM  674


 Score = 93.2 bits (230),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+ L  S  N+PQTNPI+ RIE  AGHG GRPTQK+IDEAADRY+FMAK++ A W
Sbjct  670  LLATMQYELGLSLENSPQTNPIIARIEVKAGHGAGRPTQKMIDEAADRYSFMAKMVDASW  729

Query  225  IE  220
            I+
Sbjct  730  ID  731



>ref|XP_006828887.1| hypothetical protein AMTR_s00001p00185410 [Amborella trichopoda]
 gb|ERM96303.1| hypothetical protein AMTR_s00001p00185410 [Amborella trichopoda]
Length=731

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/472 (68%), Positives = 386/472 (82%), Gaps = 6/472 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGT QSEDILCW+D ++P+ +  + VTEDGK+ L+ I E CDPVNK+Y CDLS LP 
Sbjct  222   YHFLGTYQSEDILCWRDPEHPKWIFGSQVTEDGKFLLLDIEEGCDPVNKLYYCDLSDLPK  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL G++G + +LPF K+VD+F+ASY  VAND+ +FTF TNK+APKYKLVRVD+KEP  W 
Sbjct  282   GLAGFKGENVMLPFVKLVDNFDASYRTVANDDTIFTFLTNKDAPKYKLVRVDLKEPNLWT  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ E E+DVLESA+ VN NQLV++YLSDVK VL  R+++TG  L H LPI+IGTV G+ 
Sbjct  342   DVVPESERDVLESAICVNGNQLVMSYLSDVKYVLHTRNLKTGHFL-HRLPIEIGTVYGVF  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RRK   +F+GFT+FL P IIYQCNL + VPE++IFREI VP FDR  F V QVFV SKD
Sbjct  401   GRRKHKEIFVGFTSFLSPGIIYQCNLDADVPEMRIFREINVPWFDRTEFQVNQVFVSSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIVS K I LDGS+PCLL+GYGGF+ S+TP FS +R+V+ +HLG +FC+ANIRG
Sbjct  461   GTKIPMFIVSKKGIPLDGSHPCLLYGYGGFNISLTPSFSVSRIVLTRHLGAVFCIANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+L+KKQNCFDDFI AAEYL++ G+TQP +LCIEGGSNGGLL+ AC+NQ
Sbjct  521   GGEYGEEWHKAGSLSKKQNCFDDFISAAEYLVSEGYTQPKRLCIEGGSNGGLLVAACMNQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGC LAHVGVMDMLRFHKFTIGHAWTSD+GCSD +EEFHWLIKYSPLHNV+RPWEQ
Sbjct  581   RPDLFGCVLAHVGVMDMLRFHKFTIGHAWTSDYGCSDKDEEFHWLIKYSPLHNVKRPWEQ  640

Query  508   TH-QACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHS  356
             ++ ++ QYP TMLLTADHDDRVVPLH+ K LA M     H  C   + S  +
Sbjct  641   SNGKSYQYPPTMLLTADHDDRVVPLHSLKLLATMQ----HVLCSSLENSPQT  688


 Score =   107 bits (266),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQHVLC+S  N+PQTNPI+ RI+R AGHG GRPTQKLIDEAADRY+FMAKVL A W
Sbjct  670  LLATMQHVLCSSLENSPQTNPIIARIDRKAGHGAGRPTQKLIDEAADRYSFMAKVLDASW  729

Query  225  IE  220
            ++
Sbjct  730  VQ  731



>gb|AAF88151.1|AC026234_2 Contains similarity to a rPOP protein from Rattus norvegicus 
gi|3043760 and is a member of the prolyl oligopeptidase family 
PF|00326. ESTs gb|AA651190, gb|H36145 come from this gene 
[Arabidopsis thaliana]
Length=739

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/454 (71%), Positives = 382/454 (84%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQSED+LCW+D DNP+HM  + VT+DGKY ++ I E CDPVNKVY CDLS LP 
Sbjct  222   YHFLGTDQSEDVLCWRDQDNPKHMFGSKVTDDGKYLIMSIEEGCDPVNKVYHCDLSLLPK  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+RG++ LLPF K++D F+A Y  +ANDE +FTF TNK+APKYK+VRVD+KEP  W 
Sbjct  282   GLEGFRGSNTLLPFVKLIDTFDAQYIAIANDETLFTFLTNKDAPKYKVVRVDLKEPSSWT  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVI E EKDVL +A AVN +QLVV+Y+SDVK +LQ+RD+++G +L H LP+DIG+V G+ 
Sbjct  342   DVIAEHEKDVLSTASAVNGDQLVVSYMSDVKHILQIRDLKSGSLL-HGLPVDIGSVCGVF  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+  F  FT+FL P +IY C+L  + PE+ +FREI VPGFDR +F VTQVF  SKD
Sbjct  401   ARRKDTTFFFRFTSFLTPGVIYICDLSHEAPEVTVFREIGVPGFDRTAFQVTQVFYPSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G  IPMFIV+ KDI LDGS+PCLL+ YGGFS S+TP+FS  R+V+ +HLG +FC ANIRG
Sbjct  461   GTDIPMFIVARKDIKLDGSHPCLLYAYGGFSISMTPFFSATRIVLGRHLGTVFCFANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHK+GALA KQNCFDDFI  AEYL++AG+TQP KLCIEGGSNGG+L+GACINQ
Sbjct  521   GGEYGEEWHKSGALANKQNCFDDFISGAEYLVSAGYTQPRKLCIEGGSNGGILVGACINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTS+FGCSD EEEFHWLIKYSPLHNV+RPWEQ
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSEFGCSDKEEEFHWLIKYSPLHNVKRPWEQ  640

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
              T    QYPSTMLLTADHDDRVVPLH++K LA M
Sbjct  641   KTDLFFQYPSTMLLTADHDDRVVPLHSYKLLATM  674


 Score = 85.9 bits (211),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 50/70 (71%), Gaps = 8/70 (11%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKL--------IDEAADRYAFM  250
            L+ TMQ+ L  S  N+PQTNPI+ RIE  AGHG GRPTQK+        IDEAADRY+FM
Sbjct  670  LLATMQYELGLSLENSPQTNPIIARIEVKAGHGAGRPTQKMCNVCELQQIDEAADRYSFM  729

Query  249  AKVLGAHWIE  220
            AK++ A WI+
Sbjct  730  AKMVDASWID  739



>ref|XP_006390231.1| hypothetical protein EUTSA_v10018135mg [Eutrema salsugineum]
 gb|ESQ27517.1| hypothetical protein EUTSA_v10018135mg [Eutrema salsugineum]
Length=711

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/472 (68%), Positives = 388/472 (82%), Gaps = 6/472 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH +GTDQS+DILCW+D +NP++M  A VT+DGKY ++ I E CDPVNK+Y CDLS+L  
Sbjct  202   YHSIGTDQSQDILCWRDHENPKYMFGAEVTDDGKYLIMSIGEGCDPVNKLYYCDLSSLSG  261

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+ +RG+   LPF K+VD  +A Y  ++NDE +FTF TNK+APKYKLVRVD+KEP  W 
Sbjct  262   GLESFRGSSSFLPFIKLVDTLDAQYSVISNDETLFTFLTNKDAPKYKLVRVDLKEPNSWT  321

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV++E +KDVL SA AVN NQLV  Y+SDVK +LQ+RD+++G +L   LP+DIG+V+ +S
Sbjct  322   DVVEEHDKDVLASACAVNGNQLVACYMSDVKHILQIRDLKSGSLLRQ-LPLDIGSVSDVS  380

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+  F  FT+FL P +IY+C+L ++ PE+K+FRE+ VPGFDR +F  TQVF  SKD
Sbjct  381   ARRKDNSFFFSFTSFLTPGVIYKCDLVNESPEVKVFREVVVPGFDREAFQATQVFYPSKD  440

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ KDI LDGS+PCLL+ YGGF+ S+TP FS +R+V++KHLGV+FC ANIRG
Sbjct  441   GTKIPMFIVAKKDIKLDGSHPCLLYAYGGFNISITPSFSASRIVLSKHLGVVFCFANIRG  500

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LAKKQNCFDDFI  AEYL++AG+TQPSKLCIEGGSNGGLLIGACINQ
Sbjct  501   GGEYGEEWHKAGSLAKKQNCFDDFISGAEYLVSAGYTQPSKLCIEGGSNGGLLIGACINQ  560

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE-  512
             RP+LFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCS+NEEEFHWLIKYSPLHNV+RPWE 
Sbjct  561   RPNLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSENEEEFHWLIKYSPLHNVKRPWEQ  620

Query  511   QTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHS  356
             QT    QYPSTMLLTADHDDRVVPLH+ K LA M     H  C   + S  +
Sbjct  621   QTDNLVQYPSTMLLTADHDDRVVPLHSLKLLATMQ----HVLCTSLENSPQT  668


 Score =   105 bits (263),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQHVLCTS  N+PQTNPI+GRIE  AGHG GRPTQK+IDEAADRY+FMAK++ A W
Sbjct  650  LLATMQHVLCTSLENSPQTNPIIGRIEVKAGHGAGRPTQKMIDEAADRYSFMAKMVNASW  709

Query  225  IE  220
             E
Sbjct  710  TE  711



>ref|XP_007017944.1| Prolyl oligopeptidase family protein [Theobroma cacao]
 gb|EOY15169.1| Prolyl oligopeptidase family protein [Theobroma cacao]
Length=734

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/454 (71%), Positives = 381/454 (84%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGT+QSEDILCW+D +NP+HM + SVT+DGKY L++I E C PVNK+Y CD+SALP 
Sbjct  225   YHFLGTNQSEDILCWRDPENPKHMFTGSVTDDGKYLLLFIDEGCGPVNKLYYCDMSALPE  284

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+   +  LPF K++D F+A Y  VAND+++FTF TNK+APKYK+VRVD+KEP  W 
Sbjct  285   GLEGFGVRNGPLPFVKLIDQFDARYLAVANDDSLFTFLTNKDAPKYKIVRVDLKEPSRWI  344

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ EDEK VLESA AVN NQ++V+Y+S+VK VLQ+RD++TG +L H LPIDIGTV GIS
Sbjct  345   DVVPEDEKAVLESACAVNGNQMIVSYMSEVKYVLQVRDLKTGSML-HKLPIDIGTVYGIS  403

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+DS V IGFT+FL P +IYQCNL  + P++ IFREI+VPGFDR    + QVFV SKD
Sbjct  404   ARREDSTVLIGFTSFLTPGVIYQCNLGIEFPKMNIFREISVPGFDRLELKINQVFVPSKD  463

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV   +  LDGS+PCLL+GYGGF+ S+TP FS +R+V+A+HLG  FC+ANIRG
Sbjct  464   GTKIPMFIVGENNNKLDGSHPCLLYGYGGFNVSLTPSFSVSRIVLARHLGAFFCIANIRG  523

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAGAL+ KQ CFDDFI AAEYL+++G+T+P KLCIEGGSNGGLL+GACINQ
Sbjct  524   GGEYGEEWHKAGALSNKQTCFDDFISAAEYLVSSGYTRPEKLCIEGGSNGGLLVGACINQ  583

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWT DFGCSD EE+FHWLIKYSPLHNVRRPWEQ
Sbjct  584   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTCDFGCSDKEEDFHWLIKYSPLHNVRRPWEQ  643

Query  508   THQA-CQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                   QY STMLLTADHDDRVVPLH+ K LA M
Sbjct  644   HPGGLTQYASTMLLTADHDDRVVPLHSLKMLATM  677


 Score =   106 bits (264),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            ++ TMQ+VLC S  N+PQTNPI+GRIE  AGHGCGRPT KLIDEAADRY+FMAK LGA W
Sbjct  673  MLATMQYVLCKSLENSPQTNPIIGRIECKAGHGCGRPTNKLIDEAADRYSFMAKALGATW  732

Query  225  IE  220
            +E
Sbjct  733  VE  734



>ref|XP_010428665.1| PREDICTED: prolyl endopeptidase-like [Camelina sativa]
Length=804

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/472 (67%), Positives = 390/472 (83%), Gaps = 6/472 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS+DILCW+D +NP+++  A VT+DGKY ++ I E CDPVNK+Y CD+++   
Sbjct  295   YHFLGTDQSQDILCWRDHENPKYLFGAEVTDDGKYLVMSISEGCDPVNKLYYCDMTSFAG  354

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+ +RG+   LPF K+VD+F+A Y  ++NDE +FTF TNK+APKYKLVRVD+KEP  W 
Sbjct  355   GLESFRGSSSFLPFIKLVDNFDAQYSVISNDETIFTFLTNKDAPKYKLVRVDLKEPNSWT  414

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV++E EKDVL SA AVN NQLV  Y+SDVK +LQ+RD+++G +L H LP+DIG+V+ +S
Sbjct  415   DVVEEHEKDVLASACAVNGNQLVACYMSDVKHILQIRDLKSGSLL-HQLPLDIGSVSDVS  473

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+  F  FT+FL P +IY+C L ++ PE+K+FRE+TVPGFD+ +F  TQVF  SKD
Sbjct  474   ARRKDNSFFFSFTSFLTPGVIYKCGLANESPEVKVFREVTVPGFDKEAFQATQVFYPSKD  533

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ K+I LDGS+PCLL+ YGGF+ S+TP FS +R+V++KHLGV+FC ANIRG
Sbjct  534   GTKIPMFIVAKKNIKLDGSHPCLLYAYGGFNISITPSFSASRIVLSKHLGVVFCFANIRG  593

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LAKKQNCFDDFI   EYL++AG+TQPSKLCIEGGSNGGLL+GACINQ
Sbjct  594   GGEYGEEWHKAGSLAKKQNCFDDFISGGEYLVSAGYTQPSKLCIEGGSNGGLLVGACINQ  653

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE-  512
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCS+NEEEFHWLIKYSPLHNV+RPWE 
Sbjct  654   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSENEEEFHWLIKYSPLHNVKRPWEQ  713

Query  511   QTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHS  356
             Q+    QYPSTMLLTADHDDRVVPLH+ K LA +     H  C   + S  +
Sbjct  714   QSDHLVQYPSTMLLTADHDDRVVPLHSLKLLATLQ----HVLCTSLENSPQT  761


 Score =   107 bits (268),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+QHVLCTS  N+PQTNPI+GRIE NAGHG GRPTQK+IDEAADRYAFMAK++ A W
Sbjct  743  LLATLQHVLCTSLENSPQTNPIIGRIEVNAGHGAGRPTQKMIDEAADRYAFMAKMVNASW  802

Query  225  IE  220
             E
Sbjct  803  TE  804



>emb|CDX87635.1| BnaA07g32380D [Brassica napus]
Length=731

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/472 (68%), Positives = 390/472 (83%), Gaps = 6/472 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHF+GTDQS+DILCW+DS+NP++M  A VT+DGK+ ++ I E CDPVNK+Y CDLS+L  
Sbjct  222   YHFIGTDQSQDILCWRDSENPKYMFGAEVTDDGKFLIMTIEEGCDPVNKLYYCDLSSLSG  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+ +RG+   LPF K+VD  +A Y  ++NDE +FTF TNK+APKYKLVRVD+KEP  W 
Sbjct  282   GLESFRGSSSFLPFIKLVDTLDAQYNVISNDETLFTFLTNKDAPKYKLVRVDLKEPNSWT  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV++E EKDVL SA AVN NQLV  Y+SDVK +LQ+RD+++G +L H LP+DIG+V+ +S
Sbjct  342   DVVEEHEKDVLASACAVNGNQLVTCYMSDVKHILQIRDMKSGSLL-HQLPLDIGSVSDVS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD   F  FT+FL P +IY+C+L ++ PE+K+FRE+ VPGFDR +F  TQVF  SKD
Sbjct  401   ARRKDDTFFFSFTSFLTPGVIYKCDLANEAPEVKVFREVAVPGFDREAFQATQVFYPSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ KDI LDGS+PCL++ YGGF+ S+TP FS +R+V++KHLG +FC+ANIRG
Sbjct  461   GTKIPMFIVAKKDIKLDGSHPCLVYAYGGFNISITPSFSASRIVLSKHLGAVFCIANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LA KQNCFDDFI  AEYL++AG+TQPSKLCIEGGSNGGLLIGACINQ
Sbjct  521   GGEYGEEWHKAGSLANKQNCFDDFISGAEYLVSAGYTQPSKLCIEGGSNGGLLIGACINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE-  512
             RPDL+GCALAHVGVMDMLRFHKFTIGHAWT+D+GCS+NEEEFHWLIKYSPLHNV+RPWE 
Sbjct  581   RPDLYGCALAHVGVMDMLRFHKFTIGHAWTTDYGCSENEEEFHWLIKYSPLHNVKRPWEQ  640

Query  511   QTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHS  356
             QT  + QYPSTMLLTADHDDRVVPLH+ K LA +     H  C   + S  +
Sbjct  641   QTGNSVQYPSTMLLTADHDDRVVPLHSLKLLATLQ----HVLCTSLENSPQT  688


 Score =   102 bits (254),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+QHVLCTS  N+PQTNPI+GRIE  AGHG GRPT+K+IDEAADRY+FMAK++ A W
Sbjct  670  LLATLQHVLCTSLENSPQTNPIIGRIEVKAGHGAGRPTKKMIDEAADRYSFMAKMVNAPW  729

Query  225  IE  220
             E
Sbjct  730  TE  731



>ref|XP_010416526.1| PREDICTED: prolyl endopeptidase-like [Camelina sativa]
Length=808

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/472 (68%), Positives = 391/472 (83%), Gaps = 6/472 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS+DILCW+D +NP+++  A VT+DGKY ++ I E CDPVNK+Y CD+++   
Sbjct  299   YHFLGTDQSQDILCWRDHENPKYLFGAEVTDDGKYLVMSISEGCDPVNKLYYCDMTSFAG  358

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GLQ +RG+   LPF K+VD+F+A Y  ++NDE +FTF TNK+APKYKLVRVD+KEP  W 
Sbjct  359   GLQSFRGSSSFLPFIKLVDNFDAQYSVISNDETLFTFLTNKDAPKYKLVRVDLKEPNNWT  418

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             +V++E EKDVL SA AVN NQLV  Y+SDVK +LQ+RD+++G +L H LP+DIG+V+ +S
Sbjct  419   NVVEEHEKDVLASACAVNGNQLVACYMSDVKHILQIRDLKSGSLL-HKLPLDIGSVSDVS  477

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+  F  FT+FL P +IY+C+L ++ PE+K+FRE+TVPGFDR +F  TQVF  SKD
Sbjct  478   ARRKDNSFFFSFTSFLTPGVIYKCDLANESPEVKVFREVTVPGFDREAFQATQVFYPSKD  537

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ K+I LDGS+PCLL+ YGGF+ S+TP FS +R+V++KHLGV+FC ANIRG
Sbjct  538   GTKIPMFIVAKKNIKLDGSHPCLLYAYGGFNISITPSFSASRIVLSKHLGVVFCFANIRG  597

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LAKKQNCFDDFI   EYL++AG+TQPSKLCIEGGSNGGLL+GACINQ
Sbjct  598   GGEYGEEWHKAGSLAKKQNCFDDFISGGEYLVSAGYTQPSKLCIEGGSNGGLLVGACINQ  657

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE-  512
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCS+NEEEFHWLIKYSPLHNV+RPWE 
Sbjct  658   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSENEEEFHWLIKYSPLHNVKRPWEQ  717

Query  511   QTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHS  356
             Q+    QYPSTMLLTADHDDRVVPLH+ K LA +     H  C   + S  +
Sbjct  718   QSDHLVQYPSTMLLTADHDDRVVPLHSLKLLATVQ----HVLCTSLENSPQT  765


 Score =   104 bits (259),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+QHVLCTS  N+PQTNPI+GRIE  AGHG GRPTQK+IDEAADRYAFMAK++ A W
Sbjct  747  LLATVQHVLCTSLENSPQTNPIIGRIEVKAGHGAGRPTQKMIDEAADRYAFMAKMVNASW  806

Query  225  IE  220
             E
Sbjct  807  TE  808



>ref|XP_011034925.1| PREDICTED: prolyl endopeptidase-like [Populus euphratica]
Length=733

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/454 (69%), Positives = 379/454 (83%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHF+G +QSEDILCW+D +NP+++  A VT+DGKY L+YI E CDPVNKVY CD+SA  +
Sbjct  224   YHFIGKNQSEDILCWRDHENPKYVFGADVTDDGKYLLLYIGEGCDPVNKVYYCDMSAFSD  283

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G++G   L PF K++D+F+A Y  +AND   FTF TNK+APKYK+VRVD+KEP  W 
Sbjct  284   GLEGFKGGKSLFPFTKLIDNFDARYHEIANDGTSFTFLTNKDAPKYKIVRVDLKEPSSWI  343

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVI E E+DVLESA AV+ ++++V+YL DVK VLQ+RD++TG +L H LPIDIG+V GIS
Sbjct  344   DVIPESERDVLESACAVDGDKMIVSYLRDVKHVLQIRDLKTGSLL-HQLPIDIGSVTGIS  402

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             A+RKDS VFI FT+FL P IIYQCNL + VP+LKIFREI+V GFDR  F+V Q+FV SKD
Sbjct  403   AQRKDSAVFIEFTSFLTPRIIYQCNLDTGVPDLKIFREISVRGFDRTEFHVDQLFVTSKD  462

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
               KIP FIV+ K+I LDGS+PCLL+GYGGF+ S+TP F+ +RLV+ +HLG +FC+ANIRG
Sbjct  463   DTKIPTFIVAKKNIKLDGSHPCLLYGYGGFNISITPSFNVSRLVLTRHLGAVFCIANIRG  522

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LA+KQNCFDDFI  +EYL++AG+T+P KLCIEGGSNGGLL+GACINQ
Sbjct  523   GGEYGEEWHKAGSLARKQNCFDDFISVSEYLVSAGYTEPKKLCIEGGSNGGLLVGACINQ  582

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAW SD+G  D +EE  WLIKYSPLHNVRRPWEQ
Sbjct  583   RPDLFGCALAHVGVMDMLRFHKFTIGHAWPSDYGWFDKKEEVGWLIKYSPLHNVRRPWEQ  642

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                Q  QYP TM+LTADHDDRVVPLH+ K LA M
Sbjct  643   HPEQPSQYPPTMILTADHDDRVVPLHSLKLLATM  676


 Score =   103 bits (258),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ++LCTS  N+PQTNPI+GRIE  AGHG GRPTQK+IDEAADRY+FMA++LGA W
Sbjct  672  LLATMQYILCTSLENSPQTNPIIGRIECKAGHGAGRPTQKMIDEAADRYSFMARMLGASW  731

Query  225  IE  220
             E
Sbjct  732  NE  733



>ref|XP_006303918.1| hypothetical protein CARUB_v10008428mg [Capsella rubella]
 gb|EOA36816.1| hypothetical protein CARUB_v10008428mg [Capsella rubella]
Length=731

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/454 (70%), Positives = 383/454 (84%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS+D+LCW+D +NP+HM  + VT+DGKY ++ I E CDPVNKV+ CDLS+LP 
Sbjct  222   YHFLGTDQSQDVLCWRDQENPKHMFGSKVTDDGKYLIMIIEEGCDPVNKVFHCDLSSLPK  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+RG+  LLPF K++D F+A Y  +ANDE  FTF TNK+ PKYKLVRVD+KEP  W 
Sbjct  282   GLEGFRGSSALLPFVKLIDTFDAQYIAIANDETFFTFFTNKDGPKYKLVRVDLKEPSIWS  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVI E E DVL +A AVN +QLVV+Y+SDVK +LQ+RD+++G +L H LP+DIG+V G+ 
Sbjct  342   DVIAEHENDVLSTASAVNGDQLVVSYMSDVKHILQIRDLKSGSLL-HRLPVDIGSVCGVF  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+  F  FT+FL P +IY+C+L  +VP++ +FREI VPGFDR +F+V+QVF  SKD
Sbjct  401   ARRKDTTFFFRFTSFLTPGMIYKCDLSHEVPKVTVFREIAVPGFDRTTFHVSQVFYPSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ KDI LDGS+PCLL+ YGGFS S+TP+FS  R+V+++HLG +FC ANIRG
Sbjct  461   GTKIPMFIVARKDIKLDGSHPCLLYAYGGFSVSMTPFFSATRIVLSRHLGAVFCFANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHK+GALA KQNCFDDFI  AEYL+++G+TQP KLCIEG SNGG+LIGACINQ
Sbjct  521   GGEYGEEWHKSGALASKQNCFDDFISGAEYLVSSGYTQPRKLCIEGSSNGGILIGACINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAW S+FGCSD EEEFHWLIKYSPLHNV+RPWEQ
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWASEFGCSDKEEEFHWLIKYSPLHNVKRPWEQ  640

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
              T +  QYPSTMLLTADHDDRVVPLHT+K LA M
Sbjct  641   KTDRFVQYPSTMLLTADHDDRVVPLHTYKLLATM  674


 Score = 92.4 bits (228),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+ L  S  N+PQTNP++ RIE  AGHG GRPTQK+IDEAADRY+FMAK++ A W
Sbjct  670  LLATMQYELGLSLENSPQTNPLIARIEVKAGHGAGRPTQKMIDEAADRYSFMAKMVDASW  729

Query  225  IE  220
            I+
Sbjct  730  ID  731



>ref|XP_010471763.1| PREDICTED: prolyl endopeptidase-like [Camelina sativa]
Length=806

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/472 (67%), Positives = 390/472 (83%), Gaps = 6/472 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS+DILCW+D +NP+++  A VT+DGKY ++ I E CDPVNK+Y CD+++   
Sbjct  297   YHFLGTDQSQDILCWRDHENPKYLFGAEVTDDGKYLVMSISEGCDPVNKLYYCDMTSFAG  356

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+ +RG+   LPF K+VD+F+A Y  ++NDE +FTF TNK+APKYKLVRVD+KEP  W 
Sbjct  357   GLESFRGSSSFLPFIKLVDNFDAQYSVISNDETLFTFLTNKDAPKYKLVRVDLKEPNSWT  416

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV++E EKDVL SA AVN NQLV  Y+SDVK +LQ+RD+++G +L H LP+DIG+V+ +S
Sbjct  417   DVVEEHEKDVLASACAVNGNQLVACYMSDVKHILQIRDLKSGSLL-HQLPLDIGSVSDVS  475

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+  F  FT+FL P +IY+C+L ++ PE+K+FRE+TVPGFDR +F  TQVF  SKD
Sbjct  476   ARRKDNSFFFSFTSFLTPGVIYKCDLANESPEVKVFREVTVPGFDREAFQATQVFYPSKD  535

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ K+I LDGS+PCLL+ YGGF+ S+TP FS +R+V++KHLGV+FC ANIRG
Sbjct  536   GTKIPMFIVAKKNIKLDGSHPCLLYAYGGFNISITPSFSASRIVLSKHLGVVFCFANIRG  595

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LAKKQNCFDDFI   EYL++AG+TQPSKLCIEGGSNGGLL+GACINQ
Sbjct  596   GGEYGEEWHKAGSLAKKQNCFDDFISGGEYLVSAGYTQPSKLCIEGGSNGGLLVGACINQ  655

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE-  512
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCS+NEEEF WLIKYSPLHNV+RPWE 
Sbjct  656   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSENEEEFQWLIKYSPLHNVKRPWEQ  715

Query  511   QTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHS  356
             Q+    QYPSTMLLTADHDDRVVPLH+ K LA +     H  C   + S  +
Sbjct  716   QSDHLVQYPSTMLLTADHDDRVVPLHSLKLLATLQ----HVLCTSLENSPQT  763


 Score =   105 bits (261),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+QHVLCTS  N+PQTNPI+GRIE  AGHG GRPTQK+IDEAADRYAFMAK++ A W
Sbjct  745  LLATLQHVLCTSLENSPQTNPIIGRIEVKAGHGAGRPTQKMIDEAADRYAFMAKMVNASW  804

Query  225  IE  220
             E
Sbjct  805  TE  806



>ref|XP_010536444.1| PREDICTED: prolyl endopeptidase-like [Tarenaya hassleriana]
Length=732

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/473 (69%), Positives = 385/473 (81%), Gaps = 7/473 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLG+DQS+DILCW+D +NP+++  A VT+DGKY ++ I E CDPVNKVY CDLS+L  
Sbjct  222   YHFLGSDQSDDILCWRDHENPKYLFEADVTDDGKYLIMAIEEGCDPVNKVYYCDLSSLEG  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GLQ + G++ LLPF K+VD F+A Y  +ANDE VFTF TNK+APKYKLVRVD+KEPG W 
Sbjct  282   GLQSFSGSNTLLPFIKLVDTFDAQYSAIANDETVFTFLTNKDAPKYKLVRVDLKEPGKWI  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVI E  KDVL SA AVN N L+V+YLSDVK VLQ+RD+++G +L H LP+DIG+V+G+ 
Sbjct  342   DVIDEHGKDVLSSACAVNGNHLIVSYLSDVKHVLQIRDLKSGSLL-HQLPLDIGSVSGVF  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKDS  F  F +FL P +IY+C+L  + P++K+FREI VPGFDRA+F  TQVF  SKD
Sbjct  401   ARRKDSSFFFSFASFLTPGVIYKCDLADETPKVKVFREIAVPGFDRAAFQATQVFYPSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
               KIPMFIV+ K I LDGS+PCLL+ YGGF+ S+TP+FS +R+V+ +HLG +FC ANIRG
Sbjct  461   RTKIPMFIVAKKGIELDGSHPCLLYAYGGFNISITPFFSVSRIVLGRHLGAVFCFANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHK GALAKKQ CFDDFI  AEYL++AG+TQP KLCIEGGSNGGLLIGACINQ
Sbjct  521   GGEYGEEWHKGGALAKKQTCFDDFISGAEYLVSAGYTQPGKLCIEGGSNGGLLIGACINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE-  512
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTS+FGCSD EEEFHWLI+YSPLHNV+RPWE 
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSEFGCSDKEEEFHWLIRYSPLHNVKRPWEE  640

Query  511   -QTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHS  356
              QT +  QYPSTMLLTADHDDRVVPLH+ K LA M     H  C   + S  +
Sbjct  641   QQTGRFVQYPSTMLLTADHDDRVVPLHSLKLLATMQ----HVLCTSLENSPQT  689


 Score =   103 bits (257),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQHVLCTS  N+PQT PI+ RIE  AGHG GRPTQK+IDEAADRY FMAK+L A W
Sbjct  671  LLATMQHVLCTSLENSPQTKPIISRIEVKAGHGAGRPTQKMIDEAADRYGFMAKMLDASW  730

Query  225  IE  220
            IE
Sbjct  731  IE  732



>ref|XP_006493142.1| PREDICTED: prolyl endopeptidase-like, partial [Citrus sinensis]
Length=564

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/455 (69%), Positives = 384/455 (84%), Gaps = 3/455 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGT+QSEDILCWKD ++P++  S  VTEDG+Y ++YI EN D VNKVY  DLSALP 
Sbjct  54    YHFLGTEQSEDILCWKDPEHPKYTFSGHVTEDGQYLVMYIRENFDQVNKVYYYDLSALPE  113

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+R ++ LLPF K++D F+A Y  VAND++VFTFRT+K+APKYK+VRVD++EP  W 
Sbjct  114   GLEGFRKSNGLLPFVKLIDRFDAQYEVVANDDSVFTFRTSKDAPKYKIVRVDLREPNNWS  173

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             +V+ E E+D+LESA A N NQ++++YLSDVK VLQ+RD++TG +L H LPI+IG+VN  S
Sbjct  174   EVVAEAERDMLESASAANFNQMILSYLSDVKYVLQIRDLKTGSLL-HQLPIEIGSVNAKS  232

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR DS+VFI FT+FL P IIYQCNL+++ PE+KIFRE +VPGFDR+ F+V QVFV SKD
Sbjct  233   VRRDDSVVFISFTSFLTPGIIYQCNLKTESPEMKIFRETSVPGFDRSEFHVHQVFVPSKD  292

Query  1048  G-VKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIR  872
             G  KIPMFIV+ K+I LDGS+PCLL+GYGGF+AS+TP FS +R V+ +HLG +FC+ANIR
Sbjct  293   GSTKIPMFIVAKKNIKLDGSHPCLLYGYGGFNASITPSFSVSRTVLMRHLGAVFCIANIR  352

Query  871   GGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACIN  692
             GGGEYGEEWHK GALAKKQNCFDDFI A+EYLI+AG+TQ  KLCIEG SNGGLL+GACIN
Sbjct  353   GGGEYGEEWHKDGALAKKQNCFDDFISASEYLISAGYTQSRKLCIEGESNGGLLVGACIN  412

Query  691   QRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE  512
             QRPDLFGCALAHVGVMDMLR HKFTIGHA  S++GC + +EEF WLIKYSPLHNVRRPWE
Sbjct  413   QRPDLFGCALAHVGVMDMLRLHKFTIGHAGFSEYGCPEKKEEFDWLIKYSPLHNVRRPWE  472

Query  511   QT-HQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             Q   +  QYP+T+LLTADHDDRVVPLH+ K LA M
Sbjct  473   QDPDKPSQYPATLLLTADHDDRVVPLHSLKLLATM  507


 Score =   103 bits (258),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS  N+PQTNPI+GRIE  AGHG GRPTQK+IDEAAD Y FMAK+LGA W
Sbjct  503  LLATMQYVLCTSLENSPQTNPILGRIECKAGHGAGRPTQKMIDEAADCYGFMAKMLGASW  562

Query  225  IE  220
            IE
Sbjct  563  IE  564



>ref|XP_009106269.1| PREDICTED: prolyl endopeptidase [Brassica rapa]
Length=807

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/472 (68%), Positives = 389/472 (82%), Gaps = 6/472 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHF+GTDQS+DILCW+DS+NP++M  A VT+DGK+ ++ I E CDPVNK+Y CDLS+L  
Sbjct  298   YHFIGTDQSQDILCWRDSENPKYMFGAEVTDDGKFLIMTIEEGCDPVNKLYYCDLSSLSG  357

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+ +RG+   LPF K+VD  +A Y  ++NDE +FTF TNK+APKYKLVRVD+KEP  W 
Sbjct  358   GLESFRGSSSFLPFIKLVDTLDAQYNIISNDETLFTFLTNKDAPKYKLVRVDLKEPNSWT  417

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV++E EKDVL SA AVN NQLV  Y+SDVK +LQ+RD+++G +L H LP+DIG+V+ +S
Sbjct  418   DVVEEHEKDVLASACAVNGNQLVTCYMSDVKHILQIRDMKSGSLL-HQLPLDIGSVSDVS  476

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD   F  FT+FL P +IY+C+L ++ PE+K+FRE+ VPGFDR +F  TQVF  SKD
Sbjct  477   ARRKDDTFFFSFTSFLTPGVIYKCDLANEAPEVKVFREVAVPGFDREAFQATQVFYPSKD  536

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ KDI LDGS+PCLL+ YGGF+ S+TP FS +R+V++KHLG +FC+ANIRG
Sbjct  537   GTKIPMFIVAKKDIKLDGSHPCLLYAYGGFNISITPSFSASRIVLSKHLGAVFCIANIRG  596

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LA KQNCFDDFI  AEYL++AG+TQPSKLCIEGGSNGGLLIGACINQ
Sbjct  597   GGEYGEEWHKAGSLANKQNCFDDFISGAEYLVSAGYTQPSKLCIEGGSNGGLLIGACINQ  656

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE-  512
             RPDL+GCALAHVGVMDMLRFHKFTIGHAWT+D+GCS+NEEEFHWLIKYSPLHNV+RPWE 
Sbjct  657   RPDLYGCALAHVGVMDMLRFHKFTIGHAWTTDYGCSENEEEFHWLIKYSPLHNVKRPWEQ  716

Query  511   QTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHS  356
             QT    QYPSTMLLTADHDDRVVPLH+ K LA +     H  C   + S  +
Sbjct  717   QTGTLVQYPSTMLLTADHDDRVVPLHSLKLLATLQ----HVLCTSLENSPQT  764


 Score =   102 bits (253),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+QHVLCTS  N+PQTNPI+GRIE  AGHG GRPT+K+IDEAADRY+FMAK++ A W
Sbjct  746  LLATLQHVLCTSLENSPQTNPIIGRIEVKAGHGAGRPTKKMIDEAADRYSFMAKMVNAPW  805

Query  225  IE  220
             E
Sbjct  806  TE  807



>emb|CDY31465.1| BnaC05g15740D [Brassica napus]
Length=721

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/455 (71%), Positives = 378/455 (83%), Gaps = 3/455 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFL TDQSED+LCW+D DNP+HM  + VT+DGKY ++ I E CDPVNKVY CDLS+LP 
Sbjct  211   YHFLETDQSEDVLCWRDQDNPKHMFGSKVTDDGKYLIMTIEEGCDPVNKVYHCDLSSLPK  270

Query  1588  -GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCW  1412
              GL+GYRG+  LLPF K++D FEA Y  +ANDE +F F TNK+APKYKLVRVD+ EP  W
Sbjct  271   LGLEGYRGSKSLLPFIKLIDTFEAQYIAIANDETLFNFFTNKDAPKYKLVRVDLNEPSTW  330

Query  1411  CDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGI  1232
              DVI E EKDVL +A  VN NQLVV+Y+SDVK +LQ+RD+ +G +L H LP+DIG+V G+
Sbjct  331   NDVIPEHEKDVLSTACVVNGNQLVVSYMSDVKHILQIRDLESGSLL-HTLPVDIGSVGGV  389

Query  1231  SARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSK  1052
              ARRKD+  F  FT+FL P +IY+C+L ++ P + +FREI VPGFDR +F VTQVF  SK
Sbjct  390   FARRKDTTFFFRFTSFLTPGVIYKCDLSNEAPLVTVFREIDVPGFDRTAFQVTQVFYPSK  449

Query  1051  DGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIR  872
             DG KIPMFIV+ K+I LDGS+PCLL+ YGGFSAS+TP+FS  R+V+++HLG +FC ANIR
Sbjct  450   DGTKIPMFIVARKEIELDGSHPCLLYAYGGFSASMTPFFSATRIVLSRHLGAVFCFANIR  509

Query  871   GGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACIN  692
             GGGEYGEEWHKAGAL  KQNCFDDFI  AEYL++AG+TQP KLCIEG SNGG+LIGACIN
Sbjct  510   GGGEYGEEWHKAGALGNKQNCFDDFIAGAEYLVSAGYTQPKKLCIEGSSNGGILIGACIN  569

Query  691   QRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE  512
             QRPDLFGCALAHVGVMDMLRFHKFTIGHAWTS+FGCSD EEEFHWLIKYSPLHNV+RPWE
Sbjct  570   QRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSEFGCSDKEEEFHWLIKYSPLHNVKRPWE  629

Query  511   QTHQA-CQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             Q      QYPSTMLLTADHDDRVVPLHTFK LA M
Sbjct  630   QKRDGFVQYPSTMLLTADHDDRVVPLHTFKLLATM  664


 Score = 90.9 bits (224),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+ L  S  N+PQTNPI+ RIE  AGHG GRPTQK+IDEAADRY FMAK++ A W
Sbjct  660  LLATMQYELGLSLENSPQTNPIIARIEVKAGHGAGRPTQKIIDEAADRYGFMAKMVDATW  719

Query  225  IE  220
            ++
Sbjct  720  LD  721



>ref|XP_006390232.1| hypothetical protein EUTSA_v10018135mg [Eutrema salsugineum]
 gb|ESQ27518.1| hypothetical protein EUTSA_v10018135mg [Eutrema salsugineum]
Length=804

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/472 (68%), Positives = 388/472 (82%), Gaps = 6/472 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH +GTDQS+DILCW+D +NP++M  A VT+DGKY ++ I E CDPVNK+Y CDLS+L  
Sbjct  295   YHSIGTDQSQDILCWRDHENPKYMFGAEVTDDGKYLIMSIGEGCDPVNKLYYCDLSSLSG  354

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+ +RG+   LPF K+VD  +A Y  ++NDE +FTF TNK+APKYKLVRVD+KEP  W 
Sbjct  355   GLESFRGSSSFLPFIKLVDTLDAQYSVISNDETLFTFLTNKDAPKYKLVRVDLKEPNSWT  414

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV++E +KDVL SA AVN NQLV  Y+SDVK +LQ+RD+++G +L   LP+DIG+V+ +S
Sbjct  415   DVVEEHDKDVLASACAVNGNQLVACYMSDVKHILQIRDLKSGSLLRQ-LPLDIGSVSDVS  473

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+  F  FT+FL P +IY+C+L ++ PE+K+FRE+ VPGFDR +F  TQVF  SKD
Sbjct  474   ARRKDNSFFFSFTSFLTPGVIYKCDLVNESPEVKVFREVVVPGFDREAFQATQVFYPSKD  533

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ KDI LDGS+PCLL+ YGGF+ S+TP FS +R+V++KHLGV+FC ANIRG
Sbjct  534   GTKIPMFIVAKKDIKLDGSHPCLLYAYGGFNISITPSFSASRIVLSKHLGVVFCFANIRG  593

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LAKKQNCFDDFI  AEYL++AG+TQPSKLCIEGGSNGGLLIGACINQ
Sbjct  594   GGEYGEEWHKAGSLAKKQNCFDDFISGAEYLVSAGYTQPSKLCIEGGSNGGLLIGACINQ  653

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE-  512
             RP+LFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCS+NEEEFHWLIKYSPLHNV+RPWE 
Sbjct  654   RPNLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSENEEEFHWLIKYSPLHNVKRPWEQ  713

Query  511   QTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHS  356
             QT    QYPSTMLLTADHDDRVVPLH+ K LA M     H  C   + S  +
Sbjct  714   QTDNLVQYPSTMLLTADHDDRVVPLHSLKLLATMQ----HVLCTSLENSPQT  761


 Score =   105 bits (262),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQHVLCTS  N+PQTNPI+GRIE  AGHG GRPTQK+IDEAADRY+FMAK++ A W
Sbjct  743  LLATMQHVLCTSLENSPQTNPIIGRIEVKAGHGAGRPTQKMIDEAADRYSFMAKMVNASW  802

Query  225  IE  220
             E
Sbjct  803  TE  804



>ref|XP_006478474.1| PREDICTED: prolyl endopeptidase-like isoform X1 [Citrus sinensis]
Length=732

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/455 (70%), Positives = 384/455 (84%), Gaps = 3/455 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGT+QSEDILCWKD ++P++  S  VTEDG+Y ++YI EN D VNKVY  DLSALP 
Sbjct  222   YHFLGTEQSEDILCWKDPEHPKYTFSGHVTEDGQYLVMYIRENFDQVNKVYYYDLSALPE  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+R ++ LLPF K++D F+A Y  VAND++VFTFRT+K+APKYK+VRVD++EP  W 
Sbjct  282   GLEGFRKSNGLLPFVKLIDRFDAQYEVVANDDSVFTFRTSKDAPKYKIVRVDLREPNNWS  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             +V+ E E+D+LESA A N NQ++++YLSDVK VLQ+RD++TG +L H LPI+IG+VN  S
Sbjct  342   EVVAEAERDMLESASAANFNQMILSYLSDVKYVLQIRDLKTGSLL-HQLPIEIGSVNAKS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR DS+VFI FT+FL P IIYQCNL+++ PE+KIFRE +VPGFDR+ F+V QVFV SKD
Sbjct  401   VRRDDSVVFISFTSFLTPGIIYQCNLKTESPEMKIFRETSVPGFDRSEFHVHQVFVPSKD  460

Query  1048  G-VKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIR  872
             G  KIPMFIV+ K+I LDGS+PCLL+GYGGF+AS+TP FS +R V+ +HLG +FC+ANIR
Sbjct  461   GSTKIPMFIVAKKNIKLDGSHPCLLYGYGGFNASITPSFSVSRTVLMRHLGAVFCIANIR  520

Query  871   GGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACIN  692
             GGGEYGEEWHK GALAKKQNCFDDFI A+EYLI+AG+TQ  KLCIEG SNGGLLIGACIN
Sbjct  521   GGGEYGEEWHKDGALAKKQNCFDDFISASEYLISAGYTQSRKLCIEGESNGGLLIGACIN  580

Query  691   QRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE  512
             QRPDLFGCALAHVGVMDMLR HKFTIGHA  S++GC + +EEF WLIKYSPLHNVRRPWE
Sbjct  581   QRPDLFGCALAHVGVMDMLRLHKFTIGHAGFSEYGCPEKKEEFDWLIKYSPLHNVRRPWE  640

Query  511   QT-HQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             Q   +  QYPST+LLTADHDDRVVPLH+ K LA M
Sbjct  641   QDPDKPSQYPSTLLLTADHDDRVVPLHSLKLLATM  675


 Score =   104 bits (259),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS  N+PQTNPI+GRIE  AGHG GRPTQK+IDEAAD Y FMAK+LGA W
Sbjct  671  LLATMQYVLCTSLENSPQTNPILGRIECKAGHGAGRPTQKMIDEAADCYGFMAKMLGASW  730

Query  225  IE  220
            IE
Sbjct  731  IE  732



>ref|XP_006478476.1| PREDICTED: prolyl endopeptidase-like isoform X3 [Citrus sinensis]
Length=732

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/455 (70%), Positives = 384/455 (84%), Gaps = 3/455 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGT+QSEDILCWKD ++P++  S  VTEDG+Y ++YI EN D VNKVY  DLSALP 
Sbjct  222   YHFLGTEQSEDILCWKDPEHPKYTFSGHVTEDGQYLVMYIRENFDQVNKVYYYDLSALPE  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+R ++ LLPF K++D F+A Y  VAND++VFTFRT+K+APKYK+VRVD++EP  W 
Sbjct  282   GLEGFRKSNGLLPFVKLIDRFDAQYEVVANDDSVFTFRTSKDAPKYKIVRVDLREPNNWS  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             +V+ E E+D+LESA A N NQ++++YLSDVK VLQ+RD++TG +L H LPI+IG+VN  S
Sbjct  342   EVVAEAERDMLESASAANFNQMILSYLSDVKYVLQIRDLKTGSLL-HQLPIEIGSVNAKS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR DS+VFI FT+FL P IIYQCNL+++ PE+KIFRE +VPGFDR+ F+V QVFV SKD
Sbjct  401   VRRDDSVVFISFTSFLTPGIIYQCNLKTESPEMKIFRETSVPGFDRSEFHVHQVFVPSKD  460

Query  1048  G-VKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIR  872
             G  KIPMFIV+ K+I LDGS+PCLL+GYGGF+AS+TP FS +R V+ +HLG +FC+ANIR
Sbjct  461   GSTKIPMFIVAKKNIKLDGSHPCLLYGYGGFNASITPSFSVSRTVLMRHLGAVFCIANIR  520

Query  871   GGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACIN  692
             GGGEYGEEWHK GALAKKQNCFDDFI A+EYLI+AG+TQ  KLCIEG SNGGLLIGACIN
Sbjct  521   GGGEYGEEWHKDGALAKKQNCFDDFISASEYLISAGYTQSRKLCIEGESNGGLLIGACIN  580

Query  691   QRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE  512
             QRPDLFGCALAHVGVMDMLR HKFTIGHA  S++GC + +EEF WLIKYSPLHNVRRPWE
Sbjct  581   QRPDLFGCALAHVGVMDMLRLHKFTIGHAGFSEYGCPEKKEEFDWLIKYSPLHNVRRPWE  640

Query  511   QT-HQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             Q   +  QYPST+LLTADHDDRVVPLH+ K LA M
Sbjct  641   QDPDKPSQYPSTLLLTADHDDRVVPLHSLKLLATM  675


 Score =   104 bits (259),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS  N+PQTNPI+GRIE  AGHG GRPTQK+IDEAAD Y FMAK+LGA W
Sbjct  671  LLATMQYVLCTSLENSPQTNPILGRIECKAGHGAGRPTQKMIDEAADCYGFMAKMLGASW  730

Query  225  IE  220
            IE
Sbjct  731  IE  732



>ref|XP_006478479.1| PREDICTED: prolyl endopeptidase-like isoform X1 [Citrus sinensis]
Length=732

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/455 (70%), Positives = 384/455 (84%), Gaps = 3/455 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGT+QSEDILCWKD ++P++  S  VTEDG+Y ++YI EN D VNKVY  DLSALP 
Sbjct  222   YHFLGTEQSEDILCWKDPEHPKYTFSGHVTEDGQYLVMYIRENFDQVNKVYYYDLSALPE  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+R ++ LLPF K++D F+A Y  VAND++VFTFRT+K+APKYK+VRVD++EP  W 
Sbjct  282   GLEGFRKSNGLLPFVKLIDRFDAQYEVVANDDSVFTFRTSKDAPKYKIVRVDLREPNNWS  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             +V+ E E+D+LESA A N NQ++++YLSDVK VLQ+RD++TG +L H LPI+IG+VN  S
Sbjct  342   EVVAEAERDMLESASAANFNQMILSYLSDVKYVLQIRDLKTGSLL-HQLPIEIGSVNAKS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR DS+VFI FT+FL P IIYQCNL+++ PE+KIFRE +VPGFDR+ F+V QVFV SKD
Sbjct  401   VRRDDSVVFISFTSFLTPGIIYQCNLKTESPEMKIFRETSVPGFDRSEFHVHQVFVPSKD  460

Query  1048  G-VKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIR  872
             G  KIPMFIV+ K+I LDGS+PCLL+GYGGF+AS+TP FS +R V+ +HLG +FC+ANIR
Sbjct  461   GSTKIPMFIVAKKNIKLDGSHPCLLYGYGGFNASITPSFSVSRTVLMRHLGAVFCIANIR  520

Query  871   GGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACIN  692
             GGGEYGEEWHK GALAKKQNCFDDFI A+EYLI+AG+TQ  KLCIEG SNGGLL+GACIN
Sbjct  521   GGGEYGEEWHKDGALAKKQNCFDDFISASEYLISAGYTQSRKLCIEGESNGGLLVGACIN  580

Query  691   QRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE  512
             QRPDLFGCALAHVGVMDMLR HKFTIGHA  S++GC + +EEF WLIKYSPLHNVRRPWE
Sbjct  581   QRPDLFGCALAHVGVMDMLRLHKFTIGHAGFSEYGCPEKKEEFDWLIKYSPLHNVRRPWE  640

Query  511   QT-HQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             Q   +  QYPST+LLTADHDDRVVPLH+ K LA M
Sbjct  641   QDPDKPSQYPSTLLLTADHDDRVVPLHSLKLLATM  675


 Score =   104 bits (259),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS  N+PQTNPI+GRIE  AGHG GRPTQK+IDEAAD Y FMAK+LGA W
Sbjct  671  LLATMQYVLCTSLENSPQTNPILGRIECKAGHGAGRPTQKMIDEAADCYGFMAKMLGASW  730

Query  225  IE  220
            IE
Sbjct  731  IE  732



>ref|XP_010539814.1| PREDICTED: prolyl endopeptidase-like isoform X2 [Tarenaya hassleriana]
Length=799

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/456 (70%), Positives = 385/456 (84%), Gaps = 4/456 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS+DILCW+D DNP+++  A+VT+DGKY ++ I E CDPVNKVY CDLS++  
Sbjct  288   YHFLGTDQSQDILCWRDHDNPKYLFGANVTDDGKYLIMDIAEGCDPVNKVYYCDLSSIKG  347

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+RG++ LLPF K++D F+A Y  +ANDE VFTF TNKNAPKYKLVRVD+KEP  W 
Sbjct  348   GLEGFRGSNSLLPFVKLIDTFDAQYSAIANDETVFTFLTNKNAPKYKLVRVDLKEPSKWF  407

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVI E +KDVL SA AVN NQLVV+YLSDVK +LQ+RD+++G +L H LP+DIG+V+G+ 
Sbjct  408   DVIGEHDKDVLSSACAVNTNQLVVSYLSDVKHILQIRDLKSGSLL-HQLPLDIGSVSGVF  466

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             AR KDS  F  FT+FL P +IY+C+L ++ PE+ +FREI VP FDRA+F VTQVF  SKD
Sbjct  467   ARLKDSSFFFSFTSFLTPGVIYKCDLATEAPEVTVFREIAVPDFDRAAFQVTQVFYPSKD  526

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ K I LDGS+PCLL+ YGGF+ S+TP+FS +R+V+++HLG +FC AN+RG
Sbjct  527   GTKIPMFIVAKKGIELDGSHPCLLYAYGGFNISITPFFSVSRIVLSRHLGTVFCFANLRG  586

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAGALAKKQ CFDDFI  AEYL+ AG+TQP KLCIEGGSNGGLLIGACINQ
Sbjct  587   GGEYGEEWHKAGALAKKQTCFDDFISGAEYLVTAGYTQPGKLCIEGGSNGGLLIGACINQ  646

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTS++GCSD E+EFHWLIKYSPLHNV+RPWE+
Sbjct  647   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSEYGCSDKEDEFHWLIKYSPLHNVKRPWEE  706

Query  508   TH---QACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                  +  QYP TMLLTADHDDRVVPLH+ K+LA M
Sbjct  707   QRTDSRLVQYPPTMLLTADHDDRVVPLHSLKFLATM  742


 Score = 95.9 bits (237),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + TMQ+ LC S   +PQTNPIVGRIE  AGHG GR TQK+I+EAADRYAFMAK LGA W
Sbjct  738  FLATMQYELCMSLDESPQTNPIVGRIEVKAGHGAGRSTQKMIEEAADRYAFMAKTLGASW  797

Query  225  IE  220
            I+
Sbjct  798  ID  799



>ref|XP_010539813.1| PREDICTED: prolyl endopeptidase-like isoform X1 [Tarenaya hassleriana]
Length=800

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/456 (70%), Positives = 385/456 (84%), Gaps = 4/456 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS+DILCW+D DNP+++  A+VT+DGKY ++ I E CDPVNKVY CDLS++  
Sbjct  289   YHFLGTDQSQDILCWRDHDNPKYLFGANVTDDGKYLIMDIAEGCDPVNKVYYCDLSSIKG  348

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+RG++ LLPF K++D F+A Y  +ANDE VFTF TNKNAPKYKLVRVD+KEP  W 
Sbjct  349   GLEGFRGSNSLLPFVKLIDTFDAQYSAIANDETVFTFLTNKNAPKYKLVRVDLKEPSKWF  408

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVI E +KDVL SA AVN NQLVV+YLSDVK +LQ+RD+++G +L H LP+DIG+V+G+ 
Sbjct  409   DVIGEHDKDVLSSACAVNTNQLVVSYLSDVKHILQIRDLKSGSLL-HQLPLDIGSVSGVF  467

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             AR KDS  F  FT+FL P +IY+C+L ++ PE+ +FREI VP FDRA+F VTQVF  SKD
Sbjct  468   ARLKDSSFFFSFTSFLTPGVIYKCDLATEAPEVTVFREIAVPDFDRAAFQVTQVFYPSKD  527

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ K I LDGS+PCLL+ YGGF+ S+TP+FS +R+V+++HLG +FC AN+RG
Sbjct  528   GTKIPMFIVAKKGIELDGSHPCLLYAYGGFNISITPFFSVSRIVLSRHLGTVFCFANLRG  587

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAGALAKKQ CFDDFI  AEYL+ AG+TQP KLCIEGGSNGGLLIGACINQ
Sbjct  588   GGEYGEEWHKAGALAKKQTCFDDFISGAEYLVTAGYTQPGKLCIEGGSNGGLLIGACINQ  647

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTS++GCSD E+EFHWLIKYSPLHNV+RPWE+
Sbjct  648   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSEYGCSDKEDEFHWLIKYSPLHNVKRPWEE  707

Query  508   TH---QACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                  +  QYP TMLLTADHDDRVVPLH+ K+LA M
Sbjct  708   QRTDSRLVQYPPTMLLTADHDDRVVPLHSLKFLATM  743


 Score = 95.9 bits (237),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + TMQ+ LC S   +PQTNPIVGRIE  AGHG GR TQK+I+EAADRYAFMAK LGA W
Sbjct  739  FLATMQYELCMSLDESPQTNPIVGRIEVKAGHGAGRSTQKMIEEAADRYAFMAKTLGASW  798

Query  225  IE  220
            I+
Sbjct  799  ID  800



>ref|XP_006478475.1| PREDICTED: prolyl endopeptidase-like isoform X2 [Citrus sinensis]
Length=732

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/455 (70%), Positives = 384/455 (84%), Gaps = 3/455 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGT+QSEDILCWKD ++P++  S  VTEDG+Y ++YI EN D VNKVY  DLSALP 
Sbjct  222   YHFLGTEQSEDILCWKDPEHPKYTFSGHVTEDGQYLVMYIRENFDQVNKVYYYDLSALPE  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+R ++ LLPF K++D F+A Y  VAND++VFTFRT+K+APKYK+VRVD++EP  W 
Sbjct  282   GLEGFRKSNGLLPFVKLIDRFDAQYEVVANDDSVFTFRTSKDAPKYKIVRVDLREPNNWS  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             +V+ E E+D+LESA A N NQ++++YLSDVK VLQ+RD++TG +L H LPI+IG+VN  S
Sbjct  342   EVVAEAERDMLESASAANFNQMILSYLSDVKYVLQIRDLKTGSLL-HQLPIEIGSVNAKS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR DS+VFI FT+FL P IIYQCNL+++ PE+KIFRE +VPGFDR+ F+V QVFV SKD
Sbjct  401   VRRDDSVVFISFTSFLTPGIIYQCNLKTESPEMKIFRETSVPGFDRSEFHVHQVFVPSKD  460

Query  1048  G-VKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIR  872
             G  KIPMFIV+ K+I LDGS+PCLL+GYGGF+AS+TP FS +R V+ +HLG +FC+ANIR
Sbjct  461   GSTKIPMFIVAKKNIKLDGSHPCLLYGYGGFNASITPSFSVSRTVLMRHLGAVFCIANIR  520

Query  871   GGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACIN  692
             GGGEYGEEWHK GALAKKQNCFDDFI A+EYLI+AG+TQ  KLCIEG SNGGLLIGACIN
Sbjct  521   GGGEYGEEWHKDGALAKKQNCFDDFISASEYLISAGYTQSRKLCIEGESNGGLLIGACIN  580

Query  691   QRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE  512
             QRPDLFGCALAHVGVMDMLR HKFTIGHA  S++GC + +EEF WLIKYSPLHNVRRPWE
Sbjct  581   QRPDLFGCALAHVGVMDMLRLHKFTIGHAGFSEYGCPEKKEEFDWLIKYSPLHNVRRPWE  640

Query  511   QT-HQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             Q   +  QYPST+LLTADHDDRVVPLH+ K LA M
Sbjct  641   QDPDKPSQYPSTLLLTADHDDRVVPLHSLKLLATM  675


 Score =   104 bits (259),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS  N+PQTNPI+GRIE  AGHG GRPTQK+IDEAAD Y FMAK+LGA W
Sbjct  671  LLATMQYVLCTSLENSPQTNPILGRIECKAGHGAGRPTQKMIDEAADCYGFMAKMLGASW  730

Query  225  IE  220
            IE
Sbjct  731  IE  732



>ref|XP_006441995.1| hypothetical protein CICLE_v10019028mg [Citrus clementina]
 gb|ESR55235.1| hypothetical protein CICLE_v10019028mg [Citrus clementina]
Length=732

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/455 (70%), Positives = 383/455 (84%), Gaps = 3/455 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGT+QSEDILCWKD ++P++  S  VTEDG+Y ++YI EN D VNKVY  DLSALP 
Sbjct  222   YHFLGTEQSEDILCWKDPEHPKYTFSGHVTEDGQYLVMYIRENFDQVNKVYYYDLSALPE  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+R ++ LLPF K++D F+A Y  VAND++VFTFRT+K+APKYK+VRVD++EP  W 
Sbjct  282   GLEGFRKSNGLLPFVKLMDRFDAQYEVVANDDSVFTFRTSKDAPKYKIVRVDLREPNNWS  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             +V+ E E+DVLESA A N NQ++++YLSDVK VLQ+RD++TG +L H LPI+IG+VN  S
Sbjct  342   EVVPEAERDVLESASAANFNQMILSYLSDVKYVLQIRDLKTGSLL-HQLPIEIGSVNAKS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR DS+VFI FT+FL P IIYQCNL S+ PE+KIFR+ +VPGFDR+ F+V QVFV SKD
Sbjct  401   VRRDDSVVFISFTSFLTPGIIYQCNLISETPEMKIFRDTSVPGFDRSEFHVHQVFVPSKD  460

Query  1048  G-VKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIR  872
             G  KIPMFIV+ KDI LDGS+PCLL+GYGGF+AS+TP FS +R V+ +HLG +FC+ANIR
Sbjct  461   GSTKIPMFIVAKKDIKLDGSHPCLLYGYGGFNASITPSFSVSRTVLMRHLGAVFCIANIR  520

Query  871   GGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACIN  692
             GGGEYGEEWHK GALAKKQNCFDDFI A++YLI+AG+TQ  KLCIEG SNGGLLIGACIN
Sbjct  521   GGGEYGEEWHKDGALAKKQNCFDDFISASQYLISAGYTQSRKLCIEGESNGGLLIGACIN  580

Query  691   QRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE  512
             QRPDLFGCALAHVGVMDMLR HKFTIGHA  S++GC + +EEF WLIKYSPLHNVRRPWE
Sbjct  581   QRPDLFGCALAHVGVMDMLRLHKFTIGHAGFSEYGCPEKKEEFDWLIKYSPLHNVRRPWE  640

Query  511   QT-HQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             Q   +  QYPST+LLTADHDDRVVPLH+ K LA M
Sbjct  641   QDPDKPSQYPSTLLLTADHDDRVVPLHSLKLLATM  675


 Score =   100 bits (248),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS  N+PQTNPI+G IE  AGHG GRPTQK+IDE+AD Y FMAK+LGA W
Sbjct  671  LLATMQYVLCTSLENSPQTNPILGLIECKAGHGAGRPTQKMIDESADCYGFMAKMLGASW  730

Query  225  IE  220
            IE
Sbjct  731  IE  732



>dbj|BAJ96495.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=776

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/487 (67%), Positives = 387/487 (79%), Gaps = 12/487 (2%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LG+DQSEDILCWKD +NP+H + ASVTEDGKY ++  ++ CDPVNK+Y C++S+LP 
Sbjct  267   YHILGSDQSEDILCWKDPENPKHSLGASVTEDGKYIILGTYDGCDPVNKLYYCEISSLPQ  326

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             G++G+R T E+LPF K++D+F+A Y  VAND   FTF TNKNAPK KLVRV++K P  W 
Sbjct  327   GIEGFRDTKEMLPFVKLIDNFDAQYQVVANDGDEFTFLTNKNAPKNKLVRVNIKTPEVWT  386

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ E E+DVLESA AVN NQLVV Y+SDVK  LQ+RD+ TG  L H LP++IG+V+ IS
Sbjct  387   DVLPEHERDVLESADAVNGNQLVVCYMSDVKHTLQIRDLTTGNFL-HQLPLEIGSVSEIS  445

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR+D  VFIGFT+FL P IIY+CNL S +PE+K FREI+VPGFDR SF V Q+FV SKD
Sbjct  446   CRREDKEVFIGFTSFLSPGIIYRCNLASTIPEMKTFREISVPGFDRTSFEVKQIFVPSKD  505

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFI+S KDI LDGS+P LL+GYGGF+ S+TP FS +RLV+ K++G + C+ANIRG
Sbjct  506   GTKIPMFIMSKKDIELDGSHPTLLYGYGGFNISITPSFSVSRLVLCKNMGSVVCIANIRG  565

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAGALAKKQNCFDDF+  AE LI+ G+T   K+CIEGGSNGGLLI ACINQ
Sbjct  566   GGEYGEEWHKAGALAKKQNCFDDFVACAEQLISFGYTSSKKICIEGGSNGGLLIAACINQ  625

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWT+D+GCSD EEEF WLIKYSPLHNVRRPWEQ
Sbjct  626   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTTDYGCSDKEEEFGWLIKYSPLHNVRRPWEQ  685

Query  508   TH-QACQYPSTMLLTADHDDRVVPLHTFKYLAMMM----------PCPDHAACPVYKRSQ  362
             +    CQYP+TMLLTADHDDRVVPLH+ K LA M           P  +     + ++S 
Sbjct  686   SFGDNCQYPATMLLTADHDDRVVPLHSLKLLATMQHVLCTSIENSPQTNPIIGRIDRKSG  745

Query  361   HSANQPN  341
             H A +P 
Sbjct  746   HGAGRPT  752


 Score =   107 bits (267),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQHVLCTS  N+PQTNPI+GRI+R +GHG GRPT+KLIDEAADRY+FM+K+LGA W
Sbjct  715  LLATMQHVLCTSIENSPQTNPIIGRIDRKSGHGAGRPTKKLIDEAADRYSFMSKMLGATW  774

Query  225  IE  220
             E
Sbjct  775  TE  776



>ref|XP_003570892.1| PREDICTED: prolyl endopeptidase-like [Brachypodium distachyon]
Length=775

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/454 (69%), Positives = 381/454 (84%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH +G+DQSEDILCWKD DNP++ I ASVTEDGKY ++  ++ CDPVNK+Y C++S+LP 
Sbjct  266   YHVMGSDQSEDILCWKDPDNPKYTIGASVTEDGKYIILGTYDGCDPVNKLYYCEISSLPQ  325

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             G++G++ T ++LPF K++D+F+A Y  VAND   FTF TNKNAPK KLVRV++K+P  W 
Sbjct  326   GIEGFKETKDMLPFVKLIDNFDAQYQVVANDGDEFTFLTNKNAPKNKLVRVNIKKPELWT  385

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ E E+DVLESA AVN NQLVV Y+SDVK  LQ+RD+ TG +LN  LP++IG+V+ +S
Sbjct  386   DVLAEHERDVLESADAVNGNQLVVCYMSDVKHTLQIRDLITGNLLNQ-LPLEIGSVSEVS  444

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR+D  VFIGFT+FL P I Y+CNL S  PE+K+FREI+VPGFDR SF V Q+FV SKD
Sbjct  445   CRREDKEVFIGFTSFLSPGITYRCNLSSTTPEMKVFREISVPGFDRTSFEVKQIFVPSKD  504

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFI+S KDI LDGS+P LL+GYGGF+ S+TP FS +RLV+ K++G + C+ANIRG
Sbjct  505   GTKIPMFIMSKKDIELDGSHPTLLYGYGGFNISITPSFSVSRLVLCKNMGSVVCIANIRG  564

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAGALAKKQNCFDDFI  AE+LI+AG+T   K+CIEGGSNGGLL+ ACINQ
Sbjct  565   GGEYGEEWHKAGALAKKQNCFDDFIACAEFLISAGYTSNKKICIEGGSNGGLLVAACINQ  624

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWT+D+GCSD EEEF+WLIKYSPLHNVR+PWEQ
Sbjct  625   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTTDYGCSDKEEEFNWLIKYSPLHNVRKPWEQ  684

Query  508   TH-QACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             +    CQYP+TMLLTADHDDRVVPLH+ K LA +
Sbjct  685   SFGNHCQYPATMLLTADHDDRVVPLHSLKLLATL  718


 Score = 99.0 bits (245),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+Q+VLCTS  +T QTNPI+GRI+R +GHG GRPT+K+IDEAADRY+FMAK+LG  W
Sbjct  714  LLATLQYVLCTSNEDTRQTNPIIGRIDRKSGHGAGRPTKKMIDEAADRYSFMAKMLGTTW  773

Query  225  IE  220
             E
Sbjct  774  TE  775



>ref|XP_002887627.1| prolyl oligopeptidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63886.1| prolyl oligopeptidase [Arabidopsis lyrata subsp. lyrata]
Length=794

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/472 (68%), Positives = 388/472 (82%), Gaps = 7/472 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS+DILCW+D +NP++M  A VT+DGKY  + I E+CDPVNK+Y CD+++   
Sbjct  286   YHFLGTDQSQDILCWRDHENPKYMFGAEVTDDGKYLFMSIGESCDPVNKLYYCDMTSFSG  345

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+ +RG+   LPF K+VD F+A Y  ++NDE +FTF TNK+APKYKLV VD+KEP  W 
Sbjct  346   GLESFRGSSSFLPFIKLVDTFDAQYSVISNDETLFTFLTNKDAPKYKLVLVDLKEPNSWT  405

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV++E EKDVL SA AVN N LV  Y+SDVK +LQ+RD+++G +L H LP+DIG+V+ +S
Sbjct  406   DVVEEHEKDVLASACAVNGNHLVACYMSDVKHILQIRDLKSGSLL-HQLPLDIGSVSDVS  464

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+  F  FT+FL P +IY+C+L ++ PE+K+FRE+TVPGFDR +F   QVF  SKD
Sbjct  465   ARRKDNTFFFSFTSFLTPGVIYKCDLANESPEVKVFREVTVPGFDREAFQAIQVFYPSKD  524

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ KDI LDGS+PCLL+ YGGF+ S+TP FS +R+V++KHLGV+FC+ANIRG
Sbjct  525   GTKIPMFIVAKKDIKLDGSHPCLLYAYGGFNISITPSFSASRIVLSKHLGVVFCVANIRG  584

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LAKKQNCFDDFI  AEYL++AG+TQPSKLCIEGGSNGGLLIGACINQ
Sbjct  585   GGEYGEEWHKAGSLAKKQNCFDDFISGAEYLVSAGYTQPSKLCIEGGSNGGLLIGACINQ  644

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE-  512
               +LFGCALAHVGVMDMLRFHKFTIGHAWTSD+GCS+NEEEFHWLIKYSPLHNV+RPWE 
Sbjct  645   -ANLFGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSENEEEFHWLIKYSPLHNVKRPWEQ  703

Query  511   QTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHS  356
             QT Q  QYPSTMLLTADHDDRVVPLH+ K LA +     H  C   + S  +
Sbjct  704   QTDQFIQYPSTMLLTADHDDRVVPLHSLKLLATLQ----HVLCTSLENSPQT  751


 Score =   103 bits (257),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+QHVLCTS  N+PQTNPI+GRIE  AGHG GRPTQK+IDEAADRY+FMAK++ A W
Sbjct  733  LLATLQHVLCTSLENSPQTNPIIGRIEVKAGHGAGRPTQKMIDEAADRYSFMAKMVNAAW  792

Query  225  IE  220
             E
Sbjct  793  TE  794



>ref|XP_009401895.1| PREDICTED: prolyl endopeptidase-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=735

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/487 (64%), Positives = 394/487 (81%), Gaps = 12/487 (2%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGT QSEDILCW+D + P+++   SVT DGK+AL++I E CDPVNK+Y CDL +LPN
Sbjct  226   YHFLGTHQSEDILCWRDPEYPKYIFGISVTNDGKFALLHITEGCDPVNKLYYCDLCSLPN  285

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+RG++E+LPF K+VD+FEA Y  VAND++ FTF TNK AP+ KLVRVD+KEP  W 
Sbjct  286   GLEGFRGSNEMLPFVKLVDNFEARYSAVANDDSEFTFLTNKGAPRCKLVRVDLKEPDLWT  345

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             D++ E E+DVLESA AVN NQ++V YL DVK +LQ+RD+ TG +L H LP+D+G+V+GIS
Sbjct  346   DILPEHERDVLESAYAVNGNQILVCYLRDVKHILQIRDMSTGDLL-HCLPLDVGSVSGIS  404

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR++S +FI FT+FL P IIY+CNL ++V E+KIF+EI++PGFDR  F+V QVFV SKD
Sbjct  405   ARRENSEIFISFTSFLSPGIIYRCNLATEVQEMKIFQEISIPGFDRTEFDVKQVFVSSKD  464

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
               ++PMFIVS K++ LDGSNP LL+GYGGF+ S+ P F  +R+V+A++LG +FCLANIRG
Sbjct  465   ATRLPMFIVSKKNLKLDGSNPTLLYGYGGFNISLKPSFHVSRVVLARNLGFVFCLANIRG  524

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+L+KKQNCF DFI AAE+L++  +T P  LCIEG SNGGLL+ AC+NQ
Sbjct  525   GGEYGEEWHKAGSLSKKQNCFHDFIAAAEFLVSNNYTNPKHLCIEGSSNGGLLVAACMNQ  584

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGC LAHVGVMDMLRFHKFTIGHAWTSD+GCSDNEEEFHWLIKYSPLHN++RPWE+
Sbjct  585   RPDLFGCVLAHVGVMDMLRFHKFTIGHAWTSDYGCSDNEEEFHWLIKYSPLHNIKRPWEK  644

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM----------PCPDHAACPVYKRSQ  362
              + ++CQYP TMLLTADHDDRVVPLH+ K LA M           P  +     + +++ 
Sbjct  645   GSGKSCQYPPTMLLTADHDDRVVPLHSLKLLATMQYILCNGVENSPQTNPIIARIDRKAG  704

Query  361   HSANQPN  341
             H A +P 
Sbjct  705   HGAGRPT  711


 Score =   104 bits (259),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ++LC    N+PQTNPI+ RI+R AGHG GRPTQKLIDEAADRY+FMAKVLG  W
Sbjct  674  LLATMQYILCNGVENSPQTNPIIARIDRKAGHGAGRPTQKLIDEAADRYSFMAKVLGVSW  733

Query  225  IE  220
            I+
Sbjct  734  ID  735



>ref|XP_009401894.1| PREDICTED: prolyl endopeptidase-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=738

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/487 (64%), Positives = 394/487 (81%), Gaps = 12/487 (2%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGT QSEDILCW+D + P+++   SVT DGK+AL++I E CDPVNK+Y CDL +LPN
Sbjct  229   YHFLGTHQSEDILCWRDPEYPKYIFGISVTNDGKFALLHITEGCDPVNKLYYCDLCSLPN  288

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+RG++E+LPF K+VD+FEA Y  VAND++ FTF TNK AP+ KLVRVD+KEP  W 
Sbjct  289   GLEGFRGSNEMLPFVKLVDNFEARYSAVANDDSEFTFLTNKGAPRCKLVRVDLKEPDLWT  348

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             D++ E E+DVLESA AVN NQ++V YL DVK +LQ+RD+ TG +L H LP+D+G+V+GIS
Sbjct  349   DILPEHERDVLESAYAVNGNQILVCYLRDVKHILQIRDMSTGDLL-HCLPLDVGSVSGIS  407

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR++S +FI FT+FL P IIY+CNL ++V E+KIF+EI++PGFDR  F+V QVFV SKD
Sbjct  408   ARRENSEIFISFTSFLSPGIIYRCNLATEVQEMKIFQEISIPGFDRTEFDVKQVFVSSKD  467

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
               ++PMFIVS K++ LDGSNP LL+GYGGF+ S+ P F  +R+V+A++LG +FCLANIRG
Sbjct  468   ATRLPMFIVSKKNLKLDGSNPTLLYGYGGFNISLKPSFHVSRVVLARNLGFVFCLANIRG  527

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+L+KKQNCF DFI AAE+L++  +T P  LCIEG SNGGLL+ AC+NQ
Sbjct  528   GGEYGEEWHKAGSLSKKQNCFHDFIAAAEFLVSNNYTNPKHLCIEGSSNGGLLVAACMNQ  587

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGC LAHVGVMDMLRFHKFTIGHAWTSD+GCSDNEEEFHWLIKYSPLHN++RPWE+
Sbjct  588   RPDLFGCVLAHVGVMDMLRFHKFTIGHAWTSDYGCSDNEEEFHWLIKYSPLHNIKRPWEK  647

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM----------PCPDHAACPVYKRSQ  362
              + ++CQYP TMLLTADHDDRVVPLH+ K LA M           P  +     + +++ 
Sbjct  648   GSGKSCQYPPTMLLTADHDDRVVPLHSLKLLATMQYILCNGVENSPQTNPIIARIDRKAG  707

Query  361   HSANQPN  341
             H A +P 
Sbjct  708   HGAGRPT  714


 Score =   104 bits (259),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ++LC    N+PQTNPI+ RI+R AGHG GRPTQKLIDEAADRY+FMAKVLG  W
Sbjct  677  LLATMQYILCNGVENSPQTNPIIARIDRKAGHGAGRPTQKLIDEAADRYSFMAKVLGVSW  736

Query  225  IE  220
            I+
Sbjct  737  ID  738



>ref|NP_001130392.1| uncharacterized protein LOC100191488 [Zea mays]
 gb|ACG43067.1| prolyl endopeptidase [Zea mays]
Length=731

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/486 (66%), Positives = 391/486 (80%), Gaps = 12/486 (2%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LG+DQSEDILCWKD ++P++   ASVTEDGKY ++ I+E CDPVNK+Y C++S+LP 
Sbjct  222   YHVLGSDQSEDILCWKDPEHPKYSFGASVTEDGKYIILGIYEGCDPVNKLYYCEISSLPQ  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             G++G+RGT +LLPF K++D+F+A Y  VAND   FTF TNK+APK KLVRV++K P  W 
Sbjct  282   GIEGFRGTQDLLPFVKLIDNFDAQYQVVANDGDEFTFLTNKSAPKNKLVRVNIKNPELWT  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ E EKDVLESA AVNNNQL+VNY+SDVK +LQ+RD+RTG  + H LP++IG+V+ IS
Sbjct  342   DVLSEHEKDVLESADAVNNNQLLVNYMSDVKHILQIRDLRTGNFI-HQLPLEIGSVSEIS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR+D  VFIGFT+FL P II++CNL S +PE+K+FREI+VPGFDR SF V QVFV SKD
Sbjct  401   CRREDKEVFIGFTSFLSPGIIFRCNLASTIPEMKMFREISVPGFDRTSFQVKQVFVPSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFI+S KDI L+GS+P LL+GYGGF+ S+TP FS  R+V+ K++G + CLANIRG
Sbjct  461   GTKIPMFIMSKKDIDLNGSHPTLLYGYGGFNISITPSFSVGRVVLCKNMGFVVCLANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAGALA KQNCFDDF   AE+LI+ G+T   +LCIEGGSNGGLL+ A INQ
Sbjct  521   GGEYGEEWHKAGALAMKQNCFDDFAACAEFLISNGYTSSRRLCIEGGSNGGLLVAASINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWT+D+GCSD EEEF WLIKYSPLHNVRRPWEQ
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTTDYGCSDKEEEFQWLIKYSPLHNVRRPWEQ  640

Query  508   TH-QACQYPSTMLLTADHDDRVVPLHTFKYLAMM--MPCPDHAACP--------VYKRSQ  362
             +    CQYP+TMLLTADHDDRVVPLH+ K LA +  + C      P        + ++S 
Sbjct  641   SSGNNCQYPATMLLTADHDDRVVPLHSLKLLATLQHVLCTSTEDSPQTNPIIGRIDRKSG  700

Query  361   HSANQP  344
             H A +P
Sbjct  701   HGAGRP  706


 Score =   107 bits (267),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+QHVLCTS  ++PQTNPI+GRI+R +GHG GRPTQK+IDEAADRY+FMAK+LGA W
Sbjct  670  LLATLQHVLCTSTEDSPQTNPIIGRIDRKSGHGAGRPTQKMIDEAADRYSFMAKMLGASW  729

Query  225  IE  220
             E
Sbjct  730  TE  731



>ref|XP_009397972.1| PREDICTED: prolyl endopeptidase-like [Musa acuminata subsp. malaccensis]
Length=734

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/487 (65%), Positives = 388/487 (80%), Gaps = 12/487 (2%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLG DQSEDILCW+D ++P+++    VT+DGKYAL+YI E C+P NK+Y C LS LP+
Sbjct  225   YHFLGMDQSEDILCWRDPEHPKYIYGTDVTDDGKYALLYIEEGCNPTNKLYYCKLSLLPH  284

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G++G +E+LPF ++VD+FEA Y FV ND+  FTF TNK AP+YKLVRVD  EP  W 
Sbjct  285   GLEGFKGRNEMLPFIQLVDNFEARYLFVTNDDTKFTFMTNKGAPRYKLVRVDFIEPESWT  344

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ ED+KDVLE+A AVNNNQL+V+YL DVK  LQLRD+ TG +L H +P+DIGTV GIS
Sbjct  345   DVLPEDDKDVLETASAVNNNQLLVSYLRDVKYGLQLRDLETGALL-HEIPVDIGTVYGIS  403

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              +R+DS VFIGFT+FL P IIY+CNL + VPE++IFRE  VPGF R +F V QVFV SKD
Sbjct  404   GKREDSDVFIGFTSFLSPGIIYKCNLAAGVPEMQIFREAFVPGFHRENFEVKQVFVSSKD  463

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
               +IPMFIVS K+I LDGS+PCLL+GYGGF+ S+TP F+  RLV+ ++LG +FC+ANIRG
Sbjct  464   DTRIPMFIVSKKNIQLDGSHPCLLYGYGGFNISLTPSFNVTRLVLTRNLGFVFCIANIRG  523

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHK G+L+KKQNCFDDFI +AE+L++ G+T P +LCIEG SNGGLL+  C+NQ
Sbjct  524   GGEYGEEWHKGGSLSKKQNCFDDFIASAEFLVSNGYTNPRRLCIEGRSNGGLLVATCMNQ  583

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGC LAHVGVMDMLRFHKFTIGHAWTSDFGCSDN+EEFHWLIKYSPLHNV+RPWE+
Sbjct  584   RPDLFGCVLAHVGVMDMLRFHKFTIGHAWTSDFGCSDNKEEFHWLIKYSPLHNVKRPWEK  643

Query  508   -THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM--MPCPDHAACP--------VYKRSQ  362
                   QYPSTMLLTADHDDRVVPLH+ K LA M  + C    + P        + ++  
Sbjct  644   GDSHRLQYPSTMLLTADHDDRVVPLHSLKMLATMQYVLCTSLGSSPQSNPIIARIERKGG  703

Query  361   HSANQPN  341
             H A +P 
Sbjct  704   HGAGRPT  710


 Score = 93.2 bits (230),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            ++ TMQ+VLCTS  ++PQ+NPI+ RIER  GHG GRPTQK+IDEAADRY+F AKV+   W
Sbjct  673  MLATMQYVLCTSLGSSPQSNPIIARIERKGGHGAGRPTQKMIDEAADRYSFAAKVMELSW  732

Query  225  IE  220
             +
Sbjct  733  TD  734



>ref|XP_006478480.1| PREDICTED: prolyl endopeptidase-like isoform X2 [Citrus sinensis]
Length=729

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/455 (69%), Positives = 382/455 (84%), Gaps = 6/455 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGT+QSEDILCWKD ++P++  S  VTEDG+Y ++YI EN D VNKVY  DLSALP 
Sbjct  222   YHFLGTEQSEDILCWKDPEHPKYTFSGHVTEDGQYLVMYIRENFDQVNKVYYYDLSALPE  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+R ++ LLPF K++D F+A Y  VAND++VFTFRT+K+APKYK+VRVD++EP  W 
Sbjct  282   GLEGFRKSNGLLPFVKLIDRFDAQYEVVANDDSVFTFRTSKDAPKYKIVRVDLREPNNWS  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             +V+ E E+D+LESA A N NQ++++YLSDVK VLQ+RD++TG +L H LPI+IG+VN  S
Sbjct  342   EVVAEAERDMLESASAANFNQMILSYLSDVKYVLQIRDLKTGSLL-HQLPIEIGSVNAKS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR DS+VFI FT+FL P IIYQCNL+++ PE+KIFRE +VPGFDR+ F+V QVFV SKD
Sbjct  401   VRRDDSVVFISFTSFLTPGIIYQCNLKTESPEMKIFRETSVPGFDRSEFHVHQVFVPSKD  460

Query  1048  G-VKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIR  872
             G  KIPMFIV+ K+I LDGS+PCLL+GYGGF+AS+TP FS +R V+ +HLG +FC+ANIR
Sbjct  461   GSTKIPMFIVAKKNIKLDGSHPCLLYGYGGFNASITPSFSVSRTVLMRHLGAVFCIANIR  520

Query  871   GGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACIN  692
             GGGEYGEEWHK GALAKKQNCFDDFI A+EYLI+AG+TQ  KLCIEG SNGGLL+GACIN
Sbjct  521   GGGEYGEEWHKDGALAKKQNCFDDFISASEYLISAGYTQSRKLCIEGESNGGLLVGACIN  580

Query  691   QRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE  512
             QRPDLFGCALAHVGVMDMLR HKFTIG    S++GC + +EEF WLIKYSPLHNVRRPWE
Sbjct  581   QRPDLFGCALAHVGVMDMLRLHKFTIGF---SEYGCPEKKEEFDWLIKYSPLHNVRRPWE  637

Query  511   QT-HQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             Q   +  QYPST+LLTADHDDRVVPLH+ K LA M
Sbjct  638   QDPDKPSQYPSTLLLTADHDDRVVPLHSLKLLATM  672


 Score =   104 bits (259),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS  N+PQTNPI+GRIE  AGHG GRPTQK+IDEAAD Y FMAK+LGA W
Sbjct  668  LLATMQYVLCTSLENSPQTNPILGRIECKAGHGAGRPTQKMIDEAADCYGFMAKMLGASW  727

Query  225  IE  220
            IE
Sbjct  728  IE  729



>gb|AFW56408.1| prolyl endopeptidase [Zea mays]
Length=771

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/487 (66%), Positives = 391/487 (80%), Gaps = 12/487 (2%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LG+DQSEDILCWKD ++P++   ASVTEDGKY ++ I+E CDPVNK+Y C++S+LP 
Sbjct  262   YHVLGSDQSEDILCWKDPEHPKYSFGASVTEDGKYIILGIYEGCDPVNKLYYCEISSLPQ  321

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             G++G+RGT +LLPF K++D+F+A Y  VAND   FTF TNK+APK KLVRV++K P  W 
Sbjct  322   GIEGFRGTQDLLPFVKLIDNFDAQYQVVANDGDEFTFLTNKSAPKNKLVRVNIKNPELWT  381

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ E EKDVLESA AVNNNQL+VNY+SDVK +LQ+RD+RTG  + H LP++IG+V+ IS
Sbjct  382   DVLSEHEKDVLESADAVNNNQLLVNYMSDVKHILQIRDLRTGNFI-HQLPLEIGSVSEIS  440

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR+D  VFIGFT+FL P II++CNL S +PE+K+FREI+VPGFDR SF V QVFV SKD
Sbjct  441   CRREDKEVFIGFTSFLSPGIIFRCNLASTIPEMKMFREISVPGFDRTSFQVKQVFVPSKD  500

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFI+S KDI L+GS+P LL+GYGGF+ S+TP FS  R+V+ K++G + C+ANIRG
Sbjct  501   GTKIPMFIMSKKDIDLNGSHPTLLYGYGGFNISITPSFSVGRVVLCKNMGFVVCVANIRG  560

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAGALA KQNCFDDF   AE+LI+ G+T   +LCIEGGSNGGLL+ A INQ
Sbjct  561   GGEYGEEWHKAGALAMKQNCFDDFAACAEFLISNGYTSSRRLCIEGGSNGGLLVAASINQ  620

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWT+D+GCSD EEEF WLIKYSPLHNVRRPWEQ
Sbjct  621   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTTDYGCSDKEEEFQWLIKYSPLHNVRRPWEQ  680

Query  508   TH-QACQYPSTMLLTADHDDRVVPLHTFKYLAMM--MPCPDHAACP--------VYKRSQ  362
             +    CQYP+TMLLTADHDDRVVPLH+ K LA +  + C      P        + ++S 
Sbjct  681   SSGNNCQYPATMLLTADHDDRVVPLHSLKLLATLQHVLCTSTEDSPQTNPIIGRIDRKSG  740

Query  361   HSANQPN  341
             H A +P 
Sbjct  741   HGAGRPT  747


 Score =   107 bits (266),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+QHVLCTS  ++PQTNPI+GRI+R +GHG GRPTQK+IDEAADRY+FMAK+LGA W
Sbjct  710  LLATLQHVLCTSTEDSPQTNPIIGRIDRKSGHGAGRPTQKMIDEAADRYSFMAKMLGASW  769

Query  225  IE  220
             E
Sbjct  770  TE  771



>ref|XP_004172990.1| PREDICTED: prolyl endopeptidase-like, partial [Cucumis sativus]
Length=476

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/420 (73%), Positives = 365/420 (87%), Gaps = 2/420 (0%)
 Frame = -2

Query  1666  YALVYIFENCDPVNKVYVCDLSALPNGLQGYRGTDELLPFNKIVDHFEASYGFVANDEAV  1487
             Y L+ I E CDPVNK Y C++SALPNGL+G++G ++LLPF K++D F+A Y  +AND+ +
Sbjct  1     YVLMPIEEGCDPVNKFYYCNISALPNGLEGFKGKNDLLPFTKLIDDFDAQYYAIANDDTL  60

Query  1486  FTFRTNKNAPKYKLVRVDVKEPGCWCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVL  1307
             FTF TNKNAPKYKLVRVD+ +P  W +++ E +KDVLESA AVN +Q++V+YLSDVK VL
Sbjct  61    FTFITNKNAPKYKLVRVDLNDPTVWTELLPESDKDVLESACAVNGDQMIVSYLSDVKYVL  120

Query  1306  QLRDIRTGGILNHNLPIDIGTVNGISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELK  1127
             Q+RD+++G +L H LPIDIGTVNGISARR+DS++FIGFT+FL P IIYQCNL+S  P+LK
Sbjct  121   QIRDLKSGSLL-HQLPIDIGTVNGISARREDSLIFIGFTSFLTPGIIYQCNLESGTPDLK  179

Query  1126  IFREITVPGFDRASFNVTQVFVGSKDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASV  947
             IFRE  VPGF+R++FNV QVFV SKDG  IPMF+V+ K+I  DGS+PCLL+GYGGF+ S+
Sbjct  180   IFRETVVPGFERSAFNVDQVFVRSKDGTNIPMFVVARKNIVFDGSHPCLLYGYGGFNISL  239

Query  946   TPYFSTARLVIAKHLGVIFCLANIRGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAA  767
             TP FS +R V+ +HLG +FC+ANIRGGGEYGEEWHKAG+LAKKQNCFDDFI +AEYLI+A
Sbjct  240   TPSFSVSRTVLMRHLGAVFCVANIRGGGEYGEEWHKAGSLAKKQNCFDDFISSAEYLISA  299

Query  766   GFTQPSKLCIEGGSNGGLLIGACINQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFG  587
             G+TQPSKLCIEGGSNGGLL+GACINQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSD+G
Sbjct  300   GYTQPSKLCIEGGSNGGLLVGACINQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDYG  359

Query  586   CSDNEEEFHWLIKYSPLHNVRRPWEQ-THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             CSDNEEEF WLIKYSPLHNV+RPWEQ   +  QYPSTMLLTADHDDRVVPLH+ K LA M
Sbjct  360   CSDNEEEFKWLIKYSPLHNVKRPWEQHPDRLLQYPSTMLLTADHDDRVVPLHSLKLLATM  419


 Score =   102 bits (254),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VLCTS   +PQTNPI+GRIE  AGHG GRPTQK+IDEA+DRYAFMAK+L A W
Sbjct  415  LLATMQYVLCTSLEKSPQTNPIIGRIECKAGHGAGRPTQKMIDEASDRYAFMAKMLAATW  474

Query  225  IE  220
            I+
Sbjct  475  ID  476



>gb|ACN31271.1| unknown [Zea mays]
Length=771

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/487 (66%), Positives = 390/487 (80%), Gaps = 12/487 (2%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LG+DQSEDILCWKD ++P++   ASVTEDGKY ++ I+E CDPVNK+Y C++S+LP 
Sbjct  262   YHVLGSDQSEDILCWKDPEHPKYSFGASVTEDGKYIILGIYEGCDPVNKLYYCEISSLPQ  321

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             G++G+RGT +LLPF K++D+F+A Y  VAND   FTF TNK+A K KLVRV++K P  W 
Sbjct  322   GIEGFRGTQDLLPFVKLIDNFDAQYQVVANDGDEFTFLTNKSALKNKLVRVNIKNPELWT  381

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ E EKDVLESA AVNNNQL+VNY+SDVK +LQ+RD+RTG  + H LP++IG+V+ IS
Sbjct  382   DVLSEHEKDVLESADAVNNNQLLVNYMSDVKHILQIRDLRTGNFI-HQLPLEIGSVSEIS  440

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR+D  VFIGFT+FL P II++CNL S +PE+K+FREI+VPGFDR SF V QVFV SKD
Sbjct  441   CRREDKEVFIGFTSFLSPGIIFRCNLASTIPEMKMFREISVPGFDRTSFQVKQVFVPSKD  500

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFI+S KDI L+GS+P LL+GYGGF+ S+TP FS  R+V+ K++G + C+ANIRG
Sbjct  501   GTKIPMFIMSKKDIDLNGSHPTLLYGYGGFNISITPSFSVGRVVLCKNMGFVVCVANIRG  560

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAGALA KQNCFDDF   AE+LI+ G+T   +LCIEGGSNGGLL+ A INQ
Sbjct  561   GGEYGEEWHKAGALAMKQNCFDDFAACAEFLISNGYTSSRRLCIEGGSNGGLLVAASINQ  620

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWT+D+GCSD EEEF WLIKYSPLHNVRRPWEQ
Sbjct  621   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTTDYGCSDKEEEFQWLIKYSPLHNVRRPWEQ  680

Query  508   TH-QACQYPSTMLLTADHDDRVVPLHTFKYLAMM--MPCPDHAACP--------VYKRSQ  362
             +    CQYP+TMLLTADHDDRVVPLH+ K LA +  + C      P        + ++S 
Sbjct  681   SSGNNCQYPATMLLTADHDDRVVPLHSLKLLATLQHVLCTSTEDSPQTNPIIGRIDRKSG  740

Query  361   HSANQPN  341
             H A +P 
Sbjct  741   HGAGRPT  747


 Score =   107 bits (266),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+QHVLCTS  ++PQTNPI+GRI+R +GHG GRPTQK+IDEAADRY+FMAK+LGA W
Sbjct  710  LLATLQHVLCTSTEDSPQTNPIIGRIDRKSGHGAGRPTQKMIDEAADRYSFMAKMLGASW  769

Query  225  IE  220
             E
Sbjct  770  TE  771



>gb|EEC69790.1| hypothetical protein OsI_00077 [Oryza sativa Indica Group]
Length=730

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/454 (68%), Positives = 377/454 (83%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH +G+DQSEDILCWKD ++P++   ASVTEDGKY ++  +E CDPVNK+Y C++  LP 
Sbjct  221   YHVVGSDQSEDILCWKDPEHPKYSFGASVTEDGKYIILGTYEGCDPVNKLYYCEICTLPQ  280

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             G++G++ T  +LPF K++D+F+A Y  VAND   FTF TN+NAPK KLVRVD+K+P  W 
Sbjct  281   GIEGFKETKGMLPFVKLIDNFDAQYHVVANDGDEFTFLTNRNAPKNKLVRVDIKKPELWT  340

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             D++ E E+DVLESA AVN NQL+V Y+SDVK +LQ+RD+ TG +L H LP++IG+V+ IS
Sbjct  341   DILPEHERDVLESADAVNGNQLLVCYMSDVKHILQIRDLVTGNLL-HKLPLEIGSVSEIS  399

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR+D  VFIGFT+FL P IIY+CNL S +PE+KIFREI+VPGFDR +F V Q+FV SKD
Sbjct  400   CRREDMDVFIGFTSFLSPGIIYRCNLTSAIPEMKIFREISVPGFDRTNFEVKQIFVNSKD  459

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFI+S +DI LDGS+P LL+GYGGF+ S+TP FS +R+V+ K++G + C+ANIRG
Sbjct  460   GTKIPMFIMSKRDIELDGSHPTLLYGYGGFNISLTPSFSVSRVVLCKNMGFVVCVANIRG  519

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAGA A KQNCFDDFI  AE LI+AG+T   +LCIEGGSNGGLLI AC+NQ
Sbjct  520   GGEYGEEWHKAGARAMKQNCFDDFIACAELLISAGYTSYRQLCIEGGSNGGLLIAACVNQ  579

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWT+D+GCSDNEEEFHWLIKYSPLHNVRRPWEQ
Sbjct  580   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTTDYGCSDNEEEFHWLIKYSPLHNVRRPWEQ  639

Query  508   TH-QACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             +    CQYP+ MLLTADHDDRVVPLH+ K LA +
Sbjct  640   SFVNCCQYPAIMLLTADHDDRVVPLHSLKLLATL  673


 Score = 93.6 bits (231),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+Q+VLCTS  +TPQ NPI+GRI+  +GHG GRPT+K+IDE ADRY+FMA +L A W
Sbjct  669  LLATLQYVLCTSIEDTPQVNPIIGRIDVKSGHGAGRPTKKMIDEVADRYSFMANMLDASW  728

Query  225  IE  220
             E
Sbjct  729  TE  730



>ref|NP_001041787.1| Os01g0108200 [Oryza sativa Japonica Group]
 dbj|BAD44856.1| putative prolyl endopeptidase [Oryza sativa Japonica Group]
 dbj|BAF03701.1| Os01g0108200 [Oryza sativa Japonica Group]
 dbj|BAG92479.1| unnamed protein product [Oryza sativa Japonica Group]
Length=730

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/454 (68%), Positives = 377/454 (83%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH +G+DQSEDILCWKD ++P++   ASVTEDGKY ++  +E CDPVNK+Y C++  LP 
Sbjct  221   YHVVGSDQSEDILCWKDPEHPKYSFGASVTEDGKYIILGTYEGCDPVNKLYYCEICTLPQ  280

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             G++G++ T  +LPF K++D+F+A Y  VAND   FTF TN+NAPK KLVRVD+K+P  W 
Sbjct  281   GIEGFKETKGMLPFVKLIDNFDAQYHVVANDGDEFTFLTNRNAPKNKLVRVDIKKPELWT  340

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             D++ E E+DVLESA AVN NQL+V Y+SDVK +LQ+RD+ TG +L H LP++IG+V+ IS
Sbjct  341   DILPEHERDVLESADAVNGNQLLVCYMSDVKHILQIRDLVTGNLL-HKLPLEIGSVSEIS  399

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR+D  VFIGFT+FL P IIY+CNL S +PE+KIFREI+VPGFDR +F V Q+FV SKD
Sbjct  400   CRREDMDVFIGFTSFLSPGIIYRCNLTSAIPEMKIFREISVPGFDRTNFEVKQIFVNSKD  459

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFI+S +DI LDGS+P LL+GYGGF+ S+TP FS +R+V+ K++G + C+ANIRG
Sbjct  460   GTKIPMFIMSKRDIELDGSHPTLLYGYGGFNISLTPSFSVSRVVLCKNMGFVVCVANIRG  519

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAGA A KQNCFDDFI  AE LI+AG+T   +LCIEGGSNGGLLI AC+NQ
Sbjct  520   GGEYGEEWHKAGARAMKQNCFDDFIACAELLISAGYTSYRQLCIEGGSNGGLLIAACVNQ  579

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWT+D+GCSDNEEEFHWLIKYSPLHNVRRPWEQ
Sbjct  580   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTTDYGCSDNEEEFHWLIKYSPLHNVRRPWEQ  639

Query  508   TH-QACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             +    CQYP+ MLLTADHDDRVVPLH+ K LA +
Sbjct  640   SFVNCCQYPAIMLLTADHDDRVVPLHSLKLLATL  673


 Score = 93.6 bits (231),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+Q+VLCTS  +TPQ NPI+GRI+  +GHG GRPT+K+IDE ADRY+FMA +L A W
Sbjct  669  LLATLQYVLCTSIEDTPQVNPIIGRIDVKSGHGAGRPTKKMIDEVADRYSFMANMLDASW  728

Query  225  IE  220
             E
Sbjct  729  TE  730



>ref|NP_001053552.1| Os04g0561500 [Oryza sativa Japonica Group]
 emb|CAE01849.2| OSJNBa0084K11.14 [Oryza sativa Japonica Group]
 dbj|BAF15466.1| Os04g0561500 [Oryza sativa Japonica Group]
 dbj|BAG91543.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61488.1| hypothetical protein OsJ_15773 [Oryza sativa Japonica Group]
Length=739

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/473 (65%), Positives = 377/473 (80%), Gaps = 7/473 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQSED+LCW+D D+P+++ +  V+EDGKY ++ + E  +PVNK+Y CDLSALP+
Sbjct  229   YHFLGTDQSEDLLCWEDPDHPKYIYTPEVSEDGKYVILSVAETSEPVNKLYYCDLSALPD  288

Query  1588  GLQGYRGT--DELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGC  1415
             GL+G +G   + +LPF K+VD FEA Y  +AND+  FTF TNKNAPKYKL R+DV EP  
Sbjct  289   GLEGMKGNHGNAMLPFVKLVDEFEAYYALIANDDTQFTFLTNKNAPKYKLSRIDVNEPHS  348

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W D++ EDEK VLESA AV+ ++L+VNYLSDVK VLQ+R + TG +L H++PIDIG+VNG
Sbjct  349   WMDILPEDEKAVLESACAVHGDKLLVNYLSDVKYVLQMRSLVTGELL-HDIPIDIGSVNG  407

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
             IS RR +S VFI F +FL P IIY+C++  + PE+ I+REI+V GFDR  F   QVF  S
Sbjct  408   ISGRRDNSEVFIEFASFLTPGIIYRCDVSKETPEMNIYREISVGGFDRTDFEAKQVFYPS  467

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIVS K I LDGS+P LL+GYGGF  ++TP+FS  R+V+ ++LG + C+ANI
Sbjct  468   KDGTKIPMFIVSKKSIVLDGSHPTLLYGYGGFGMNMTPHFSVTRIVLMRNLGFVSCIANI  527

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE+WHKAG+LA KQNCFDDFI A E+L++AG+T PS+LC+EG SNGGLL+ ACI
Sbjct  528   RGGGEYGEDWHKAGSLANKQNCFDDFIAAGEFLVSAGYTNPSRLCVEGASNGGLLVAACI  587

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCALAHVGVMDMLRFHKFTIG AWT DFGCS+ EEEFHWLIKYSPLHNVRRPW
Sbjct  588   NQRPDLFGCALAHVGVMDMLRFHKFTIGRAWTCDFGCSEKEEEFHWLIKYSPLHNVRRPW  647

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHS  356
             E+ H+  QYPSTMLLTADHDDRVVP HT K+LA M     H  C   K S  +
Sbjct  648   EKGHRRQQYPSTMLLTADHDDRVVPSHTLKFLATMQ----HVLCTSVKESPQT  696


 Score =   100 bits (248),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + TMQHVLCTS   +PQTNPIV RI+R +GHGCGR TQK+IDEAADRYAF AK +G  W
Sbjct  678  FLATMQHVLCTSVKESPQTNPIVARIDRKSGHGCGRSTQKIIDEAADRYAFAAKTMGISW  737

Query  225  IE  220
            I+
Sbjct  738  ID  739



>ref|XP_002961763.1| hypothetical protein SELMODRAFT_77679 [Selaginella moellendorffii]
 gb|EFJ37023.1| hypothetical protein SELMODRAFT_77679 [Selaginella moellendorffii]
Length=729

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/477 (66%), Positives = 375/477 (79%), Gaps = 11/477 (2%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQSEDILCWKDSDNP+ M  A VT+DGKY ++ I E CDPVN++Y+C+L +LPN
Sbjct  221   YHFLGTDQSEDILCWKDSDNPKWMFGAEVTDDGKYLVLSIEEGCDPVNRLYLCELDSLPN  280

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GLQG++G DELLPF ++VD F+A Y  +AND  VFTFRTNKNAP+YK+ RVD + P  W 
Sbjct  281   GLQGWKGKDELLPFERLVDKFDAKYEVIANDGNVFTFRTNKNAPRYKVTRVDTRNPETWT  340

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             D+I E  KDVL+SA  VN+ QLVV+YLSDVK VL++RD+  G +L   LP+DIGTV+GIS
Sbjct  341   DIIAESAKDVLDSAQCVNHQQLVVSYLSDVKHVLEVRDLEHGTLL-RTLPLDIGTVSGIS  399

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RRKD+ +F GFT+FL P +IY+C+L S+  EL +F+E +V GFDR  F   QVFV SKD
Sbjct  400   GRRKDAEIFYGFTSFLTPGVIYRCDL-SEDSELTVFKETSVKGFDRTRFETKQVFVPSKD  458

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G K+PMFIV+ K I LDG +P LL+GYGGF+ S+TPYFS +R+V+ +H GVIF +ANIRG
Sbjct  459   GTKVPMFIVARKSIALDGKHPALLYGYGGFNISITPYFSASRIVLIQHCGVIFAIANIRG  518

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWH+AG+L  KQNCFDDF   +EYLI  G+TQP KL IEGGSNGGLL+ ACINQ
Sbjct  519   GGEYGEEWHRAGSLGNKQNCFDDFQACSEYLIKEGYTQPRKLGIEGGSNGGLLVAACINQ  578

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDL+GCALAHVGVMDMLRFHKFTIGHAWT+D+GCS+ EEEF WLIKYSPLHNV RPWE+
Sbjct  579   RPDLYGCALAHVGVMDMLRFHKFTIGHAWTTDYGCSEKEEEFKWLIKYSPLHNVSRPWEK  638

Query  508   THQ-ACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHSANQPN  341
                   QYP TMLLTADHDDRVVPLHT K LA +          V  +S  S+NQ N
Sbjct  639   PDGLGVQYPPTMLLTADHDDRVVPLHTLKLLATLQ--------HVLIKSSKSSNQTN  687


 Score = 84.3 bits (207),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+QHVL  S+ ++ QTNPIV RI+  AGHG GRPT+K+IDEAADR +F  K+ GA W
Sbjct  668  LLATLQHVLIKSSKSSNQTNPIVARIDTKAGHGAGRPTKKMIDEAADRLSFFVKMTGAEW  727

Query  225  IE  220
             E
Sbjct  728  TE  729



>ref|XP_004956126.1| PREDICTED: prolyl endopeptidase-like [Setaria italica]
Length=783

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/487 (64%), Positives = 387/487 (79%), Gaps = 12/487 (2%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LG++QSEDILCWKD ++P++   ASVTEDGK+ ++  ++ CDPVNK+Y C +S+LP 
Sbjct  274   YHVLGSNQSEDILCWKDPEHPKYSFGASVTEDGKFIILGTYDGCDPVNKLYYCKISSLPR  333

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             G++G+R + E+LPF K++D+F+A Y  VAND   FTF TNKNAPK KLVRV++  P  W 
Sbjct  334   GIEGFRESQEMLPFVKLIDNFDAQYQVVANDGDEFTFLTNKNAPKNKLVRVNINNPELWT  393

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ E EKDVLESA AVNNNQL+V Y+SDVK +LQ+RD+ TG ++ H LP++IG+V+ IS
Sbjct  394   DVLPEHEKDVLESADAVNNNQLLVCYMSDVKHILQIRDLSTGNLI-HQLPLEIGSVSEIS  452

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR+D  VFIGFT+FL P IIY+CNL   +PE+K+FREI+VPGFDR SF V QVFV SKD
Sbjct  453   CRREDKEVFIGFTSFLSPGIIYRCNLAPTIPEMKMFREISVPGFDRTSFQVKQVFVSSKD  512

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFI+S KD+ LDGS P LL+GYGGF+ S+TP FS +R+V+ K++G + C+ANIRG
Sbjct  513   GTKIPMFIMSKKDVNLDGSYPTLLYGYGGFNISITPSFSVSRVVLCKNMGFVVCVANIRG  572

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAGALA KQNCFDDF   AE+LI++G+T   +LCIEGGSNGGLL+ A INQ
Sbjct  573   GGEYGEEWHKAGALAMKQNCFDDFAACAEFLISSGYTSSRRLCIEGGSNGGLLVAASINQ  632

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWT+D+GCSD EEEF WLIKYSPLHNVRRPWEQ
Sbjct  633   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTTDYGCSDKEEEFQWLIKYSPLHNVRRPWEQ  692

Query  508   TH-QACQYPSTMLLTADHDDRVVPLHTFKYLAMM--MPCPDHAACP--------VYKRSQ  362
             +    C+YP+TMLLTADHDDRVVPLH+ K LA +  + C D    P        + ++S 
Sbjct  693   SSGDHCEYPATMLLTADHDDRVVPLHSLKLLATLQHVLCTDAEDSPQTNPIIGRIDRKSG  752

Query  361   HSANQPN  341
             H A +P 
Sbjct  753   HGAGRPT  759


 Score =   108 bits (270),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+QHVLCT A ++PQTNPI+GRI+R +GHG GRPTQKLIDEAADRY+FMAK+LGA W
Sbjct  722  LLATLQHVLCTDAEDSPQTNPIIGRIDRKSGHGAGRPTQKLIDEAADRYSFMAKMLGAQW  781

Query  225  IE  220
             E
Sbjct  782  TE  783



>ref|XP_006661048.1| PREDICTED: prolyl endopeptidase-like [Oryza brachyantha]
Length=730

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/487 (64%), Positives = 382/487 (78%), Gaps = 12/487 (2%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH +G+DQSEDILCWKD ++P++    SVTEDGKY ++ I E CDPVNK+Y C +S L  
Sbjct  221   YHVVGSDQSEDILCWKDPEHPKYTFGVSVTEDGKYIILGIHEGCDPVNKLYYCKISTLAQ  280

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             G++GY+ + E LPF K++D+F+A Y  VAND   FTF TN+NAPK KLVRVD+K+   W 
Sbjct  281   GIEGYKESKENLPFVKLIDNFDAQYEVVANDGDEFTFLTNRNAPKNKLVRVDIKKEELWT  340

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             D++ E E+DVLESA  VN NQL+V Y+SDVK +LQ+RD+ TG +L H LP++IG+V+ IS
Sbjct  341   DILPEHERDVLESADVVNGNQLLVCYMSDVKHILQIRDLVTGNLL-HKLPLEIGSVSEIS  399

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR+D+ VFIGFT+FL P IIY+CNL + +PE+KIFREI VPGFDR  F V Q+FV SKD
Sbjct  400   CRREDTEVFIGFTSFLSPGIIYRCNLTAAIPEMKIFREILVPGFDRTKFEVKQIFVNSKD  459

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMF++S KDI LDGS+P LL+GYGGF+ S+TP FS +R+V+ K++G + C+ANIRG
Sbjct  460   GTKIPMFVMSNKDIELDGSHPTLLYGYGGFNISLTPSFSVSRVVLCKNMGFVVCVANIRG  519

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAGALA KQNCFDDFI  AE LI+AG+T   +LCIEGGSNGGLLI AC+NQ
Sbjct  520   GGEYGEEWHKAGALAMKQNCFDDFIACAELLISAGYTSSRQLCIEGGSNGGLLIAACVNQ  579

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLF CALAHVGVMDMLRFHKFTIGHAWT+D+GCSDNEEEFHWLIKYSPLHNVRRPWEQ
Sbjct  580   RPDLFACALAHVGVMDMLRFHKFTIGHAWTTDYGCSDNEEEFHWLIKYSPLHNVRRPWEQ  639

Query  508   TH-QACQYPSTMLLTADHDDRVVPLHTFKYLAMMM----------PCPDHAACPVYKRSQ  362
             +    CQYP+ MLLTADHDDRVVPLH+ K LA +           P  +     + ++S 
Sbjct  640   SFGSGCQYPAIMLLTADHDDRVVPLHSLKLLATLQYVLCTSIEDPPQVNPIIGRIDRKSG  699

Query  361   HSANQPN  341
             H A +P 
Sbjct  700   HGAGRPT  706


 Score = 96.7 bits (239),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+Q+VLCTS  + PQ NPI+GRI+R +GHG GRPT+K+IDE  DRY+FMA +LGA W
Sbjct  669  LLATLQYVLCTSIEDPPQVNPIIGRIDRKSGHGAGRPTKKMIDEVVDRYSFMANILGASW  728

Query  225  IE  220
             E
Sbjct  729  TE  730



>gb|EEC77797.1| hypothetical protein OsI_16976 [Oryza sativa Indica Group]
Length=739

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/473 (65%), Positives = 376/473 (79%), Gaps = 7/473 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQSED+LCW+D D+P+++ +  V+EDGKY ++ + E  +PVNK+Y CDLSALP+
Sbjct  229   YHFLGTDQSEDLLCWEDPDHPKYIYTPEVSEDGKYVILSVAETSEPVNKLYYCDLSALPD  288

Query  1588  GLQGYRGT--DELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGC  1415
             GL+G +G   + +LPF K+VD FEA Y  +AND+  FTF TNKNAPKYKL R+DV EP  
Sbjct  289   GLEGMKGNHGNAMLPFVKLVDEFEAYYALIANDDTQFTFLTNKNAPKYKLSRIDVNEPHS  348

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W D++ EDEK VLESA AV+ ++L+VNYLSDVK VLQ+R + TG +L H++PIDIG+VNG
Sbjct  349   WMDILPEDEKAVLESACAVHGDKLLVNYLSDVKYVLQMRSLVTGELL-HDIPIDIGSVNG  407

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
             IS RR +S VFI F +FL P IIY+C++  + PE+ I+REI+V GFDR  F   QVF  S
Sbjct  408   ISGRRDNSEVFIEFASFLTPGIIYRCDVSKETPEMNIYREISVGGFDRTDFEAKQVFYPS  467

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIVS K I LDGS+P LL+GYGGF  ++TP+FS  R+V+ ++LG + C+ANI
Sbjct  468   KDGTKIPMFIVSKKSIVLDGSHPTLLYGYGGFGMNMTPHFSVTRIVLMRNLGFVSCIANI  527

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE+WHKAG+LA KQNCFDDFI A E+L++AG+T  S+LC+EG SNGGLL+ ACI
Sbjct  528   RGGGEYGEDWHKAGSLANKQNCFDDFIAAGEFLVSAGYTNSSRLCVEGASNGGLLVAACI  587

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCALAHVGVMDMLRFHKFTIG AWT DFGCS+ EEEFHWLIKYSPLHNVRRPW
Sbjct  588   NQRPDLFGCALAHVGVMDMLRFHKFTIGRAWTCDFGCSEKEEEFHWLIKYSPLHNVRRPW  647

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHS  356
             E+ H+  QYPSTMLLTADHDDRVVP HT K+LA M     H  C   K S  +
Sbjct  648   EKGHRRQQYPSTMLLTADHDDRVVPSHTLKFLATMQ----HVLCTSVKESPQT  696


 Score =   100 bits (248),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + TMQHVLCTS   +PQTNPIV RI+R +GHGCGR TQK+IDEAADRYAF AK +G  W
Sbjct  678  FLATMQHVLCTSVKESPQTNPIVARIDRKSGHGCGRSTQKIIDEAADRYAFAAKTMGISW  737

Query  225  IE  220
            I+
Sbjct  738  ID  739



>ref|XP_004976493.1| PREDICTED: prolyl endopeptidase-like isoform X1 [Setaria italica]
Length=742

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/462 (67%), Positives = 372/462 (81%), Gaps = 10/462 (2%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS+D+LCW+D D+P+++    VTEDGKY ++ + E  +PVNK+Y CDLSAL +
Sbjct  225   YHFLGTDQSQDVLCWRDPDHPKYIYIPEVTEDGKYVILSVSETSEPVNKLYYCDLSALAH  284

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G RGT  +LPF K+VD FEA YG +AND   FTF TNK+AP+YKL RVDV E G W 
Sbjct  285   GLEGMRGTHGMLPFVKLVDKFEAYYGLIANDGTEFTFLTNKDAPRYKLSRVDVDESGSWA  344

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ EDEK VLESA AV+  +L+VNYLSDVK VLQ+R + TG +L H++PIDIGTVNGIS
Sbjct  345   DVLPEDEKAVLESACAVHGGKLLVNYLSDVKYVLQMRSLVTGELL-HDIPIDIGTVNGIS  403

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR DS VFI F +FL P IIY+C++ ++VPE+ ++REI+VPGFDR  F   QVF  SKD
Sbjct  404   GRRVDSEVFIEFASFLTPGIIYRCDVSTEVPEMSVYREISVPGFDRNEFEAKQVFYPSKD  463

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIVS K++ L+GS+P LLFGYGGF  S+TP FS  R+V+ ++LG + C+ANIRG
Sbjct  464   GTKIPMFIVSKKNLILNGSHPALLFGYGGFGMSMTPQFSVTRVVLMRNLGFVTCVANIRG  523

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGE WH+AG+LA KQNCFDDFI A E+L+AAG+T P++LCIEGGSNGGLL+ AC+NQ
Sbjct  524   GGEYGEGWHRAGSLANKQNCFDDFIAAGEFLVAAGYTNPTRLCIEGGSNGGLLVAACLNQ  583

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIG AWT DFGCS+NEEEFHWLIKYSPLHNVRRPWE+
Sbjct  584   RPDLFGCALAHVGVMDMLRFHKFTIGRAWTCDFGCSENEEEFHWLIKYSPLHNVRRPWEE  643

Query  508   T------HQAC---QYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                     + C   QYP TMLLTADHDDRVVP HT K+LA +
Sbjct  644   KGDDDPRRRVCWGGQYPPTMLLTADHDDRVVPSHTLKFLATL  685


 Score = 95.9 bits (237),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+QHVL   A  +PQTNPI+GRIER +GHGCGR TQK+IDEAADRYAF AK++G  W
Sbjct  681  FLATLQHVLRAGAEGSPQTNPIIGRIERKSGHGCGRSTQKIIDEAADRYAFAAKMMGVSW  740

Query  225  IE  220
            I+
Sbjct  741  ID  742



>ref|XP_004976494.1| PREDICTED: prolyl endopeptidase-like isoform X2 [Setaria italica]
Length=739

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/463 (67%), Positives = 373/463 (81%), Gaps = 10/463 (2%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS+D+LCW+D D+P+++    VTEDGKY ++ + E  +PVNK+Y CDLSAL +
Sbjct  225   YHFLGTDQSQDVLCWRDPDHPKYIYIPEVTEDGKYVILSVSETSEPVNKLYYCDLSALAH  284

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G RGT  +LPF K+VD FEA YG +AND   FTF TNK+AP+YKL RVDV E G W 
Sbjct  285   GLEGMRGTHGMLPFVKLVDKFEAYYGLIANDGTEFTFLTNKDAPRYKLSRVDVDESGSWA  344

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ EDEK VLESA AV+  +L+VNYLSDVK VLQ+R + TG +L H++PIDIGTVNGIS
Sbjct  345   DVLPEDEKAVLESACAVHGGKLLVNYLSDVKYVLQMRSLVTGELL-HDIPIDIGTVNGIS  403

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR DS VFI F +FL P IIY+C++ ++VPE+ ++REI+VPGFDR  F   QVF  SKD
Sbjct  404   GRRVDSEVFIEFASFLTPGIIYRCDVSTEVPEMSVYREISVPGFDRNEFEAKQVFYPSKD  463

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIVS K++ L+GS+P LLFGYGGF  S+TP FS  R+V+ ++LG + C+ANIRG
Sbjct  464   GTKIPMFIVSKKNLILNGSHPALLFGYGGFGMSMTPQFSVTRVVLMRNLGFVTCVANIRG  523

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGE WH+AG+LA KQNCFDDFI A E+L+AAG+T P++LCIEGGSNGGLL+ AC+NQ
Sbjct  524   GGEYGEGWHRAGSLANKQNCFDDFIAAGEFLVAAGYTNPTRLCIEGGSNGGLLVAACLNQ  583

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIG AWT DFGCS+NEEEFHWLIKYSPLHNVRRPWE+
Sbjct  584   RPDLFGCALAHVGVMDMLRFHKFTIGRAWTCDFGCSENEEEFHWLIKYSPLHNVRRPWEE  643

Query  508   T------HQAC---QYPSTMLLTADHDDRVVPLHTFKYLAMMM  407
                     + C   QYP TMLLTADHDDRVVP HT K+LA ++
Sbjct  644   KGDDDPRRRVCWGGQYPPTMLLTADHDDRVVPSHTLKFLAHVL  686


 Score = 91.7 bits (226),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = -3

Query  402  VQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHWI  223
            ++ + HVL   A  +PQTNPI+GRIER +GHGCGR TQK+IDEAADRYAF AK++G  WI
Sbjct  679  LKFLAHVLRAGAEGSPQTNPIIGRIERKSGHGCGRSTQKIIDEAADRYAFAAKMMGVSWI  738

Query  222  E  220
            +
Sbjct  739  D  739



>ref|XP_006652640.1| PREDICTED: prolyl endopeptidase-like [Oryza brachyantha]
Length=735

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/454 (67%), Positives = 367/454 (81%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGT+QSED+LCW+D D+P+++ +  V+EDGKY ++ + E  +PVNK Y CDLSALP+
Sbjct  226   YHFLGTNQSEDVLCWEDPDHPKYIYTTEVSEDGKYVILSVAETSEPVNKSYYCDLSALPD  285

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G +G   +LPF K+VD FEA Y  +AND+  FTF TNKNAPKYKL RVDV EP  W 
Sbjct  286   GLEGMKGDHGMLPFVKLVDEFEAYYALIANDDTQFTFLTNKNAPKYKLSRVDVNEPHSWI  345

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ EDEK VLESA AV+ ++L+VNYLSDVK VLQ+R + TG +L H++PIDIG+VNGIS
Sbjct  346   DVLPEDEKAVLESACAVHGDKLMVNYLSDVKYVLQMRSLVTGELL-HDIPIDIGSVNGIS  404

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR DS VFI F +FL P IIY+C++  + PE+ I+REI+V GFDR  F   QVF  S D
Sbjct  405   GRRDDSEVFIHFASFLTPGIIYRCDVSKETPEMNIYREISVSGFDRTDFEAKQVFYTSMD  464

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIVS K+I LDGSNP LL+GYGGF  ++TP+FS  R+V+ ++LG + C+ANIRG
Sbjct  465   GTKIPMFIVSKKNIVLDGSNPTLLYGYGGFGMNMTPHFSVTRIVLMRNLGFVSCIANIRG  524

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGE WH+ G+LA KQNCFDDFI A E+L++AG+T PS+LCIEG SNGGLL+ ACINQ
Sbjct  525   GGEYGEVWHRGGSLANKQNCFDDFIAAGEFLVSAGYTNPSRLCIEGASNGGLLVAACINQ  584

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIG AWT DFGCS+ EEEFHWLIKYSPLHNVRRPWE 
Sbjct  585   RPDLFGCALAHVGVMDMLRFHKFTIGRAWTCDFGCSEKEEEFHWLIKYSPLHNVRRPWEN  644

Query  508   TH-QACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                ++ QYPSTMLLTADHDDRVVP HT K+LA M
Sbjct  645   GGCRSQQYPSTMLLTADHDDRVVPSHTLKFLATM  678


 Score =   100 bits (248),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + TMQHVLCT   ++PQTNPI+GRI+R +GHGCGR TQK+IDEA DRYAF AK++G  W
Sbjct  674  FLATMQHVLCTGVQDSPQTNPIIGRIDRKSGHGCGRSTQKIIDEAVDRYAFAAKMMGISW  733

Query  225  IE  220
            I+
Sbjct  734  ID  735



>gb|EPS68647.1| hypothetical protein M569_06121, partial [Genlisea aurea]
Length=625

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/405 (74%), Positives = 357/405 (88%), Gaps = 1/405 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQSEDILCW D +NP++  SASVTEDGKY L+YI ENCDPVNK+Y CDLS L +
Sbjct  222   YHFLGTDQSEDILCWSDPENPKYSHSASVTEDGKYLLLYISENCDPVNKIYYCDLSILSH  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+GY+GT ELLPF K+VD+FEA Y ++AND+AVFTFR+NK+APKYKLVRVD++EP  W 
Sbjct  282   GLEGYKGTKELLPFVKLVDNFEALYSYIANDDAVFTFRSNKDAPKYKLVRVDLREPTAWI  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             +++QED KDVLESA AVNN  +VVNYLSDVK+VLQ+RD++TG +L H+LP+DIGTV+ IS
Sbjct  342   ELLQEDAKDVLESATAVNNGLMVVNYLSDVKNVLQIRDLKTG-VLLHHLPLDIGTVSSIS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RRKD  +FI F +FL+P IIY C+L+S+VP+L+IFRE  VPGFDR  F VTQVFV SKD
Sbjct  401   GRRKDGKIFIEFKSFLVPGIIYLCDLESEVPDLRIFRETVVPGFDRTLFEVTQVFVPSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIP+F+V+ K + LDGS+PCLL+GYGGF+ S+TP FSTAR++IA++LGV+ C+ANIRG
Sbjct  461   GTKIPVFVVARKGLPLDGSHPCLLYGYGGFNISITPSFSTARILIARYLGVVLCIANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAGALA KQNCFDDFI AAEYLI+AG+TQP KLCIEGGSNGGLL+GAC+NQ
Sbjct  521   GGEYGEEWHKAGALANKQNCFDDFISAAEYLISAGYTQPKKLCIEGGSNGGLLVGACVNQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWL  554
             RPDL+GCALAHVGVMDMLRFHKFTIGHAWTSD+GCSD EEEF WL
Sbjct  581   RPDLYGCALAHVGVMDMLRFHKFTIGHAWTSDYGCSDKEEEFSWL  625



>ref|XP_003580320.1| PREDICTED: prolyl endopeptidase [Brachypodium distachyon]
Length=740

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/480 (64%), Positives = 375/480 (78%), Gaps = 11/480 (2%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQS+D+LCW D ++P+H+ +  VTEDGKY L+ + E  +PVNK+Y CDLSALP+
Sbjct  226   YHLLGTDQSDDVLCWNDPEHPKHIYTPEVTEDGKYVLLSVSEASEPVNKLYYCDLSALPH  285

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G +GT ++LPF K+VD FEA YG +AND+A FT  TNK+AP+YKL RV +  P  W 
Sbjct  286   GLEGIKGTRDMLPFVKLVDEFEAYYGVIANDDAQFTILTNKDAPRYKLSRVGIDNPQSWV  345

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVI ED+K VLESA AV+ N+L+VNYLSDVK VLQ+R + TG +L H++PIDIG+VNGI+
Sbjct  346   DVIPEDDKAVLESACAVHGNKLLVNYLSDVKYVLQVRSLITGELL-HDIPIDIGSVNGIT  404

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR DS VFI F  FL P IIY+C+L ++ PE+ I+REI+VPGFDR  F   QVF  SKD
Sbjct  405   GRRVDSEVFIEFAGFLTPGIIYRCDLSAETPEMNIYREISVPGFDRTGFEAKQVFYQSKD  464

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G K+PMFIVS K I LDGS+P LL+GYGGF  S+TP FS AR+V+ ++LG++ C+ANIRG
Sbjct  465   GTKVPMFIVSKKGIDLDGSHPTLLYGYGGFGMSMTPQFSAARVVLMRNLGLVTCIANIRG  524

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGE WH+AG+LA KQNCFDDFI A E+L++AG+T PS+LCIEGGSNGGLL+  C+NQ
Sbjct  525   GGEYGEGWHRAGSLANKQNCFDDFIAAGEFLVSAGYTSPSRLCIEGGSNGGLLVAGCVNQ  584

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RP LFGCALAHVGVMDMLRFHKFTIG AWT DFGCS+NEEEFHWLIKYSPLHNVRRPWE+
Sbjct  585   RPGLFGCALAHVGVMDMLRFHKFTIGRAWTCDFGCSENEEEFHWLIKYSPLHNVRRPWEK  644

Query  508   THQAC----QYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHSANQPN  341
                      QYP  MLLTADHDDRVVP HT K+LA M     H  C   +  +H + Q N
Sbjct  645   CAGGGGDHRQYPPIMLLTADHDDRVVPSHTLKFLATMQ----HVLCTSLQ--EHGSPQTN  698


 Score = 96.3 bits (238),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 51/64 (80%), Gaps = 2/64 (3%)
 Frame = -3

Query  405  LVQTMQHVLCTS--AHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGA  232
             + TMQHVLCTS   H +PQTNPIV RI R +GHGCGR TQK+IDEAADRYAF AK++G 
Sbjct  677  FLATMQHVLCTSLQEHGSPQTNPIVARIARKSGHGCGRSTQKIIDEAADRYAFAAKMMGL  736

Query  231  HWIE  220
             WI+
Sbjct  737  SWID  740



>dbj|BAK03252.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=736

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/477 (65%), Positives = 373/477 (78%), Gaps = 15/477 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS+D++CW+D ++P+++ +  VTEDGKY L+ + E+ +PVNK+Y CDLSAL  
Sbjct  226   YHFLGTDQSDDVMCWRDPEHPKYIYAPEVTEDGKYVLLSVSESSEPVNKLYYCDLSAL--  283

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
                  +GT E+LPF K+VD FEA YG VAND   FT  TNK+AP+YKL R+DV +P  W 
Sbjct  284   --SAMKGTHEMLPFVKLVDEFEAFYGVVANDGTQFTILTNKDAPRYKLSRIDVDDPESWT  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ +D+K VLESA AV+ ++L+VNYLSDVK VLQ+R + TG +L HN+PIDIG+VNGI+
Sbjct  342   DVLPQDDKAVLESACAVHGDKLLVNYLSDVKYVLQMRSLVTGELL-HNIPIDIGSVNGIT  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR DS VFI F++FL P IIY+C+L S  PE+ I+REITVPGFDR  F   QVF  SKD
Sbjct  401   GRRADSEVFIEFSSFLTPGIIYRCDLSSGAPEMNIYREITVPGFDRTDFEAKQVFYQSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMF+V  K I LDGS+P LLFGYGGF  S+TP FS AR+V+ ++LG + C+ANIRG
Sbjct  461   GTKIPMFVVLRKSIVLDGSHPALLFGYGGFGMSMTPQFSAARVVLMRNLGFVTCIANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGE+WHKAG+LA KQNCFDDFI A E+L++AG+T PS+LCIEGGSNGGLL+ ACINQ
Sbjct  521   GGEYGEDWHKAGSLANKQNCFDDFIAAGEFLVSAGYTSPSRLCIEGGSNGGLLVAACINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RP LFGCALAHVGVMDMLRFHKFTIG AWT DFGCS+ EEEFHWLIKYSPLHNVRRPWE+
Sbjct  581   RPGLFGCALAHVGVMDMLRFHKFTIGRAWTCDFGCSEKEEEFHWLIKYSPLHNVRRPWEK  640

Query  508   T----HQAC--QYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHS  356
                  HQ    QYP TMLLTADHDDRVVP HT K+LA M     H  C   ++S  +
Sbjct  641   RAAGDHQRLRRQYPPTMLLTADHDDRVVPSHTLKFLATMQ----HVLCTSVEQSPQT  693


 Score =   100 bits (248),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + TMQHVLCTS   +PQTNPIV RI+R +GHGCGR TQK+IDEAADRYAF AK++G  W
Sbjct  675  FLATMQHVLCTSVEQSPQTNPIVARIDRKSGHGCGRSTQKIIDEAADRYAFAAKMMGVSW  734

Query  225  I  223
            I
Sbjct  735  I  735



>ref|XP_002510623.1| prolyl endopeptidase, putative [Ricinus communis]
 gb|EEF52810.1| prolyl endopeptidase, putative [Ricinus communis]
Length=696

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/485 (64%), Positives = 371/485 (76%), Gaps = 45/485 (9%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILCWKD +NP++M  ASVT+DGKY L+YI E+CDPVNKVY CD+SA   
Sbjct  222   YHLLGTDQSEDILCWKDPENPKYMFGASVTDDGKYLLLYIDESCDPVNKVYYCDISAFAE  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+RG ++LLPF K++D+ +A Y  +AND+  FTF TNK+AP+YKLVRVD++EP  W 
Sbjct  282   GLEGFRGRNDLLPFTKLIDNLDARYIAIANDDTRFTFLTNKDAPRYKLVRVDLREPSIWT  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ E EKDVLESA AVN ++L++ YLSDVK VLQ+RD++TG +L+H LP+DIGTVNGIS
Sbjct  342   DVVPEAEKDVLESASAVNGDKLILGYLSDVKYVLQVRDLKTGSLLHH-LPMDIGTVNGIS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKDS VFIGFT+FL P IIYQCNL S+VPE+KIFREI VPGFDR  F V QVFV SKD
Sbjct  401   ARRKDSTVFIGFTSFLTPGIIYQCNLDSEVPEMKIFREINVPGFDRTEFYVDQVFVPSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIP+FIV+ K+I LDGS+PCLL+GYGGF+ S+TP FS +R+++ +HLG +FC+ANIRG
Sbjct  461   GTKIPVFIVAKKNIKLDGSHPCLLYGYGGFNISLTPSFSVSRIILTRHLGAVFCIANIRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHK+G+L KKQNCFDDFI AAEYL++                           
Sbjct  521   GGEYGEEWHKSGSLEKKQNCFDDFISAAEYLVST--------------------------  554

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
                      AHVGVMDMLRFHKFTIGHAWTSD+GCSD EEEFHWLIKYSPLHNVRRPWEQ
Sbjct  555   ---------AHVGVMDMLRFHKFTIGHAWTSDYGCSDKEEEFHWLIKYSPLHNVRRPWEQ  605

Query  508   TH-QACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHSANQPNCGS  332
              + + C+YPSTMLLTADHDDRVVPLH+ K LA M     H  C     S  ++ Q N   
Sbjct  606   PNSRHCEYPSTMLLTADHDDRVVPLHSLKLLATMQ----HVLCT----SLENSPQTNLII  657

Query  331   HRAQC  317
              R +C
Sbjct  658   GRIEC  662


 Score =   105 bits (263),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQHVLCTS  N+PQTN I+GRIE  AGHG GRPTQKLIDEAADRY+FMAKVL A W
Sbjct  635  LLATMQHVLCTSLENSPQTNLIIGRIECKAGHGAGRPTQKLIDEAADRYSFMAKVLDATW  694

Query  225  IE  220
            IE
Sbjct  695  IE  696



>ref|XP_010667345.1| PREDICTED: prolyl endopeptidase-like [Beta vulgaris subsp. vulgaris]
Length=730

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/455 (67%), Positives = 365/455 (80%), Gaps = 4/455 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILCWKD  +PR+     VT+DGKY L++I  NC+ VNK+Y  +LS LPN
Sbjct  221   YHVLGTDQSEDILCWKDPKHPRYRFYPRVTDDGKYLLLHIENNCEEVNKLYYLNLSNLPN  280

Query  1588  -GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCW  1412
              GL+  +  + LLPF K+VD  +A Y +VAND+ +FTF+TNKNAP+ KLVR+D+ +P  W
Sbjct  281   DGLRSAQDANGLLPFTKLVDELDALYHYVANDDTIFTFQTNKNAPRCKLVRIDLNKPNVW  340

Query  1411  CDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGI  1232
              DVI E EKDVL +A   N NQL+V YL DVK +L++RD++TG  L   LPIDIGTV  I
Sbjct  341   TDVIPESEKDVLVTAEVANENQLIVCYLKDVKHLLEIRDLQTGDFL-QCLPIDIGTVR-I  398

Query  1231  SARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSK  1052
             SARRKD   F+ FT+FL   I YQC+L ++VP++KIFREI VP FDR+ F + QVFV SK
Sbjct  399   SARRKDRFAFVSFTSFLTFNITYQCDLAAEVPQMKIFREIFVPNFDRSEFKIDQVFVPSK  458

Query  1051  DGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIR  872
             DG KIPMFIV+ ++I LD SNPCLL+ YGGF+ S+TP FS  R ++ KHLG +FCLANIR
Sbjct  459   DGTKIPMFIVAKRNIVLDKSNPCLLYAYGGFNVSLTPGFSVIRTMLLKHLGAVFCLANIR  518

Query  871   GGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACIN  692
             GGGEYGEEWHKAGAL +KQNCFDDFI AAE+L++ G+TQPSKLCIEG SNGGLLIGACIN
Sbjct  519   GGGEYGEEWHKAGALERKQNCFDDFIAAAEFLVSKGYTQPSKLCIEGRSNGGLLIGACIN  578

Query  691   QRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE  512
             QRPDLFGCALAHVGVMDMLRFHKFTIGHAWT+DFGCSD EE+FH LIKYSPLHNV+RPWE
Sbjct  579   QRPDLFGCALAHVGVMDMLRFHKFTIGHAWTADFGCSDKEEDFHSLIKYSPLHNVQRPWE  638

Query  511   QTH-QACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
              +  +  QYP+TMLLTADHDDRVVPLH+ K LA M
Sbjct  639   SSSGRYIQYPATMLLTADHDDRVVPLHSLKLLATM  673


 Score = 91.3 bits (225),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+ LCTS   +PQ  PI+GRIE  AGHGCGRP QK IDEAADRY+FMAK++ A W
Sbjct  669  LLATMQYTLCTSLAKSPQITPIIGRIECKAGHGCGRPIQKEIDEAADRYSFMAKMVDAAW  728



>ref|XP_002446934.1| hypothetical protein SORBIDRAFT_06g025250 [Sorghum bicolor]
 gb|EES11262.1| hypothetical protein SORBIDRAFT_06g025250 [Sorghum bicolor]
Length=748

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/464 (66%), Positives = 369/464 (80%), Gaps = 12/464 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGT+QS+D+LCW+D D+P+++    VTEDGKY ++ + E  +PVNK+Y CDLSAL +
Sbjct  228   YHFLGTEQSQDVLCWRDPDHPKYIYIPEVTEDGKYVILSVSETSEPVNKLYYCDLSALAH  287

Query  1588  GLQGYRGT----DELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKE-  1424
             GL G        + +LPF K+VD FEA YG +AND   FTF TNK+APKYKL RVDV + 
Sbjct  288   GLGGITKQSTHGNGMLPFVKLVDKFEAYYGLIANDGTEFTFLTNKDAPKYKLARVDVDDD  347

Query  1423  -PGCWCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIG  1247
              PG W DV+ ED+K VLESA AV+ ++L+VNYLSDVK VLQ+R + TG  L  ++PIDIG
Sbjct  348   APGSWTDVVPEDDKAVLESACAVHGHKLLVNYLSDVKYVLQMRSLVTGEFLR-DIPIDIG  406

Query  1246  TVNGISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQV  1067
             TVNGIS RR DS VFI F +FL P IIY+C++ +++PE+ ++REI+VPGFDR  F   QV
Sbjct  407   TVNGISGRRVDSEVFIEFASFLTPGIIYRCDVSAEIPEMDVYREISVPGFDRNEFEAKQV  466

Query  1066  FVGSKDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFC  887
             F  SKDG KIPMFI+S K + LDGS+P LLFGYGGF  S+TP FS  R+V+ ++LG + C
Sbjct  467   FYPSKDGTKIPMFIISKKGMDLDGSHPALLFGYGGFGVSITPQFSVTRVVLMRNLGFVTC  526

Query  886   LANIRGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLI  707
             +ANIRGGGEYGE+WH+AG+LA KQNCFDDFI A E+L++AG+T P++LCIEGGSNGGLL+
Sbjct  527   VANIRGGGEYGEDWHRAGSLANKQNCFDDFIAAGEFLVSAGYTSPARLCIEGGSNGGLLV  586

Query  706   GACINQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNV  527
              AC+NQRPDLFGCALAHVGVMDMLRFHKFTIG AWT DFGCSDNEEEFHWLIKYSPLHNV
Sbjct  587   AACMNQRPDLFGCALAHVGVMDMLRFHKFTIGRAWTCDFGCSDNEEEFHWLIKYSPLHNV  646

Query  526   RRPWEQTHQAC-----QYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             RRPWE+   A      QYP+TMLLTADHDDRVVP HT K+LA M
Sbjct  647   RRPWEKEKWAAATGGGQYPATMLLTADHDDRVVPSHTLKFLATM  690


 Score = 89.4 bits (220),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHN-TPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAH  229
             + TMQHVL   A   +PQTNPI+ RIERN+GH CGR TQK+IDEAADRYAF AK++G  
Sbjct  686  FLATMQHVLRAGAEGGSPQTNPIIARIERNSGHCCGRSTQKIIDEAADRYAFAAKMMGVS  745

Query  228  WIE  220
            WI+
Sbjct  746  WID  748



>ref|XP_002964833.1| hypothetical protein SELMODRAFT_230523 [Selaginella moellendorffii]
 gb|EFJ33671.1| hypothetical protein SELMODRAFT_230523 [Selaginella moellendorffii]
Length=714

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/477 (64%), Positives = 366/477 (77%), Gaps = 24/477 (5%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQSEDILCWKDSDNP+ M  A VT+DGKY ++ I E CDPVN++Y+C+L +LPN
Sbjct  219   YHFLGTDQSEDILCWKDSDNPKWMFGAEVTDDGKYLVLSIEEGCDPVNRLYLCELDSLPN  278

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GLQG++G DELLPF ++VD F+A Y  +AND  VFTFRTNKNAP+YK+ RVD + P  W 
Sbjct  279   GLQGWKGKDELLPFERLVDKFDAKYEVIANDGNVFTFRTNKNAPRYKVTRVDTRNPETWT  338

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             D+I E  KDVL+SA  VN+ QLVV+YLSDVK VL++RD+  G +L   LP+DIGTV+GIS
Sbjct  339   DIIAESAKDVLDSAQCVNHQQLVVSYLSDVKHVLEVRDLEHGTLL-RTLPLDIGTVSGIS  397

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RRKD+ +F GFT+FL P +IY+C+L S+  E  +F+E             T VFV SKD
Sbjct  398   GRRKDAEIFYGFTSFLTPGVIYRCDL-SEDSEPTVFKE-------------TSVFVPSKD  443

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G K+PMFIV+ K I LDG +P LL+GYGGF+ S+TP FS +R+V+ +H GVIF +ANIRG
Sbjct  444   GTKVPMFIVAKKSIALDGKHPALLYGYGGFNISITPSFSASRIVLIQHCGVIFAIANIRG  503

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWH+AG+L  KQNCFDDF   +EYLI  G+TQP KL IEGGSNGGLL+ ACINQ
Sbjct  504   GGEYGEEWHRAGSLGNKQNCFDDFQACSEYLIKEGYTQPRKLGIEGGSNGGLLVAACINQ  563

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDL+GCALAHVGVMDMLRFHKFTIGHAWT+D+GCS+ EEEF WLIKYSPLHNV RPWE+
Sbjct  564   RPDLYGCALAHVGVMDMLRFHKFTIGHAWTTDYGCSEKEEEFKWLIKYSPLHNVLRPWEK  623

Query  508   THQ-ACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHSANQPN  341
                   QYP TMLLTADHDDRVVPLHT K LA +          V  +S  S+NQ N
Sbjct  624   PDGLGVQYPPTMLLTADHDDRVVPLHTLKLLATLQ--------HVLVKSSKSSNQTN  672


 Score = 84.3 bits (207),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+QHVL  S+ ++ QTNPIV RI+  AGHG GRPT+K+IDEAADR +F  K+ GA W
Sbjct  653  LLATLQHVLVKSSKSSNQTNPIVARIDTKAGHGAGRPTKKMIDEAADRLSFFVKMTGAEW  712

Query  225  IE  220
             E
Sbjct  713  TE  714



>gb|AGL51088.1| peptide cyclase 1 [Vaccaria hispanica]
Length=724

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/454 (65%), Positives = 362/454 (80%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQSEDIL W+D +NP H +   +T+DGKY L+YI + CD  NKVY  DL+ LPN
Sbjct  216   YHFLGTDQSEDILLWRDLENPAHHLKCQITDDGKYFLLYILDGCDDANKVYCLDLTKLPN  275

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+ +RG ++  PF K++D F+ASY  +AND +VFTF+TNK+AP+ KLVRVD+  P  W 
Sbjct  276   GLESFRGREDSAPFMKLIDSFDASYTAIANDGSVFTFQTNKDAPRKKLVRVDLNNPSVWT  335

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             D++ E +KD+LESA AVN NQL++ YLSDVK VL++RD+ +G  L H LPIDIG+V+GI+
Sbjct  336   DLVPESKKDLLESAHAVNENQLILRYLSDVKHVLEIRDLESGA-LQHRLPIDIGSVDGIT  394

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+DS+VF  FT+ L P I+YQC+L++   +LKIFRE  VP FDR+ F V QVFV SKD
Sbjct  395   ARRRDSVVFFKFTSILTPGIVYQCDLKNDPTQLKIFRESVVPDFDRSEFEVKQVFVPSKD  454

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIP+FI + K I LDGS+PC + GYGGF  ++ P FS +R+V  KHLG +FCLANIRG
Sbjct  455   GTKIPIFIAARKGISLDGSHPCEMHGYGGFGINMMPTFSASRIVFLKHLGGVFCLANIRG  514

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG   KKQN FDDFI AAEYLI++G+T+  ++ IEGGSNGGLL+ ACINQ
Sbjct  515   GGEYGEEWHKAGFRDKKQNVFDDFISAAEYLISSGYTKARRVAIEGGSNGGLLVAACINQ  574

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCA A+ GVMDMLRFHKFT+G+ WT D+GCSD EEEF WLIKYSP+HNVRRPWEQ
Sbjct  575   RPDLFGCAEANCGVMDMLRFHKFTLGYLWTGDYGCSDKEEEFKWLIKYSPIHNVRRPWEQ  634

Query  508   T-HQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
               ++  QYP+TM+LTADHDDRVVPLH+FK LA M
Sbjct  635   PGNEETQYPATMILTADHDDRVVPLHSFKLLATM  668


 Score = 77.0 bits (188),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQHVLCTS  ++PQ NPI+ RI+R A H  GR T   I E ADRY FMAK L A W
Sbjct  664  LLATMQHVLCTSLEDSPQKNPIIARIQRKAAH-YGRATMTQIAEVADRYGFMAKALEAPW  722

Query  225  IE  220
            I+
Sbjct  723  ID  724



>tpg|DAA36457.1| TPA: hypothetical protein ZEAMMB73_895418 [Zea mays]
Length=710

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/474 (64%), Positives = 371/474 (78%), Gaps = 22/474 (5%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGT+QS+D+LCW+D D+P+++    VTEDGKY ++ + E  +PVNK+Y CDLSAL +
Sbjct  181   YHFLGTEQSQDVLCWRDPDHPKYIYIPQVTEDGKYVILSVSETSEPVNKLYYCDLSALAH  240

Query  1588  GLQGYRGT--DELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVK--EP  1421
             GL G +    + +LPF K+VD FEA YG +AND   FTF TNK+AP+YKL RVDV   EP
Sbjct  241   GLGGVKSAHGNGMLPFVKLVDRFEAYYGLIANDGTQFTFLTNKDAPRYKLARVDVDDDEP  300

Query  1420  GC--WCDVIQEDE--KDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPID  1253
             G   W DV+ EDE  K VLESA AV+ ++L+V+YLSDV+ VLQ+R + TG +L H++P+D
Sbjct  301   GSPWWTDVVPEDEDGKAVLESACAVHGHKLLVSYLSDVRCVLQMRSLVTGELL-HDIPVD  359

Query  1252  IGTVNGISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVT  1073
             IGTV+GIS RR D+ VF+ F +FL P IIY+C++ S VPE+ ++REI+VPGFDR  F   
Sbjct  360   IGTVSGISGRRCDAEVFVEFASFLTPGIIYRCDVGSAVPEMDVYREISVPGFDRNEFEAK  419

Query  1072  QVFVGSKDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVI  893
             QVF  SKDG KIPMFIVS K+I LDGS+P LLFGYGGF  SVTP FS AR+V+ ++LG +
Sbjct  420   QVFYPSKDGTKIPMFIVSKKEISLDGSHPALLFGYGGFGVSVTPQFSVARVVLMRNLGFV  479

Query  892   FCLANIRGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGL  713
              C+AN+RGGGEYGE WH+AG+LA KQNCFDDF+ A E+L++AG+T P++LC+EGGSNGGL
Sbjct  480   ACVANLRGGGEYGEGWHRAGSLANKQNCFDDFVAAGEFLVSAGYTSPARLCVEGGSNGGL  539

Query  712   LIGACINQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLH  533
             L+ AC+NQRPDLFGCALAHVGVMDMLRFHKFTIG AWT DFGCS+NEEEF WLIKYSPLH
Sbjct  540   LVAACVNQRPDLFGCALAHVGVMDMLRFHKFTIGRAWTCDFGCSENEEEFQWLIKYSPLH  599

Query  532   NVRRPWEQTH--------QAC-----QYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             NVRRPWE            +C     QYP+TMLLTADHDDRVVP HT K+LA M
Sbjct  600   NVRRPWENKRAAAAANGDASCRGLGGQYPATMLLTADHDDRVVPSHTLKFLATM  653


 Score = 89.7 bits (221),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + TMQHVL   A  +PQTNP+V RIER +GH CGR TQK+IDEAADRYAF AK++G  W
Sbjct  649  FLATMQHVLRPGADGSPQTNPVVARIERKSGHCCGRSTQKIIDEAADRYAFAAKMMGVSW  708

Query  225  IE  220
            ++
Sbjct  709  MD  710



>tpg|DAA36459.1| TPA: hypothetical protein ZEAMMB73_895418 [Zea mays]
Length=756

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/474 (64%), Positives = 371/474 (78%), Gaps = 22/474 (5%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGT+QS+D+LCW+D D+P+++    VTEDGKY ++ + E  +PVNK+Y CDLSAL +
Sbjct  227   YHFLGTEQSQDVLCWRDPDHPKYIYIPQVTEDGKYVILSVSETSEPVNKLYYCDLSALAH  286

Query  1588  GLQGYRGT--DELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVK--EP  1421
             GL G +    + +LPF K+VD FEA YG +AND   FTF TNK+AP+YKL RVDV   EP
Sbjct  287   GLGGVKSAHGNGMLPFVKLVDRFEAYYGLIANDGTQFTFLTNKDAPRYKLARVDVDDDEP  346

Query  1420  GC--WCDVIQEDE--KDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPID  1253
             G   W DV+ EDE  K VLESA AV+ ++L+V+YLSDV+ VLQ+R + TG +L H++P+D
Sbjct  347   GSPWWTDVVPEDEDGKAVLESACAVHGHKLLVSYLSDVRCVLQMRSLVTGELL-HDIPVD  405

Query  1252  IGTVNGISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVT  1073
             IGTV+GIS RR D+ VF+ F +FL P IIY+C++ S VPE+ ++REI+VPGFDR  F   
Sbjct  406   IGTVSGISGRRCDAEVFVEFASFLTPGIIYRCDVGSAVPEMDVYREISVPGFDRNEFEAK  465

Query  1072  QVFVGSKDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVI  893
             QVF  SKDG KIPMFIVS K+I LDGS+P LLFGYGGF  SVTP FS AR+V+ ++LG +
Sbjct  466   QVFYPSKDGTKIPMFIVSKKEISLDGSHPALLFGYGGFGVSVTPQFSVARVVLMRNLGFV  525

Query  892   FCLANIRGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGL  713
              C+AN+RGGGEYGE WH+AG+LA KQNCFDDF+ A E+L++AG+T P++LC+EGGSNGGL
Sbjct  526   ACVANLRGGGEYGEGWHRAGSLANKQNCFDDFVAAGEFLVSAGYTSPARLCVEGGSNGGL  585

Query  712   LIGACINQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLH  533
             L+ AC+NQRPDLFGCALAHVGVMDMLRFHKFTIG AWT DFGCS+NEEEF WLIKYSPLH
Sbjct  586   LVAACVNQRPDLFGCALAHVGVMDMLRFHKFTIGRAWTCDFGCSENEEEFQWLIKYSPLH  645

Query  532   NVRRPWEQTH--------QAC-----QYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             NVRRPWE            +C     QYP+TMLLTADHDDRVVP HT K+LA M
Sbjct  646   NVRRPWENKRAAAAANGDASCRGLGGQYPATMLLTADHDDRVVPSHTLKFLATM  699


 Score = 89.4 bits (220),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + TMQHVL   A  +PQTNP+V RIER +GH CGR TQK+IDEAADRYAF AK++G  W
Sbjct  695  FLATMQHVLRPGADGSPQTNPVVARIERKSGHCCGRSTQKIIDEAADRYAFAAKMMGVSW  754

Query  225  IE  220
            ++
Sbjct  755  MD  756



>ref|XP_008669027.1| PREDICTED: prolyl endopeptidase isoform X1 [Zea mays]
 tpg|DAA36458.1| TPA: hypothetical protein ZEAMMB73_895418 [Zea mays]
Length=752

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/474 (64%), Positives = 371/474 (78%), Gaps = 22/474 (5%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGT+QS+D+LCW+D D+P+++    VTEDGKY ++ + E  +PVNK+Y CDLSAL +
Sbjct  223   YHFLGTEQSQDVLCWRDPDHPKYIYIPQVTEDGKYVILSVSETSEPVNKLYYCDLSALAH  282

Query  1588  GLQGYRGT--DELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVK--EP  1421
             GL G +    + +LPF K+VD FEA YG +AND   FTF TNK+AP+YKL RVDV   EP
Sbjct  283   GLGGVKSAHGNGMLPFVKLVDRFEAYYGLIANDGTQFTFLTNKDAPRYKLARVDVDDDEP  342

Query  1420  GC--WCDVIQEDE--KDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPID  1253
             G   W DV+ EDE  K VLESA AV+ ++L+V+YLSDV+ VLQ+R + TG +L H++P+D
Sbjct  343   GSPWWTDVVPEDEDGKAVLESACAVHGHKLLVSYLSDVRCVLQMRSLVTGELL-HDIPVD  401

Query  1252  IGTVNGISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVT  1073
             IGTV+GIS RR D+ VF+ F +FL P IIY+C++ S VPE+ ++REI+VPGFDR  F   
Sbjct  402   IGTVSGISGRRCDAEVFVEFASFLTPGIIYRCDVGSAVPEMDVYREISVPGFDRNEFEAK  461

Query  1072  QVFVGSKDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVI  893
             QVF  SKDG KIPMFIVS K+I LDGS+P LLFGYGGF  SVTP FS AR+V+ ++LG +
Sbjct  462   QVFYPSKDGTKIPMFIVSKKEISLDGSHPALLFGYGGFGVSVTPQFSVARVVLMRNLGFV  521

Query  892   FCLANIRGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGL  713
              C+AN+RGGGEYGE WH+AG+LA KQNCFDDF+ A E+L++AG+T P++LC+EGGSNGGL
Sbjct  522   ACVANLRGGGEYGEGWHRAGSLANKQNCFDDFVAAGEFLVSAGYTSPARLCVEGGSNGGL  581

Query  712   LIGACINQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLH  533
             L+ AC+NQRPDLFGCALAHVGVMDMLRFHKFTIG AWT DFGCS+NEEEF WLIKYSPLH
Sbjct  582   LVAACVNQRPDLFGCALAHVGVMDMLRFHKFTIGRAWTCDFGCSENEEEFQWLIKYSPLH  641

Query  532   NVRRPWEQTH--------QAC-----QYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             NVRRPWE            +C     QYP+TMLLTADHDDRVVP HT K+LA M
Sbjct  642   NVRRPWENKRAAAAANGDASCRGLGGQYPATMLLTADHDDRVVPSHTLKFLATM  695


 Score = 89.4 bits (220),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + TMQHVL   A  +PQTNP+V RIER +GH CGR TQK+IDEAADRYAF AK++G  W
Sbjct  691  FLATMQHVLRPGADGSPQTNPVVARIERKSGHCCGRSTQKIIDEAADRYAFAAKMMGVSW  750

Query  225  IE  220
            ++
Sbjct  751  MD  752



>ref|XP_008669028.1| PREDICTED: prolyl endopeptidase isoform X2 [Zea mays]
Length=714

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/473 (63%), Positives = 371/473 (78%), Gaps = 22/473 (5%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGT+QS+D+LCW+D D+P+++    VTEDGKY ++ + E  +PVNK+Y CDLSAL +
Sbjct  223   YHFLGTEQSQDVLCWRDPDHPKYIYIPQVTEDGKYVILSVSETSEPVNKLYYCDLSALAH  282

Query  1588  GLQGYRGT--DELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVK--EP  1421
             GL G +    + +LPF K+VD FEA YG +AND   FTF TNK+AP+YKL RVDV   EP
Sbjct  283   GLGGVKSAHGNGMLPFVKLVDRFEAYYGLIANDGTQFTFLTNKDAPRYKLARVDVDDDEP  342

Query  1420  GC--WCDVIQEDE--KDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPID  1253
             G   W DV+ EDE  K VLESA AV+ ++L+V+YLSDV+ VLQ+R + TG +L H++P+D
Sbjct  343   GSPWWTDVVPEDEDGKAVLESACAVHGHKLLVSYLSDVRCVLQMRSLVTGELL-HDIPVD  401

Query  1252  IGTVNGISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVT  1073
             IGTV+GIS RR D+ VF+ F +FL P IIY+C++ S VPE+ ++REI+VPGFDR  F   
Sbjct  402   IGTVSGISGRRCDAEVFVEFASFLTPGIIYRCDVGSAVPEMDVYREISVPGFDRNEFEAK  461

Query  1072  QVFVGSKDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVI  893
             QVF  SKDG KIPMFIVS K+I LDGS+P LLFGYGGF  SVTP FS AR+V+ ++LG +
Sbjct  462   QVFYPSKDGTKIPMFIVSKKEISLDGSHPALLFGYGGFGVSVTPQFSVARVVLMRNLGFV  521

Query  892   FCLANIRGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGL  713
              C+AN+RGGGEYGE WH+AG+LA KQNCFDDF+ A E+L++AG+T P++LC+EGGSNGGL
Sbjct  522   ACVANLRGGGEYGEGWHRAGSLANKQNCFDDFVAAGEFLVSAGYTSPARLCVEGGSNGGL  581

Query  712   LIGACINQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLH  533
             L+ AC+NQRPDLFGCALAHVGVMDMLRFHKFTIG AWT DFGCS+NEEEF WLIKYSPLH
Sbjct  582   LVAACVNQRPDLFGCALAHVGVMDMLRFHKFTIGRAWTCDFGCSENEEEFQWLIKYSPLH  641

Query  532   NVRRPWEQTH--------QAC-----QYPSTMLLTADHDDRVVPLHTFKYLAM  413
             NVRRPWE            +C     QYP+TMLLTADHDDRVVP HT K+LA+
Sbjct  642   NVRRPWENKRAAAAANGDASCRGLGGQYPATMLLTADHDDRVVPSHTLKFLAI  694



>gb|EMT12618.1| Prolyl endopeptidase [Aegilops tauschii]
Length=727

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/464 (64%), Positives = 359/464 (77%), Gaps = 13/464 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGT+QS+D++CW+D ++P+++ +  VTEDGKY L+ + E+ +PVNK+Y CDLSAL +
Sbjct  245   YHFLGTEQSDDVMCWRDPEHPKYIYTPEVTEDGKYVLLSVSESSEPVNKLYYCDLSALSH  304

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL G +GT E+LPF K+VD FEA YG VAND   FT  TNK+AP+YKL RVDV +P  W 
Sbjct  305   GLSGTKGTHEMLPFVKLVDEFEACYGVVANDGTRFTVLTNKDAPRYKLSRVDVDDPQSWT  364

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ ED+K VLE A AV+ ++L+VNYLSDVK VLQ+R +  G +L H +PIDIG+VNGI+
Sbjct  365   DVLPEDDKAVLEYACAVHGDKLLVNYLSDVKYVLQMRSLAAGELL-HGIPIDIGSVNGIT  423

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR DS VF+ F++FL P I+Y+C+L S VPE+ I+REITVPGFDR  F   QVF  SKD
Sbjct  424   GRRCDSEVFVEFSSFLTPGIVYRCDLSSGVPEMSIYREITVPGFDRTDFEAKQVFYPSKD  483

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMF+VS K+I LDGS+P LLFGYGGF  S+TP FS AR+V+ ++LG + C+ANIRG
Sbjct  484   GTKIPMFVVSRKNIDLDGSHPALLFGYGGFGMSMTPQFSAARVVLMRNLGFVTCVANIRG  543

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+LA KQNC D  I A     AAG   PS+LCIEGGSNGGLL+ ACINQ
Sbjct  544   GGEYGEEWHKAGSLANKQNCLDGLIAAGGSPCAAGARTPSRLCIEGGSNGGLLVAACINQ  603

Query  688   -------RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHN  530
                    RP LFGCALAHVGVMDMLRFHKFTIG AW  DFGCS+ EEEF WLIKYSPLHN
Sbjct  604   LISFVPKRPGLFGCALAHVGVMDMLRFHKFTIGRAWACDFGCSEEEEEFRWLIKYSPLHN  663

Query  529   VRRPWEQ-----THQACQYPSTMLLTADHDDRVVPLHTFKYLAM  413
             VRRPWE+      H+  QYP TMLLTA HDDRVVP HT K+LA+
Sbjct  664   VRRPWEKGAGGDQHRRQQYPPTMLLTAAHDDRVVPSHTLKFLAI  707



>ref|XP_001757912.1| predicted protein [Physcomitrella patens]
 gb|EDQ77154.1| predicted protein [Physcomitrella patens]
Length=740

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/453 (62%), Positives = 358/453 (79%), Gaps = 1/453 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQSEDILCW+DS++ + +  A VT+DG+Y  + I E CDPVN++Y CDLSALP+
Sbjct  228   YHFLGTDQSEDILCWRDSEHAQWLSYAEVTDDGQYLALSIEEGCDPVNRLYYCDLSALPH  287

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G R  +E LPF K+VD+F+A Y  VAN+ ++FTF TNK+AP+YKL RV+V++P  W 
Sbjct  288   GLEGLRQNNEQLPFVKLVDNFDAQYELVANEGSIFTFLTNKDAPRYKLTRVNVEDPSSWK  347

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ E + DVL SA  VN  QLV+ Y+SDVK +L+L ++++G +L H+LP++IG+V  IS
Sbjct  348   DVVPESKTDVLTSADLVNKQQLVLCYMSDVKHLLKLHNLQSGAML-HSLPLEIGSVAEIS  406

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              R +DS  F  FT+FL P  IY+C+L +  P++ + +E  +   DR+ F   QVFV SKD
Sbjct  407   GRPEDSEFFYSFTSFLTPGTIYRCDLSTGTPDVTVLKETKIANLDRSLFETRQVFVPSKD  466

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
               K+PMF+V+ K + LDG++P LL+GYGGF+ S+TP FS +RLV+A+H G +  +ANIRG
Sbjct  467   KTKVPMFVVARKGLVLDGNHPALLYGYGGFNVSLTPSFSVSRLVLAQHFGAVIAIANIRG  526

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGE+WHKAG+LA KQNCFDDFI   EYL+  G+TQ  KLCIEGGSNGGLL+ ACINQ
Sbjct  527   GGEYGEKWHKAGSLANKQNCFDDFIACGEYLVKEGYTQSKKLCIEGGSNGGLLVAACINQ  586

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDL+GCALAHVGVMDMLRFHKFTIGHAWTSD+GC+DN EEF WLIKYSPLHNV+RPWE 
Sbjct  587   RPDLYGCALAHVGVMDMLRFHKFTIGHAWTSDYGCADNAEEFDWLIKYSPLHNVKRPWEN  646

Query  508   THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
               ++ QYP+TMLLTADHDDRVVPLH+ K LA +
Sbjct  647   GSESIQYPATMLLTADHDDRVVPLHSLKLLATL  679


 Score = 76.6 bits (187),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (70%), Gaps = 4/66 (6%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKL----IDEAADRYAFMAKVL  238
            L+ T+Q+ LCTS  N+ QTNPI+ RI+  AGHG GRPT+K+    IDE  D Y+F AK+ 
Sbjct  675  LLATLQYELCTSVENSKQTNPIIARIDTKAGHGSGRPTKKIFIVQIDEMVDAYSFFAKMT  734

Query  237  GAHWIE  220
             + W++
Sbjct  735  DSKWVD  740



>ref|XP_001754097.1| predicted protein [Physcomitrella patens]
 gb|EDQ80998.1| predicted protein [Physcomitrella patens]
Length=729

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/485 (59%), Positives = 356/485 (73%), Gaps = 12/485 (2%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS+DILCWKD ++   + S  +T+DGKY L+ I E CDPVN++Y CDL+ +  
Sbjct  222   YHFLGTDQSDDILCWKDLEHSAWLSSTRITDDGKYLLLLIGEGCDPVNRLYYCDLTEISG  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+  + T+ +LPF K+VD+FEA + +VAND  +FTF TNKNAPKYK+ RV + +P  W 
Sbjct  282   GLKILKDTNSILPFTKLVDNFEAQHLYVANDGPIFTFFTNKNAPKYKVTRVSINDPEVWW  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             +VI E E DVL S   VN   L+  Y+ DVK VLQ+ D+RTG      LP+DIG+V  IS
Sbjct  342   NVIPESETDVLSSVRCVNEKNLLACYIHDVKHVLQVHDLRTGE-FQWRLPLDIGSVTEIS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
               RKDS +FI  T+FL P  IY+ +L +  PELK+ REI    F R+ F   QVFV SKD
Sbjct  401   GNRKDSEIFINVTSFLTPGTIYRSDLSAPKPELKVLREIGSEIFVRSRFETKQVFVTSKD  460

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G K+PMFIVS KD+  DG++P LL+GYGGF+ S+TP FS +RLV+ +H G +  +AN+RG
Sbjct  461   GAKVPMFIVSEKDLVQDGNHPALLYGYGGFNISLTPSFSVSRLVLVQHYGAVVAVANVRG  520

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG L KKQNCFDDFI   EYL+  G+TQ ++LCIEGGSNGGLL+ ACINQ
Sbjct  521   GGEYGEEWHKAGCLLKKQNCFDDFISCGEYLVKEGYTQSNRLCIEGGSNGGLLVAACINQ  580

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRFHKFTIGHAWTS++GCSDNEE+FH LIK+SP+HNV RPWEQ
Sbjct  581   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSEYGCSDNEEDFHNLIKFSPIHNVCRPWEQ  640

Query  508   THQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM--PCPDHAACP--------VYKRSQH  359
               +  QYPSTMLLTADHDDRVVPLH+ K LA +    C   A  P        + +++ H
Sbjct  641   M-KGLQYPSTMLLTADHDDRVVPLHSLKLLAALQYTLCTSLADSPQTNPIIARIDRKAGH  699

Query  358   SANQP  344
              A +P
Sbjct  700   GAGRP  704


 Score = 82.8 bits (203),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+  +Q+ LCTS  ++PQTNPI+ RI+R AGHG GRPTQK+IDE  D Y+F+ ++  A W
Sbjct  668  LLAALQYTLCTSLADSPQTNPIIARIDRKAGHGAGRPTQKIIDEVIDAYSFVVEMTSATW  727

Query  225  IE  220
            ++
Sbjct  728  MD  729



>gb|KEH40255.1| prolyl oligopeptidase-like protein [Medicago truncatula]
Length=530

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/455 (61%), Positives = 338/455 (74%), Gaps = 45/455 (10%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQSEDILCW+D  N ++M  +SVT DGKY L+ I E CDPVNK+Y  DLS LPN
Sbjct  62    YHFLGTDQSEDILCWRDLKNSKYMFDSSVTGDGKYVLLSINEGCDPVNKMYYFDLSELPN  121

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G++  +  LPF +++D+F+A Y  +AND+ VFTF TNKNAPKYKLVRVD+KEP  W 
Sbjct  122   GLEGFQNENAFLPFVELIDNFDAMYQAIANDDTVFTFLTNKNAPKYKLVRVDLKEPNTWT  181

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVIQE EKDVL+ A                   + +RD+ TG  L H LPIDIGTV+ IS
Sbjct  182   DVIQESEKDVLKEAY-----------------AVNVRDLETGS-LQHQLPIDIGTVSEIS  223

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNL-QSKVPELKIFREITVPGFDRASFNVTQVFVGSK  1052
             +RRKDS+V+IGFT+FL P IIYQCN+ ++++P++KIFREI VPGFDR+ F+V QVF  SK
Sbjct  224   SRRKDSVVYIGFTSFLTPSIIYQCNIGRTQIPDMKIFREIVVPGFDRSEFHVNQVFAPSK  283

Query  1051  DGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIR  872
             DG KIPMFIV+ KDI LDGS+PCLL+GYGG++ S+TP FS + +V+A++LG +FC+ANIR
Sbjct  284   DGTKIPMFIVARKDIILDGSHPCLLYGYGGYNISLTPSFSVSHIVLARYLGFVFCIANIR  343

Query  871   GGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACIN  692
             GGGEYGEEWHKA +L+ KQNCFDDFI  AEYL++ G+TQP KLCIEGGSNGGLL+   I+
Sbjct  344   GGGEYGEEWHKAASLSNKQNCFDDFISLAEYLVSTGYTQPKKLCIEGGSNGGLLVVPQIH  403

Query  691   QRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE  512
                                      IGHAWTS+FG  D EEEFHWLIKYSPLHNV RPWE
Sbjct  404   -------------------------IGHAWTSEFGSPDKEEEFHWLIKYSPLHNVWRPWE  438

Query  511   Q-THQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             Q   ++ QYP TMLL ADHDDRVVPLH+ K LA M
Sbjct  439   QHPDKSIQYPPTMLLIADHDDRVVPLHSLKLLATM  473


 Score = 97.1 bits (240),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ TMQ+VL TS   +PQTNPI+ RIE  AGHG GRPTQK+IDEAAD Y FMAK+L AHW
Sbjct  469  LLATMQYVLVTSLDKSPQTNPIIARIECKAGHGAGRPTQKIIDEAADTYTFMAKMLEAHW  528

Query  225  IE  220
            IE
Sbjct  529  IE  530



>gb|EPS72019.1| hypothetical protein M569_02738, partial [Genlisea aurea]
Length=726

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/488 (59%), Positives = 368/488 (75%), Gaps = 16/488 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLG DQ EDI  W D +NP+HM  ASV++DGK+ L+Y +ENC P +K++ CD+S L  
Sbjct  218   YHFLGNDQCEDIRVWCDPENPKHMFHASVSDDGKFILLYTYENCSPAHKLFYCDISTLSK  277

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP-GCW  1412
             GL+GY  + ELLPF K+VD F++ Y +VAND  VFTF T+ +AP+ KL+R+D+ +P    
Sbjct  278   GLEGYARSKELLPFVKLVDTFDSLYRYVANDGKVFTFLTSHDAPRNKLIRLDLWKPEDRS  337

Query  1411  CDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGI  1232
              +V+ EDE+DVLESA AVN +Q++V+YLSDVK+VLQLRD++TG +L   LP+DIGT++ I
Sbjct  338   IEVLGEDERDVLESAAAVNGDQMLVSYLSDVKNVLQLRDLKTGTLLR-RLPLDIGTISDI  396

Query  1231  SARRKDSIVFIGFTNFLIPLIIYQCNLQSKV-PELKIFREITVPGFDRASF-----NVTQ  1070
             S RRKD + FI FT+FLIP II+  +L+S+V  E+K+FRE  VPGFD   F      + Q
Sbjct  397   SCRRKDGVFFIKFTSFLIPGIIFTGDLRSQVMEEIKVFRETHVPGFDPTEFCFSLVMMMQ  456

Query  1069  VFVGSKDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIF  890
             VFV SKDG  +PMF+V+ K I LDGS+PCLL+GYGG   S+TPYFS  RLV++KHL  + 
Sbjct  457   VFVCSKDGTAVPMFVVTRKGIALDGSHPCLLYGYGGHGVSLTPYFSAGRLVLSKHLNAVV  516

Query  889   CLANIRGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLL  710
             C+AN+RGGGEYGE WH+ G L++KQN FDDF+  AEY+++ G+T+P +LCIEG SNGGLL
Sbjct  517   CVANVRGGGEYGEGWHRGGTLSRKQNSFDDFVSCAEYVVSCGYTEPRRLCIEGVSNGGLL  576

Query  709   IGACINQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHN  530
             IGAC+NQRPDLFGCALAHVGVMDMLRFHKF+IGHAWTS+FGC D EE+FHW+IKYSPLHN
Sbjct  577   IGACLNQRPDLFGCALAHVGVMDMLRFHKFSIGHAWTSEFGCPDKEEDFHWIIKYSPLHN  636

Query  529   VRRPWEQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM---MPCPDHAACPVYKRSQH  359
             VRR          +P+ MLLTADHDDRVVPLH+ K +A M   + C      P+  R + 
Sbjct  637   VRRRGPDE----AFPAVMLLTADHDDRVVPLHSLKLVATMQHEVMCSTPGKNPIIVRVER  692

Query  358   SANQPNCG  335
             +A    CG
Sbjct  693   NAGH-GCG  699


 Score = 80.9 bits (198),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 46/63 (73%), Gaps = 5/63 (8%)
 Frame = -3

Query  405  LVQTMQH-VLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAH  229
            LV TMQH V+C+    TP  NPI+ R+ERNAGHGCG PT K I E ADRY FMAK++ A 
Sbjct  668  LVATMQHEVMCS----TPGKNPIIVRVERNAGHGCGMPTDKTISEVADRYGFMAKMVDAE  723

Query  228  WIE  220
            W++
Sbjct  724  WVD  726



>ref|XP_001763118.1| predicted protein [Physcomitrella patens]
 gb|EDQ71995.1| predicted protein [Physcomitrella patens]
Length=723

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/471 (57%), Positives = 346/471 (73%), Gaps = 5/471 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGTDQS+DILCW+DS++ +    A +T+DG+Y ++ I E+CDPVN++Y C+LS LP 
Sbjct  215   YHFLGTDQSQDILCWRDSEHAQWFSRAEITDDGQYLVLSIEESCDPVNRLYYCNLSTLPQ  274

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G R   E LP  K++D+F+A Y  VAN+ ++FTF TNK+APK KL RV + +P  W 
Sbjct  275   GLEGLRQNKEHLPMIKLIDNFDAQYELVANEGSLFTFLTNKDAPKNKLTRVSLDDPSSWK  334

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ E E DVL SA  VN  QLV+ Y+SDVK +LQL D+++G +L   LP++IG++  IS
Sbjct  335   DVVPESESDVLTSADLVNRQQLVLCYMSDVKHLLQLNDLQSGHLL-QKLPLEIGSICEIS  393

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             +R +D+  F  FT+FL P IIY+C+L S  P+L + +E  +  +DR+ F + Q F  SKD
Sbjct  394   SRPEDADFFYSFTSFLTPGIIYRCDLSSGTPDLSVLKETKIANWDRSLFEIRQEFATSKD  453

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
               ++PMF+V+ K +  +G +P +L+GYGGF+ S+ PYFS +RLV+ +H G +   AN RG
Sbjct  454   ETRVPMFVVAKKGLVRNGDHPAVLYGYGGFNVSLMPYFSVSRLVLVQHYGAVVATANTRG  513

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGE+WHKAGALA KQNCFDDFI   E+LI  G+TQ  KLCIEGGSNGGLL+  CINQ
Sbjct  514   GGEYGEKWHKAGALANKQNCFDDFIACGEHLIKEGYTQNKKLCIEGGSNGGLLVAVCINQ  573

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RPDLFGCALAHVGVMDMLRF KFTIGHAW SD+GC+D  EEF WLIKYSPLHNV+RPWE 
Sbjct  574   RPDLFGCALAHVGVMDMLRFQKFTIGHAWISDYGCADIAEEFDWLIKYSPLHNVKRPWEN  633

Query  508   THQACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHS  356
               ++ QYP+TML TADHDDRVVP H+ K LA +     +  C     SQ +
Sbjct  634   GTKSIQYPATMLFTADHDDRVVPSHSLKLLATLQ----YELCTSLDNSQQT  680


 Score = 85.5 bits (210),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+Q+ LCTS  N+ QTNPI+GRIE  AGHG GRPT K+IDE  D Y+F AK+  + W
Sbjct  662  LLATLQYELCTSLDNSQQTNPIIGRIETKAGHGSGRPTMKIIDEMVDAYSFFAKMTDSAW  721

Query  225  IE  220
            IE
Sbjct  722  IE  723



>ref|XP_001780642.1| predicted protein [Physcomitrella patens]
 gb|EDQ54528.1| predicted protein [Physcomitrella patens]
Length=730

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/454 (60%), Positives = 341/454 (75%), Gaps = 2/454 (0%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGT+Q EDILCW+D ++   +  A V+EDG+Y ++ I E CDPVN++Y+CDL AL  
Sbjct  223   YHFLGTNQCEDILCWRDIEHGSWLTDAKVSEDGQYLVLSISEGCDPVNRLYLCDLCALSG  282

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL G+ GT+ LLPF K+VD FEA + +VAND  VFTF TNKNAP+YK+ RVDV  P  W 
Sbjct  283   GLAGFLGTNTLLPFQKLVDCFEAHFDYVANDGPVFTFYTNKNAPRYKVSRVDVGNPAVWS  342

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVI E   +V+ S   VN+NQL+V ++SDVK VLQ+ D+ TG  +   LPI+IGTVN  S
Sbjct  343   DVIPESHSNVITSVKCVNSNQLLVCHISDVKHVLQIHDLETGDFIRR-LPIEIGTVNSTS  401

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
               R+D  VF  FT+FL P  +Y+C+L +  PE ++ RE+    FDR+ F   QVFV SKD
Sbjct  402   GSRRDPEVFFNFTSFLTPGTVYRCDLSAPEPEPQVLREVGPSNFDRSIFETKQVFVTSKD  461

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
               K+PMFI+S K +  DG++P LL GYGGF+ S+TP FS +RLV+A+H G +  +ANIRG
Sbjct  462   QTKVPMFIISRKGLVKDGNHPALLVGYGGFNVSMTPNFSVSRLVLARHYGAVVAVANIRG  521

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHK G L+KK+N FDDFI  +E+LI  G+TQ +KLCIEG SNGGLL+ AC+NQ
Sbjct  522   GGEYGEEWHKDGTLSKKKNSFDDFIACSEFLIREGYTQSNKLCIEGSSNGGLLVAACVNQ  581

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWEQ  509
             RP+LFGCALAHVGVMDMLRFHKFTIGHAW +D+GCSD E++FH LI+YSPLHNV RPWE+
Sbjct  582   RPELFGCALAHVGVMDMLRFHKFTIGHAWVTDYGCSDKEDDFHSLIEYSPLHNVWRPWEK  641

Query  508   THQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM  407
                  QYP  MLLTADHDDRVVPLH+ K LA + 
Sbjct  642   L-IGVQYPPIMLLTADHDDRVVPLHSLKLLATLQ  674


 Score = 93.6 bits (231),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+QH LCTS  ++PQTNPI+GRI++ AGHGCGRPTQK+I+E +D Y+F AK+  + W
Sbjct  669  LLATLQHELCTSVEDSPQTNPIIGRIDKKAGHGCGRPTQKMINEVSDTYSFFAKMTRSSW  728

Query  225  IE  220
            +E
Sbjct  729  VE  730



>emb|CDX73235.1| BnaC06g36830D [Brassica napus]
Length=720

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/472 (60%), Positives = 349/472 (74%), Gaps = 23/472 (5%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHF+GTDQS+ ILCW+DS+NP++M  A VT+DGK+ ++   E CDPVNK+Y CDLS+L  
Sbjct  228   YHFIGTDQSQYILCWRDSENPKYMFGAEVTDDGKFLIMTTEEGCDPVNKLYYCDLSSLSG  287

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+ +RG+   LPF K+VD  +  Y  ++NDE +FTF TNK+APKYKLVRVD+KEP  W 
Sbjct  288   GLESFRGSISFLPFIKLVDTLDEQYNIISNDETLFTFLTNKDAPKYKLVRVDLKEPNSWT  347

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ E EKDVL SA AVN NQLV  Y+SDVK +LQ+RD+++G +L H LP+DIG+V+ +S
Sbjct  348   DVVGEHEKDVLASACAVNGNQLVTCYMSDVKHILQIRDMKSGSLL-HQLPLDIGSVSDVS  406

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARRKD+  F  FT+FL P +IY+C+L ++ PE+K+FRE+ VPGFD  +F  TQVF  SKD
Sbjct  407   ARRKDNTFFFSFTSFLTPGVIYKCDLANEAPEVKVFREVAVPGFDMEAFQATQVFYPSKD  466

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFIV+ KDI LDGS+PCLL+ YGGF+ S+TP FS +R+V++KHLG +FC ANIR 
Sbjct  467   GTKIPMFIVAKKDIKLDGSHPCLLYAYGGFNISITPSFSASRIVLSKHLGAVFCSANIRV  526

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
              G  G    K   L   +           YL  +            GSNGGLLIGACINQ
Sbjct  527   VGSMGRNGTKRVHLPTSRTA-----SMTSYLGHS------------GSNGGLLIGACINQ  569

Query  688   RPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE-  512
             RP+LFGCALAHVGVMDMLRFHKFTIGHAWT+D+GCS+NEEEFHWLIKYSPLHNV+RPWE 
Sbjct  570   RPNLFGCALAHVGVMDMLRFHKFTIGHAWTTDYGCSENEEEFHWLIKYSPLHNVKRPWEQ  629

Query  511   QTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYKRSQHS  356
             QT  + QYPSTMLLT+DHDDRVVPLH+ K LA +     H  C   + S  +
Sbjct  630   QTGNSVQYPSTMLLTSDHDDRVVPLHSLKLLATLQ----HMLCTSLENSPQT  677


 Score = 96.3 bits (238),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+QH+LCTS  N+PQTNPI+GRIE  AGH  GRPT+K+IDE ADRY+FMAK++ A W
Sbjct  659  LLATLQHMLCTSLENSPQTNPIIGRIEVKAGHRAGRPTKKMIDEPADRYSFMAKMVNAPW  718

Query  225  IE  220
             E
Sbjct  719  TE  720



>ref|XP_001783134.1| predicted protein [Physcomitrella patens]
 gb|EDQ52071.1| predicted protein [Physcomitrella patens]
Length=726

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/454 (59%), Positives = 338/454 (74%), Gaps = 3/454 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH+LGTDQSEDILCW D ++P    SA ++ DG+Y L+ I E CDPVN++Y  D+S L  
Sbjct  218   YHYLGTDQSEDILCWWDLEHPAWQSSAIISGDGQYLLLSIREGCDPVNRLYYYDVSTLTK  277

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
              L   + ++ +L F K++D+ EA Y +VAND  VFTF TNKNAP+YK+ RVD   P  W 
Sbjct  278   DLVLLKDSNSMLSFTKLIDNLEAQYQYVANDGPVFTFLTNKNAPRYKVSRVDFNNPEVWS  337

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DVI E + DVL S   VN NQL+V Y+ DVK +LQ+ D+ TG      LP++IG+V   S
Sbjct  338   DVILESQSDVLTSVTCVNKNQLLVCYMQDVKHLLQIHDLYTGA-FQWRLPLEIGSVTDTS  396

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR+D  +FI FT+FLIP  +Y+C+L +  PE+++  E+    FDR+ F   QVFV SKD
Sbjct  397   GRREDCEIFINFTSFLIPGTVYRCDLSTPNPEVRVLHEVGSQIFDRSRFETKQVFVTSKD  456

Query  1048  -GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIR  872
                +IPMFI+S K +  DG++P LL+GYGGF+ S+TP FS +RLV+A+H G +  +ANIR
Sbjct  457   KAARIPMFIISEKGLVQDGNHPALLYGYGGFNISLTPSFSVSRLVLARHYGAVLAVANIR  516

Query  871   GGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACIN  692
             GGGEYGEEWHKAG+L  KQNCFDDFI  AEYLI  G+TQ +KLCIEGGSNGGLL+ ACIN
Sbjct  517   GGGEYGEEWHKAGSLRDKQNCFDDFISCAEYLIEEGYTQSNKLCIEGGSNGGLLVAACIN  576

Query  691   QRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPWE  512
             QRP+LFGCALAHVGVMDMLRFHKFTIGHAW SD+GCSD EE+F+ LIKYSP+HNV RPWE
Sbjct  577   QRPELFGCALAHVGVMDMLRFHKFTIGHAWISDYGCSDVEEDFYNLIKYSPIHNVWRPWE  636

Query  511   QTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             +  +  QYP  +LLTADHDDRVVPLH+ K LA +
Sbjct  637   KL-KGVQYPPILLLTADHDDRVVPLHSLKLLATL  669


 Score = 87.0 bits (214),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+Q+ LCTS+    QTNPI+ RI+R AGHG GRPTQK+IDE  D Y F AK++GA W
Sbjct  665  LLATLQYTLCTSSTKLYQTNPIIARIDRKAGHGAGRPTQKMIDEVTDAYTFFAKMVGATW  724

Query  225  IE  220
            ++
Sbjct  725  VD  726



>gb|EEE53725.1| hypothetical protein OsJ_00069 [Oryza sativa Japonica Group]
Length=803

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/527 (56%), Positives = 361/527 (69%), Gaps = 75/527 (14%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH +G+DQSEDILCWKD ++P++   ASVTEDGKY ++  +E CDPVNK+Y C++  LP 
Sbjct  221   YHVVGSDQSEDILCWKDPEHPKYSFGASVTEDGKYIILGTYEGCDPVNKLYYCEICTLPQ  280

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             G++G++ T  +LPF K++D+F+A Y  VAND   FTF TN+NAPK KLVRVD+K+P  W 
Sbjct  281   GIEGFKETKGMLPFVKLIDNFDAQYHVVANDGDEFTFLTNRNAPKNKLVRVDIKKPELWT  340

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             D++ E E+DVLESA AVN NQL+V Y+SDVK +LQ+RD+ TG +L H LP++IG+V+ IS
Sbjct  341   DILPEHERDVLESADAVNGNQLLVCYMSDVKHILQIRDLVTGNLL-HKLPLEIGSVSEIS  399

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQV------  1067
              RR+D  VFIGFT+FL P IIY+CNL S +PE+KIFREI+VPGFDR +F V Q+      
Sbjct  400   CRREDMDVFIGFTSFLSPGIIYRCNLTSAIPEMKIFREISVPGFDRTNFEVKQIFVNSKD  459

Query  1066  ------FVGSKDGVKI-------------------PMFIVSGKDICLD-GSNPCLLFGYG  965
                   F+ SK  +++                   P F VS   +C + G   C+    G
Sbjct  460   GTKIPMFIMSKRDIELDGSHPTLLYGYGGFNISLTPSFSVSRVVLCKNMGFVVCVANIRG  519

Query  964   G------------------------------FSASVTPYF-------STARLVIA----K  908
             G                               SA  T Y        S   L+IA    +
Sbjct  520   GGEYGEEWHKAGARAMKQNCFDDFIACAELLISAGYTSYRQLCIEGGSNGGLLIAACVNQ  579

Query  907   HLGVIFCLANIRGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGG  728
             ++G + C+ANIRGG EYGEEWHKAGA A KQNCFDDFI  AE LI+AG+T   +LCIEGG
Sbjct  580   NMGFVVCVANIRGGWEYGEEWHKAGARAMKQNCFDDFIACAELLISAGYTSYRQLCIEGG  639

Query  727   SNGGLLIGACINQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIK  548
             SNGGLLI AC+NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWT+D+GCSDNEEEFHWLIK
Sbjct  640   SNGGLLIAACVNQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTTDYGCSDNEEEFHWLIK  699

Query  547   YSPLHNVRRPWEQTH-QACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             YSPLHNVRRPWEQ+    CQYP+ MLLTADHDDRVVPLH+ K LA +
Sbjct  700   YSPLHNVRRPWEQSFVNCCQYPAIMLLTADHDDRVVPLHSLKLLATL  746


 Score = 93.6 bits (231),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            L+ T+Q+VLCTS  +TPQ NPI+GRI+  +GHG GRPT+K+IDE ADRY+FMA +L A W
Sbjct  742  LLATLQYVLCTSIEDTPQVNPIIGRIDVKSGHGAGRPTKKMIDEVADRYSFMANMLDASW  801

Query  225  IE  220
             E
Sbjct  802  TE  803



>ref|XP_008388141.1| PREDICTED: prolyl endopeptidase-like [Malus domestica]
Length=676

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/366 (70%), Positives = 314/366 (86%), Gaps = 5/366 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHF+GTDQSEDILCW+DS+NP++   A VT DGKY L+Y+ E CDPVNK Y CD+SALPN
Sbjct  278   YHFVGTDQSEDILCWRDSENPKYTFGADVTVDGKYILLYVAEGCDPVNKFYYCDMSALPN  337

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G RG ++LLP  K++D F+A     ANDE VFT  TNK+APKYKLVRVD+KEP  W 
Sbjct  338   GLEGLRGKNDLLPVIKVIDKFDAR----ANDETVFTLLTNKDAPKYKLVRVDLKEPTVWT  393

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ E EKDVLESA AVN  Q++V+YLSDVK V+Q+RD+++G +L H LPIDIG+VNGIS
Sbjct  394   DVLPESEKDVLESASAVNGTQMIVSYLSDVKYVVQVRDLKSGNLL-HQLPIDIGSVNGIS  452

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+DS VF GFT+FL P IIYQCNL +++P+LK+FREITVPGF+R+ F+V QVFV SKD
Sbjct  453   ARREDSTVFFGFTSFLTPGIIYQCNLDNEIPDLKVFREITVPGFERSEFHVDQVFVPSKD  512

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIP F+V+ K+I LDGS+PCLL+GYGGF+ S+TP FS +R+V+ +HLGV++C+ANIRG
Sbjct  513   GTKIPTFVVARKNISLDGSHPCLLYGYGGFNISITPSFSVSRIVLTRHLGVVYCIANIRG  572

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACINQ  689
             GGEYGEEWHKAG+L+KKQNCFDDFI AAEYL++AG+TQPSKLCIEGGSNGGLL+GACINQ
Sbjct  573   GGEYGEEWHKAGSLSKKQNCFDDFISAAEYLVSAGYTQPSKLCIEGGSNGGLLVGACINQ  632

Query  688   RPDLFG  671
             RPDLFG
Sbjct  633   RPDLFG  638



>gb|EMT09978.1| Prolyl endopeptidase [Aegilops tauschii]
Length=536

 Score =   527 bits (1358),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 266/424 (63%), Positives = 321/424 (76%), Gaps = 39/424 (9%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LG+DQSEDILCWKD +NP+H + ASVTEDGKY ++  ++ CDPVNK+Y C++S+LP+
Sbjct  112   YHILGSDQSEDILCWKDPENPKHSLGASVTEDGKYIILGTYDGCDPVNKLYYCEISSLPH  171

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G+R T E+LPF K++D+F+A Y  VAND   FTF TNKNAPK KLVRV++K+P  W 
Sbjct  172   GLEGFRETKEMLPFVKLIDNFDAQYQVVANDGDEFTFLTNKNAPKNKLVRVNIKKPEVWT  231

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             DV+ E E+DVLESA AVN NQLVV Y+SDVK  LQ+RD+ TG +L H LP++IG+V+ IS
Sbjct  232   DVLSEHERDVLESADAVNGNQLVVCYMSDVKHTLQIRDLITGNLL-HQLPLEIGSVSEIS  290

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
              RR+D  VFIGFT+FL P IIY+CNL S +PE+K FREI+VPGFDR SF V Q+FV SKD
Sbjct  291   CRREDKEVFIGFTSFLSPGIIYRCNLASTIPEMKTFREISVPGFDRTSFEVKQIFVPSKD  350

Query  1048  GVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIRG  869
             G KIPMFI+S K I LDGS+P LL+GYGGF+ S+TP FS +RLV+ K++G + C+ANIRG
Sbjct  351   GTKIPMFIMSKKAIELDGSHPTLLYGYGGFNISITPSFSVSRLVLCKNMGSVVCIANIRG  410

Query  868   GGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACIN-  692
             GGEYGEEWHKAGALAKKQNCFDDFI  AE LI++G+T   K+CIEGGSNGGLLI ACIN 
Sbjct  411   GGEYGEEWHKAGALAKKQNCFDDFIACAEQLISSGYTSNKKICIEGGSNGGLLIAACINQ  470

Query  691   -------------------------------------QRPDLFGCALAHVGVMDMLRFHK  623
                                                  QRPDLFGCALAHVGVMDMLRFHK
Sbjct  471   VRVNPHFITKLHELSSLSYVNIRIQYLACISLTCTVLQRPDLFGCALAHVGVMDMLRFHK  530

Query  622   FTIG  611
             FTIG
Sbjct  531   FTIG  534



>dbj|BAE41885.1| unnamed protein product [Mus musculus]
Length=710

 Score =   530 bits (1365),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 254/455 (56%), Positives = 328/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I+E CDPVN+++ CDL   PN
Sbjct  212   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIWEGCDPVNRLWYCDLQQEPN  271

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+N+P Y+L+ +D  +P    
Sbjct  272   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRNSPNYRLINIDFTDPDESK  325

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG +L    P+D+G+V G
Sbjct  326   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNILQLHDLTTGALLK-TFPLDVGSVVG  384

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S R+KDS +F  FT+FL P +IY C+L  +  E  +FRE+TV G D A +   Q+F  S
Sbjct  385   YSGRKKDSEIFYQFTSFLSPGVIYHCDLTKEELEPMVFREVTVKGIDAADYQTIQIFYPS  444

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  445   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  504

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  505   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVAACA  564

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHKFTIGHAWT+D+GCSD ++ F WL+KYSPLHNV+ P 
Sbjct  565   NQRPDLFGCVIAQVGVMDMLKFHKFTIGHAWTTDYGCSDTKQHFEWLLKYSPLHNVKLP-  623

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  624   --EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  656


 Score = 55.8 bits (133),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++  S     Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  652  FIATLQYIVGRSRK---QSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIEW  708

Query  225  IE  220
            I+
Sbjct  709  IQ  710



>ref|NP_035286.1| prolyl endopeptidase [Mus musculus]
 sp|Q9QUR6.1|PPCE_MOUSE RecName: Full=Prolyl endopeptidase; Short=PE; AltName: Full=Post-proline 
cleaving enzyme [Mus musculus]
 dbj|BAA83071.1| prolyl oligopeptidase [Mus musculus]
 dbj|BAA88239.1| Prolyl endopeptidase [Mus musculus]
 gb|AAH12869.1| Prolyl endopeptidase [Mus musculus]
 dbj|BAC35538.1| unnamed protein product [Mus musculus]
 gb|AAH50830.2| Prolyl endopeptidase [Mus musculus]
 dbj|BAE36445.1| unnamed protein product [Mus musculus]
 dbj|BAE24858.1| unnamed protein product [Mus musculus]
 dbj|BAE37495.1| unnamed protein product [Mus musculus]
 gb|EDL05036.1| prolyl endopeptidase [Mus musculus]
Length=710

 Score =   530 bits (1365),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 254/455 (56%), Positives = 328/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I+E CDPVN+++ CDL   PN
Sbjct  212   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIWEGCDPVNRLWYCDLQQEPN  271

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+N+P Y+L+ +D  +P    
Sbjct  272   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRNSPNYRLINIDFTDPDESK  325

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG +L    P+D+G+V G
Sbjct  326   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNILQLHDLTTGALLK-TFPLDVGSVVG  384

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S R+KDS +F  FT+FL P +IY C+L  +  E  +FRE+TV G D A +   Q+F  S
Sbjct  385   YSGRKKDSEIFYQFTSFLSPGVIYHCDLTKEELEPMVFREVTVKGIDAADYQTIQIFYPS  444

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  445   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  504

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  505   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVAACA  564

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHKFTIGHAWT+D+GCSD ++ F WL+KYSPLHNV+ P 
Sbjct  565   NQRPDLFGCVIAQVGVMDMLKFHKFTIGHAWTTDYGCSDTKQHFEWLLKYSPLHNVKLP-  623

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  624   --EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  656


 Score = 55.8 bits (133),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++  S     Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  652  FIATLQYIVGRSRK---QSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIEW  708

Query  225  IE  220
            I+
Sbjct  709  IQ  710



>dbj|BAC36278.1| unnamed protein product [Mus musculus]
Length=731

 Score =   530 bits (1366),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 254/455 (56%), Positives = 328/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I+E CDPVN+++ CDL   PN
Sbjct  212   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIWEGCDPVNRLWYCDLQQEPN  271

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+N+P Y+L+ +D  +P    
Sbjct  272   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRNSPNYRLINIDFTDPDESK  325

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG +L    P+D+G+V G
Sbjct  326   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNILQLHDLTTGALLK-TFPLDVGSVVG  384

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S R+KDS +F  FT+FL P +IY C+L  +  E  +FRE+TV G D A +   Q+F  S
Sbjct  385   YSGRKKDSEIFYQFTSFLSPGVIYHCDLTKEELEPMVFREVTVKGIDAADYQTIQIFYPS  444

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  445   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  504

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  505   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVAACA  564

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHKFTIGHAWT+D+GCSD ++ F WL+KYSPLHNV+ P 
Sbjct  565   NQRPDLFGCVIAQVGVMDMLKFHKFTIGHAWTTDYGCSDTKQHFEWLLKYSPLHNVKLP-  623

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  624   --EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  656



>ref|XP_004660718.1| PREDICTED: prolyl endopeptidase [Jaculus jaculus]
Length=751

 Score =   528 bits (1361),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 252/455 (55%), Positives = 330/455 (73%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I+E CDPVN+++ CDL   PN
Sbjct  253   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIWEGCDPVNRLWYCDLQQEPN  312

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+N+P Y+L+ +D  +P    
Sbjct  313   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRNSPNYRLINIDFMDPEESK  366

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V ++ LV+ YL DVK++LQL D+ TG +L    P+++G+V G
Sbjct  367   WKVLVPEHEKDVLEWVACVRSSFLVLCYLHDVKNILQLHDLTTGALLK-TFPLEVGSVVG  425

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S R+KDS +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  426   YSGRKKDSEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPS  485

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  486   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  545

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  546   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVAACA  605

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHKFTIGHAWT+D+GCSD+++ F WL+KYSPLHNV+ P 
Sbjct  606   NQRPDLFGCVIAQVGVMDMLKFHKFTIGHAWTTDYGCSDSKQHFEWLLKYSPLHNVKLP-  664

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  665   --EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  697


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (65%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++  S     Q NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  693  FIATLQYIVGRSPK---QNNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIEW  749

Query  225  IE  220
            I+
Sbjct  750  IQ  751



>ref|XP_008848520.1| PREDICTED: prolyl endopeptidase isoform X3 [Nannospalax galili]
Length=632

 Score =   523 bits (1346),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 250/455 (55%), Positives = 327/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I+E CDPVN+++ CDL    N
Sbjct  134   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIWEGCDPVNRLWYCDLKQESN  193

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VF F+TN+N+P Y+L+ +D  +P    
Sbjct  194   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFIFKTNRNSPNYRLISIDFTDPDESK  247

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK+ LQL D+ TG +L  + P+D+G+V G
Sbjct  248   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNTLQLHDLSTGALLK-SFPLDVGSVVG  306

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S R+KDS +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  307   YSGRKKDSEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTIQIFYPS  366

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LD S+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  367   KDGTKIPMFIVHKKGIKLDSSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  426

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  427   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPRRLTINGGSNGGLLVAACA  486

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FH+FTIGHAWT+D+GCSD+++ F WL+KYSPLHNV+ P 
Sbjct  487   NQRPDLFGCVIAQVGVMDMLKFHRFTIGHAWTTDYGCSDSKQHFEWLLKYSPLHNVKLP-  545

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  546   --EADGIQYPSMLLLTADHDDRVVPLHSLKFIATL  578


 Score = 56.2 bits (134),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++     +  Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  574  FIATLQYIV---GRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIEW  630

Query  225  IE  220
            I+
Sbjct  631  IQ  632



>gb|EGW09640.1| Prolyl endopeptidase [Cricetulus griseus]
Length=555

 Score =   520 bits (1339),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 249/455 (55%), Positives = 327/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I+E CDPVN+++ CDL    +
Sbjct  57    YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIWEGCDPVNRLWYCDLQQESS  116

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+N+P Y+L+ +D  +P    
Sbjct  117   GITG------ILNWIKLIDNFEGEYDYVTNEGTVFTFKTNRNSPNYRLINIDFTDPDESK  170

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V ++ LV+ YL DVK++LQL D+ TG +L    P+D+G+V G
Sbjct  171   WKVLVPEHEKDVLEWVACVRSSFLVLCYLHDVKNILQLHDLTTGALLK-TFPLDVGSVVG  229

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S R+KDS +F  FT+FL P +IY C+L  +  E  +FRE+TV G D + +   QVF  S
Sbjct  230   YSGRKKDSEIFYQFTSFLSPGVIYHCDLTKEELEPTVFREVTVKGIDASDYQTIQVFYPS  289

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  290   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  349

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T   +L I GGSNGGLL+ AC 
Sbjct  350   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSSKRLTINGGSNGGLLVAACA  409

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHKFTIGHAWT+D+GCSD+++ F WL++YSPLHNV+ P 
Sbjct  410   NQRPDLFGCVIAQVGVMDMLKFHKFTIGHAWTTDYGCSDSKQHFEWLLRYSPLHNVKLP-  468

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  469   --EADGIQYPSMLLLTADHDDRVVPLHSLKFIATL  501


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++     +  Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  497  FIATLQYIV---GRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIEW  553

Query  225  I  223
            I
Sbjct  554  I  554



>gb|KFP09027.1| Prolyl endopeptidase, partial [Egretta garzetta]
Length=671

 Score =   523 bits (1348),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 253/455 (56%), Positives = 331/455 (73%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT+QSEDILC +  D P+ M  A V++DG+Y L+ I E CDPVN+++ CDL A   
Sbjct  173   YHVLGTNQSEDILCAEFPDEPKWMGGAEVSDDGRYVLLSIREGCDPVNRLWYCDLQAESQ  232

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FEA Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  233   GISG------ILQWVKLIDNFEAEYEYVTNEGTVFTFKTNRHSPNYRLINIDFSDPEESK  286

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E E+DVLE    V +N LV+ YL DVK++LQL D+ TG  L    P+D+G++ G
Sbjct  287   WKVLVPEHERDVLEWVACVRSNFLVLCYLHDVKNILQLHDLATGAHLK-TFPLDVGSIVG  345

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV GFD + +   QVF  S
Sbjct  346   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGFDPSVYQTIQVFYPS  405

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  406   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANI  465

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAA+YLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  466   RGGGEYGETWHKGGILANKQNCFDDFQCAAKYLIKEGYTSPKKLTINGGSNGGLLVAACA  525

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHN++ P 
Sbjct  526   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDCKEQFEWLCKYSPLHNIKLPE  585

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             E      QYPST+LLTADHDDRVVPLH+ K++A +
Sbjct  586   E---DGIQYPSTLLLTADHDDRVVPLHSLKFIATL  617


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+V+     +  QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  613  FIATLQYVV---GRSRKQTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNLDW  669

Query  225  IE  220
            IE
Sbjct  670  IE  671



>ref|XP_003781615.1| PREDICTED: prolyl endopeptidase [Otolemur garnettii]
Length=710

 Score =   524 bits (1350),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 251/455 (55%), Positives = 329/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL   PN
Sbjct  212   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQEPN  271

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  272   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRHSPNYRLINIDFTDPDESK  325

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG +L    P+++G+V G
Sbjct  326   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNILQLHDLATGALLK-TFPLEVGSVVG  384

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  385   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTIQIFYPS  444

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             +DG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  445   RDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  504

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  505   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPRRLTINGGSNGGLLVAACA  564

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSDN+E F WLIKYSPLHNV+ P 
Sbjct  565   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDNKEHFEWLIKYSPLHNVKLP-  623

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  624   --EADDVQYPSMLLLTADHDDRVVPLHSLKFIATL  656


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++  S     Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  652  FIATLQYIVGRSRK---QSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDW  708

Query  225  I  223
            I
Sbjct  709  I  709



>ref|XP_005509542.1| PREDICTED: prolyl endopeptidase [Columba livia]
Length=703

 Score =   524 bits (1349),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 254/456 (56%), Positives = 330/456 (72%), Gaps = 12/456 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT+QSEDILC +  D P+ M  A V++DG+Y L+ I E CDPVN+++ CDL     
Sbjct  205   YHVLGTNQSEDILCAEFPDEPKWMGGAEVSDDGRYVLLSIREGCDPVNRLWYCDLKTESQ  264

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FEA Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  265   GISG------ILQWVKLIDNFEAEYEYVTNEGTVFTFKTNRHSPNYRLINIDFSDPEESK  318

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E E+DVLE    V +N LV+ YL DVK+VLQL D+ TG  L    P+++G++ G
Sbjct  319   WKVLVPEHERDVLEWVACVRSNFLVLCYLHDVKNVLQLHDLATGAHLK-TFPLEVGSIVG  377

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KDS +F  FT+FL P IIY C+L  +  E ++FRE+TV GFD + +   QVF  S
Sbjct  378   YSGQKKDSEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGFDPSVYQTIQVFYPS  437

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  438   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANI  497

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  498   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKKLTINGGSNGGLLVAACA  557

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHN++ P 
Sbjct  558   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDCKEQFEWLYKYSPLHNIKLPE  617

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM  407
             E      QYPST+LLTADHDDRVVPLH+ K++A + 
Sbjct  618   E---DGIQYPSTLLLTADHDDRVVPLHSLKFIATLQ  650


 Score = 57.0 bits (136),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 40/62 (65%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+ +     +  QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  645  FIATLQYAV---GRSRKQTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNLDW  701

Query  225  IE  220
            IE
Sbjct  702  IE  703



>gb|EMC83075.1| Prolyl endopeptidase, partial [Columba livia]
Length=695

 Score =   523 bits (1348),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 254/456 (56%), Positives = 330/456 (72%), Gaps = 12/456 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT+QSEDILC +  D P+ M  A V++DG+Y L+ I E CDPVN+++ CDL     
Sbjct  197   YHVLGTNQSEDILCAEFPDEPKWMGGAEVSDDGRYVLLSIREGCDPVNRLWYCDLKTESQ  256

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FEA Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  257   GISG------ILQWVKLIDNFEAEYEYVTNEGTVFTFKTNRHSPNYRLINIDFSDPEESK  310

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E E+DVLE    V +N LV+ YL DVK+VLQL D+ TG  L    P+++G++ G
Sbjct  311   WKVLVPEHERDVLEWVACVRSNFLVLCYLHDVKNVLQLHDLATGAHLK-TFPLEVGSIVG  369

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KDS +F  FT+FL P IIY C+L  +  E ++FRE+TV GFD + +   QVF  S
Sbjct  370   YSGQKKDSEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGFDPSVYQTIQVFYPS  429

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  430   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANI  489

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  490   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKKLTINGGSNGGLLVAACA  549

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHN++ P 
Sbjct  550   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDCKEQFEWLYKYSPLHNIKLPE  609

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM  407
             E      QYPST+LLTADHDDRVVPLH+ K++A + 
Sbjct  610   E---DGIQYPSTLLLTADHDDRVVPLHSLKFIATLQ  642


 Score = 57.0 bits (136),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 40/62 (65%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+ +     +  QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  637  FIATLQYAV---GRSRKQTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNLDW  693

Query  225  IE  220
            IE
Sbjct  694  IE  695



>gb|KFO62279.1| Prolyl endopeptidase, partial [Corvus brachyrhynchos]
Length=671

 Score =   523 bits (1346),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 254/455 (56%), Positives = 330/455 (73%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT+QSEDILC +  D P+ M  A V++DG+Y L+ I E CDPVN+++ CDL     
Sbjct  173   YHVLGTNQSEDILCAEFPDEPKWMGGAEVSDDGRYVLLSIREGCDPVNRLWYCDLQKESQ  232

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FEA Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  233   GISG------ILQWVKLIDNFEAEYEYVTNEGTVFTFKTNRHSPNYRLINIDFSDPEESK  286

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK+VLQL D+ TG  L    P+++G++ G
Sbjct  287   WKVLVPEHEKDVLEWVACVRSNLLVLCYLHDVKNVLQLHDLATGAHLK-TFPLEVGSIVG  345

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV GFD + +   QVF  S
Sbjct  346   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGFDPSVYQTIQVFYPS  405

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  406   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANI  465

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAA+YLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  466   RGGGEYGETWHKGGILANKQNCFDDFQCAAKYLIKEGYTSPKKLTINGGSNGGLLVAACA  525

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHNV+ P 
Sbjct  526   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDCKEQFEWLCKYSPLHNVKLPE  585

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             E      QYPST+LLTADHDDRVVPLH+ K++A +
Sbjct  586   E---DGVQYPSTLLLTADHDDRVVPLHSLKFIATL  617


 Score = 59.3 bits (142),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+   T   ++ QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  613  FIATLQY---TVGRSSKQTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNLEW  669

Query  225  IE  220
            IE
Sbjct  670  IE  671



>ref|XP_009091499.1| PREDICTED: prolyl endopeptidase [Serinus canaria]
Length=644

 Score =   521 bits (1343),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 253/455 (56%), Positives = 330/455 (73%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT+QSEDILC +  D P+ M  A V++DG+Y L+ I E CDPVN+++ CDL     
Sbjct  146   YHILGTNQSEDILCAEFPDEPKWMGGAEVSDDGRYVLLSIREGCDPVNRLWYCDLQKESQ  205

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FEA Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  206   GISG------ILQWVKLIDNFEAEYEYVTNEGTVFTFKTNRHSPNYRLINIDFSDPEESK  259

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG  L    P+++G++ G
Sbjct  260   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNILQLHDLATGAHLK-TFPLEVGSIVG  318

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV GFD + +   QVF  S
Sbjct  319   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGFDPSVYQTIQVFYPS  378

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  379   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANI  438

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAA+YLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  439   RGGGEYGETWHKGGILANKQNCFDDFQCAAKYLIKEGYTSPKKLTINGGSNGGLLVAACA  498

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHNV+ P 
Sbjct  499   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDCKEQFEWLRKYSPLHNVKLPE  558

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             E      QYPST+LLTADHDDRVVPLH+ K++A +
Sbjct  559   E---DGIQYPSTLLLTADHDDRVVPLHSLKFIATL  590


 Score = 59.3 bits (142),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++     ++ QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  586  FIATLQYIV---GRSSKQTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFVARCLNLEW  642

Query  225  IE  220
            IE
Sbjct  643  IE  644



>ref|XP_006983806.1| PREDICTED: prolyl endopeptidase, partial [Peromyscus maniculatus 
bairdii]
Length=695

 Score =   523 bits (1346),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 252/455 (55%), Positives = 328/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I+E CDPVN+++ CDL    +
Sbjct  197   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIWEGCDPVNRLWYCDLQKESS  256

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+N+P Y+L+ +D  +P    
Sbjct  257   GITG------ILNWVKLIDNFEGEYDYVTNEGTVFTFKTNRNSPNYRLINIDFTDPDESK  310

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG +L    P+D+G+V G
Sbjct  311   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNILQLHDLTTGALLK-TFPLDVGSVVG  369

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S R+KDS +F  FT+FL P +IY C+L  +  E  +FRE+TV G D + +   QVF  S
Sbjct  370   YSGRKKDSEIFYQFTSFLSPGVIYHCDLTKEELEPIVFREVTVKGIDASDYQTIQVFYPS  429

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  430   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  489

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  490   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVAACA  549

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHKFTIGHAWT+D+GCSD+++ F WL+KYSPLHNV+ P 
Sbjct  550   NQRPDLFGCVIAQVGVMDMLKFHKFTIGHAWTTDYGCSDSKQHFEWLLKYSPLHNVKLP-  608

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  609   --EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  641


 Score = 55.8 bits (133),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++     +  Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  637  FIATLQYIV---GRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIEW  693

Query  225  IE  220
            I+
Sbjct  694  IQ  695



>ref|XP_008065250.1| PREDICTED: prolyl endopeptidase [Tarsius syrichta]
Length=644

 Score =   521 bits (1342),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 250/455 (55%), Positives = 327/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL    N
Sbjct  146   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQESN  205

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  206   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRHSPNYRLINIDFTDPDESK  259

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG  L    P+++G+V G
Sbjct  260   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNILQLHDLTTGAFLK-TFPLEVGSVVG  318

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  319   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTIQIFYPS  378

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  379   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  438

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  439   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVAACT  498

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSDN++ F WLIKYSPLHNV+ P 
Sbjct  499   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDNKQHFEWLIKYSPLHNVKLP-  557

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  558   --EPDDVQYPSMLLLTADHDDRVVPLHSLKFIATL  590


 Score = 55.8 bits (133),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++  S     Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  586  FIATLQYIVGRSGK---QSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLSIDW  642

Query  225  I  223
            I
Sbjct  643  I  643



>ref|XP_009647537.1| PREDICTED: prolyl endopeptidase [Egretta garzetta]
Length=704

 Score =   523 bits (1347),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 253/456 (55%), Positives = 331/456 (73%), Gaps = 12/456 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT+QSEDILC +  D P+ M  A V++DG+Y L+ I E CDPVN+++ CDL A   
Sbjct  206   YHVLGTNQSEDILCAEFPDEPKWMGGAEVSDDGRYVLLSIREGCDPVNRLWYCDLQAESQ  265

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FEA Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  266   GISG------ILQWVKLIDNFEAEYEYVTNEGTVFTFKTNRHSPNYRLINIDFSDPEESK  319

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E E+DVLE    V +N LV+ YL DVK++LQL D+ TG  L    P+D+G++ G
Sbjct  320   WKVLVPEHERDVLEWVACVRSNFLVLCYLHDVKNILQLHDLATGAHLK-TFPLDVGSIVG  378

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV GFD + +   QVF  S
Sbjct  379   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGFDPSVYQTIQVFYPS  438

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  439   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANI  498

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAA+YLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  499   RGGGEYGETWHKGGILANKQNCFDDFQCAAKYLIKEGYTSPKKLTINGGSNGGLLVAACA  558

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHN++ P 
Sbjct  559   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDCKEQFEWLCKYSPLHNIKLPE  618

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM  407
             E      QYPST+LLTADHDDRVVPLH+ K++A + 
Sbjct  619   E---DGIQYPSTLLLTADHDDRVVPLHSLKFIATLQ  651


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+V+     +  QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  646  FIATLQYVV---GRSRKQTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNLDW  702

Query  225  IE  220
            IE
Sbjct  703  IE  704



>gb|KFO96556.1| Prolyl endopeptidase, partial [Calypte anna]
Length=671

 Score =   522 bits (1344),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 254/455 (56%), Positives = 328/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT QSEDILC +  D P+ M  A V++DG+Y L+ I E CDPVN+++ CDL     
Sbjct  173   YHVLGTSQSEDILCAEFPDEPKWMGGAEVSDDGRYVLLSIREGCDPVNRLWYCDLQTESQ  232

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FEA Y +V N+  VFTF+TN+ +P Y+L+ +D  +P    
Sbjct  233   GISG------ILQWVKLIDNFEAEYEYVTNEGTVFTFKTNRQSPNYRLINIDFSDPEESK  286

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  +I E EKDVLE    V +N LV+ YL DVK++LQL D+ TG  L    P+++G++ G
Sbjct  287   WKVLIPEHEKDVLEWVACVRSNFLVLCYLHDVKNILQLHDLATGAHLK-TFPLEVGSIVG  345

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV GFD + +   QVF  S
Sbjct  346   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGFDPSVYQTIQVFYPS  405

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  406   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANI  465

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAA+YLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  466   RGGGEYGETWHKGGILANKQNCFDDFQCAAKYLIEEGYTSPKKLTINGGSNGGLLVAACA  525

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHNV+ P 
Sbjct  526   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDCKEQFEWLCKYSPLHNVKLPE  585

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             E      QYPST+LLTADHDDRVVPLH+ K++A +
Sbjct  586   E---DGIQYPSTLLLTADHDDRVVPLHSLKFIATL  617


 Score = 60.1 bits (144),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+V+     ++ QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  613  FIATLQYVV---GRSSKQTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNLDW  669

Query  225  IE  220
            IE
Sbjct  670  IE  671



>gb|KDO85002.1| hypothetical protein CISIN_1g0038782mg, partial [Citrus sinensis]
Length=581

 Score =   518 bits (1335),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 250/361 (69%), Positives = 306/361 (85%), Gaps = 2/361 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGT QSEDILCWKD ++P+++ S  VTEDG+Y ++ I ENCDPVNKVY CDLSALP 
Sbjct  222   YHFLGTKQSEDILCWKDPEHPKYIFSGHVTEDGQYLVMCIEENCDPVNKVYYCDLSALPE  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G++  D LLPF K++D F+A Y  +AND+ VFTF TNK+APKYK++RVD+KEP  W 
Sbjct  282   GLEGFKKRDGLLPFVKLIDGFDAQYEVIANDDTVFTFLTNKDAPKYKIIRVDLKEPNDWF  341

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             +VI E E+DVLESA AVN NQ++V+YLSDVK VLQ+RD++ G +L H LPI+IG+VN IS
Sbjct  342   EVIPEAERDVLESATAVNLNQMIVSYLSDVKYVLQIRDLKNGSLL-HQLPIEIGSVNAIS  400

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+DS+VFI FT+FLIP I+YQCNL+++ PE+KIFRE  +PGFDR+ F+V QVFV SKD
Sbjct  401   ARREDSVVFISFTSFLIPGIVYQCNLKTETPEMKIFRETIIPGFDRSEFHVHQVFVPSKD  460

Query  1048  G-VKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIR  872
             G  KIPMFIVS K+I LDGS+PCLL+GYGGF+ SVTP FS +R ++ +HLG +FC+ANIR
Sbjct  461   GSTKIPMFIVSKKNIKLDGSHPCLLYGYGGFNISVTPSFSVSRTILMRHLGAVFCIANIR  520

Query  871   GGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACIN  692
             GGGEYGEEWHK GALAKKQNCFDDFI A+EYLI+AG+TQ  KLCIEGGSNGGLL+GACIN
Sbjct  521   GGGEYGEEWHKGGALAKKQNCFDDFISASEYLISAGYTQSRKLCIEGGSNGGLLVGACIN  580

Query  691   Q  689
             Q
Sbjct  581   Q  581



>ref|XP_003466076.1| PREDICTED: prolyl endopeptidase [Cavia porcellus]
Length=710

 Score =   523 bits (1347),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 252/455 (55%), Positives = 329/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL    N
Sbjct  212   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQEAN  271

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+ +VFTF+TN+ +P Y+L+ +D  +P    
Sbjct  272   GITG------ILKWVKLIDNFEGEYDYVTNEGSVFTFKTNRLSPNYRLINIDFTDPEESK  325

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK+VLQL D+ TG +L    P+D+G+V G
Sbjct  326   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNVLQLHDLATGALLK-TFPLDVGSVVG  384

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +  TQ+F  S
Sbjct  385   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTTQIFYPS  444

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  445   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHLGGVLAVANI  504

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  505   RGGGEYGEMWHKGGILANKQNCFDDFQCAAEYLIREGYTSPKRLTINGGSNGGLLVAACA  564

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSD+++ F WL+KYSPLHNV+ P 
Sbjct  565   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKQHFEWLVKYSPLHNVKLP-  623

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  624   --EADGVQYPSMLLLTADHDDRVVPLHSLKFIATL  656


 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 39/61 (64%), Gaps = 3/61 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+   T   +  Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  652  FIATLQY---TVGRSQKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNISW  708

Query  225  I  223
            I
Sbjct  709  I  709



>ref|XP_007260527.1| PREDICTED: prolyl endopeptidase-like [Astyanax mexicanus]
Length=709

 Score =   523 bits (1346),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 254/485 (52%), Positives = 341/485 (70%), Gaps = 19/485 (4%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT QS+D+LC +  + P+ M  A V++DG+Y L+ I E CDPVN+++ CDL+ LPN
Sbjct  211   YHVLGTPQSQDVLCAEFPEQPKWMSGAEVSDDGRYVLLSIREGCDPVNRLWYCDLNTLPN  270

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      LLP+ K++D+F+A Y +V N+  VFTF+TN +AP+Y+L+ VD   P    
Sbjct  271   GITG------LLPWVKLIDNFDAEYEYVTNENTVFTFKTNLDAPRYRLINVDFANPEQSQ  324

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W ++I + +KDV+  A    +  L V YL DVK+VL++  + +G  L    P+++G++ G
Sbjct  325   WKELIPQHDKDVIVFATCSFSTNLFVCYLHDVKNVLKMYQLASGEELK-TFPLEVGSIVG  383

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              + R+KDS +F  FT+FL P +IY C+L     +  +FRE+TV GF+ A +  TQVF  S
Sbjct  384   FTGRKKDSEIFYYFTSFLSPAVIYHCDLTKAPLQPHVFREVTVKGFNPAEYQTTQVFYPS  443

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG +IPMFIV  KDI LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  444   KDGTQIPMFIVHKKDIQLDGSHPAFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANI  503

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHKAG L  KQNCF DF CAAEYLI  G+T   KL I GGSNGGLL+GAC+
Sbjct  504   RGGGEYGETWHKAGMLGNKQNCFTDFQCAAEYLIKEGYTSSKKLTINGGSNGGLLVGACV  563

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHKFTIGHAWT+DFGCS+ +E++ WLIKYSPLHN+R P 
Sbjct  564   NQRPDLFGCAVAQVGVMDMLKFHKFTIGHAWTTDFGCSEIKEQYDWLIKYSPLHNIRVP-  622

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAM---MMPCPDHAACPVY----KRSQHS  356
                 +  QYP+ +LLT DHDDRVVPLH+ KY+A    ++ C    + P++     +S H 
Sbjct  623   --EGEGVQYPAVLLLTGDHDDRVVPLHSLKYIATLQNLIGCWSGQSNPLFIYVDTKSGHG  680

Query  355   ANQPN  341
             A +P 
Sbjct  681   AGKPT  685


 Score = 53.5 bits (127),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 40/62 (65%), Gaps = 5/62 (8%)
 Frame = -3

Query  402  VQTMQHVL-CTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
            + T+Q+++ C S     Q+NP+   ++  +GHG G+PT K+I E AD YAF+A+ L   W
Sbjct  652  IATLQNLIGCWSG----QSNPLFIYVDTKSGHGAGKPTTKVIQEVADTYAFIARCLDLSW  707

Query  225  IE  220
            ++
Sbjct  708  MD  709



>ref|XP_005368679.1| PREDICTED: prolyl endopeptidase [Microtus ochrogaster]
Length=710

 Score =   523 bits (1346),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 250/455 (55%), Positives = 327/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSED+LC +  D P+ M  A +++DG+Y L+ I+E CDPVN+++ CDL    N
Sbjct  212   YHVLGTDQSEDVLCAEFPDEPKWMGGAELSDDGRYVLLSIWEGCDPVNRLWYCDLQQESN  271

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+N+P Y+L+ +D  +P    
Sbjct  272   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRNSPNYRLINIDFMDPDESK  325

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG +L    P+D+G+V G
Sbjct  326   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNILQLHDLTTGALLK-TFPLDVGSVVG  384

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S R+KDS +F  FT+FL P +IY C+L  +  E  +FRE+TV G D + +   QVF  S
Sbjct  385   YSGRKKDSEIFYQFTSFLSPGVIYHCDLTKEELEPMVFREVTVKGIDASDYQTIQVFYPS  444

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  445   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  504

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYL+  G+T P +L I GGSNGGLL+  C 
Sbjct  505   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLVKEGYTSPKRLTINGGSNGGLLVAVCA  564

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHKFTIGHAWT+D+GCSD+++ F WL+KYSPLHNV+ P 
Sbjct  565   NQRPDLFGCVIAQVGVMDMLKFHKFTIGHAWTTDYGCSDSKQHFEWLLKYSPLHNVKLP-  623

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  624   --EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  656


 Score = 55.8 bits (133),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++     +  Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  652  FIATLQYIV---GRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIEW  708

Query  225  IE  220
            I+
Sbjct  709  IQ  710



>ref|XP_008848518.1| PREDICTED: prolyl endopeptidase isoform X1 [Nannospalax galili]
Length=710

 Score =   523 bits (1346),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 250/455 (55%), Positives = 327/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I+E CDPVN+++ CDL    N
Sbjct  212   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIWEGCDPVNRLWYCDLKQESN  271

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VF F+TN+N+P Y+L+ +D  +P    
Sbjct  272   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFIFKTNRNSPNYRLISIDFTDPDESK  325

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK+ LQL D+ TG +L  + P+D+G+V G
Sbjct  326   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNTLQLHDLSTGALLK-SFPLDVGSVVG  384

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S R+KDS +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  385   YSGRKKDSEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTIQIFYPS  444

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LD S+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  445   KDGTKIPMFIVHKKGIKLDSSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  504

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  505   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPRRLTINGGSNGGLLVAACA  564

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FH+FTIGHAWT+D+GCSD+++ F WL+KYSPLHNV+ P 
Sbjct  565   NQRPDLFGCVIAQVGVMDMLKFHRFTIGHAWTTDYGCSDSKQHFEWLLKYSPLHNVKLP-  623

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  624   --EADGIQYPSMLLLTADHDDRVVPLHSLKFIATL  656


 Score = 56.2 bits (134),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++  S     Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  652  FIATLQYIVGRSRK---QSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIEW  708

Query  225  IE  220
            I+
Sbjct  709  IQ  710



>gb|KFQ71820.1| Prolyl endopeptidase, partial [Phaethon lepturus]
Length=671

 Score =   521 bits (1342),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 251/455 (55%), Positives = 329/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT QSEDILC +  D P+ M  A V++DG+Y L+ I E CDPVN+++ CDL     
Sbjct  173   YHVLGTKQSEDILCAEFPDEPKWMGGAEVSDDGRYVLLSIREGCDPVNRLWYCDLQTESQ  232

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FEA Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  233   GISG------ILQWVKLIDNFEAEYEYVTNEGTVFTFKTNRHSPNYRLINIDFSDPEESK  286

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E E+DVLE    V +N LV+ YL DVK++LQL D+ TG  L    P+++G++ G
Sbjct  287   WKVLVPEHERDVLEWVACVRSNFLVLCYLHDVKNILQLHDLATGAHLK-TFPLEVGSIVG  345

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV GFD + +   QVF  S
Sbjct  346   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGFDPSVYQTIQVFYPS  405

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  406   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANI  465

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAA+YLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  466   RGGGEYGETWHKGGILANKQNCFDDFQCAAKYLIKEGYTSPKKLTINGGSNGGLLVAACA  525

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHN++ P 
Sbjct  526   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDRKEQFEWLCKYSPLHNIKLPE  585

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             E      QYPST+LLTADHDDRVVPLH+ K++A +
Sbjct  586   E---DGIQYPSTLLLTADHDDRVVPLHSLKFIATL  617


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++     +  QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  613  FIATLQYIV---GRSRKQTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNLDW  669

Query  225  IE  220
            IE
Sbjct  670  IE  671



>ref|XP_010405605.1| PREDICTED: prolyl endopeptidase, partial [Corvus cornix cornix]
Length=697

 Score =   522 bits (1344),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 254/456 (56%), Positives = 330/456 (72%), Gaps = 12/456 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT+QSEDILC +  D P+ M  A V++DG+Y L+ I E CDPVN+++ CDL     
Sbjct  199   YHVLGTNQSEDILCAEFPDEPKWMGGAEVSDDGRYVLLSIREGCDPVNRLWYCDLQKESQ  258

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FEA Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  259   GISG------ILQWVKLIDNFEAEYEYVTNEGTVFTFKTNRHSPNYRLINIDFSDPEESK  312

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK+VLQL D+ TG  L    P+++G++ G
Sbjct  313   WKVLVPEHEKDVLEWVACVRSNLLVLCYLHDVKNVLQLHDLATGAHLK-TFPLEVGSIVG  371

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV GFD + +   QVF  S
Sbjct  372   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGFDPSVYQTIQVFYPS  431

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  432   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANI  491

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAA+YLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  492   RGGGEYGETWHKGGILANKQNCFDDFQCAAKYLIKEGYTSPKKLTINGGSNGGLLVAACA  551

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHNV+ P 
Sbjct  552   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDCKEQFEWLCKYSPLHNVKLPE  611

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM  407
             E      QYPST+LLTADHDDRVVPLH+ K++A + 
Sbjct  612   E---DGVQYPSTLLLTADHDDRVVPLHSLKFIATLQ  644


 Score = 59.3 bits (142),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+   T   ++ QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  639  FIATLQY---TVGRSSKQTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNLEW  695

Query  225  IE  220
            IE
Sbjct  696  IE  697



>ref|XP_005974615.1| PREDICTED: prolyl endopeptidase [Pantholops hodgsonii]
Length=698

 Score =   522 bits (1344),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 249/455 (55%), Positives = 327/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL   PN
Sbjct  200   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLHQEPN  259

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  260   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRHSPNYRLINIDFTDPEESR  313

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V ++ LV+ YL DVK+ LQL D+ TG +L    P+++G+V G
Sbjct  314   WKVLVPEHEKDVLEWVACVRSSFLVLCYLHDVKNTLQLHDLATGALLK-TFPLEVGSVVG  372

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  373   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPS  432

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  433   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  492

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+  C 
Sbjct  493   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVATCA  552

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSDN++ F WLIKYSPLHNV+ P 
Sbjct  553   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDNKQHFEWLIKYSPLHNVKLP-  611

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  612   --EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  644


 Score = 56.2 bits (134),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 40/62 (65%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+QH++  S     Q NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  640  FIATLQHLVGRSRK---QNNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDW  696

Query  225  IE  220
            I+
Sbjct  697  IQ  698



>ref|XP_004011542.1| PREDICTED: prolyl endopeptidase, partial [Ovis aries]
Length=702

 Score =   522 bits (1344),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 249/455 (55%), Positives = 327/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL   PN
Sbjct  204   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLHQEPN  263

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  264   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRHSPNYRLINIDFTDPEESR  317

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V ++ LV+ YL DVK+ LQL D+ TG +L    P+++G+V G
Sbjct  318   WKVLVPEHEKDVLEWVACVRSSFLVLCYLHDVKNTLQLHDLATGALLK-TFPLEVGSVVG  376

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  377   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPS  436

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  437   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  496

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+  C 
Sbjct  497   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVATCA  556

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSDN++ F WLIKYSPLHNV+ P 
Sbjct  557   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDNKQHFEWLIKYSPLHNVKLP-  615

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  616   --EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  648


 Score = 56.2 bits (134),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 40/62 (65%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+QH++  S     Q NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  644  FIATLQHLVGRSRK---QNNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDW  700

Query  225  IE  220
            I+
Sbjct  701  IQ  702



>gb|ELR52168.1| Prolyl endopeptidase, partial [Bos mutus]
Length=695

 Score =   521 bits (1343),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 250/455 (55%), Positives = 327/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL   PN
Sbjct  197   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLHQEPN  256

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  257   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRHSPNYRLINIDFTDPEESR  310

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK+ LQL D+ TG +L    P+++G+V G
Sbjct  311   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNTLQLHDLATGALLK-TFPLEVGSVVG  369

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  370   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPS  429

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  430   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  489

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+  C 
Sbjct  490   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVATCA  549

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSDN++ F WLIKYSPLHNV+ P 
Sbjct  550   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDNKQHFEWLIKYSPLHNVKLP-  608

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  609   --EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  641


 Score = 56.2 bits (134),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 40/62 (65%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+QH++  S     Q NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  637  FIATLQHLVGRSRK---QNNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDW  693

Query  225  IE  220
            I+
Sbjct  694  IQ  695



>ref|XP_008636142.1| PREDICTED: prolyl endopeptidase [Corvus brachyrhynchos]
Length=707

 Score =   522 bits (1344),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 254/456 (56%), Positives = 330/456 (72%), Gaps = 12/456 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT+QSEDILC +  D P+ M  A V++DG+Y L+ I E CDPVN+++ CDL     
Sbjct  209   YHVLGTNQSEDILCAEFPDEPKWMGGAEVSDDGRYVLLSIREGCDPVNRLWYCDLQKESQ  268

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FEA Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  269   GISG------ILQWVKLIDNFEAEYEYVTNEGTVFTFKTNRHSPNYRLINIDFSDPEESK  322

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK+VLQL D+ TG  L    P+++G++ G
Sbjct  323   WKVLVPEHEKDVLEWVACVRSNLLVLCYLHDVKNVLQLHDLATGAHLK-TFPLEVGSIVG  381

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV GFD + +   QVF  S
Sbjct  382   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGFDPSVYQTIQVFYPS  441

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  442   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANI  501

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAA+YLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  502   RGGGEYGETWHKGGILANKQNCFDDFQCAAKYLIKEGYTSPKKLTINGGSNGGLLVAACA  561

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHNV+ P 
Sbjct  562   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDCKEQFEWLCKYSPLHNVKLPE  621

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM  407
             E      QYPST+LLTADHDDRVVPLH+ K++A + 
Sbjct  622   E---DGVQYPSTLLLTADHDDRVVPLHSLKFIATLQ  654


 Score = 59.3 bits (142),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+   T   ++ QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  649  FIATLQY---TVGRSSKQTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNLEW  705

Query  225  IE  220
            IE
Sbjct  706  IE  707



>ref|XP_009204023.1| PREDICTED: prolyl endopeptidase isoform X2 [Papio anubis]
Length=644

 Score =   520 bits (1338),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 247/455 (54%), Positives = 329/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL    N
Sbjct  146   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQESN  205

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+++P Y+++ +D ++P    
Sbjct  206   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRHSPNYRVINIDFRDPEESK  259

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG +L    P+++G++ G
Sbjct  260   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNILQLHDLTTGALLK-TFPLEVGSIVG  318

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  319   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPS  378

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G I  +ANI
Sbjct  379   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGILAVANI  438

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  439   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVAACA  498

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSD+++ F WL+KYSPLHNV+ P 
Sbjct  499   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKQHFEWLVKYSPLHNVKLP-  557

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  558   --EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  590


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++  S     Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  586  FIATLQYIVGRSRK---QSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDW  642

Query  225  I  223
            I
Sbjct  643  I  643



>ref|XP_008005660.1| PREDICTED: prolyl endopeptidase isoform X2 [Chlorocebus sabaeus]
Length=644

 Score =   520 bits (1338),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 247/455 (54%), Positives = 329/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL    N
Sbjct  146   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQESN  205

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+++P Y+++ +D ++P    
Sbjct  206   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRHSPNYRVINIDFRDPEESK  259

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG +L    P+++G++ G
Sbjct  260   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNILQLHDLTTGALLK-TFPLEVGSIVG  318

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  319   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPS  378

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G I  +ANI
Sbjct  379   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGILAVANI  438

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  439   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVAACA  498

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSD+++ F WL+KYSPLHNV+ P 
Sbjct  499   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKQHFEWLVKYSPLHNVKLP-  557

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  558   --EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  590


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++  S     Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  586  FIATLQYIVGRSRK---QSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDW  642

Query  225  I  223
            I
Sbjct  643  I  643



>ref|XP_005552311.1| PREDICTED: prolyl endopeptidase isoform X2 [Macaca fascicularis]
Length=644

 Score =   519 bits (1337),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 247/455 (54%), Positives = 329/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL    N
Sbjct  146   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQESN  205

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+++P Y+++ +D ++P    
Sbjct  206   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRHSPNYRVINIDFRDPEESK  259

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG +L    P+++G++ G
Sbjct  260   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNILQLHDLTTGALLK-TFPLEVGSIVG  318

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  319   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYLS  378

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G I  +ANI
Sbjct  379   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGILAVANI  438

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  439   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVAACA  498

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSD+++ F WL+KYSPLHNV+ P 
Sbjct  499   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKQHFEWLVKYSPLHNVKLP-  557

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  558   --EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  590


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++  S     Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  586  FIATLQYIVGRS---RKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDW  642

Query  225  I  223
            I
Sbjct  643  I  643



>gb|KGM00304.1| Prolyl endopeptidase, partial [Charadrius vociferus]
Length=671

 Score =   520 bits (1340),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 251/455 (55%), Positives = 330/455 (73%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT+QSEDILC +  D P+ M  A V++DG+Y L+ I E CDPVN+++ CDL     
Sbjct  173   YHVLGTNQSEDILCAEFPDEPKWMGGAEVSDDGRYVLLSIREGCDPVNRLWYCDLQTESQ  232

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FEA Y ++ N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  233   GISG------ILQWVKLIDNFEAEYEYITNEGTVFTFKTNRHSPNYRLINIDFSDPEESK  286

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  +I E E+DVLE    V +N LV+ YL DVK++LQL D+ TG  L    P+++G++ G
Sbjct  287   WKVLIPEHERDVLEWVACVRSNFLVLCYLHDVKNILQLHDLATGAHLK-TFPLEVGSIVG  345

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV GFD + +   QVF  S
Sbjct  346   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGFDPSVYQTIQVFYPS  405

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  406   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANI  465

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAA+YLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  466   RGGGEYGETWHKGGILANKQNCFDDFQCAAKYLIKEGYTSPKKLTINGGSNGGLLVAACA  525

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHN++ P 
Sbjct  526   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDCKEQFEWLCKYSPLHNIKLPE  585

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             E      QYPST+LLTADHDDRVVPLH+ K++A +
Sbjct  586   E---DGIQYPSTLLLTADHDDRVVPLHSLKFIATL  617


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+V+     +  QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  613  FIATLQYVV---GRSRKQTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNLDW  669

Query  225  IE  220
            IE
Sbjct  670  IE  671



>ref|XP_005154718.1| PREDICTED: prolyl endopeptidase [Melopsittacus undulatus]
Length=759

 Score =   523 bits (1347),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 253/455 (56%), Positives = 332/455 (73%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT+QSEDILC +  D P+ M  A V++DG+Y L+ I E CDPVN+++ CDL     
Sbjct  261   YHVLGTNQSEDILCAEFPDEPKWMGGAEVSDDGRYVLLSIREGCDPVNRLWYCDLQKESQ  320

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPG--C  1415
             G+ G      +L + K++D+FEA Y +V N+  VFTF+TN+++P Y+L+ +D  +PG   
Sbjct  321   GISG------ILQWVKLIDNFEAEYEYVTNEGTVFTFKTNRHSPNYRLINIDFSDPGESK  374

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E E+DVLE A  V +N LV+ YL DVK++LQL D+ TG  L    P+++G++ G
Sbjct  375   WKVLVPEHERDVLEWAACVRSNFLVLCYLHDVKNILQLHDLATGAHLK-TFPLEVGSIVG  433

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV GFD + +   QVF  S
Sbjct  434   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGFDPSVYQTIQVFYPS  493

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  494   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANI  553

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAA+YLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  554   RGGGEYGETWHKGGILANKQNCFDDFQCAAKYLIKEGYTSPKKLTINGGSNGGLLVAACA  613

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHN++ P 
Sbjct  614   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDCKEQFEWLFKYSPLHNIKLPE  673

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             E      QYPST+LLTADHDDRVVPLH+ K++A +
Sbjct  674   E---DGIQYPSTLLLTADHDDRVVPLHSLKFIATL  705


 Score = 59.7 bits (143),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+V+  S+    QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  701  FIATLQYVVGRSSK---QTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNLDW  757

Query  225  IE  220
            IE
Sbjct  758  IE  759



>gb|KFV82344.1| Prolyl endopeptidase, partial [Struthio camelus australis]
Length=671

 Score =   520 bits (1339),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 252/455 (55%), Positives = 330/455 (73%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A V++DG+Y L+ I E CDPVN+++ CDL     
Sbjct  173   YHVLGTDQSEDILCAEFPDEPKWMGGAEVSDDGRYVLLSIREGCDPVNRLWYCDLQTESQ  232

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+F+A Y +V N+  +FTF+TN++AP Y+L+ +D  +P    
Sbjct  233   GISG------ILQWVKLIDNFDAEYEYVTNEGPLFTFKTNRHAPNYRLINIDFSDPDESK  286

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E E+DVLE    V +N LV+ YL DVK+VLQL D+ TG  L    P+++G++ G
Sbjct  287   WKVLVPEHERDVLEWVACVRSNFLVLCYLHDVKNVLQLHDLATGAHLK-TFPLEVGSIVG  345

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV GFD + +   QVF  S
Sbjct  346   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGFDPSVYQTIQVFYPS  405

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  406   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANI  465

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAA+YLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  466   RGGGEYGETWHKGGILANKQNCFDDFQCAAKYLIKEGYTSPRKLTINGGSNGGLLVAACA  525

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHN++ P 
Sbjct  526   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDCKEQFEWLCKYSPLHNIKLPE  585

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             E      QYPST+LLTADHDDRVVPLH+ K++A +
Sbjct  586   E---DGIQYPSTLLLTADHDDRVVPLHSLKFIATL  617


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+V+     +  QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  613  FIATLQYVV---GRSRKQTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNLDW  669

Query  225  IE  220
            IE
Sbjct  670  IE  671



>gb|EDL99674.1| prolyl endopeptidase [Rattus norvegicus]
Length=710

 Score =   521 bits (1342),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 249/455 (55%), Positives = 328/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSED+LC +  D P+ M  A +++DG+Y L+ I+E CDPVN+++ CDL    N
Sbjct  212   YHVLGTDQSEDVLCAEFPDEPKWMGGAELSDDGRYVLLSIWEGCDPVNRLWYCDLQQGSN  271

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y ++ N+  VFTF+TN+N+P Y+L+ +D  +P    
Sbjct  272   GING------ILKWVKLIDNFEGEYDYITNEGTVFTFKTNRNSPNYRLINIDFTDPDESK  325

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL +VK++LQL D+ TG +L    P+D+G+V G
Sbjct  326   WKVLVPEHEKDVLEWVACVRSNFLVLCYLRNVKNILQLHDLTTGALLK-TFPLDVGSVVG  384

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S R+KDS +F  FT+FL P +IY C+L  +  E ++FRE+TV G D + +   QVF  S
Sbjct  385   YSGRKKDSEIFYQFTSFLSPGVIYHCDLTREELEPRVFREVTVKGIDASDYQTIQVFYPS  444

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  445   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  504

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T   +L I GGSNGGLL+ AC 
Sbjct  505   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTTSKRLTINGGSNGGLLVAACA  564

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHKFTIGHAWT+D+GCSD+++ F WL+KYSPLHNV+ P 
Sbjct  565   NQRPDLFGCVIAQVGVMDMLKFHKFTIGHAWTTDYGCSDSKQHFEWLLKYSPLHNVKLP-  623

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  624   --EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  656


 Score = 55.8 bits (133),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++  S     Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  652  FIATLQYIVGRSRK---QSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIEW  708

Query  225  IE  220
            I+
Sbjct  709  IQ  710



>ref|XP_010281515.1| PREDICTED: prolyl endopeptidase, partial [Phaethon lepturus]
Length=695

 Score =   521 bits (1341),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 251/456 (55%), Positives = 329/456 (72%), Gaps = 12/456 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT QSEDILC +  D P+ M  A V++DG+Y L+ I E CDPVN+++ CDL     
Sbjct  197   YHVLGTKQSEDILCAEFPDEPKWMGGAEVSDDGRYVLLSIREGCDPVNRLWYCDLQTESQ  256

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FEA Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  257   GISG------ILQWVKLIDNFEAEYEYVTNEGTVFTFKTNRHSPNYRLINIDFSDPEESK  310

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E E+DVLE    V +N LV+ YL DVK++LQL D+ TG  L    P+++G++ G
Sbjct  311   WKVLVPEHERDVLEWVACVRSNFLVLCYLHDVKNILQLHDLATGAHLK-TFPLEVGSIVG  369

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV GFD + +   QVF  S
Sbjct  370   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGFDPSVYQTIQVFYPS  429

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  430   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANI  489

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAA+YLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  490   RGGGEYGETWHKGGILANKQNCFDDFQCAAKYLIKEGYTSPKKLTINGGSNGGLLVAACA  549

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHN++ P 
Sbjct  550   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDRKEQFEWLCKYSPLHNIKLPE  609

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM  407
             E      QYPST+LLTADHDDRVVPLH+ K++A + 
Sbjct  610   E---DGIQYPSTLLLTADHDDRVVPLHSLKFIATLQ  642


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++     +  QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  637  FIATLQYIV---GRSRKQTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNLDW  693

Query  225  IE  220
            IE
Sbjct  694  IE  695



>ref|XP_008261549.1| PREDICTED: LOW QUALITY PROTEIN: prolyl endopeptidase [Oryctolagus 
cuniculus]
Length=710

 Score =   521 bits (1342),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 249/455 (55%), Positives = 329/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQ+EDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL   PN
Sbjct  212   YHVLGTDQAEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQEPN  271

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDV--KEPGC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+++P Y+L+ +D    +   
Sbjct  272   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRHSPNYRLINIDFMDADESK  325

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG +L    P+++G+V G
Sbjct  326   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNILQLHDLTTGALLK-PFPLEVGSVVG  384

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   QVF  S
Sbjct  385   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASEYQTVQVFYPS  444

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  445   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  504

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYL+  G+T P +L I GGSNGGLL+ AC 
Sbjct  505   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLVKEGYTSPKRLTINGGSNGGLLVAACA  564

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCS+N++ F WLIKYSPLHNVR P 
Sbjct  565   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSENKQHFEWLIKYSPLHNVRLP-  623

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                 +  QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  624   --EAEDVQYPSMLLLTADHDDRVVPLHSLKFIATL  656


 Score = 55.8 bits (133),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++  S     Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  652  FIATLQYIVGRSQK---QSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDW  708

Query  225  IE  220
            I+
Sbjct  709  IQ  710



>ref|XP_003509718.1| PREDICTED: prolyl endopeptidase isoform X1, partial [Cricetulus 
griseus]
Length=695

 Score =   521 bits (1341),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 249/455 (55%), Positives = 327/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I+E CDPVN+++ CDL    +
Sbjct  197   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIWEGCDPVNRLWYCDLQQESS  256

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+N+P Y+L+ +D  +P    
Sbjct  257   GITG------ILNWIKLIDNFEGEYDYVTNEGTVFTFKTNRNSPNYRLINIDFTDPDESK  310

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V ++ LV+ YL DVK++LQL D+ TG +L    P+D+G+V G
Sbjct  311   WKVLVPEHEKDVLEWVACVRSSFLVLCYLHDVKNILQLHDLTTGALLK-TFPLDVGSVVG  369

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S R+KDS +F  FT+FL P +IY C+L  +  E  +FRE+TV G D + +   QVF  S
Sbjct  370   YSGRKKDSEIFYQFTSFLSPGVIYHCDLTKEELEPTVFREVTVKGIDASDYQTIQVFYPS  429

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  430   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  489

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T   +L I GGSNGGLL+ AC 
Sbjct  490   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSSKRLTINGGSNGGLLVAACA  549

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHKFTIGHAWT+D+GCSD+++ F WL++YSPLHNV+ P 
Sbjct  550   NQRPDLFGCVIAQVGVMDMLKFHKFTIGHAWTTDYGCSDSKQHFEWLLRYSPLHNVKLP-  608

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  609   --EADGIQYPSMLLLTADHDDRVVPLHSLKFIATL  641


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++     +  Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  637  FIATLQYIV---GRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIEW  693

Query  225  I  223
            I
Sbjct  694  I  694



>gb|KFQ95616.1| Prolyl endopeptidase, partial [Nipponia nippon]
Length=671

 Score =   520 bits (1338),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 251/455 (55%), Positives = 329/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT+QSEDILC +  D P+ M  A V++DG+Y L+ + E CDPVN+++ CDL     
Sbjct  173   YHVLGTNQSEDILCAEFPDEPKWMGGAEVSDDGRYVLLSVREGCDPVNRLWYCDLQTESQ  232

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FEA Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  233   GISG------ILQWVKLIDNFEAEYEYVTNEGTVFTFKTNRHSPNYRLINIDFSDPEESK  286

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  +I E E+DVLE    V +N LV+ YL DVK++LQL D+ TG  L    P+++G++ G
Sbjct  287   WKVLIPEHERDVLEWVACVRSNFLVLCYLHDVKNILQLHDLATGAHLK-TFPLEVGSIVG  345

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV GFD + +   QVF  S
Sbjct  346   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGFDPSVYQTIQVFYPS  405

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  406   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANI  465

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAA YLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  466   RGGGEYGETWHKGGILANKQNCFDDFQCAANYLIKEGYTSPKKLTINGGSNGGLLVAACA  525

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHN++ P 
Sbjct  526   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDCKEQFEWLCKYSPLHNIKLPE  585

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             E      QYPST+LLTADHDDRVVPLH+ K++A +
Sbjct  586   E---DGIQYPSTLLLTADHDDRVVPLHSLKFIATL  617


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++     +  QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  613  FIATLQYIV---GRSRKQTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNLDW  669

Query  225  IE  220
            IE
Sbjct  670  IE  671



>gb|AAI40508.1| PREP protein [Bos taurus]
Length=710

 Score =   521 bits (1342),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 250/455 (55%), Positives = 327/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL   PN
Sbjct  212   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLHQEPN  271

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  272   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRHSPNYRLINIDFTDPEESR  325

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK+ LQL D+ TG +L    P+++G+V G
Sbjct  326   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNTLQLHDLATGALLK-TFPLEVGSVVG  384

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  385   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPS  444

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  445   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  504

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+  C 
Sbjct  505   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVATCA  564

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSDN++ F WLIKYSPLHNV+ P 
Sbjct  565   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDNKQHFEWLIKYSPLHNVKLP-  623

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  624   --EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  656


 Score = 56.2 bits (134),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 40/62 (65%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+QH++  S     Q NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  652  FIATLQHLVGRSRK---QNNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDW  708

Query  225  IE  220
            I+
Sbjct  709  IQ  710



>ref|XP_005377881.1| PREDICTED: prolyl endopeptidase [Chinchilla lanigera]
Length=704

 Score =   521 bits (1341),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 248/455 (55%), Positives = 328/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL    N
Sbjct  206   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQESN  265

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+ +VFTF+TN+ +P Y+L+ +D  +P    
Sbjct  266   GITG------ILKWVKLIDNFEGEYDYVTNEGSVFTFKTNRRSPNYRLINIDFADPDESK  319

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG +L    P+D+G++ G
Sbjct  320   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNILQLHDLATGALLK-TFPLDVGSIVG  378

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  379   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPS  438

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  439   KDGTKIPMFIVHKKAIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  498

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  499   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIREGYTSPKRLTINGGSNGGLLVAACA  558

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSD+++ F WL+KYSPLHNV+ P 
Sbjct  559   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKQHFEWLVKYSPLHNVKLP-  617

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  618   --EADGVQYPSMLLLTADHDDRVVPLHSLKFIATL  650


 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 39/61 (64%), Gaps = 3/61 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+   T   +  Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  646  FIATLQY---TVGRSQKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNISW  702

Query  225  I  223
            I
Sbjct  703  I  703



>ref|NP_112614.1| prolyl endopeptidase [Rattus norvegicus]
 sp|O70196.1|PPCE_RAT RecName: Full=Prolyl endopeptidase; Short=PE; AltName: Full=Post-proline 
cleaving enzyme; AltName: Full=rPop [Rattus norvegicus]
 dbj|BAA25544.1| rPOP [Rattus norvegicus]
Length=710

 Score =   521 bits (1342),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 249/455 (55%), Positives = 328/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSED+LC +  D P+ M  A +++DG+Y L+ I+E CDPVN+++ CDL    N
Sbjct  212   YHVLGTDQSEDVLCAEFPDEPKWMGGAELSDDGRYVLLSIWEGCDPVNRLWYCDLQQGSN  271

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y ++ N+  VFTF+TN+N+P Y+L+ +D  +P    
Sbjct  272   GING------ILKWVKLIDNFEGEYDYITNEGTVFTFKTNRNSPNYRLINIDFTDPDESK  325

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL +VK++LQL D+ TG +L    P+D+G+V G
Sbjct  326   WKVLVPEHEKDVLEWVACVRSNFLVLCYLRNVKNILQLHDLTTGALLK-TFPLDVGSVVG  384

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S R+KDS +F  FT+FL P +IY C+L  +  E ++FRE+TV G D + +   QVF  S
Sbjct  385   YSGRKKDSEIFYQFTSFLSPGVIYHCDLTREELEPRVFREVTVKGIDASDYQTIQVFYPS  444

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  445   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  504

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T   +L I GGSNGGLL+ AC 
Sbjct  505   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTTSKRLTINGGSNGGLLVAACA  564

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHKFTIGHAWT+D+GCSD+++ F WL+KYSPLHNV+ P 
Sbjct  565   NQRPDLFGCVIAQVGVMDMLKFHKFTIGHAWTTDYGCSDSKQHFEWLLKYSPLHNVKLP-  623

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  624   --EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  656


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++  S     Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  652  FIATLQYIVGRSRK---QSNPLLIHVDTKAGHGPGKPTAKVIEEVSDMFAFIARCLNIEW  708

Query  225  IE  220
            I+
Sbjct  709  IQ  710



>ref|XP_004875134.1| PREDICTED: prolyl endopeptidase [Heterocephalus glaber]
Length=710

 Score =   521 bits (1342),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 248/455 (55%), Positives = 328/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL    N
Sbjct  212   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQESN  271

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+ +VFTF+TN+ +P Y+L+ +D  +P    
Sbjct  272   GITG------ILKWVKLIDNFEGEYDYVTNEGSVFTFKTNRRSPNYRLINIDFTDPDESK  325

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG +L    P+D+G+V G
Sbjct  326   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNILQLHDLATGALLK-TFPLDVGSVVG  384

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  385   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTIQIFYSS  444

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  445   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  504

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAA+YLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  505   RGGGEYGETWHKGGILANKQNCFDDFQCAAQYLIREGYTSPKRLTINGGSNGGLLVAACA  564

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSD+++ F WL+KYSPLHNV+ P 
Sbjct  565   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKQHFEWLVKYSPLHNVKLP-  623

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  624   --EADGVQYPSMLLLTADHDDRVVPLHSLKFIATL  656


 Score = 56.2 bits (134),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++     N  Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  652  FIATLQYMV---GRNQKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNISW  708

Query  225  I  223
            I
Sbjct  709  I  709



>ref|XP_005426660.1| PREDICTED: prolyl endopeptidase [Geospiza fortis]
Length=738

 Score =   522 bits (1344),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 252/456 (55%), Positives = 330/456 (72%), Gaps = 12/456 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT+QSEDILC +  D P+ M  A V++DG+Y L+ I E CDPVN+++ CDL     
Sbjct  240   YHVLGTNQSEDILCAEFPDEPKWMGGAEVSDDGRYVLLSIREGCDPVNRLWYCDLQKESQ  299

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FEA Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  300   GISG------ILQWVKLIDNFEAEYEYVTNEGTVFTFKTNRHSPNYRLINIDFNDPEESK  353

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V ++ LV+ YL DVK++LQL D+ TG  L    P+++G++ G
Sbjct  354   WKVLVPEHEKDVLEWVACVRSSFLVLCYLHDVKNILQLHDLATGAHLK-TFPLEVGSIVG  412

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV GFD + +   QVF  S
Sbjct  413   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGFDPSVYQTVQVFYPS  472

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  473   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANI  532

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAA+YLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  533   RGGGEYGETWHKGGILANKQNCFDDFQCAAKYLIKEGYTSPKKLTINGGSNGGLLVAACA  592

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHNV+ P 
Sbjct  593   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDCKEQFEWLRKYSPLHNVKLPE  652

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM  407
             E      QYPST+LLTADHDDRVVPLH+ K++A + 
Sbjct  653   E---DGIQYPSTLLLTADHDDRVVPLHSLKFIATLQ  685


 Score = 59.7 bits (143),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++     ++ QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  680  FIATLQYIV---GRSSKQTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFVARCLNLEW  736

Query  225  IE  220
            IE
Sbjct  737  IE  738



>dbj|BAA86936.1| prolyl endopeptidase [Homo sapiens]
 dbj|BAB19053.1| prolyl oligopeptidase [Homo sapiens]
Length=710

 Score =   521 bits (1341),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 248/455 (55%), Positives = 329/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL    +
Sbjct  212   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQESS  271

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+ AVFTF+TN+ +P Y+++ +D ++P    
Sbjct  272   GIAG------ILKWVKLIDNFEGEYDYVTNEGAVFTFKTNRQSPNYRVINIDFRDPEESK  325

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG +L    P+D+G++ G
Sbjct  326   WKVLVPEHEKDVLEWIACVRSNFLVLCYLHDVKNILQLHDLTTGALLK-TFPLDVGSIVG  384

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  385   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPS  444

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G I  +ANI
Sbjct  445   KDGTKIPMFIVHKKSIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGILAVANI  504

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  505   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVAACA  564

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSD+++ F WL+KYSPLHNV+ P 
Sbjct  565   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKQHFEWLVKYSPLHNVKLP-  623

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  624   --EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  656


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++  S     Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  652  FIATLQYIVGRSRK---QSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNVDW  708

Query  225  I  223
            I
Sbjct  709  I  709



>ref|XP_008502431.1| PREDICTED: prolyl endopeptidase [Calypte anna]
Length=728

 Score =   521 bits (1343),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 254/456 (56%), Positives = 328/456 (72%), Gaps = 12/456 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT QSEDILC +  D P+ M  A V++DG+Y L+ I E CDPVN+++ CDL     
Sbjct  230   YHVLGTSQSEDILCAEFPDEPKWMGGAEVSDDGRYVLLSIREGCDPVNRLWYCDLQTESQ  289

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FEA Y +V N+  VFTF+TN+ +P Y+L+ +D  +P    
Sbjct  290   GISG------ILQWVKLIDNFEAEYEYVTNEGTVFTFKTNRQSPNYRLINIDFSDPEESK  343

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  +I E EKDVLE    V +N LV+ YL DVK++LQL D+ TG  L    P+++G++ G
Sbjct  344   WKVLIPEHEKDVLEWVACVRSNFLVLCYLHDVKNILQLHDLATGAHLK-TFPLEVGSIVG  402

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV GFD + +   QVF  S
Sbjct  403   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGFDPSVYQTIQVFYPS  462

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  463   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANI  522

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAA+YLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  523   RGGGEYGETWHKGGILANKQNCFDDFQCAAKYLIEEGYTSPKKLTINGGSNGGLLVAACA  582

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHNV+ P 
Sbjct  583   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDCKEQFEWLCKYSPLHNVKLPE  642

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM  407
             E      QYPST+LLTADHDDRVVPLH+ K++A + 
Sbjct  643   E---DGIQYPSTLLLTADHDDRVVPLHSLKFIATLQ  675


 Score = 59.7 bits (143),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+V+     ++ QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  670  FIATLQYVV---GRSSKQTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNLDW  726

Query  225  IE  220
            IE
Sbjct  727  IE  728



>gb|AFK11407.1| prolyl endopeptidase-like protein [Callorhinchus milii]
Length=708

 Score =   521 bits (1341),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 263/488 (54%), Positives = 338/488 (69%), Gaps = 24/488 (5%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT Q++DILC +  DNP+    A V++ G+Y ++ I E C P N+++ CDL  LP 
Sbjct  211   YHILGTPQAQDILCAEYPDNPKWKSGARVSDQGRYVVLSIREGCKPKNRIWYCDLHQLPQ  270

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVK--EPGC  1415
             G+ G      LLP+ K++D+FEA Y ++ N+ +VFTFRTN NAP+Y ++ +D+   EP  
Sbjct  271   GITG------LLPWVKLIDNFEAEYSYITNEGSVFTFRTNLNAPRYCIINIDLDKPEPMQ  324

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  +I + EKDVL+ A  VN   LVV++L +VK VLQL  + TG  L  NLP+D+G+V G
Sbjct  325   WVTLIPQHEKDVLDWATCVNYTFLVVSFLHNVKDVLQLYHLPTGKFLK-NLPLDVGSVVG  383

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S R+K++ +F  FT++L P +IY C+L  +  E KIFRE+ + GF  + +   QVF  S
Sbjct  384   YSGRKKNTEIFYMFTSYLTPGVIYHCDLTRETLEPKIFREVEIKGFSFSEYQTIQVFFPS  443

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG +IPMFIV  K I LDGS+P LL+GYGGFS S+TP +  + LV  +HLG I  +ANI
Sbjct  444   KDGTQIPMFIVHKKGIKLDGSHPVLLYGYGGFSISLTPTYDVSYLVFVRHLGGILAVANI  503

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WH+AG L KKQN FDDF CA +YLI  G+T PSKL I G SNGGLL+GAC+
Sbjct  504   RGGGEYGETWHEAGILGKKQNGFDDFQCAGQYLINQGYTCPSKLTINGASNGGLLVGACV  563

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHKFTIGHAWT+DFGCSDN EEF WLIKYSPLHN+R P 
Sbjct  564   NQRPDLFGCAVAEVGVMDMLKFHKFTIGHAWTTDFGCSDNAEEFEWLIKYSPLHNIRVP-  622

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYK---------RSQ  362
                    QYP+ +LL+ADHDDRVVPLH+ KYLA +        CP+ +         +S 
Sbjct  623   ---ASGVQYPAILLLSADHDDRVVPLHSLKYLATLQHT--LRQCPIQRNPLLIRVDTKSG  677

Query  361   HSANQPNC  338
             H A +P  
Sbjct  678   HGAGKPTA  685



>gb|KFU94339.1| Prolyl endopeptidase, partial [Chaetura pelagica]
Length=695

 Score =   520 bits (1339),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 252/456 (55%), Positives = 329/456 (72%), Gaps = 12/456 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT QSED+LC +  D P+ M  A V++DG+Y L+ I E CDPVN+++ CDL     
Sbjct  197   YHVLGTKQSEDVLCAEFPDEPKWMGGAEVSDDGRYVLLSIREGCDPVNRLWYCDLQKESQ  256

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FEA Y +V N+ +VFTF+TN+++P Y+L+ +D  +P    
Sbjct  257   GISG------ILQWVKLIDNFEAEYEYVTNEGSVFTFKTNRHSPNYRLINIDFSDPEESK  310

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG  L    P+++G++ G
Sbjct  311   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNILQLHDLATGAHLK-TFPLEVGSIVG  369

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E K+FRE+TV GFD + +   QVF  S
Sbjct  370   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPKVFREVTVKGFDPSVYQTIQVFYPS  429

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  430   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANI  489

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAA YLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  490   RGGGEYGETWHKGGILANKQNCFDDFQCAANYLIKEGYTSPKKLTINGGSNGGLLVAACA  549

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHN++ P 
Sbjct  550   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDCKEQFEWLCKYSPLHNIKLPE  609

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM  407
             E      QYPST+LLTADHDDRVVPLH+ K++A + 
Sbjct  610   E---DGIQYPSTLLLTADHDDRVVPLHSLKFIATLQ  642


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+V+     +  QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  637  FIATLQYVV---GRSQKQTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLKLDW  693

Query  225  IE  220
            IE
Sbjct  694  IE  695



>ref|XP_009563199.1| PREDICTED: prolyl endopeptidase [Cuculus canorus]
Length=708

 Score =   520 bits (1340),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 252/455 (55%), Positives = 331/455 (73%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT+QSEDILC +  D P+ M  A V++DG+Y L+ I E CDPVN+++ CDL     
Sbjct  210   YHVLGTNQSEDILCAEFPDEPKWMGGAEVSDDGRYVLLSIREGCDPVNRLWYCDLQTESK  269

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+       ++LP+ K++D+FEA Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  270   GIS------DILPWVKLIDNFEAEYEYVTNEGTVFTFKTNRHSPNYQLINIDFSDPDESK  323

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  +I E ++DVLE    V +N LV+ YL DVK++L L D+ TG  L   LP+++G++ G
Sbjct  324   WKVLIPEHKRDVLEWVACVRSNLLVLCYLHDVKNILYLHDLATGARLK-TLPLEVGSIVG  382

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV GFD + +   QVF  S
Sbjct  383   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGFDPSVYQTIQVFYPS  442

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  443   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNMSITPSYSVSRLIFVRHLGGVLAIANI  502

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P+KL I GGSNGGLL+ AC 
Sbjct  503   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPNKLTINGGSNGGLLVAACA  562

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHNV+ P 
Sbjct  563   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDCKEQFEWLCKYSPLHNVKLPE  622

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             E      QYPST+L TADHDDRVVPLH+ K++A +
Sbjct  623   E---DGIQYPSTLLFTADHDDRVVPLHSLKFIATL  654


 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+QHV+     +  QTNP++  I+  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  650  FIATLQHVV---GRSRKQTNPLLIHIDTKAGHGSGKPTAKVIEEVSDMFAFIARCLNLDW  706

Query  225  IE  220
            IE
Sbjct  707  IE  708



>ref|XP_005684669.1| PREDICTED: prolyl endopeptidase [Capra hircus]
Length=720

 Score =   521 bits (1341),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 249/455 (55%), Positives = 327/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL   PN
Sbjct  222   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLHQEPN  281

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  282   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRHSPNYRLINIDFTDPEESR  335

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V ++ LV+ YL DVK+ LQL D+ TG +L    P+++G+V G
Sbjct  336   WKVLVPEHEKDVLEWVACVRSSFLVLCYLHDVKNTLQLHDLATGALLK-TFPLEVGSVVG  394

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  395   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPS  454

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  455   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFMRHMGGVLAVANI  514

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+  C 
Sbjct  515   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVATCA  574

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSDN++ F WLIKYSPLHNV+ P 
Sbjct  575   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDNKQHFEWLIKYSPLHNVKLP-  633

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  634   --EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  666


 Score = 56.2 bits (134),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (65%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+QH++     +  Q NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  662  FIATLQHLV---GRSRKQNNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDW  718

Query  225  IE  220
            I+
Sbjct  719  IQ  720



>gb|KFO79123.1| Prolyl endopeptidase, partial [Cuculus canorus]
Length=695

 Score =   520 bits (1338),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 252/455 (55%), Positives = 331/455 (73%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT+QSEDILC +  D P+ M  A V++DG+Y L+ I E CDPVN+++ CDL     
Sbjct  197   YHVLGTNQSEDILCAEFPDEPKWMGGAEVSDDGRYVLLSIREGCDPVNRLWYCDLQTESK  256

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+       ++LP+ K++D+FEA Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  257   GIS------DILPWVKLIDNFEAEYEYVTNEGTVFTFKTNRHSPNYQLINIDFSDPDESK  310

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  +I E ++DVLE    V +N LV+ YL DVK++L L D+ TG  L   LP+++G++ G
Sbjct  311   WKVLIPEHKRDVLEWVACVRSNLLVLCYLHDVKNILYLHDLATGARLK-TLPLEVGSIVG  369

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV GFD + +   QVF  S
Sbjct  370   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGFDPSVYQTIQVFYPS  429

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  430   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNMSITPSYSVSRLIFVRHLGGVLAIANI  489

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P+KL I GGSNGGLL+ AC 
Sbjct  490   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPNKLTINGGSNGGLLVAACA  549

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHNV+ P 
Sbjct  550   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDCKEQFEWLCKYSPLHNVKLPE  609

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             E      QYPST+L TADHDDRVVPLH+ K++A +
Sbjct  610   E---DGIQYPSTLLFTADHDDRVVPLHSLKFIATL  641


 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+QHV+     +  QTNP++  I+  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  637  FIATLQHVV---GRSRKQTNPLLIHIDTKAGHGSGKPTAKVIEEVSDMFAFIARCLNLDW  693

Query  225  IE  220
            IE
Sbjct  694  IE  695



>gb|KDO85001.1| hypothetical protein CISIN_1g0038782mg, partial [Citrus sinensis]
Length=638

 Score =   518 bits (1333),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 250/361 (69%), Positives = 306/361 (85%), Gaps = 2/361 (1%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YHFLGT QSEDILCWKD ++P+++ S  VTEDG+Y ++ I ENCDPVNKVY CDLSALP 
Sbjct  279   YHFLGTKQSEDILCWKDPEHPKYIFSGHVTEDGQYLVMCIEENCDPVNKVYYCDLSALPE  338

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGCWC  1409
             GL+G++  D LLPF K++D F+A Y  +AND+ VFTF TNK+APKYK++RVD+KEP  W 
Sbjct  339   GLEGFKKRDGLLPFVKLIDGFDAQYEVIANDDTVFTFLTNKDAPKYKIIRVDLKEPNDWF  398

Query  1408  DVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNGIS  1229
             +VI E E+DVLESA AVN NQ++V+YLSDVK VLQ+RD++ G +L H LPI+IG+VN IS
Sbjct  399   EVIPEAERDVLESATAVNLNQMIVSYLSDVKYVLQIRDLKNGSLL-HQLPIEIGSVNAIS  457

Query  1228  ARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGSKD  1049
             ARR+DS+VFI FT+FLIP I+YQCNL+++ PE+KIFRE  +PGFDR+ F+V QVFV SKD
Sbjct  458   ARREDSVVFISFTSFLIPGIVYQCNLKTETPEMKIFRETIIPGFDRSEFHVHQVFVPSKD  517

Query  1048  G-VKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANIR  872
             G  KIPMFIVS K+I LDGS+PCLL+GYGGF+ SVTP FS +R ++ +HLG +FC+ANIR
Sbjct  518   GSTKIPMFIVSKKNIKLDGSHPCLLYGYGGFNISVTPSFSVSRTILMRHLGAVFCIANIR  577

Query  871   GGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACIN  692
             GGGEYGEEWHK GALAKKQNCFDDFI A+EYLI+AG+TQ  KLCIEGGSNGGLL+GACIN
Sbjct  578   GGGEYGEEWHKGGALAKKQNCFDDFISASEYLISAGYTQSRKLCIEGGSNGGLLVGACIN  637

Query  691   Q  689
             Q
Sbjct  638   Q  638



>gb|KGL76780.1| Prolyl endopeptidase, partial [Tinamus guttatus]
Length=695

 Score =   520 bits (1338),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 251/456 (55%), Positives = 328/456 (72%), Gaps = 12/456 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT QSEDILC +  D P+ M  A V++DG+Y L+ I E CDPVN+++ CDL     
Sbjct  197   YHVLGTSQSEDILCAEFPDEPKWMGGAEVSDDGRYVLLSIREGCDPVNRLWYCDLQTESQ  256

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FEA Y +V N+  VFTF+TN++AP Y+L+ +D  +P    
Sbjct  257   GISG------ILQWVKLIDNFEAEYEYVTNEGTVFTFKTNRHAPNYRLINIDFSDPDESK  310

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  +I E E+DVLE    V +N LV+ YL DVK++LQL D+ TG  L    P+++G++ G
Sbjct  311   WKVLIPEHERDVLEWVACVRSNFLVLCYLHDVKNILQLHDLATGAHLK-TFPLEVGSIVG  369

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L     E ++FRE+TV GFD + +   QVF  S
Sbjct  370   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKDELEPRVFREVTVKGFDPSVYQTIQVFYPS  429

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  430   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANI  489

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAA+YLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  490   RGGGEYGETWHKGGILANKQNCFDDFQCAAKYLIKEGYTSPKKLTINGGSNGGLLVAACA  549

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGV+DML+FHK+TIGHAWT+D+GC+D +E+F WL KYSPLHN++ P 
Sbjct  550   NQRPDLFGCAIAQVGVLDMLKFHKYTIGHAWTTDYGCADTKEQFEWLCKYSPLHNIKLPE  609

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM  407
             E      QYPST+LLTADHDDRVVPLH+ K++A + 
Sbjct  610   E---DGIQYPSTLLLTADHDDRVVPLHSLKFIATLQ  642


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+V+     +  QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  637  FIATLQYVV---GRSRKQTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFVARCLNLDW  693

Query  225  IE  220
            IE
Sbjct  694  IE  695



>ref|XP_010571747.1| PREDICTED: prolyl endopeptidase [Haliaeetus leucocephalus]
Length=718

 Score =   520 bits (1340),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 253/455 (56%), Positives = 330/455 (73%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT+QSEDILC +  D P+ M  A V++DG+Y L+ I E CDPVN+++ CDL     
Sbjct  220   YHVLGTNQSEDILCAEFPDEPKWMGGAEVSDDGRYVLLSIREGCDPVNRLWYCDLQMESQ  279

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FEA Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  280   GISG------ILQWVKLIDNFEAEYEYVTNEGTVFTFKTNRHSPNYRLINIDFNDPEESK  333

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  +I E E+DVLE    V +N LV+ YL DVK++LQL D+ TG  L    P+++G++ G
Sbjct  334   WKVLIPEHERDVLEWVACVRSNFLVLCYLHDVKNILQLHDLATGAHLK-TFPLEVGSIVG  392

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KDS +F  FT+FL P IIY C+L  +  E ++FRE+TV GFD + +   QVF  S
Sbjct  393   YSGQKKDSEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGFDPSVYQTIQVFYPS  452

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  453   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVQHLGGVLAVANI  512

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAA+YLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  513   RGGGEYGETWHKGGILANKQNCFDDFQCAAKYLIKEGYTSPKKLTINGGSNGGLLVAACA  572

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHN++ P 
Sbjct  573   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDCKEQFEWLCKYSPLHNIKLPE  632

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             E      QYPST+LLTADHDDRVVPLH+ K++A +
Sbjct  633   E---DGIQYPSTLLLTADHDDRVVPLHSLKFIATL  664


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+V+     +  QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  660  FIATLQYVV---GRSRKQTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNLDW  716

Query  225  IE  220
            IE
Sbjct  717  IE  718



>ref|XP_005493071.1| PREDICTED: prolyl endopeptidase [Zonotrichia albicollis]
Length=707

 Score =   520 bits (1338),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 252/456 (55%), Positives = 330/456 (72%), Gaps = 12/456 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT+QS+DILC +  D P+ M  A V++DG+Y L+ I E CDPVN+++ CDL     
Sbjct  209   YHVLGTNQSDDILCAEFPDEPKWMGGAEVSDDGRYVLLSIREGCDPVNRLWYCDLQKESQ  268

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FEA Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  269   GISG------ILQWVKLIDNFEAEYEYVTNEGTVFTFKTNRHSPNYRLINIDFNDPEESK  322

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG  L    P+++G++ G
Sbjct  323   WKVLVPEHEKDVLEWVACVRSNYLVLCYLHDVKNILQLHDLATGAHLK-TFPLEVGSIVG  381

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV GFD + +   QVF  S
Sbjct  382   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGFDPSVYQTIQVFYPS  441

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  442   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVQHLGGVLAVANI  501

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAA+YLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  502   RGGGEYGETWHKGGILANKQNCFDDFQCAAKYLIKEGYTSPKKLTINGGSNGGLLVAACA  561

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHNV+ P 
Sbjct  562   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDCKEQFEWLRKYSPLHNVKLPE  621

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM  407
             E      QYPST+LLTADHDDRVVPLH+ K++A + 
Sbjct  622   E---DGIQYPSTLLLTADHDDRVVPLHSLKFIATLQ  654


 Score = 59.7 bits (143),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++     ++ QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  649  FIATLQYIV---GRSSKQTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFVARCLNLEW  705

Query  225  IE  220
            IE
Sbjct  706  IE  707



>ref|XP_009894751.1| PREDICTED: prolyl endopeptidase [Picoides pubescens]
Length=703

 Score =   520 bits (1338),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 252/455 (55%), Positives = 330/455 (73%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT+QSEDILC +  + P+ M  A V+ DG+Y L+ I E C PVN+++ CDL A P 
Sbjct  205   YHVLGTNQSEDILCAEFPEEPKWMGGAEVSVDGRYVLMTIREGCHPVNRLWYCDLQAEPQ  264

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FEA Y +V N+  VFTF+TN ++P Y+L+ +D+ +P    
Sbjct  265   GISG------ILQWVKLIDNFEAEYEYVTNEGPVFTFKTNHHSPNYRLINIDIDDPEEAK  318

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E E+DVLE    V +N LV+ YL DVK+VLQL D+ TG  L    P+++G++ G
Sbjct  319   WKVLVPEHERDVLEWVACVRSNFLVLCYLHDVKNVLQLHDLATGAHLK-TFPLEVGSIVG  377

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E  +FRE+TV GFD +++   QVF  S
Sbjct  378   YSGQKKDTEIFYQFTSFLSPDIIYHCDLTKEELEPTVFREVTVKGFDPSAYQTVQVFYPS  437

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  438   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANI  497

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAA+YLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  498   RGGGEYGETWHKGGILANKQNCFDDFQCAAKYLIKEGYTSPKKLTINGGSNGGLLVAACA  557

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHN++ P 
Sbjct  558   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDCKEQFEWLCKYSPLHNIKLPE  617

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             E      QYPST+LLTADHDDRVVPLH+ K++A +
Sbjct  618   E---DGIQYPSTLLLTADHDDRVVPLHSLKFIATL  649


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+V+     +  QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  645  FIATLQYVV---GRSRKQTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNLEW  701

Query  225  IE  220
            IE
Sbjct  702  IE  703



>ref|XP_010002170.1| PREDICTED: prolyl endopeptidase [Chaetura pelagica]
Length=734

 Score =   520 bits (1340),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 252/456 (55%), Positives = 329/456 (72%), Gaps = 12/456 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT QSED+LC +  D P+ M  A V++DG+Y L+ I E CDPVN+++ CDL     
Sbjct  236   YHVLGTKQSEDVLCAEFPDEPKWMGGAEVSDDGRYVLLSIREGCDPVNRLWYCDLQKESQ  295

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FEA Y +V N+ +VFTF+TN+++P Y+L+ +D  +P    
Sbjct  296   GISG------ILQWVKLIDNFEAEYEYVTNEGSVFTFKTNRHSPNYRLINIDFSDPEESK  349

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG  L    P+++G++ G
Sbjct  350   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNILQLHDLATGAHLK-TFPLEVGSIVG  408

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E K+FRE+TV GFD + +   QVF  S
Sbjct  409   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPKVFREVTVKGFDPSVYQTIQVFYPS  468

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  469   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANI  528

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAA YLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  529   RGGGEYGETWHKGGILANKQNCFDDFQCAANYLIKEGYTSPKKLTINGGSNGGLLVAACA  588

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHN++ P 
Sbjct  589   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDCKEQFEWLCKYSPLHNIKLPE  648

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM  407
             E      QYPST+LLTADHDDRVVPLH+ K++A + 
Sbjct  649   E---DGIQYPSTLLLTADHDDRVVPLHSLKFIATLQ  681


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+V+  S     QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  676  FIATLQYVVGRSQK---QTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLKLDW  732

Query  225  IE  220
            IE
Sbjct  733  IE  734



>gb|EHH53266.1| hypothetical protein EGM_13872, partial [Macaca fascicularis]
Length=695

 Score =   519 bits (1337),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 247/455 (54%), Positives = 329/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL    N
Sbjct  197   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQESN  256

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+++P Y+++ +D ++P    
Sbjct  257   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRHSPNYRVINIDFRDPEESK  310

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG +L    P+++G++ G
Sbjct  311   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNILQLHDLTTGALLK-TFPLEVGSIVG  369

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  370   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYLS  429

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G I  +ANI
Sbjct  430   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGILAVANI  489

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  490   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVAACA  549

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSD+++ F WL+KYSPLHNV+ P 
Sbjct  550   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKQHFEWLVKYSPLHNVKLP-  608

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  609   --EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  641


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++  S     Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  637  FIATLQYIVGRSRK---QSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDW  693

Query  225  I  223
            I
Sbjct  694  I  694



>ref|XP_003898012.2| PREDICTED: prolyl endopeptidase isoform X1 [Papio anubis]
Length=710

 Score =   520 bits (1338),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 247/455 (54%), Positives = 329/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL    N
Sbjct  212   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQESN  271

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+++P Y+++ +D ++P    
Sbjct  272   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRHSPNYRVINIDFRDPEESK  325

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG +L    P+++G++ G
Sbjct  326   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNILQLHDLTTGALLK-TFPLEVGSIVG  384

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  385   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPS  444

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G I  +ANI
Sbjct  445   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGILAVANI  504

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  505   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVAACA  564

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSD+++ F WL+KYSPLHNV+ P 
Sbjct  565   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKQHFEWLVKYSPLHNVKLP-  623

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  624   --EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  656


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++  S     Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  652  FIATLQYIVGRSRK---QSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDW  708

Query  225  I  223
            I
Sbjct  709  I  709



>ref|XP_005901668.1| PREDICTED: prolyl endopeptidase [Bos mutus]
Length=765

 Score =   521 bits (1343),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 250/455 (55%), Positives = 327/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL   PN
Sbjct  267   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLHQEPN  326

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  327   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRHSPNYRLINIDFTDPEESR  380

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK+ LQL D+ TG +L    P+++G+V G
Sbjct  381   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNTLQLHDLATGALLK-TFPLEVGSVVG  439

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  440   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPS  499

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  500   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  559

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+  C 
Sbjct  560   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVATCA  619

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSDN++ F WLIKYSPLHNV+ P 
Sbjct  620   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDNKQHFEWLIKYSPLHNVKLP-  678

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  679   --EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  711


 Score = 56.2 bits (134),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 40/62 (65%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+QH++  S     Q NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  707  FIATLQHLVGRSRK---QNNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDW  763

Query  225  IE  220
            I+
Sbjct  764  IQ  765



>ref|XP_009892160.1| PREDICTED: prolyl endopeptidase [Charadrius vociferus]
Length=708

 Score =   520 bits (1338),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 251/455 (55%), Positives = 330/455 (73%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT+QSEDILC +  D P+ M  A V++DG+Y L+ I E CDPVN+++ CDL     
Sbjct  210   YHVLGTNQSEDILCAEFPDEPKWMGGAEVSDDGRYVLLSIREGCDPVNRLWYCDLQTESQ  269

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FEA Y ++ N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  270   GISG------ILQWVKLIDNFEAEYEYITNEGTVFTFKTNRHSPNYRLINIDFSDPEESK  323

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  +I E E+DVLE    V +N LV+ YL DVK++LQL D+ TG  L    P+++G++ G
Sbjct  324   WKVLIPEHERDVLEWVACVRSNFLVLCYLHDVKNILQLHDLATGAHLK-TFPLEVGSIVG  382

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV GFD + +   QVF  S
Sbjct  383   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGFDPSVYQTIQVFYPS  442

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  443   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANI  502

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAA+YLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  503   RGGGEYGETWHKGGILANKQNCFDDFQCAAKYLIKEGYTSPKKLTINGGSNGGLLVAACA  562

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHN++ P 
Sbjct  563   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDCKEQFEWLCKYSPLHNIKLPE  622

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             E      QYPST+LLTADHDDRVVPLH+ K++A +
Sbjct  623   E---DGIQYPSTLLLTADHDDRVVPLHSLKFIATL  654


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+V+     +  QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  650  FIATLQYVV---GRSRKQTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNLDW  706

Query  225  IE  220
            IE
Sbjct  707  IE  708



>gb|KFV64238.1| Prolyl endopeptidase, partial [Picoides pubescens]
Length=695

 Score =   519 bits (1336),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 252/456 (55%), Positives = 330/456 (72%), Gaps = 12/456 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT+QSEDILC +  + P+ M  A V+ DG+Y L+ I E C PVN+++ CDL A P 
Sbjct  197   YHVLGTNQSEDILCAEFPEEPKWMGGAEVSVDGRYVLMTIREGCHPVNRLWYCDLQAEPQ  256

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FEA Y +V N+  VFTF+TN ++P Y+L+ +D+ +P    
Sbjct  257   GISG------ILQWVKLIDNFEAEYEYVTNEGPVFTFKTNHHSPNYRLINIDIDDPEEAK  310

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E E+DVLE    V +N LV+ YL DVK+VLQL D+ TG  L    P+++G++ G
Sbjct  311   WKVLVPEHERDVLEWVACVRSNFLVLCYLHDVKNVLQLHDLATGAHLK-TFPLEVGSIVG  369

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E  +FRE+TV GFD +++   QVF  S
Sbjct  370   YSGQKKDTEIFYQFTSFLSPDIIYHCDLTKEELEPTVFREVTVKGFDPSAYQTVQVFYPS  429

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  430   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANI  489

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAA+YLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  490   RGGGEYGETWHKGGILANKQNCFDDFQCAAKYLIKEGYTSPKKLTINGGSNGGLLVAACA  549

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHN++ P 
Sbjct  550   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDCKEQFEWLCKYSPLHNIKLPE  609

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM  407
             E      QYPST+LLTADHDDRVVPLH+ K++A + 
Sbjct  610   E---DGIQYPSTLLLTADHDDRVVPLHSLKFIATLQ  642


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+V+     +  QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  637  FIATLQYVV---GRSRKQTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNLEW  693

Query  225  IE  220
            IE
Sbjct  694  IE  695



>ref|NP_001279126.1| prolyl endopeptidase-like [Callorhinchus milii]
 gb|AFM90997.1| prolyl endopeptidase-like protein [Callorhinchus milii]
Length=708

 Score =   519 bits (1337),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 262/488 (54%), Positives = 339/488 (69%), Gaps = 24/488 (5%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT Q++DILC +  DNP+    A V++ G+Y ++ I E C P N+++ CDL  LP 
Sbjct  211   YHILGTPQAQDILCAEYPDNPKWKSGARVSDQGRYVVLSIREGCKPKNRIWYCDLHQLPQ  270

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVK--EPGC  1415
             G+ G      LLP+ K++D+FEA Y ++ N+ +VFTFRTN NAP+Y ++ +D++  EP  
Sbjct  271   GITG------LLPWVKLIDNFEAEYSYITNEGSVFTFRTNLNAPRYCIINIDLEKPEPMQ  324

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  +I + EKDVL+ A  VN   LVV++L +VK VLQL  + TG  L  NLP+D+G+V G
Sbjct  325   WVTLIPQHEKDVLDWATCVNYTFLVVSFLHNVKDVLQLYHLPTGKFLK-NLPLDVGSVVG  383

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S R+K++ +F  FT++L P +IY C+L  +  E KIFRE+ + GF  + +   QVF  S
Sbjct  384   YSGRKKNTEIFYMFTSYLTPGVIYHCDLTRETLEPKIFREVEIKGFSFSEYQTIQVFFPS  443

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG +IPMFIV  K I LDGS+P LL+GYGGFS S+TP +  + LV  +HLG I  +ANI
Sbjct  444   KDGTQIPMFIVHKKGIKLDGSHPVLLYGYGGFSISLTPTYDVSYLVFVRHLGGILAVANI  503

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE W++AG L KKQN FDDF CA +YLI  G+T PSKL I G SNGGLL+GAC+
Sbjct  504   RGGGEYGETWYEAGILGKKQNGFDDFQCAGQYLINQGYTCPSKLTINGASNGGLLVGACV  563

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHKFTIGHAWT+DFGCSDN EEF WLIKYSPLHN+R P 
Sbjct  564   NQRPDLFGCAVAEVGVMDMLKFHKFTIGHAWTTDFGCSDNAEEFEWLIKYSPLHNIRVP-  622

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMMPCPDHAACPVYK---------RSQ  362
                    QYP+ +LL+ADHDDRVVPLH+ KYLA +        CP+ +         +S 
Sbjct  623   ---ASGVQYPAILLLSADHDDRVVPLHSLKYLATLQHT--LRQCPIQRNPLLIRVDTKSG  677

Query  361   HSANQPNC  338
             H A +P  
Sbjct  678   HGAGKPTA  685



>tpg|DAA26234.1| TPA: prolyl endopeptidase [Bos taurus]
Length=702

 Score =   519 bits (1337),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 250/455 (55%), Positives = 326/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL   PN
Sbjct  212   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLHQEPN  271

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  272   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRHSPNYRLINIDFTDPEESR  325

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK+ LQL D+ TG +L    P+++G+V G
Sbjct  326   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNTLQLHDMATGALLK-TFPLEVGSVVG  384

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  385   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPS  444

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S  RL+  +H+G +  +ANI
Sbjct  445   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVCRLIFVRHMGGVLAVANI  504

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+  C 
Sbjct  505   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVATCA  564

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSDN++ F WLIKYSPLHNV+ P 
Sbjct  565   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDNKQHFEWLIKYSPLHNVKLP-  623

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  624   --EADDIQYPSMLLLTADHDDRVVPLHSPKFIATL  656



>ref|XP_006061999.1| PREDICTED: prolyl endopeptidase-like [Bubalus bubalis]
Length=710

 Score =   520 bits (1338),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 249/455 (55%), Positives = 326/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL   PN
Sbjct  212   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLHQEPN  271

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  272   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRHSPNYRLINIDFTDPEESR  325

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK+ LQL D+ TG +L    P+++G++ G
Sbjct  326   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNTLQLHDLATGALLK-TFPLEVGSIVG  384

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  385   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPS  444

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  445   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  504

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P  L I GGSNGGLL+  C 
Sbjct  505   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKMLTINGGSNGGLLVATCA  564

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSDN++ F WLIKYSPLHNV+ P 
Sbjct  565   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDNKQHFEWLIKYSPLHNVKLP-  623

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  624   --EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  656


 Score = 56.2 bits (134),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 40/62 (65%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+QH++  S     Q NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  652  FIATLQHLVGRSRK---QNNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDW  708

Query  225  IE  220
            I+
Sbjct  709  IQ  710



>gb|ADK26642.1| prolyl endopeptidase, partial [Zonotrichia albicollis]
Length=717

 Score =   520 bits (1338),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 252/456 (55%), Positives = 330/456 (72%), Gaps = 12/456 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT+QS+DILC +  D P+ M  A V++DG+Y L+ I E CDPVN+++ CDL     
Sbjct  219   YHVLGTNQSDDILCAEFPDEPKWMGGAEVSDDGRYVLLSIREGCDPVNRLWYCDLQKESQ  278

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FEA Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  279   GISG------ILQWVKLIDNFEAEYEYVTNEGTVFTFKTNRHSPNYRLINIDFNDPEESK  332

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG  L    P+++G++ G
Sbjct  333   WKVLVPEHEKDVLEWVACVRSNYLVLCYLHDVKNILQLHDLATGAHLK-TFPLEVGSIVG  391

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV GFD + +   QVF  S
Sbjct  392   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGFDPSVYQTIQVFYPS  451

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  452   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVQHLGGVLAVANI  511

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAA+YLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  512   RGGGEYGETWHKGGILANKQNCFDDFQCAAKYLIKEGYTSPKKLTINGGSNGGLLVAACA  571

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHNV+ P 
Sbjct  572   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDCKEQFEWLRKYSPLHNVKLPE  631

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM  407
             E      QYPST+LLTADHDDRVVPLH+ K++A + 
Sbjct  632   E---DGIQYPSTLLLTADHDDRVVPLHSLKFIATLQ  664


 Score = 59.7 bits (143),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++  S+    QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  659  FIATLQYIVGRSSK---QTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFVARCLNLEW  715

Query  225  IE  220
            IE
Sbjct  716  IE  717



>ref|XP_005445825.1| PREDICTED: prolyl endopeptidase [Falco cherrug]
Length=756

 Score =   521 bits (1341),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 252/456 (55%), Positives = 330/456 (72%), Gaps = 12/456 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT+QSEDILC +  D P+ M  A V++DG+Y L+ I E CDPVN+++ CDL     
Sbjct  258   YHVLGTNQSEDILCAEFPDEPKWMGGAEVSDDGRYVLLSIREGCDPVNRLWYCDLQTESQ  317

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FEA Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  318   GISG------ILQWVKLIDNFEAEYEYVTNEGTVFTFKTNRHSPNYRLINIDFSDPEESK  371

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E E+DVLE    V +N LV+ YL DVK++LQL D+ TG  L    P+++G++ G
Sbjct  372   WKVLVPEHERDVLEWVACVRSNFLVLCYLHDVKNILQLHDLATGAHLK-TFPLEVGSIVG  430

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV GFD + +   QVF  S
Sbjct  431   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGFDPSVYQTVQVFYPS  490

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  491   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANI  550

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAA+YLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  551   RGGGEYGETWHKGGILANKQNCFDDFQCAAKYLIKEGYTSPKKLTINGGSNGGLLVAACA  610

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHNV+ P 
Sbjct  611   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDCKEQFEWLCKYSPLHNVKLPE  670

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM  407
             E      QYPST+LLTADHDDRVVPLH+ K++A + 
Sbjct  671   E---DGIQYPSTLLLTADHDDRVVPLHSLKFIATLQ  703


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+V+     +  QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  698  FIATLQYVV---GRSRKQTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNLDW  754

Query  225  IE  220
            IE
Sbjct  755  IE  756



>ref|XP_005244132.1| PREDICTED: prolyl endopeptidase [Falco peregrinus]
Length=756

 Score =   521 bits (1341),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 252/456 (55%), Positives = 330/456 (72%), Gaps = 12/456 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT+QSEDILC +  D P+ M  A V++DG+Y L+ I E CDPVN+++ CDL     
Sbjct  258   YHVLGTNQSEDILCAEFPDEPKWMGGAEVSDDGRYVLLSIREGCDPVNRLWYCDLQTESQ  317

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FEA Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  318   GISG------ILQWVKLIDNFEAEYEYVTNEGTVFTFKTNRHSPNYRLINIDFSDPEESK  371

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E E+DVLE    V +N LV+ YL DVK++LQL D+ TG  L    P+++G++ G
Sbjct  372   WKVLVPEHERDVLEWVACVRSNFLVLCYLHDVKNILQLHDLATGAHLK-TFPLEVGSIVG  430

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV GFD + +   QVF  S
Sbjct  431   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGFDPSVYQTVQVFYPS  490

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  491   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANI  550

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAA+YLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  551   RGGGEYGETWHKGGILANKQNCFDDFQCAAKYLIKEGYTSPKKLTINGGSNGGLLVAACA  610

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHNV+ P 
Sbjct  611   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDCKEQFEWLCKYSPLHNVKLPE  670

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM  407
             E      QYPST+LLTADHDDRVVPLH+ K++A + 
Sbjct  671   E---DGIQYPSTLLLTADHDDRVVPLHSLKFIATLQ  703


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+V+     +  QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  698  FIATLQYVV---GRSRKQTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNLDW  754

Query  225  IE  220
            IE
Sbjct  755  IE  756



>ref|XP_005330186.1| PREDICTED: prolyl endopeptidase [Ictidomys tridecemlineatus]
Length=710

 Score =   519 bits (1337),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 247/455 (54%), Positives = 328/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  + P+ M  A +++DG+Y L+ I E CDPVN+++ CDL    N
Sbjct  212   YHVLGTDQSEDILCAEFPEEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQESN  271

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  272   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRHSPNYRLINIDFTDPDESK  325

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG +L    P+++G++ G
Sbjct  326   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNILQLHDLTTGALLK-TFPLEVGSIVG  384

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  385   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTIQIFYPS  444

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  445   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  504

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  505   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVAACA  564

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSD+++ F WL+KYSPLHNVR P 
Sbjct  565   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKQHFEWLVKYSPLHNVRLP-  623

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  624   --EADGVQYPSMLLLTADHDDRVVPLHSLKFIATL  656


 Score = 56.2 bits (134),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+V+     +  Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  652  FIATLQYVV---GRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDW  708

Query  225  IE  220
            I+
Sbjct  709  IQ  710



>ref|XP_008005659.1| PREDICTED: prolyl endopeptidase isoform X1 [Chlorocebus sabaeus]
Length=710

 Score =   519 bits (1337),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 247/455 (54%), Positives = 329/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL    N
Sbjct  212   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQESN  271

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+++P Y+++ +D ++P    
Sbjct  272   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRHSPNYRVINIDFRDPEESK  325

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG +L    P+++G++ G
Sbjct  326   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNILQLHDLTTGALLK-TFPLEVGSIVG  384

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  385   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPS  444

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G I  +ANI
Sbjct  445   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGILAVANI  504

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  505   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVAACA  564

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSD+++ F WL+KYSPLHNV+ P 
Sbjct  565   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKQHFEWLVKYSPLHNVKLP-  623

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  624   --EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  656


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++  S     Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  652  FIATLQYIVGRSRK---QSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDW  708

Query  225  I  223
            I
Sbjct  709  I  709



>ref|XP_009675264.1| PREDICTED: prolyl endopeptidase [Struthio camelus australis]
Length=734

 Score =   520 bits (1338),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 252/455 (55%), Positives = 330/455 (73%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A V++DG+Y L+ I E CDPVN+++ CDL     
Sbjct  236   YHVLGTDQSEDILCAEFPDEPKWMGGAEVSDDGRYVLLSIREGCDPVNRLWYCDLQTESQ  295

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+F+A Y +V N+  +FTF+TN++AP Y+L+ +D  +P    
Sbjct  296   GISG------ILQWVKLIDNFDAEYEYVTNEGPLFTFKTNRHAPNYRLINIDFSDPDESK  349

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E E+DVLE    V +N LV+ YL DVK+VLQL D+ TG  L    P+++G++ G
Sbjct  350   WKVLVPEHERDVLEWVACVRSNFLVLCYLHDVKNVLQLHDLATGAHLK-TFPLEVGSIVG  408

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV GFD + +   QVF  S
Sbjct  409   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGFDPSVYQTIQVFYPS  468

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  469   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANI  528

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAA+YLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  529   RGGGEYGETWHKGGILANKQNCFDDFQCAAKYLIKEGYTSPRKLTINGGSNGGLLVAACA  588

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHN++ P 
Sbjct  589   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDCKEQFEWLCKYSPLHNIKLPE  648

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             E      QYPST+LLTADHDDRVVPLH+ K++A +
Sbjct  649   E---DGIQYPSTLLLTADHDDRVVPLHSLKFIATL  680


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+V+     +  QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  676  FIATLQYVV---GRSRKQTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNLDW  732

Query  225  IE  220
            IE
Sbjct  733  IE  734



>dbj|BAG36874.1| unnamed protein product [Homo sapiens]
Length=710

 Score =   519 bits (1336),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 247/455 (54%), Positives = 328/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL    +
Sbjct  212   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQESS  271

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+ +P Y+++ +D ++P    
Sbjct  272   GIAG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRQSPNYRVINIDFRDPEESK  325

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG +L    P+D+G++ G
Sbjct  326   WKVLVPEHEKDVLEWIACVRSNFLVLCYLHDVKNILQLHDLTTGALLK-TFPLDVGSIVG  384

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  385   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPS  444

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G I  +ANI
Sbjct  445   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGILAVANI  504

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  505   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVAACA  564

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSD+++ F WL+KYSPLHNV+ P 
Sbjct  565   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKQHFEWLVKYSPLHNVKLP-  623

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  624   --EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  656


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++  S     Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  652  FIATLQYIVGRSRK---QSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNVDW  708

Query  225  I  223
            I
Sbjct  709  I  709



>gb|KFM01437.1| Prolyl endopeptidase, partial [Aptenodytes forsteri]
Length=671

 Score =   518 bits (1333),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 251/455 (55%), Positives = 328/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT+QSEDILC +  D P+ M  A V++DG+Y L+ I E CDPVN+++ CDL     
Sbjct  173   YHVLGTNQSEDILCAEFPDEPKWMGGAEVSDDGRYVLLSIREGCDPVNRLWYCDLQRESQ  232

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FEA Y +V N+  VFTF+TN ++P Y+L+ +D  +P    
Sbjct  233   GISG------ILQWVKLIDNFEAEYEYVTNEGTVFTFKTNCHSPNYRLINIDFSDPEESK  286

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  +I E E+DVLE    V +N LV+ YL DVK++LQL D+ TG  L    P+++G++ G
Sbjct  287   WKVLIPEHERDVLEWVACVRSNFLVLCYLHDVKNILQLHDLATGAHLK-TFPLEVGSIVG  345

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV GFD + +   QVF  S
Sbjct  346   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGFDPSVYQTVQVFYPS  405

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  406   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANI  465

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAA+YLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  466   RGGGEYGETWHKGGILANKQNCFDDFQCAAKYLIKEGYTSPKKLTINGGSNGGLLVAACA  525

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHN++ P 
Sbjct  526   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDCKEQFEWLCKYSPLHNIKLP-  584

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPST+LLTADHDDRVVPLH+ K++A +
Sbjct  585   --EQDGIQYPSTLLLTADHDDRVVPLHSLKFIATL  617


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+V+     +  QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  613  FIATLQYVV---GRSRKQTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNLDW  669

Query  225  IE  220
            IE
Sbjct  670  IE  671



>ref|XP_010350811.1| PREDICTED: prolyl endopeptidase [Rhinopithecus roxellana]
Length=710

 Score =   519 bits (1336),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 247/455 (54%), Positives = 328/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSED LC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL    N
Sbjct  212   YHVLGTDQSEDTLCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQESN  271

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+E VFTF+TN++ P Y+++ +D ++P    
Sbjct  272   GITG------ILKWVKLIDNFEGEYDYVTNEETVFTFKTNRHCPNYRVINIDFRDPEESK  325

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG +L    P+++G++ G
Sbjct  326   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNILQLHDLTTGALLK-TFPLEVGSIVG  384

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  385   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPS  444

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G I  +ANI
Sbjct  445   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGILAVANI  504

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  505   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVAACA  564

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSD+++ F WL+KYSPLHNV+ P 
Sbjct  565   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKQHFEWLVKYSPLHNVKLP-  623

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  624   --EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  656


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 39/61 (64%), Gaps = 3/61 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++  S     Q NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  652  FIATLQYIVGRSRK---QNNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDW  708

Query  225  I  223
            I
Sbjct  709  I  709



>ref|XP_009450003.1| PREDICTED: prolyl endopeptidase isoform X2 [Pan troglodytes]
Length=675

 Score =   518 bits (1333),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 246/455 (54%), Positives = 328/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL    +
Sbjct  177   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQESS  236

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+ +P Y+++ +D ++P    
Sbjct  237   GIAG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRQSPNYRVINIDFRDPEESK  290

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG +L    P+++G++ G
Sbjct  291   WKVLVPEHEKDVLEWIACVRSNFLVLCYLHDVKNILQLHDLTTGALLK-TFPLEVGSIVG  349

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  350   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPS  409

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G I  +ANI
Sbjct  410   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGILAVANI  469

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  470   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVAACA  529

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSD+++ F WL+KYSPLHNV+ P 
Sbjct  530   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKQHFEWLVKYSPLHNVKLP-  588

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  589   --EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  621


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++  S     Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  617  FIATLQYIVGRSRK---QSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDW  673

Query  225  I  223
            I
Sbjct  674  I  674



>ref|NP_001244843.1| prolyl endopeptidase [Macaca mulatta]
 ref|XP_005552310.1| PREDICTED: prolyl endopeptidase isoform X1 [Macaca fascicularis]
 gb|EHH18566.1| hypothetical protein EGK_15203 [Macaca mulatta]
Length=710

 Score =   519 bits (1336),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 247/455 (54%), Positives = 329/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL    N
Sbjct  212   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQESN  271

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+++P Y+++ +D ++P    
Sbjct  272   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRHSPNYRVINIDFRDPEESK  325

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG +L    P+++G++ G
Sbjct  326   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNILQLHDLTTGALLK-TFPLEVGSIVG  384

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  385   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYLS  444

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G I  +ANI
Sbjct  445   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGILAVANI  504

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  505   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVAACA  564

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSD+++ F WL+KYSPLHNV+ P 
Sbjct  565   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKQHFEWLVKYSPLHNVKLP-  623

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  624   --EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  656


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++  S     Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  652  FIATLQYIVGRSRK---QSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDW  708

Query  225  I  223
            I
Sbjct  709  I  709



>ref|XP_006215840.1| PREDICTED: prolyl endopeptidase [Vicugna pacos]
Length=712

 Score =   519 bits (1336),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 249/455 (55%), Positives = 328/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ + E CDPVN+++ CDL    N
Sbjct  214   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSVREGCDPVNRLWYCDLQQESN  273

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  274   GIAG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRHSPNYRLINIDFTDPEESK  327

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK+VLQL D+ TG +L    P+++G+V G
Sbjct  328   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNVLQLHDLATGALLK-TFPLEVGSVVG  386

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  387   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTIQIFYPS  446

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  447   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  506

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  507   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVAACA  566

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSD+++ F WLIKYSPLHNV+ P 
Sbjct  567   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKQHFEWLIKYSPLHNVKLP-  625

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  626   --EADDTQYPSMLLLTADHDDRVVPLHSLKFIATL  658


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (65%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++  S     Q NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  654  FIATLQYIVGRSRK---QNNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDW  710

Query  225  IE  220
            I+
Sbjct  711  IQ  712



>ref|XP_007190702.1| PREDICTED: prolyl endopeptidase [Balaenoptera acutorostrata scammoni]
Length=710

 Score =   519 bits (1336),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 249/455 (55%), Positives = 328/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL   P+
Sbjct  212   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQREPS  271

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  272   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRHSPNYRLINIDFTDPEESK  325

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL +VK++LQL D+ TG +L    P+++G+V G
Sbjct  326   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHNVKNILQLHDLATGALLK-TFPLEVGSVVG  384

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   QVF  S
Sbjct  385   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQVFYPS  444

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LD S+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  445   KDGTKIPMFIVHKKGIKLDASHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  504

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  505   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVAACA  564

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSDN++ F WLIKYSPLHNV+ P 
Sbjct  565   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDNKQHFDWLIKYSPLHNVKLP-  623

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  624   --EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  656


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (65%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++  S     Q NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  652  FIATLQYLVGRSRK---QNNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDW  708

Query  225  IE  220
            I+
Sbjct  709  IQ  710



>ref|NP_777197.1| prolyl endopeptidase [Bos taurus]
 sp|Q9XTA2.1|PPCE_BOVIN RecName: Full=Prolyl endopeptidase; Short=PE; AltName: Full=Post-proline 
cleaving enzyme [Bos taurus]
 dbj|BAA78907.1| prolyl oligopeptidase [Bos taurus]
Length=710

 Score =   519 bits (1336),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 250/455 (55%), Positives = 326/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL   PN
Sbjct  212   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLHQEPN  271

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  272   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRHSPNYRLINIDFTDPEESR  325

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK+ LQL D+ TG +L    P+++G+V G
Sbjct  326   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNTLQLHDMATGALLK-TFPLEVGSVVG  384

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  385   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPS  444

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S  RL+  +H+G +  +ANI
Sbjct  445   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVCRLIFVRHMGGVLAVANI  504

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+  C 
Sbjct  505   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVATCA  564

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSDN++ F WLIKYSPLHNV+ P 
Sbjct  565   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDNKQHFEWLIKYSPLHNVKLP-  623

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  624   --EADDIQYPSMLLLTADHDDRVVPLHSPKFIATL  656


 Score = 56.2 bits (134),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (65%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+QH++     +  Q NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  652  FIATLQHLV---GRSRKQNNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDW  708

Query  225  IE  220
            I+
Sbjct  709  IQ  710



>ref|XP_003458281.1| PREDICTED: prolyl endopeptidase-like [Oreochromis niloticus]
Length=741

 Score =   520 bits (1338),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 245/455 (54%), Positives = 330/455 (73%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT QSED+LC +  D+P+ M  A V+EDG+Y L+ I E CDPVN+++ CDL   P 
Sbjct  243   YHVLGTPQSEDVLCAEFPDHPKWMSGAEVSEDGRYVLLSIREGCDPVNRLWYCDLKTTPQ  302

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      LLP+ K++D+F+A Y +V N+  +FTF+TN +AP+Y+L+ +D   P    
Sbjct  303   GITG------LLPWVKLIDNFDAEYEYVTNEGTLFTFKTNLDAPRYRLINIDFASPEQSS  356

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W +++ + EKDV+  A    ++ L V +L DVK+VL++  + +G  L    P+D+G++ G
Sbjct  357   WKELLPQHEKDVIVFATCTYSSYLFVCFLHDVKNVLKMYRLSSGEELR-TFPLDVGSIVG  415

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              + R++DS +F  FT+FL P IIY C+L  +  +  IFRE+TV GF+ + +  TQ+F  S
Sbjct  416   FTGRKRDSEIFYYFTSFLSPAIIYHCDLTKEPLQPHIFREVTVKGFNPSDYQTTQIFYPS  475

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG +IPMFIV  K I +DGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  476   KDGTQIPMFIVHKKGIKMDGSHPGFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANI  535

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHKAG LA KQNCF DF CAAEYLI  G+T PSKL I GGSNGGLL+ AC+
Sbjct  536   RGGGEYGETWHKAGMLANKQNCFTDFQCAAEYLIKEGYTSPSKLTINGGSNGGLLVAACV  595

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             N+RP+LFGCA+A VGVMDML+FHKFTIGHAWT+DFGCS+++E+F WLIKYSPLHN+R P 
Sbjct  596   NERPELFGCAVAQVGVMDMLKFHKFTIGHAWTTDFGCSEDKEQFEWLIKYSPLHNIRVP-  654

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYP+ +LLT DHDDRVVPLH+ KY+A +
Sbjct  655   --EGNGVQYPAVLLLTGDHDDRVVPLHSLKYIATL  687


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 39/61 (64%), Gaps = 3/61 (5%)
 Frame = -3

Query  402  VQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHWI  223
            + T+QH++  S     QTNP+   ++  +GHG G+PT K+I E AD YAF+A+ L   W+
Sbjct  684  IATLQHIVGRSPK---QTNPLFILVDTKSGHGAGKPTSKVIQEVADTYAFIARCLNISWV  740

Query  222  E  220
            +
Sbjct  741  K  741



>ref|NP_002717.3| prolyl endopeptidase [Homo sapiens]
 sp|P48147.2|PPCE_HUMAN RecName: Full=Prolyl endopeptidase; Short=PE; AltName: Full=Post-proline 
cleaving enzyme [Homo sapiens]
 gb|AAH30636.1| Prolyl endopeptidase [Homo sapiens]
 gb|AAV70495.1| prolyl oligopeptidase [Homo sapiens]
 gb|EAW48426.1| prolyl endopeptidase [Homo sapiens]
 gb|ABM84353.1| prolyl endopeptidase [synthetic construct]
 gb|ABM87741.1| prolyl endopeptidase [synthetic construct]
Length=710

 Score =   518 bits (1335),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 247/455 (54%), Positives = 328/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL    +
Sbjct  212   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQESS  271

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+ +P Y+++ +D ++P    
Sbjct  272   GIAG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRQSPNYRVINIDFRDPEESK  325

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG +L    P+D+G++ G
Sbjct  326   WKVLVPEHEKDVLEWIACVRSNFLVLCYLHDVKNILQLHDLTTGALLK-TFPLDVGSIVG  384

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  385   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPS  444

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G I  +ANI
Sbjct  445   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGILAVANI  504

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  505   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVAACA  564

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSD+++ F WL+KYSPLHNV+ P 
Sbjct  565   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKQHFEWLVKYSPLHNVKLP-  623

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  624   --EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  656


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++  S     Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  652  FIATLQYIVGRSRK---QSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNVDW  708

Query  225  I  223
            I
Sbjct  709  I  709



>ref|XP_006626084.1| PREDICTED: prolyl endopeptidase-like [Lepisosteus oculatus]
Length=710

 Score =   518 bits (1335),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 248/455 (55%), Positives = 333/455 (73%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT QSED+LC +  +NP+ M  A V++DG+Y L+ I E CDPVN+++ CDL  +P 
Sbjct  211   YHVLGTPQSEDVLCVEFPENPKWMGGAEVSDDGRYVLLSIHEGCDPVNRLWYCDLQEVPE  270

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPGC--  1415
             G++G      +LP+ K++D+F+A Y ++ N+ +VFTF+TN NAP+Y+++ ++  +P    
Sbjct  271   GIKG------ILPWVKLIDNFDAEYEYITNEGSVFTFKTNLNAPRYRIININFDDPDITN  324

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W ++I E EKDV+  A   + + L V +L DVK+VL +  + TG  L   L +D+G+V G
Sbjct  325   WKELIPEHEKDVIVFASCAHEHFLFVCFLHDVKNVLTMYSLETGEHLKTFL-LDVGSVVG  383

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              + R+KDS +F  FT+FL P IIY C+L     E  +FRE+TV GFD + +  TQVF  S
Sbjct  384   FTGRKKDSDIFYYFTSFLSPAIIYHCDLTKDPLEPTVFREVTVKGFDPSDYQTTQVFYPS  443

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG +IPMFIV  K I +D S+P LL+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  444   KDGTQIPMFIVHKKGINMDSSHPALLYGYGGFNISITPSYSVSRLIFVRHLGGVLAIANI  503

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA+KQNCF+DF CAAEYL+  G+T  SKL I GGSNGGLL+ AC+
Sbjct  504   RGGGEYGETWHKGGMLAQKQNCFNDFQCAAEYLVKQGYTSSSKLTINGGSNGGLLVAACV  563

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHKFTIGHAWT+DFGCS+ +E++ WLIKYSPLHN++ P 
Sbjct  564   NQRPDLFGCAVAQVGVMDMLKFHKFTIGHAWTTDFGCSEIKEQYEWLIKYSPLHNIKVPE  623

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
             E      QYP+ +LLTADHDDRVVPLH+ KY+A +
Sbjct  624   E---NGVQYPAVLLLTADHDDRVVPLHSLKYIATL  655


 Score = 56.2 bits (134),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 39/60 (65%), Gaps = 3/60 (5%)
 Frame = -3

Query  402  VQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHWI  223
            + T+Q+++   + N  QTNP+   ++  +GHG G+PT K+I E AD YAF+++ L   WI
Sbjct  652  IATLQYMV---SQNPKQTNPLFIHVDTKSGHGAGKPTSKVIQEVADMYAFISRCLDIPWI  708



>ref|XP_004568833.1| PREDICTED: prolyl endopeptidase-like [Maylandia zebra]
 ref|XP_005731085.1| PREDICTED: prolyl endopeptidase-like [Pundamilia nyererei]
Length=741

 Score =   519 bits (1337),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 245/455 (54%), Positives = 330/455 (73%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT QSED+LC +  D+P+ M  A V+EDG+Y L+ I E CDPVN+++ CDL   P 
Sbjct  243   YHVLGTPQSEDVLCAEFPDHPKWMSGAEVSEDGRYVLLSIREGCDPVNRLWYCDLKTTPQ  302

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      LLP+ K++D+F+A Y +V N+  +FTF+TN +AP+Y+L+ +D   P    
Sbjct  303   GITG------LLPWVKLIDNFDAEYEYVTNEGTLFTFKTNLDAPRYRLINIDFASPEQSS  356

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W +++ + EKDV+  A    ++ L V +L DVK+VL++  + +G  L    P+D+G++ G
Sbjct  357   WKELLPQHEKDVIVFATCTYSSYLFVCFLHDVKNVLKMYRLSSGEELR-TFPLDVGSIVG  415

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              + R++DS +F  FT+FL P IIY C+L  +  +  IFRE+TV GF+ + +  TQ+F  S
Sbjct  416   FTGRKRDSEIFYYFTSFLSPAIIYHCDLTKEPLQPHIFREVTVKGFNPSDYQTTQIFFPS  475

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG +IPMFIV  K I +DGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  476   KDGTQIPMFIVHKKGIKMDGSHPGFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANI  535

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHKAG LA KQNCF DF CAAEYLI  G+T PSKL I GGSNGGLL+ AC+
Sbjct  536   RGGGEYGETWHKAGMLANKQNCFTDFQCAAEYLIKEGYTSPSKLTINGGSNGGLLVAACV  595

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             N+RP+LFGCA+A VGVMDML+FHKFTIGHAWT+DFGCS+++E+F WLIKYSPLHN+R P 
Sbjct  596   NERPELFGCAVAQVGVMDMLKFHKFTIGHAWTTDFGCSEDKEQFEWLIKYSPLHNIRVP-  654

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYP+ +LLT DHDDRVVPLH+ KY+A +
Sbjct  655   --EGNGVQYPAVLLLTGDHDDRVVPLHSLKYIATL  687


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 39/61 (64%), Gaps = 3/61 (5%)
 Frame = -3

Query  402  VQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHWI  223
            + T+QH++  S     QTNP+   ++  +GHG G+PT K+I E AD YAF+A+ L   W+
Sbjct  684  IATLQHIVGRSPK---QTNPLFILVDTKSGHGAGKPTSKVIQEVADTYAFIARCLNISWV  740

Query  222  E  220
            +
Sbjct  741  K  741



>ref|XP_007939038.1| PREDICTED: prolyl endopeptidase [Orycteropus afer afer]
Length=710

 Score =   518 bits (1334),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 248/455 (55%), Positives = 328/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL    N
Sbjct  212   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQESN  271

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+F+A Y +V N+  VFTF+TN+++P Y L+ +D  +P    
Sbjct  272   GITG------ILKWVKLIDNFDAEYDYVTNEGTVFTFKTNRHSPNYHLINIDFMDPDESK  325

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG +L    P+++G++ G
Sbjct  326   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNILQLHDLATGALLK-TFPLEVGSIVG  384

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  385   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTIQIFYTS  444

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G I  +ANI
Sbjct  445   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGILAVANI  504

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  505   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVAACA  564

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSD+++ F WLIKYSPLHN++ P 
Sbjct  565   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKQHFDWLIKYSPLHNIKLP-  623

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  624   --EADDVQYPSMLLLTADHDDRVVPLHSLKFIATL  656


 Score = 57.0 bits (136),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (65%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++     N  Q NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  652  FIATLQYIV---GRNRKQINPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDW  708

Query  225  IE  220
            I+
Sbjct  709  IQ  710



>ref|XP_004673792.1| PREDICTED: prolyl endopeptidase [Condylura cristata]
Length=710

 Score =   518 bits (1334),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 249/455 (55%), Positives = 326/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D PR M    +++DG+Y L+ I E CDPVN+++ CDL   PN
Sbjct  212   YHVLGTDQSEDILCAEFPDEPRWMGGVELSDDGRYVLLSIREGCDPVNRLWYCDLQQEPN  271

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEPG--C  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+++P Y+L+ +D  EP    
Sbjct  272   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRHSPNYRLINIDFTEPAESK  325

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK+ LQL D+ TG +L    P+++G++ G
Sbjct  326   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNTLQLHDLATGALLK-AFPLEVGSIVG  384

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  385   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPS  444

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K + LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  445   KDGTKIPMFIVHKKGLKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHLGGVLAVANI  504

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF  AAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  505   RGGGEYGETWHKGGILANKQNCFDDFQRAAEYLIKEGYTSPKRLTINGGSNGGLLVAACA  564

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSD+++ F WLIKYSPLHNV+ P 
Sbjct  565   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKQHFEWLIKYSPLHNVKLP-  623

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  624   --EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  656


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++  S     Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  652  FIATLQYIVGRSRK---QSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDW  708

Query  225  I  223
            I
Sbjct  709  I  709



>ref|XP_008152832.1| PREDICTED: prolyl endopeptidase [Eptesicus fuscus]
Length=710

 Score =   518 bits (1334),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 248/455 (55%), Positives = 326/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL    N
Sbjct  212   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQESN  271

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  272   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRHSPNYRLINIDFTDPEESK  325

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK+ LQL D+ TG +L    P+++G++ G
Sbjct  326   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNTLQLHDLATGALLK-AFPLEVGSIVG  384

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  385   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPS  444

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  445   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  504

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  505   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVAACA  564

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSD++  F WLIKYSPLHNV+ P 
Sbjct  565   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKHHFEWLIKYSPLHNVKLP-  623

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  624   --EADGIQYPSMLLLTADHDDRVVPLHSLKFIATL  656


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++  S     Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  652  FIATLQYIVGRSRK---QSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDW  708

Query  225  I  223
            I
Sbjct  709  I  709



>ref|XP_010855005.1| PREDICTED: prolyl endopeptidase [Bison bison bison]
Length=769

 Score =   520 bits (1339),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 250/455 (55%), Positives = 327/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL   PN
Sbjct  271   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLHQEPN  330

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  331   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRHSPNYRLINIDFTDPEESR  384

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK+ LQL D+ TG +L    P+++G+V G
Sbjct  385   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNTLQLHDLATGALLK-TFPLEVGSVVG  443

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  444   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPS  503

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  504   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  563

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+  C 
Sbjct  564   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVATCA  623

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSDN++ F WLIKYSPLHNV+ P 
Sbjct  624   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDNKQHFEWLIKYSPLHNVKLP-  682

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  683   --EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  715


 Score = 55.8 bits (133),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (65%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+QH++     +  Q NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  711  FIATLQHLV---GRSRKQNNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDW  767

Query  225  IE  220
            I+
Sbjct  768  IQ  769



>ref|XP_002193605.1| PREDICTED: prolyl endopeptidase [Taeniopygia guttata]
Length=739

 Score =   519 bits (1336),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 253/456 (55%), Positives = 329/456 (72%), Gaps = 12/456 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT+QSEDILC +  D P+ M  A V++DG+Y L+ I E CDPVN+++ CDL     
Sbjct  241   YHVLGTNQSEDILCAEFPDEPKWMGGAEVSDDGRYVLLSIREGCDPVNRLWYCDLQKESQ  300

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FEA Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  301   GISG------ILQWVKLIDNFEAEYEYVTNEGTVFTFKTNRHSPNYRLINIDFSDPEESK  354

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG  L    P+++G++ G
Sbjct  355   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNILQLHDLATGAHLK-TFPLEVGSIVG  413

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E  +FRE+TV GFD + +   QVF  S
Sbjct  414   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPTVFREVTVKGFDPSVYQTIQVFYPS  473

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  474   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVQHLGGVLAVANI  533

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAA+YLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  534   RGGGEYGETWHKGGILANKQNCFDDFQCAAKYLIKEGYTSPKKLTINGGSNGGLLVAACA  593

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHNV+ P 
Sbjct  594   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDCKEQFEWLRKYSPLHNVKLPE  653

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM  407
             E      QYPST+LLTADHDDRVVPLH+ K++A + 
Sbjct  654   EDD---IQYPSTLLLTADHDDRVVPLHSLKFIATLQ  686


 Score = 59.3 bits (142),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++     ++ QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  681  FIATLQYIV---GRSSKQTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFVARCLNLEW  737

Query  225  IE  220
            IE
Sbjct  738  IE  739



>ref|XP_005518296.1| PREDICTED: prolyl endopeptidase [Pseudopodoces humilis]
Length=767

 Score =   520 bits (1338),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 252/456 (55%), Positives = 329/456 (72%), Gaps = 12/456 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGT+QSEDILC +  D P+ M  A V++DG+Y L+ + E CDPVN+++ CDL     
Sbjct  269   YHVLGTNQSEDILCAEFPDEPKWMGGAEVSDDGRYVLLSVREGCDPVNRLWYCDLQKESQ  328

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FEA Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  329   GITG------ILQWVKLIDNFEAEYEYVTNEGTVFTFKTNRHSPNYRLINIDFSDPEESK  382

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG  L    P+++G++ G
Sbjct  383   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNILQLHDLATGAHLK-TFPLEVGSIVG  441

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E  +FRE+TV GFD + +   QVF  S
Sbjct  442   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPTVFREVTVKGFDPSVYQTIQVFYPS  501

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFI+  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  502   KDGTKIPMFIIHKKGIKLDGSHPAFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANI  561

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAA+YLI  G+T P KL I GGSNGGLL+ AC 
Sbjct  562   RGGGEYGETWHKGGILANKQNCFDDFQCAAKYLIKEGYTSPKKLTINGGSNGGLLVAACA  621

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGCA+A VGVMDML+FHK+TIGHAWT+D+GCSD +E+F WL KYSPLHNV+ P 
Sbjct  622   NQRPDLFGCAIAQVGVMDMLKFHKYTIGHAWTTDYGCSDCKEQFEWLHKYSPLHNVKLPE  681

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMMM  407
             E      QYPST+LLTADHDDRVVPLH+ K++A + 
Sbjct  682   E---DGIQYPSTLLLTADHDDRVVPLHSLKFIATLQ  714


 Score = 59.7 bits (143),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++  S+    QTNP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  709  FIATLQYIVGRSSK---QTNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNLEW  765

Query  225  IE  220
            IE
Sbjct  766  IE  767



>gb|KFO22328.1| Prolyl endopeptidase [Fukomys damarensis]
Length=714

 Score =   518 bits (1333),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 246/455 (54%), Positives = 327/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSED+LC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL    N
Sbjct  216   YHVLGTDQSEDVLCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQESN  275

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+ +VFTF+TN+ +P Y+L+ +D  +P    
Sbjct  276   GITG------ILKWVKLIDNFEGEYDYVTNEGSVFTFKTNRRSPNYRLINIDFTDPDESK  329

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG +L    P+++G+V G
Sbjct  330   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNILQLHDLATGALL-RTFPLEVGSVVG  388

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  389   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTIQIFYPS  448

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  449   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  508

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+  C 
Sbjct  509   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIREGYTSPKRLTINGGSNGGLLVATCA  568

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSD+++ F WL+KYSPLHNV+ P 
Sbjct  569   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKQHFEWLVKYSPLHNVKLP-  627

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  628   --EADGVQYPSMLLLTADHDDRVVPLHSLKFIATL  660


 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 39/61 (64%), Gaps = 3/61 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+   T   +  Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  656  FIATLQY---TVGRSQKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNISW  712

Query  225  I  223
            I
Sbjct  713  I  713



>ref|XP_004605818.1| PREDICTED: prolyl endopeptidase [Sorex araneus]
Length=753

 Score =   519 bits (1337),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 248/455 (55%), Positives = 328/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL   PN
Sbjct  255   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQEPN  314

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN ++P Y+L+ +D  +P    
Sbjct  315   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNLHSPNYRLINIDFTDPEESK  368

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK+ LQL D+ TG +L  + P+++G++ G
Sbjct  369   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNTLQLHDLATGALLK-SFPLEVGSIVG  427

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  428   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYSS  487

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +HLG +  +ANI
Sbjct  488   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHLGGVLAVANI  547

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF  AAEYL+  G+T P +L I GGSNGGLL+ AC 
Sbjct  548   RGGGEYGETWHKGGILANKQNCFDDFQRAAEYLVKEGYTSPKRLTINGGSNGGLLVAACA  607

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSD+++ F WLIKYSPLHNV+ P 
Sbjct  608   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKQHFEWLIKYSPLHNVKLP-  666

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                 +  QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  667   --DAEGVQYPSMLLLTADHDDRVVPLHSLKFIATL  699


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++     +  Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  695  FIATLQYIV---GRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDW  751

Query  225  I  223
            I
Sbjct  752  I  752



>ref|XP_004044512.1| PREDICTED: prolyl endopeptidase [Gorilla gorilla gorilla]
Length=710

 Score =   518 bits (1333),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 246/455 (54%), Positives = 328/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL    +
Sbjct  212   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQESS  271

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+ +P Y+++ +D ++P    
Sbjct  272   GIAG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRQSPNYRVINIDFRDPEESK  325

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG +L    P+++G++ G
Sbjct  326   WKVLVPEHEKDVLEWIACVRSNFLVLCYLHDVKNILQLHDLTTGALLK-TFPLEVGSIVG  384

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  385   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPS  444

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G I  +ANI
Sbjct  445   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGILAVANI  504

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  505   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVAACA  564

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSD+++ F WL+KYSPLHNV+ P 
Sbjct  565   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKQHFEWLVKYSPLHNVKLP-  623

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  624   --EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  656


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++  S     Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  652  FIATLQYIVGRSRK---QSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDW  708

Query  225  I  223
            I
Sbjct  709  I  709



>ref|XP_010605500.1| PREDICTED: prolyl endopeptidase [Fukomys damarensis]
Length=697

 Score =   517 bits (1332),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 246/455 (54%), Positives = 327/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSED+LC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL    N
Sbjct  199   YHVLGTDQSEDVLCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQESN  258

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+ +VFTF+TN+ +P Y+L+ +D  +P    
Sbjct  259   GITG------ILKWVKLIDNFEGEYDYVTNEGSVFTFKTNRRSPNYRLINIDFTDPDESK  312

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG +L    P+++G+V G
Sbjct  313   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNILQLHDLATGALLR-TFPLEVGSVVG  371

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  372   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTIQIFYPS  431

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  432   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  491

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+  C 
Sbjct  492   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIREGYTSPKRLTINGGSNGGLLVATCA  551

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSD+++ F WL+KYSPLHNV+ P 
Sbjct  552   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKQHFEWLVKYSPLHNVKLP-  610

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  611   --EADGVQYPSMLLLTADHDDRVVPLHSLKFIATL  643


 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 39/61 (64%), Gaps = 3/61 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+   T   +  Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  639  FIATLQY---TVGRSQKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNISW  695

Query  225  I  223
            I
Sbjct  696  I  696



>ref|XP_004264819.1| PREDICTED: prolyl endopeptidase [Orcinus orca]
Length=710

 Score =   518 bits (1333),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 248/455 (55%), Positives = 327/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL   P+
Sbjct  212   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQWEPS  271

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  272   GITG------ILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRHSPNYRLINIDFTDPEESR  325

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL +VK+ LQL D+ TG +L    P+++G+V G
Sbjct  326   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHNVKNTLQLHDLATGALLK-TFPLEVGSVVG  384

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  385   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPS  444

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LD S+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  445   KDGTKIPMFIVHKKGIKLDASHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  504

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF CAAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  505   RGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVAACA  564

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSDN++ F WLIKYSPLHNV+ P 
Sbjct  565   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDNKQHFEWLIKYSPLHNVKLP-  623

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  624   --EADGIQYPSMLLLTADHDDRVVPLHSLKFIATL  656


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (65%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++  S     Q NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  652  FIATLQYLVGRSRK---QNNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDW  708

Query  225  IE  220
            I+
Sbjct  709  IQ  710



>ref|XP_001501827.1| PREDICTED: prolyl endopeptidase [Equus caballus]
Length=752

 Score =   519 bits (1336),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 250/455 (55%), Positives = 327/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1768  YHFLGTDQSEDILCWKDSDNPRHMISASVTEDGKYALVYIFENCDPVNKVYVCDLSALPN  1589
             YH LGTDQSEDILC +  D P+ M  A +++DG+Y L+ I E CDPVN+++ CDL    N
Sbjct  254   YHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQESN  313

Query  1588  GLQGYRGTDELLPFNKIVDHFEASYGFVANDEAVFTFRTNKNAPKYKLVRVDVKEP--GC  1415
             G+ G      +L + K++D+FE  Y +V N+  VFTF+TN+++P Y+L+ +D  +P    
Sbjct  314   GITG------ILTWVKLIDNFEGEYDYVTNEGTVFTFKTNRDSPNYRLINIDFTDPEESK  367

Query  1414  WCDVIQEDEKDVLESavavnnnqlvvNYLSDVKSVLQLRDIRTGGILNHNLPIDIGTVNG  1235
             W  ++ E EKDVLE    V +N LV+ YL DVK++LQL D+ TG +L    P+D+G+V G
Sbjct  368   WKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNILQLHDLATGALLK-TFPLDVGSVVG  426

Query  1234  ISARRKDSIVFIGFTNFLIPLIIYQCNLQSKVPELKIFREITVPGFDRASFNVTQVFVGS  1055
              S ++KD+ +F  FT+FL P IIY C+L  +  E ++FRE+TV G D + +   Q+F  S
Sbjct  427   YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTIQIFYPS  486

Query  1054  KDGVKIPMFIVSGKDICLDGSNPCLLFGYGGFSASVTPYFSTARLVIAKHLGVIFCLANI  875
             KDG KIPMFIV  K I LDGS+P  L+GYGGF+ S+TP +S +RL+  +H+G +  +ANI
Sbjct  487   KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANI  546

Query  874   RGGGEYGEEWHKAGALAKKQNCFDDFICAAEYLIAAGFTQPSKLCIEGGSNGGLLIGACI  695
             RGGGEYGE WHK G LA KQNCFDDF  AAEYLI  G+T P +L I GGSNGGLL+ AC 
Sbjct  547   RGGGEYGETWHKGGILANKQNCFDDFQRAAEYLIKEGYTSPKRLTINGGSNGGLLVAACA  606

Query  694   NQRPDLFGCALAHVGVMDMLRFHKFTIGHAWTSDFGCSDNEEEFHWLIKYSPLHNVRRPW  515
             NQRPDLFGC +A VGVMDML+FHK+TIGHAWT+D+GCSD+E+ F WLIKYSPLHNV+ P 
Sbjct  607   NQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSEQHFDWLIKYSPLHNVKLP-  665

Query  514   EQTHQACQYPSTMLLTADHDDRVVPLHTFKYLAMM  410
                    QYPS +LLTADHDDRVVPLH+ K++A +
Sbjct  666   --DADDIQYPSMLLLTADHDDRVVPLHSLKFIATL  698


 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  405  LVQTMQHVLCTSAHNTPQTNPIVGRIERNAGHGCGRPTQKLIDEAADRYAFMAKVLGAHW  226
             + T+Q+++     +  Q+NP++  ++  AGHG G+PT K+I+E +D +AF+A+ L   W
Sbjct  694  FIATLQYIV---GRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDW  750

Query  225  IE  220
            I+
Sbjct  751  IQ  752



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5109523114556